... AAR: CLAW, Requirements; Precision Navigation System Architecture and ... AAR: CLAWs, Requirements; Precision Navigation System Architecture ...
DTIC Science & Technology
Huntington Beach, CA 92647 Mr. Sayed Kadri Douglas Aircraft Company (1-22) 3855 ... Huntington Beach, CA 92647 Dr. John Tracy McDonnell Douglas Corp. ...
NASA Website
Clarified language throughout the document ...... addressed throughout the remainder of the acquisition process. This process results in ...... Third, the AAR is close to the action in time, space and personnel. Fourth, the AAR does not ...
... of military training After Action Review (AAR) Take Home Packages ... This proposed study could survey live, constructive, and simulation exercises ...
... of military training After Action Review (AAR) Take-Home Packages ... This proposed study could survey live, constructive, and simulation exercises ...
... Action Review (AAR) Guide contains procedures for the prepara- tion and conduct of Army Training Battle Simulation System (ARTBASS) AAPs. ...
... Armed Services Technical Information flgenc. ... CORPORATION, OR CONVEYING ANY RIGHTS OR PERMISSION ... A bearing block shook loose after ...
AAR-243. Table 3 shows the conditions at atmospheric entry in both an inertial .... AAR-243. More specifically,. Table 12 pertains to the reference ...
A recessive mutation, aarG1, has been identified that resulted in an 18-fold increase in the expression of beta-galactosidase from an aac(2')-lacZ fusion. Transcriptional fusions and Northern blot analysis demonstrated that the aarG1 allele also resulted in a large increase in the expression of aarP, a gene encoding a transcriptional ...
PubMed
We describe a new mitotic locus of Drosophila melanogaster required for the progression through mitosis in the syncytial embryo and in late larval development. The locus aar (abnormal anaphase resolution) maps to the cytological interval 85E7-F16 and was identified by two alleles. The aar1 allele causes pupal lethality. Larval neuroblasts show an elevated ...
Alpha 2-adrenergic receptors (alpha 2AARs) are coupled by pertussis-toxin sensitive G proteins to various effectors, including adenylyl cyclase and ion channels. The alpha 2AARs respond to endogenous norepinephrine and epinephrine to elicit a variety of physiological responses, including inhibition of neurotransmitter release, suppression of insulin ...
The changing patterns of bladder cancer in Egypt over the past 26 years Ashley S. Felix � Amr S. Soliman � Hussein Khaled � Mohamed S. Zaghloul � Mousumi Banerjee � Manal El-Baradie � Mohamed El-Kalawy � Alaa A. Abd-Elsayed � Kadry Ismail � Ahmed Hablas � Ibrahim A. Seifeldin � Mohamed Ramadan � Mark L.
Cancer.gov
Patterns of hepatocellular carcinoma incidence in Egypt from a population-based cancer registry Elizabeth M. Lehman,1 Amr S. Soliman,1 Kadry Ismail,2 Ahmed Hablas,2 Ibrahim A. Seifeldin,2 Mohamed Ramadan,2 Hesham El-Hamzawy,2 Christiana S. Shoushtari1 and Mark L.
The After Action Review (AAR) is the Army's approach for providing feedback to units after collective training exercises. AAR systems should support the goals of analyzing what happened during an exercise, deciding why it happened, and identifying potenti...
National Technical Information Service (NTIS)
... Accession Number : ADA018796. Title : Instrumentation for Track Light Modification of AN/AAR-34. Descriptive Note : Final rept. Oct 74-Apr 75,. ...
AAR-245. Final Report on NASAGrant No. NAG-8-755,. Optimal Trajectories ...... AAR-245 simultaneously minimizing the total characteristic velocity, ...
Where it is not possible to avoid the use of an aggregate containing reactive constituents, a means for preventing or minimizing the risk of alkali-aggregate reaction (AAR) can be found in the most appropriate of the following options described in this pa...
AAR-239 rightward, and the zb-axis is positive downward ...... AAR-239 w t modulus V i, the inertial path inclination. Yi' and the inertial heading ...
... sake, not understanding the relationship between abilities ... from AARs, mentors, counseling, 360-degree ... and adaptability in the Army's culture. ...
