Sample records for aluminum barium calcium

  1. 40 CFR 721.10011 - Barium calcium manganese strontium oxide.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ...2014-07-01 2014-07-01 false Barium calcium manganese strontium oxide. 721.10011...Chemical Substances § 721.10011 Barium calcium manganese strontium oxide. (a...chemical substance identified as barium calcium manganese strontium oxide (PMN...

  2. 40 CFR 721.10011 - Barium calcium manganese strontium oxide.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ...2013-07-01 2013-07-01 false Barium calcium manganese strontium oxide. 721.10011...Chemical Substances § 721.10011 Barium calcium manganese strontium oxide. (a...chemical substance identified as barium calcium manganese strontium oxide (PMN...

  3. 40 CFR 721.10011 - Barium calcium manganese strontium oxide.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ...2011-07-01 2011-07-01 false Barium calcium manganese strontium oxide. 721.10011...Chemical Substances § 721.10011 Barium calcium manganese strontium oxide. (a...chemical substance identified as barium calcium manganese strontium oxide (PMN...

  4. 40 CFR 721.10011 - Barium calcium manganese strontium oxide.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ...2012-07-01 2012-07-01 false Barium calcium manganese strontium oxide. 721.10011...Chemical Substances § 721.10011 Barium calcium manganese strontium oxide. (a...chemical substance identified as barium calcium manganese strontium oxide (PMN...

  5. Electron emitting barium-calcium aluminate obtained from chemical solution techniques

    Microsoft Academic Search

    C. Higashi; N. B. de Lima; J. R. Matos; C. Giovedi; C. C. Motta

    2005-01-01

    This paper reports a chemical technique to obtain barium-calcium aluminates used in impregnated thermionic cathodes. This procedure has been employed to improve the thermionic emission characteristics of the cathodes and to facilitate the preparation process of the emitting material. The crystallized powders were obtained using a mixed solution that contains barium, calcium, and aluminum in their chemical formula. Thermogravimetry and

  6. Densities of liquid metals: calcium, strontium, barium

    Microsoft Academic Search

    S. Hiemstra; D. Prins; G. Gabrielse; J. B. Van Zytveld

    1977-01-01

    We report a method of measuring the densities of liquids at intermediate temperatures which employs Archimedes' Principle in a two-sinker arrangement. This method is then used to measure the densities of pure liquid calcium, strontium, and barium. We find ?(Ca) = 1.4931 ? 1.37 × 10 T(°C) from 850 ? 950°C, ?(Sr) = 2.5547 ? 2.83 × 10 T(°C) from

  7. Scattering lengths of calcium and barium isotopes

    E-print Network

    U. Dammalapati; L. Willmann; S. Knoop

    2011-10-25

    We have calculated the s-wave scattering length of all the even isotopes of calcium (Ca) and barium (Ba), in order to investigate the prospect of Bose-Einstein condensation (BEC). For Ca we have used an accurate molecular potential based on detailed spectroscopic data. Our calculations show that Ca does not provide other isotopes alternative to the recently Bose condensed 40Ca that suffers strong losses because of a very large scattering length. For Ba we show by using a model potential that the even isotopes cover a broad range of scattering lengths, opening the possibility of BEC for at least one of the isotopes.

  8. Scattering lengths of calcium and barium isotopes

    E-print Network

    Dammalapati, U; Knoop, S

    2011-01-01

    We have calculated the s-wave scattering length of all the even isotopes of calcium (Ca) and barium (Ba), in order to investigate the prospect of Bose-Einstein condensation (BEC). For Ca we have used an accurate molecular potential based on detailed spectroscopic data. Our calculations show that Ca does not provide other isotopes alternative to the recently Bose condensed 40Ca that suffers strong losses because of a very large scattering length. For Ba we show by using a model potential that the even isotopes cover a broad range of scattering lengths, opening the possibility of BEC for at least one of the isotopes.