... reviews (AARs) lead to enhanced mission execution and ... Definitive airway control for an unconscious ... the impact of integrating tactically appropriate ...
... effective2y in the study of the tick spring enceophalitis. ... growth on artificial feedirn medium (sugar bouillon and sugar a:ar). The ...
This document is the report of the Second International Conference on Alkali-Aggregate Reactions in Hydroelectric Plants and Dams. This conference was held in October 1995 in Chattanooga, TN and sponsored by the Tennessee Valley Authority. Thirty five papers were presented, with technical sessions covering: (1) The TVA experience, (2) AAR in Hydroelectric Powerplants, (3) ...
Energy Citations Database
In the cell, many small endogenous metabolic molecules are involved in distinct cellular functions such as modulation of chromatin structure and regulation of gene expression. O-acetyl-ADP-ribose (AAR) is a small metabolic molecule that is generated during NAD-dependent deacetylation by Sir2. Sir2 regulates gene expression, DNA repair, and genome stability. Here, we developed ...
We have identified from human liver eight alpha(1A)-adrenoceptor (alpha(1A)-AR) splice variants that were also expressed in human heart, prostate and hippocampus. Three of these alpha(1A)-AR isoforms (alpha(1A-1)-AR, alpha(1A-2a)-AR and alpha(1A-3a)-AR) gave rise to receptors with seven transmembrane domains ...
PubMed Central
ObjectiveValidation of methods to assess the area at risk (AAR) in patients with ST elevation myocardial infarction is limited. A study was undertaken to test different AAR methods using established physiological concepts to provide a reference standard.Main outcome measuredIn 78 reperfused patients with first ST elevation myocardial infarction, ...
Sporting clubs play a key role in community-level physical activity. This study investigated participation trends in sport club membership. A survey of 50 State sports governing bodies in Victoria, Australia collected information on factors affecting membership trends. The records for four of these sports were analysed for the 6 years, 1998-2003. Three sports reported increases in total membership ...
The goal of the Adolescent Assessment/Referral System (AARS) project was to identify, collect, and organize all the appropriate materials associated with assessment and treatment referral for troubled youth 12 through 19 years of age. This document discusses the components of the AARS. After an introduction to the AARS, the structure ...
ERIC Educational Resources Information Center
The purpose of this study was to compare the accuracy of post-reperfusion cardiac magnetic resonance (CMR) and pre-reperfusion multidetector computed tomography (MDCT) imaging to measure the size of the area at risk (AAR), using pathology as a reference technique in a porcine acute myocardial infarction model. Fifteen pigs underwent balloon-induced coronary artery occlusion ...
... Joint Staff Board Joint Campaign Action Plan ... MNC-I AAR (At Rotation) Analyst knowledge / training ... MNC-I Rotations (Right Seat) ...
... to use standard interview protocols to extract After Action Review (AAR) descriptions ... the moulage of simulators will more accurately capture the mix ...
CSD temperature warninglight illuminates. Checklist completion indicates ...... (1987). Aircraft accident report. NTSB/AAR-87/08,. Piedmont. Airlines ...
... Moses, and Henry A. Simpson reviewed a draft of this paper, we gratefully acknowledge ... exercises is the AAR (Meliza, Bessemer, and Hiller, 1994). ...
... could actually ride on top of the wingtip vortices trailing behind a C-130 Hercules transport. ... includes AN/ALE-47 chaff/flare dispensers and AAR-47 ...
... 1.3 Pro~ellant Formulations. Using various combinations of the binders, additives, and the aar-Toniz, Derchiorate oxidizer selected in the ...
Kvavilashvili and Ellis (1996) argued that habit intrusion errors of this sort ...... Little Rock, Arkansas, June 1, 1999 (NTSB/AAR-01/02). ...
... During 2002, the Department ... (AAR) as of 26 June 2002 after redeploying Task Force (TF) 1-186 IN from the Sinai Peninsula. ...
1. AAR-238 w. Wm_ w. I. Introduction. This report is the first of a series dealing with the determination of optimal trajectories ...