  9. PHOTOSENSITIVE CENTERS AND CHARGE TRANSFER PROCESSES IN BARIUM CALCIUM TITANATE

    E-print Network

    Malovichko, Galina

    PHOTOSENSITIVE CENTERS AND CHARGE TRANSFER PROCESSES IN BARIUM CALCIUM TITANATE G.MALOVICHKO, V calcium titanate crystals, Ba0.77Ca0.23TiO3, in the temperature range between 4.2 K and 300 K are reported of crystals from barium titanate (BT) family make them promising candidates for various applications

  10. 21 CFR 182.2122 - Aluminum calcium silicate.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ...2010-04-01 2009-04-01 true Aluminum calcium silicate. 182.2122 Section 182.2122...Anticaking Agents § 182.2122 Aluminum calcium silicate. (a) Product. Aluminum calcium silicate. (b) Tolerance. 2...

  11. 21 CFR 182.2122 - Aluminum calcium silicate.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ...2012-04-01 2012-04-01 false Aluminum calcium silicate. 182.2122 Section 182.2122...Anticaking Agents § 182.2122 Aluminum calcium silicate. (a) Product. Aluminum calcium silicate. (b) Tolerance. 2...

  12. 21 CFR 582.2122 - Aluminum calcium silicate.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ...2011-04-01 2011-04-01 false Aluminum calcium silicate. 582.2122 Section 582.2122...Anticaking Agents § 582.2122 Aluminum calcium silicate. (a) Product. Aluminum calcium silicate. (b) Tolerance. 2...

  13. 21 CFR 182.2122 - Aluminum calcium silicate.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ...2013-04-01 2013-04-01 false Aluminum calcium silicate. 182.2122 Section 182.2122...Anticaking Agents § 182.2122 Aluminum calcium silicate. (a) Product. Aluminum calcium silicate. (b) Tolerance. 2...

  14. 21 CFR 582.2122 - Aluminum calcium silicate.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ...2010-04-01 2010-04-01 false Aluminum calcium silicate. 582.2122 Section 582.2122...Anticaking Agents § 582.2122 Aluminum calcium silicate. (a) Product. Aluminum calcium silicate. (b) Tolerance. 2...

  15. 21 CFR 182.2122 - Aluminum calcium silicate.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ...2011-04-01 2011-04-01 false Aluminum calcium silicate. 182.2122 Section 182.2122...Anticaking Agents § 182.2122 Aluminum calcium silicate. (a) Product. Aluminum calcium silicate. (b) Tolerance. 2...

  16. 21 CFR 582.2122 - Aluminum calcium silicate.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ...2013-04-01 2013-04-01 false Aluminum calcium silicate. 582.2122 Section 582.2122...Anticaking Agents § 582.2122 Aluminum calcium silicate. (a) Product. Aluminum calcium silicate. (b) Tolerance. 2...

  17. 21 CFR 582.2122 - Aluminum calcium silicate.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ...2014-04-01 2014-04-01 false Aluminum calcium silicate. 582.2122 Section 582.2122...Anticaking Agents § 582.2122 Aluminum calcium silicate. (a) Product. Aluminum calcium silicate. (b) Tolerance. 2...

  18. 21 CFR 582.2122 - Aluminum calcium silicate.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ...2012-04-01 2012-04-01 false Aluminum calcium silicate. 582.2122 Section 582.2122...Anticaking Agents § 582.2122 Aluminum calcium silicate. (a) Product. Aluminum calcium silicate. (b) Tolerance. 2...

  19. 21 CFR 182.2122 - Aluminum calcium silicate.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ...2014-04-01 2014-04-01 false Aluminum calcium silicate. 182.2122 Section 182.2122...Anticaking Agents § 182.2122 Aluminum calcium silicate. (a) Product. Aluminum calcium silicate. (b) Tolerance. 2...

  20. REMOVING BARIUM AND RADIUM THROUGH CALCIUM CATION EXCHANGE

    EPA Science Inventory

    The removal of barium (Ba) and radium (Ra), which are found in many groundwater sources, was achieved in laboratory studies with an ion exchange process. In the studies, a strong acid resin in the calcium form effectively removed Ba(+2) and Ra (+2) to meet standards. The resin wa...

  1. Final Report on the Safety Assessment of Aluminum Silicate, Calcium Silicate, Magnesium Aluminum

    E-print Network

    Ahmad, Sajjad

    Final Report on the Safety Assessment of Aluminum Silicate, Calcium Silicate, Magnesium Aluminum Sodium Silicate, Montmorillonite, Pyrophyllite, and Zeolite1 This report reviews the safety of Aluminum, Calcium, Lithium Magnesium, Lithium Magnesium Sodium, Magnesium Aluminum, Magnesium, Sodium Magnesium

  2. Barium oxide, calcium oxide, magnesia, and alkali oxide free glass

    SciTech Connect

    Lu, Peizhen Kathy; Mahapatra, Manoj Kumar

    2013-09-24

    A glass composition consisting essentially of about 10-45 mole percent of SrO; about 35-75 mole percent SiO.sub.2; one or more compounds from the group of compounds consisting of La.sub.2O.sub.3, Al.sub.2O.sub.3, B.sub.2O.sub.3, and Ni; the La.sub.2O.sub.3 less than about 20 mole percent; the Al.sub.2O.sub.3 less than about 25 mole percent; the B.sub.2O.sub.3 less than about 15 mole percent; and the Ni less than about 5 mole percent. Preferably, the glass is substantially free of barium oxide, calcium oxide, magnesia, and alkali oxide. Preferably, the glass is used as a seal in a solid oxide fuel/electrolyzer cell (SOFC) stack. The SOFC stack comprises a plurality of SOFCs connected by one or more interconnect and manifold materials and sealed by the glass. Preferably, each SOFC comprises an anode, a cathode, and a solid electrolyte.

  3. Investigation of electron emitting barium-calcium aluminate fabrication process for impregnated microwave tube cathodes

    Microsoft Academic Search

    C. Higashi; N. B. de Lima; J. R. Matos; C. Giovedi; C. C. Motta

    2005-01-01

    In this paper it is reported the fabrication process of electron emitting barium-calcium aluminates used on impregnated cathodes which constitute high power vacuum microwave devices such as klystrons and TWTs (traveling wave tubes). The compound thermal behavior and the analysis of the formed phases during processing are evaluated, respectively, by means of thermal analysis and X-Ray diffraction. Results about the

  4. Aluminum Citrate Prevents Renal Injury from Calcium Oxalate Crystal Deposition

    PubMed Central

    Besenhofer, Lauren M.; Cain, Marie C.; Dunning, Cody

    2012-01-01

    Calcium oxalate monohydrate crystals are responsible for the kidney injury associated with exposure to ethylene glycol or severe hyperoxaluria. Current treatment strategies target the formation of calcium oxalate but not its interaction with kidney tissue. Because aluminum citrate blocks calcium oxalate binding and toxicity in human kidney cells, it may provide a different therapeutic approach to calcium oxalate-induced injury. Here, we tested the effects of aluminum citrate and sodium citrate in a Wistar rat model of acute high-dose ethylene glycol exposure. Aluminum citrate, but not sodium citrate, attenuated increases in urea nitrogen, creatinine, and the ratio of kidney to body weight in ethylene glycol–treated rats. Compared with ethylene glycol alone, the addition of aluminum citrate significantly increased the urinary excretion of both crystalline calcium and crystalline oxalate and decreased the deposition of crystals in renal tissue. In vitro, aluminum citrate interacted directly with oxalate crystals to inhibit their uptake by proximal tubule cells. These results suggest that treating with aluminum citrate attenuates renal injury in rats with severe ethylene glycol toxicity, apparently by inhibiting calcium oxalate’s interaction with, and retention by, the kidney epithelium. PMID:23138489