Little is known about how particle-specific proteins are assembled on spliceosomal small nuclear ribonucleoproteins (snRNPs). Brr2p is a U5 snRNP-specific RNA helicase required for spliceosome catalytic activation and disassembly. In yeast, the Aar2 protein is part of a cytoplasmic precursor U5 snRNP that lacks Brr2p and is replaced by Brr2p in the nucleus. Here we show that ...
The role of ?(1)-adrenergic receptors (?(1)ARs) in cognition and mood is controversial, probably as a result of past use of nonselective agents. ?(1A)AR activation was recently shown to increase neurogenesis, which is linked to cognition and mood. We studied the effects of long-term ?(1A)AR stimulation using transgenic mice engineered to express a ...
data set (net balance, accumulation, ablation, accumulation area ratio (AAR), and equilibrium line altitude (ELA)) has been published by the World Glacier Monitoring Service...
Science.gov Websites
at the 700-mb level over extreme eastern Kansas was associated with the aarly ... Wind directions indicated difluence at the 30& and 100-rnb levels ...
... in confined compartments (like cockpits and lavatories ... example, the B757 cockpit ventilation rate ... Transportation Safety Board Report NTSB/AAR-86 ...
Page 1. a Veo et t Jet aar -Aril 1972 FINAL REPORT s'tila9 ½i is unllmited. Document may be -icascdcd ! th-ie Clearinghouse ...
RATIONALE: A(2A) adenosine receptors (A(2A)ARs) have been proposed to be involved in drug addiction; however, preclinical studies about the effects of A(2A)AR ligands on alcohol consumption have provided inconsistent results. OBJECTIVES: The present study evaluated the effect of intraperitoneal injections of the A(2A)AR antagonist ANR ...
... science-based principles and theories, and develop ... part of the Army training culture with recognized ... reference model, the Integrated Theory of AAR ...
Alkali aggregate reaction (AAR) affects numerous civil engineering structures and causes irreversible expansion and cracking. In order to control the safety level and the maintenance cost of its hydraulic dams, Electricite de France (EDF) must reach better comprehension and better prediction of the expansion phenomena. For this purpose, EDF has developed a numerical model ...
... circuit description of the video signal converter, supplemented with ... AIRBORNE, ELECTRONIC EQUIPMENT, INFRARED PULSES, LIGHT PULSES ...
... reports, BCTP Analyst generated data, WAARS generated reports, Unit-generated data, AAR video tapes and hard copies, FER, PSP, ACCES, ...
The capability of the advanced analysis of reactor engineering (AARE) modular code system and JEF-1-based nuclear data libraries to analyze light water high converter reactor (LWHCR) lattices is investigated by calculating the wet and dry cells of the PROTEUS-LWHCR phase II experiment. The results are compared to those obtained using several cell codes. Main features of the ...
... directly relate to CC 130 Hercules avionics Refuelling (AAR) missions; ... Specification economic analysis' cost estimates ... international standards; ...
... across live, virtual, and constructive environments (Meliza ... Provided unit with self-discovery AAR experience ... more than 50% of Talked about 50% of ...
... The introduction of game-based training has ... Training Analysis and Feedback System [4] was ... These AAR systems addressed technical issues of ...
The supply of aggregates suitable for use in construction and maintenance of infrastructure in western North America is a continuing concern to the engineering and resources-management community. Steady population growth throughout the region has fueled demand for high-quality aggregates, in the face of rapid depletion of existing aggregate resources and slow and difficult permitting of new ...
USGS Publications Warehouse
Weld and heat affected zone (HAZ) crack arrest fracture toughness were determined for welded plates of normalized AAR TC128 grade B steel, currently used in appropriate tank cars that carry hazardous materials. The plates were joined under laboratory cond...
Alkali-aggregate reactions (AAR) occur between the alkali hydroxides in the pore solution of concrete and certain minerals found in some aggregates. Two types of AAR reaction are currently recognized depending on the nature of the reactive mineral; alkali...
++I131/0-/.023<AAr+*.,,*+*+++-*,-,F52-./0//1348@@r*+,,+,*+,+,+-,++F520..../ 0578AAr,,,-,,**+*++-,**G41//0.-13238@@r,*-+-*-,,,),+,**F6100/../254;??r+,.+. ...