  5. Aluminum citrate prevents renal injury from calcium oxalate crystal deposition.

    PubMed

    Besenhofer, Lauren M; Cain, Marie C; Dunning, Cody; McMartin, Kenneth E

    2012-12-01

    Calcium oxalate monohydrate crystals are responsible for the kidney injury associated with exposure to ethylene glycol or severe hyperoxaluria. Current treatment strategies target the formation of calcium oxalate but not its interaction with kidney tissue. Because aluminum citrate blocks calcium oxalate binding and toxicity in human kidney cells, it may provide a different therapeutic approach to calcium oxalate-induced injury. Here, we tested the effects of aluminum citrate and sodium citrate in a Wistar rat model of acute high-dose ethylene glycol exposure. Aluminum citrate, but not sodium citrate, attenuated increases in urea nitrogen, creatinine, and the ratio of kidney to body weight in ethylene glycol-treated rats. Compared with ethylene glycol alone, the addition of aluminum citrate significantly increased the urinary excretion of both crystalline calcium and crystalline oxalate and decreased the deposition of crystals in renal tissue. In vitro, aluminum citrate interacted directly with oxalate crystals to inhibit their uptake by proximal tubule cells. These results suggest that treating with aluminum citrate attenuates renal injury in rats with severe ethylene glycol toxicity, apparently by inhibiting calcium oxalate's interaction with, and retention by, the kidney epithelium. PMID:23138489

  6. Infrared studies of apatites. I. Vibrational assignments for calcium, strontium, and barium hydroxyapatities utilizing isotopic substitution

    Microsoft Academic Search

    B. O. Fowler

    1974-01-01

    The infrared spectra of powdered calcium hydroxyapatite isotopically ; substituted with D, ¹⁸O, ⁴⁴Ca, and ⁴⁸Ca and infrared spectra of ; powdered strontium and barium hydroxyapatites and their deuterated analogs are ; reported at 48 and - 185 deg in the 4000-200cm-¹ region. Band ; assignments, based on isotopic frequency shifts, band intensity, band temperature ; dependency, and comparisons between

  7. Pyroelectric and dielectric properties of calcium barium niobate single crystals

    NASA Astrophysics Data System (ADS)

    Malyshkina, O. V.; Lisitsin, V. S.; Dec, J.; ?ukasiewicz, T.

    2014-09-01

    The effect of the calcium concentration on the pyroelectric and dielectric properties of Ca x Ba1 - x Nb2O6 (CBN) crystals has been studied over a wide temperature range. It has been shown that the calcium concentration only influences the Curie point of crystals of this class. It insignificantly changes the absolute values of the permittivity, the coercive field, and the remanent polarization and does not influence their temperature dependences and the shape of the dielectric hysteresis loop. The possibility of the existence of relaxor properties in CBN crystals has been discussed.

  8. Assessment of the solubility and bioaccessibility of barium and aluminum in soils affected by mine dust deposition.

    PubMed

    Shock, S S; Bessinger, B A; Lowney, Y W; Clark, J L

    2007-07-01

    Barium is a heavy metal to which human and animal receptors may be exposed in various settings--for example, in mineral extraction industries where the mining and milling of ores occurs. Aluminum is also an element abundant in soil and dust to which human and animal receptors may be exposed in association with such industries. This study investigated the solubility and bioaccessibility of barium and aluminum in simulated gastric fluids using an in vitro test method previously validated for lead. Soil samples were collected from the vicinity of a mine and transport road that generated fugitive dust containing barium as barite (BaSO4). It was found that barium bioaccessibility in different tundra soil and fugitive dust source materials varied greatly, between 0.07 and 66.0%, depending on sample location, grain size, solid-to-fluid ratio used in the in vitro experiments, and the analytical method selected for determining total barium concentrations in the sample substrates. For X-ray fluorescence spectrometry (XRF) analytical methods and a solid-to-fluid ratio of 1:100, barium bioaccessibility from the barite-rich mine waste rock and gyro crusher ore dust source materials was very low (0.07-0.36%). By contrast, the bioaccessibility of barium in tundra soil samples affected by fugitive dust deposition ranged from 3.8 to 19.5%. The relative solubility of barium measured in the simulated gastric fluids of this study is consistent with time-dependent dissolution of barite in mine waste rock and ore dust, and the presence of more soluble chemical forms in tundra soil. Laboratory XRF analysis was the only analytical method used in this study that accurately characterized total barium concentrations for all sample substrates. Aluminum bioaccessibility was distinguished from barium bioaccessibility by its generally lower values and smaller dependence on grain size and solid-to-fluid ratios. The range of aluminum bioaccessibility values (0.31-4.0%) is consistent with the predominance of aluminum in relatively insoluble aluminosilicate minerals. PMID:17695934

  9. Optical planar waveguide in sodium-doped calcium barium niobate crystals by carbon ion implantation

    NASA Astrophysics Data System (ADS)

    Zhao, Jin-Hua; Qin, Xi-Feng; Wang, Feng-Xiang; Fu, Gang; Wang, Hui-Lin; Wang, Xue-Lin

    2013-07-01

    There is great interest in niobate crystals which belong to the tetragonal tungsten bronze (TTB) families owing to their intriguing properties. As one representative of such crystals, CBN (calcium barium niobate) has attracted rapidly growing attention. Because it has a higher Curie temperature than SBN (strontium barium niobate), possesses outstanding ferroelectric and it possesses optical properties. In addition, doped with sodium, CBN will show a higher Curie temperature than pure CBN. We report on the fabrication and characterization of optical planar waveguide in x-cut sodium-doped calcium barium niobate crystal by using C ion implantation. The guided-mode properties at the wavelength of 633 and 1539 nm are investigated through prism-coupling measurements, respectively. By applying direct end-face coupling arrangement, the near-field optical intensity distribution of waveguide modes is measured at 633 nm. For comparison, the modal profile of the same guided mode is also numerically calculated by the finite difference beam-propagation method via computer software BeamPROP. The transmission spectra of the waveguide before and after ion implantation treatments were investigated also. Our experiment results reveal that the waveguide could propagate light with transverse magnetic polarized direction only and it is assumed that the polarization selectivity of CBN crystal may responsible for this phenomenon.

  10. Magnetic behavior and dielectric properties of aluminum substituted M-type barium hexaferrite

    NASA Astrophysics Data System (ADS)

    El-Sayed, S. M.; Meaz, T. M.; Amer, M. A.; El Shersaby, H. A.

    2013-10-01

    Various parameters in the structural features of the aluminum substituted barium hexagonal ferrite particles BaAlxFe12-xO19 with 0?x?3.5 which were prepared by the solid state reaction method have been studied. The infrared transmission spectrum was measured in the wave number region 5000-200 cm-1 at room temperature. The results were interpreted in terms of the vibrations of the isolated molecular units in such a way to preserve the tetrahedral and octahedral clusters of metal oxides in the barium aluminum hexagonal ferrites. The infrared features are assigned to Fe-O and Ba-O bonds in M-type hexagonal ferrite (BaFe12O19) molecules. Also, the results explain the structural model, based on the effect of aluminum substitution “Al-O bond”. On the other hand, the magnetic behavior of the samples was studied using the vibrating sample magnetometer technique. The saturation magnetization (Ms) and magneton number (nB) decrease with increasing Al3+ substitution from 61.2 to 28.9 emu/g and from 12.2 to 5.3 ?B respectively. Also, all samples were characterized using X-ray diffraction and the values of grain size, microstrain and dislocation density of all samples were calculated. The dielectric parameters and ac conductivity measurements were performed within a temperature range 293-493 K. The ac conductivity showed a linear relation with the frequency power law with an exponent s?0.69-0.14 for BaFe12O19. It decreases with increasing temperature, indicating that the heterogeneous structures increase. While the dielectric constant (??) and the dielectric loss (??) decrease with increasing Al substitution.

  11. Efficient ionisation of calcium, strontium and barium by resonant laser pumping

    NASA Technical Reports Server (NTRS)

    Skinner, C. H.

    1980-01-01

    Efficient ionization has been observed when an atomic vapor of strontium, barium or calcium was illuminated with a long pulse tunable laser at the frequency of the atomic resonance line. The variation in the degree of ionization with neutral density and laser intensity has been measured using the 'hook' method. The maximum ionization observed was 94%. Excited state populations were measured yielding an excitation temperature (depending on exact experimental conditions) in the region of 0.4 eV. The decay of ion density after the laser pulse was monitored and the recombination coefficients determined. The results are interpreted in terms of an electron heating model.