Studies were undertaken to measure the elevated-temperature mechanical properties and to determine the elevated-temperature fracture behavior of selected AAR M128-B steel plates. In addition, the ambient-temperature mechanical properties were measured to ...
The plant is composed of two heat pumps of 0.65 MW each, a 2.0 MW electric boiler, and a 2.9 MW oil-fired boiler. In the Aare lake two types of collectors have been placed. Collector 1 with a tube diameter of 110mm with a centre distance between tubes of ...
Operational experience has shown that the AN/AAR-34 produces an excessive number of short duration IR TGT lamp indications on the AN/APS-109 Indicator Panel. A replacement circuit module, which eliminates these extraneous IR TGT lamp indications by delayi...
Five acetic acid-sensitive mutants of Acetobacter aceti subsp. aceti no. 1023 were isolated by mutagenesis with N-methyl-N'-nitro-N-nitrosoguanidine. Three recombinant plasmids that complemented the mutations were isolated from a gene bank of the chromosome DNA of the parental strain constructed in Escherichia coli by using cosmid vector pMVC1. One of these plasmids (pAR1611), carrying about a ...
. (2000) and Lockyer 1 60 Achatina fulica DVAVVGAGPSGTYSAYKLRNKGQTVELFEYSNRIGGRLFTTHLPNVPDLNLESGGMRYFK L, AAR14186, AAR14187, CAC19361, CAC19362), Aplysia californica (AAN78211), Achatina fulica (P35903 immune defence genes were also isolated, including an orthologue of achacin from Achatina fulica (Obara
E-print Network
A pH cycling remineralization/dimineralization model has been used to compare remineralization and acid resistance benefits provided by commercial MFP and NaF dentifrices. Test results show that fluoride dentifrice systems were effective in enhancing lesion remineralization and providing acquired acid resistance (AAR) to carious lesions, with AAR benefits ...
The biochemical flexibility of the cellular translation apparatus offers, in principle, a simple route to the synthesis of drug-like modified peptides and novel biopolymers. However, only ?75 unnatural building blocks are known to be fully compatible with enzymatic tRNA acylation and subsequent ribosomal synthesis of modified peptides. Although the translation system can reject substrate analogs ...
The reactivity of carbonate rock with the alkali content of cement, commonly called alkali-carbonate reaction (ACR), has been investigated. Alkali-silica reaction (ASR) can also contribute in the alkali-aggregate reaction (AAR) in carbonate rock, mainly due to micro- and crypto-crystalline quartz or clay content in carbonate aggregate. Both ACR and ASR can occur in the same ...
To isolate novel auxin-responsive mutants in Arabidopsis (Arabidopsis thaliana), we screened mutants for root growth resistance to a putative antiauxin, p-chlorophenoxyisobutyric acid (PCIB), which inhibits auxin action by interfering the upstream auxin-signaling events. Eleven PCIB-resistant mutants were obtained. Genetic mapping indicates that the mutations are located in at least five ...
Although ligand-selective regulation of G protein-coupled receptor-mediated signaling and trafficking are well documented, little is known about whether ligand-selective effects occur on endogenous receptors or whether such effects modify the signaling response in physiologically relevant cells. Using a gene targeting approach, we generated a knock-in mouse line, in which N-terminal hemagglutinin ...
ABSTRACT: BACKGROUND: Late Gadolinium Enhancement (LGE) and T2-weighted cardiovascular magnetic resonance (CMR) provides a means to measure myocardial area at risk (AAR) and salvage. Several T2-weighted CMR sequences are in use, but there is no consensus in terms of which sequence to be the preferred. Therefore, the aim of the present study was to: (1) Assess the ...
BackgroundThe area-at-risk (AAR) is a key determinant of myocardial infarction (MI) size. We investigated whether MRI measurement of AAR would correlate with an angiographic AAR risk score in patients with acute MI.Methods and ResultsBright blood T2-prepared steady-state free-precession MRI (T2-SSFP MRI) was used to depict the ...
AARE, a code package to perform Advanced Analysis for Reactor Engineering, is a linked modular system for fission reactor core and shielding, as well as fusion blanket, analysis. Its cross-section sensitivity and uncertainty path presently includes the cross-section processing and reformatting code TRAMIX, cross-section homogenization and library reformatting code MIXIT, the ...