  12. Preparation and characterization of uniform particles of flufenamic acid and its calcium and barium salts.

    PubMed

    Mohamed, Amr Ali; Matijevi?, Egon

    2012-09-01

    Uniform fully dispersed particles of flufenamic acid, a widely used anti-inflammatory drug, were prepared by two different methods. In the first one, the drug solution in organic solvents was added to a non-solvent (water or aqueous solutions of stabilizers); while in the second procedure the drug was precipitated by acidifying its basic aqueous solutions. In addition calcium and barium salts of uniform spherical particles were obtained by precipitation in aqueous basic solutions of the drug. These salts are supposed to improve the drug reactivity. The prepared dispersions of the drug and its salts were examined by scanning electron microscopy, X-ray diffractometry and electrophoresis. PMID:22703985

  13. Copper, aluminum, iron and calcium inhibit human acetylcholinesterase in vitro.

    PubMed

    Pohanka, Miroslav

    2014-01-01

    Acetylcholinesterase (AChE) is an important part of cholinergic nerves where it participates in termination of neurotransmission. AChE can be inhibited by e.g. some Alzheimer disease drugs, nerve agents, and secondary metabolites. In this work, metal salts aluminum chloride, calcium chloride, cupric chloride, ferric chloride, potassium chloride, magnesium chloride and sodium chloride were tested for their ability to inhibit AChE. Standard Ellman assay based on human recombinant AChE was done and inhibition was measured using Dixon plot. No inhibition was proved for sodium, potassium and magnesium ions. However, aluminum, cupric, ferric and calcium ions were able to inhibit AChE via noncompetitive mechanism of inhibition. Though the inhibition is much weaker when compared to e.g. drugs with noncompetitive mechanism of action, biological relevance of the findings can be anticipated. PMID:24473150

  14. Creep and microstructure of magnesium-aluminum-calcium based alloys

    Microsoft Academic Search

    Alan A. Luo; Bob R. Powell; Michael P. Balogh

    2002-01-01

    This article describes the creep and microstructure of Mg-Al-Ca-based magnesium alloys (designated as ACX alloys, where A\\u000a stands for aluminum; C for calcium; and X for strontium or silicon) developed for automotive powertrain applications. Important\\u000a creep parameters, i.e., secondary creep rate and creep strength, for the new alloys are reported. Creep properties of the new alloys are significantly\\u000a better than

  15. Interaction Studies Between Crofer-22APU Alloy And P{sub 2}O{sub 5} Containing Barium Calcium Alumino-borosilicate (BCABS) Sealant Glass-Ceramics

    SciTech Connect

    Ananthanarayanan, A. [Technical Physics Division, Bhabha Atomic Research Centre, Mumbai 400085 (India); UCCS-Unite de Catalyse et Chimie du Solide-UMR CNRS 8181, Ecole Nationale Superieure de Chimie de Lille, Universite des Sciences et Technologies de Lille, BP 108, 59562 Villeneuve d'Ascq Cedex (France); Montagne, L.; Revel, B. [UCCS-Unite de Catalyse et Chimie du Solide-UMR CNRS 8181, Ecole Nationale Superieure de Chimie de Lille, Universite des Sciences et Technologies de Lille, BP 108, 59562 Villeneuve d'Ascq Cedex (France); Kothiyal, G. P. [Technical Physics Division, Bhabha Atomic Research Centre, Mumbai 400085 (India)

    2010-12-01

    We present the effect of P{sub 2}O{sub 5} addition on barium calcium aluminum borosilicate BCABS glasses of composition (mol %)35BaO-15CaO-5Al{sub 2}O{sub 3}-(37-x)SiO{sub 2}-8B{sub 2}O{sub 3}-xP{sub 2}O{sub 5}(0{<=}x{<=}5). The incorporation of P{sub 2}O{sub 5} increased network polymerization and crystallization tendency. However, addition of P{sub 2}O{sub 5} leads to the formation of Cr{sub 2}O{sub 3} at the interface, saturating it in the ions of the metal. This improves glass-to-metal bonding.

  16. Reactions of calcium orthosilicate and barium zirconate with oxides and sulfates of various elements

    NASA Technical Reports Server (NTRS)

    Zaplatynsky, I.

    1979-01-01

    Calcium orthosilicate and barium zirconate were evaluated as the insulation layer of thermal barrier coatings for air cooled gas turbine components. Their reactions with various oxides and sulfates were studied at 1100 C and 1300 C for times ranging up to 400 and 200 hours, respectively. These oxides and sulfates represent potential impurities or additives in gas turbine fuels and in turbine combustion air, as well as elements of potential bond coat alloys. The phase compositions of the reaction products were determined by X-ray diffraction analysis. BaZrO3 and 2CaO-SiO2 both reacted with P2O5, V2O5, Cr2O3, Al2O3, and SiO2. In addition, 2CaO-SiO2 reacted with Na2O, BaO, MgO, and CoO and BaZrO3 reacted with Fe2O3.