DOE Information Bridge
The course administration (16 mg/kg per os for 5 days) of extracts of Panax ginseng or Rhodiola rosea induced a decrease in the infarction size/the area at risk (IS AAR) ratio during a 45-min local ischemia and a 2-hr reperfusion in artificially ventilated chloralose-anaesthetized rats. Single administration of ginseng or Rhodiola 24 h before ischemia did not affect the ...
11--Tungsten-182 cross section o MEASURED. -. CALCULATED FROM POSITIVE. ENERGY PARAMETERS. IO. I aar. 0. li. I;. NEUTRON ENERGY (eV). Fig. ...
A-U. A.AR18IV WANIIcrrLI OORPORANON. DENVER DIVISION ..... Analyze the (:ross feu lbility and iilat,ch/iiiisrtlatch c. expcriinents assigned t o each flight ...
The first Intensive Observation Period (IOP) of the Swiss air pollution experiment POLLUMET took place in 1990 in the Aare River Valley between Bern and Zurich. During the IOP, fast response measurements of meteorological variables and ozone concentration...
It is known that stimulation of the alpha(2A)-adrenoceptors (alpha(2A)-ARs) by the selective alpha(2A)-AR agonist guanfacine produces an important and beneficial influence on prefrontal cortical (PFC) cognitive functions such as spatial working memory and selective attention. However, it is unclear whether stimulation of the ...
... months of 'World Yiar I with similar figures for the first twenty months ... orld aar I-Wforlda. War II, CT, AS, July 1943, p. 9. ~~~~E ta'v p. 23 - ...
The Federal Railroad Administration, with supplemental support from the Association of American Railroads (AAR), Railway Progress Institute, and Chemical Manufacturers Association, contracted with the Transportation Technology Center, Inc., a subsidiary o...
All new thermal power plants in the suburbian area of the Rhine and Aare River must be equipped with cooling towers. Mixed cooling is permitted, provided that it is absolutely warranted that the limiting values laid down in the regulation are not trespass...
... Proceedings, Held in Sydney, Australia on July 8-10 ... Interdict DCA FA18, AAR Continuous ISR ... Local air control established (SE) 12 FA 18 2 FA 18 ...
In 1938 the Norwegian Parliament passed a law to ensure protection against ionizing radiation. The law stated that all use of ionizing radiation should be under governmental supervision. To enact this supervision, the National Institute for Radiation Hygi...
The report is a follow-up of a Transportation Research Board (TRB) study on rail transport research needs conducted in 1975. The 1975 study was sponsored by the Association of American Railroads (AAR) and the Federal Railroad Administration (FRA) and was ...
... Group, 20-24 June, Seattle, Washington, USA. IUCN, Gland, Switzerland. 198 pp. Aars, J., A.E. Derocher, ... Group, 3-7 February 1997, Oslo Norway. IUCN, Gland, Switzerland...
NBII National Biological Information Infrastructure
The contention of the Association of American Railroads (AAR) that special trains are necessary for handling spent fuel is discussed. These special trains would not move faster than 35 mph nor carry any nonradioactive freight. When a special train meets, ...
Two new precast concrete bridges were installed by the Transportation Technology Center, Inc. (TTCI), a wholly owned subsidiary of the Association of American Railroads (AAR), Pueblo, Colorado, at the Facility for Accelerated Service Testing (FAST) in Dec...
Tests were performed on the Peacekeeper Rail Garrison Missile Launch Car (MLC), EMS-1 according to specifications in Chapter XI of the AAR's, Manual of Standards and Recommended Practices. The tests included vehicle characterization, service worthiness, a...
Tests were performed on the Peacekeeper Rail Garrison Launch Control Car (LCC), EMS-2 according to specifications in Chapter XI of the AAR's, Manual of Standards and Recommended Practices. The tests included vehicle characterization, service worthiness, a...
Tests were performed on the Peacekeeper Rail Garrison Maintenance Car (MC), according to specifications in Chapter XI of the AAR's, Manual of Standards and Recommended Practices and results are included in the report. The unloaded MC was subjected to limi...
Sturgeon and Whooping Cranes are publicly prominent issues, but are often misunderstood. On the other end of threatened or endangered whooping cranes, interior least terns, piping plovers and pallid sturgeon. "We have
A DNA sequence encoding N-acylamino acid racemase (AAR) was inserted downstream from the T7 promoter in pET3c. The recombinant plasmid was introduced into Escherichia coli MM 294 lysogenized with a bacteriophage lambda having a T7 RNA polymerase gene. The amount of AAR produced by the E. coli transformant was 1100-fold more than that produced by ...
... AAR ex MPU 29668). Rumex aeroplaniformis Eig, Pl. Palestine Anal. Key: 99. 1931. TYPE: [Israel.] Sharon Plain: ... Zohary, and N. Feinbrun. 1931. The Plants of Palestine, An Analytical Key. The Hebrew Un...
Page 1. NAVSTAR GPS PROGRAM STATUS AND PMSE 111 GPS USER EQUIPHEKT LCDR (WolI) PER W. NIEL~GI~AAR ...
Page 1. Page 2. Page 3. Page 4. Page 5. Page 6. Page 7. Page 8. Page 9. Page 10. Page 11. Page 12. Page 13. Page 14. Page 15. Page 16. Page ...
ObjectiveTo determine age-adjusted rates (AAR) of lower urinary tract (LUT) injury and incidence in selected inpatient gynecologic and obstetric procedures.Study DesignWe utilized the National Hospital Discharge Survey, 1979�2006. AAR of non-obstetric bladder and ureteral injuries and incidence of LUT injury for various hysterectomy types and deliveries ...
The Federal Railroad Administration (FRA) and the Association of American Railroads (AAR) have jointly sponsored an experimental program to study the 100-ton covered hopper car with the end objective of improving its safety performance. The total program ...
This report describes test procedures and results of the AAR lateral track shift tests. The tests included static and dynamic lateral track loadings under various vertical loads, relative effects of single and double axle loading, panel shift tests and si...
The three main areas of research are: the floating body problem (zero forward speed), the Kelvin-Neumann problem (non-zero favored speed), and the application of optimization methods. Comments aare made on each separately.
... Cu- tu m as Rulso Asampons m AAR heal Um so ... do that by going over some of your responses on ... tiel I In ) MWee Of hW WA you *"Imdyo haboute ...
Sep 1, 2011... MI: American Society of Agricultural and Biological Engineers: 583-594 ... the average of 362 mm for the 1951-00 period (AAR = 1288 min). ...
Treesearch
... rAar-W34agingj enhancement and is motivated by the Ismc tEEN. Vol. 71.14o. . ... (p-iv e. affa9Oice) sonar and the likte infatuation gathering systems. ...
AUGA. National Aeronautics. nd. Sp wo Aumirnv,trahnn. Ames Research Center. Moffett Field. f,'ahfornw 9403,5. M. E u ^^. _..^....__.^_.-.. . ..a:a.,r . ...
The Association of American Railroads (AAR) has prepared a handbook entitled 'Field Product Removal Methods for Tank Cars' containing guidelines for use by responders to derailments involving tank cars. The handbook presents several general techniques for...
... use in infants and pregnant women. ... and -nultple drug-res~stant sru ::czrnM aar_-a. ... esting and quantitation of spor-)z(-.tes for mnonkey inoculation ...
The purpose of this report is to provide a literature review of the cognitive and learning science research that is relevant to defining an effective after action review (AAR) process. The goal of this review is to assemble research sources that apply to ...
The study has determined the safety effectiveness of various types of motorist warning devices in reducing accidents at rail-highway crossings. The study was based on analysis of data included in the DOT-AAR Rail-Highway Crossing Inventory and the FRA Rai...
Current Automated Aerial Refueling (AAR) research requires precision modeling and simulation of the refueling process between a KC-135 tanker aircraft and an unmanned aircraft. In order to meet this requirement, both steady-state and dynamic interactions ...
This report provides an analysis of variations in the distributional effects among groups of households for the 1985 energy Projections Series A through F prepared by the EIA for its Annual Report to Congress (AAR). The estimates are made using a combinat...