  17. Express Letter Oxygen isotopes in calcium^aluminum-rich inclusions from

    E-print Network

    Express Letter Oxygen isotopes in calcium^aluminum-rich inclusions from enstatite chondrites: new July 2000 Abstract Calcium^aluminum-rich inclusions (CAIs) from enstatite chondrites have large 16 O, mineralogy and Al^Mg isotopic systematics. These similarities provide new evidence that most CAIs might have

  18. Chemical Compatibility of Barium-Calcium-Aluminosilicate Based Sealing Glasses with Ferritic Stainless Steel Interconnect in SOFCs

    Microsoft Academic Search

    Zhenguo Yang; Kerry D. Meinhardt; Jeffry W. Stevenson

    2003-01-01

    In most planar SOFC stack designs, the interconnect, which is typically made from a ferritic stainless steel, is hermitically sealed to the ceramic PEN (Positive electrode-Electrolyte-Negative electrode) by a sealing glass. To maintain the structural stability and minimize degradation of the stack performance, the sealing glass must be chemically compatible with the stainless steel interconnect. In this study, a barium-calcium-aluminosilicate

  19. Aluminum and calcium distribution patterns in aluminum-intoxicated roots of Allium cepa do not support the calcium-displacement hypothesis and indicate signal-mediated inhibition of root growth

    Microsoft Academic Search

    R. M. S. Schofield; J. Pallon; G. Fiskesjö; G. Karlsson; K. G. Malmqvist

    1998-01-01

    .   The aluminum and calcium distributions in the root tips of aluminum-intoxicated onions, Allium cepa L., were mapped using PIXE (particle-induced X-ray emission) microanalysis. Not enough aluminum was present to have replaced,\\u000a atom-for-atom, more than a minor fraction of the calcium. Furthermore, no inverse relationship between variations in aluminum\\u000a and calcium concentrations was observed for pairs of adjacent 30-?m-diameter regions.

  20. Aluminum is a weak agonist for the calcium-sensing receptor

    Microsoft Academic Search

    Robert F. Spurney; Min Pi; Patrick Flannery; L. Darryl Quarles

    1999-01-01

    Aluminum is a weak agonist for the calcium-sensing receptor.BackgroundAluminum (Al3+) has diverse biological effects mediated through activation of a putative extracellular cation-sensing receptor. A recently identified calcium-sensing receptor (CaSR), which has been identified in target tissues for Al3+, may transduce some of the biological effects of Al3+.MethodsTo test this possibility, we transfected human embryonic kidney 293 (HEK 293) cells with

  1. Calcium-Aluminum-Rich Inclusions in Chondritic Meteorites

    NASA Astrophysics Data System (ADS)

    MacPherson, G. J.

    Calcium-aluminum-rich inclusions (CAIs) are sub-mm- to cm-sized clasts in chondritic meteorites. They are composed almost entirely of CaO-Al2O3-MgO-SiO2-TiO2, and they contain the same minerals predicted by thermodynamic calculations to condense out of a gas of solar composition during cooling from very high temperatures. These features, together with ages of 4.567 Ga, suggest that CAIs are the oldest and most primitive solid objects formed at the time our solar system was born. CAIs possess endemic nuclear anomalies of nucleosynthetic origin, enrichment in 16O relative to other solar system materials, and also radiogenic anomalies from the in situ decay of short-lived nuclides such as 26Al and 10Be that existed when the CAIs (and solar system) formed. CAIs are complex objects whose petrologic and isotopic properties give clues to the events - and chronology of those events - that occurred during the first 1-2 million years of the solar system's existence. Reading that ancient record has been greatly enabled by recent and continuing advances in analytical laboratory instrumentation, and thus interest in CAIs remains very high.