A large number of military aircraft are equipped with the AN/AAR-47 missile approach warning system (MAWS). The AN/AAR-47 comprises four ultraviolet (UV) sensors, a computer processor (CP) and a control indicator (CI). In-band photon irradiance from incoming missiles produces sensor outputs that are analyzed by the CP to produce threat declaration. The ...
NASA Astrophysics Data System (ADS)
... humans with hacmorhatio eer(huaior'haj,) in tha ma~~a.ar * Ioyer seoondary ... of I.trialiuijoeps ticks, wich inhabit the forest ,1tter, 7started to increaso ...
Lake Brienz to the northwest results from the actions of both glacial ice and the flowing waters of the Aare and Lutschine rivers, and has a maximum depth of 261 meters (856 feet). The lake has a particularly ... Fires Around Lake Baikal, Russia ...
Abstract � IP alias resolution is an important step in generating sample Internet topologies from collected path traces. Inaccuracies in IP alias resolution may significantly affect the characteristics of the resulting sample topologies. This in turn affects the accuracy of measurement results obtained using such topologies. Existing tools for alias resolution use an active probing approach. ...
The research examined how operational capabilities in the future Ground Soldier System (GSS) could serve as after action review (AAR) aids for trainers during force-on-force field exercises. It also examined what specific additional embedded training feat...
In immunosuppressed mice that carry rat skin xeno-grafts, acute antibody-mediated graft rejection (AAR) can be induced by intravenous administration of mouse anti-rat globulin. Dependent on the amount of antibody injected and on the complement status of the recipient, an Arthus-like or a Shwartzman-like pattern of vasculitis occurs. The role of polymorphonuclear granulocytes ...
In July 1999, Transportation Technology Center, Inc. (TTCI), a subsidiary of the Association of American Railroads (AAR), conducted a system evaluation test as part of the Federal Railroad Administration's (FRA) Improved Freight Car Roller Bearing Inspect...
81 Hawker Beechcraft Corporation 125-800A, N818MV Owatonna, Minnesota July 31, 2008 NTSB Number AAR-11/01 NTIS Number PB2011-910401 PDF Document EXECUTIVE SUMMARY On July 31,...
This metallurgical evaluation included determining whether the samples conformed with the appropriate specifications and to determine the impact test behavior of both plate samples.
...MATERIALS REGULATIONS SPECIFICATIONS FOR TANK CARS Introduction, Approvals and Reports...of construction. (a) Before a tank car is placed in service, the party assembling...owner and the Executive Director�Tank Car Safety, AAR, certifying that...
Code of Federal Regulations, 2010
...and purged of all water vapor. (b) Caulking of welded joints to stop leaks developed during the test is prohibited. Repairs to welded joints must be made as prescribed in AAR Specifications...
...REGULATIONS SPECIFICATIONS FOR TANK CARS General Design Requirements ...requirements apply: (a) Each tank car must be marked according to the...appendix C of the AAR Specifications for Tank Cars (IBR, see § 171.7 of this...
...before rubber lining is applied. (d) Caulking of welded joints to stop leaks developed during the foregoing tests is prohibited. Repairs in welded joints shall be made as prescribed in AAR Specifications...
...MATERIALS REGULATIONS SPECIFICATIONS FOR TANK CARS General Design Requirements § 179...an applicable tank car specification authorizes location...and E10.00 of the AAR Specifications for Tank Cars (IBR,...
...MATERIALS REGULATIONS SPECIFICATIONS FOR TANK CARS Introduction, Approvals and Reports...Approved means approval by the AAR Tank Car Committee. (3) ASTM means... (9) [Reserved] (10) Tank car facility means an entity...
...tested before insulation is applied. (c) Caulking of welded joints to stop leaks developed during the foregoing test is prohibited. Repairs in welded joints shall be made as prescribed in AAR Specifications...
...calculate and file the RCAF unadjusted for changes in railroad productivity as prescribed in Railroad Cost Recovery Procedures, ...amendments thereto. In addition, the AAR shall calculate the productivity-adjusted RCAF as prescribed in Railroad Cost Recovery...
...false Special access. 69.114 Section 69.114 Telecommunication FEDERAL...Computation of Charges § 69.114 Special access. (a...are assigned to the Special Access element for purposes of...