  2. Mineral interactions and absorption in the equine digestive tract: calcium, phosphorus, and magnesium interaction with aluminum, and calcium digestibility of alfalfa in ponies

    E-print Network

    Kapusniak, Linda J.

    1987-01-01

    MINERAL INTERACTIONS AND ABSORPTION IN THE EQUINE DIGESTIVE TRACT: CALCIUM, PHOSPHORUS, AND MAGNESIUM INTERACTION WITH ALUMINUM, AND CALCIUM DIGESTIBILITY OF ALFALFA IN PONIES A Thesis by LINDA J. KAPUSN IAK Subnitted to the Graduate College... INTERACTION 4IITH ALUMINUM, AND CALCIUM DIGESTIBILITY OF ALFALF4 IN PONIES A Thesis LINDA J. KAPUSNIAK Appr oved as to stgle and content bg: L. W. Greene [Chairman of Committeej G. . tter [Committee Member3 L. H. Russell CCommittee Member) G. C...

  3. Eu-doped barium aluminum oxynitride with the {beta}-alumina-type structure as new blue-emitting phosphor

    SciTech Connect

    Jansen, S.R.; Migchels, J.M.; Hintzen, H.T.; Metselaar, R. [Eindhoven Univ. of Technology (Netherlands). Lab. of Solid State and Materials Chemistry] [Eindhoven Univ. of Technology (Netherlands). Lab. of Solid State and Materials Chemistry

    1999-02-01

    Attractive new blue-emitting phosphors for use in low-pressure mercury gas discharge lamps are synthesized by Eu-substitution in the barium aluminum oxynitride host lattice with the {beta}-alumina-type structure. The emission spectra of these phosphors for 254 nm excitation show a band at about 450 nm with a shoulder at higher wavelength. The maximum quantum efficiency of these materials is about 85--90% just like commercial BaMgAl{sub 10}O{sub 17}:Eu with the {beta}-alumina type structure. The nonoptimized oxynitride phosphors are more sensitive to oxidation (at 873 K) and to short-term depreciation due to 185 nm irradiation compared to commercial BaMgAl{sub 10}O{sub 17}:Eu. However, the maintenance of the oxynitride phosphors in single component fluorescent lamps is improved. Calculations indicate that by using these phosphors in tricolor fluorescent lamps instead of BaMgAl{sub 10}O{sub 17}:Eu with the {beta}-alumina type structure, the color rendering index will improve while the lumen output remains high.

  4. Room temperature structural and electrical properties of barium calcium titanate (BCT) thin films

    NASA Astrophysics Data System (ADS)

    Singh, B.; Kumar, S.; Arya, G. S.; Negi, N. S.

    2015-05-01

    In this work the effect of Ca doping on the structural and electrical properties of BaTiO3 thin films prepared by sol- gel method was investigated. The XRD patterns revealed the perovskite structure of BCT thin film shows tetragonality decreases with increase of Ca concentration at Ba-site. AFM images show dense, homogeneous and smooth micrograph of these thin films. The dielectric measurements of thin films show that dielectric constant decreases with Ca substitution. Polarization study shows the ferroelectric character of BCT thin films which decreases with increase in the concentration of Ca content on barium titanate.

  5. Creep deformation in magnesium aluminum calcium-based alloys

    Microsoft Academic Search

    Jessica Renae Terbush

    2010-01-01

    Magnesium alloys, with a lower density than steel or aluminum, have the potential to reduce the mass of automotive components. However, new alloys with improved creep resistance must be developed before Mg can be used for high temperature powertrain applications. Limiting the development of these alloys is the lack of fundamental knowledge of creep deformation in Mg alloys. This dissertation

  6. RenaGel®, a nonabsorbed calcium- and aluminum-free phosphate binder, lowers serum phosphorus and parathyroid hormone

    Microsoft Academic Search

    EDUARDO A SLATOPOLSKY; STEVEN K BURKE; MAUREEN A DILLON

    1999-01-01

    RenaGel®, a nonabsorbed calcium- and aluminum-free phosphate binder, lowers serum phosphorus and parathyroid hormone.Background.This multicenter, open-label, dose-titration study assessed the safety and efficacy of RenaGel®, a nonabsorbed calcium- and aluminum-free phosphate binder, in lowering serum phosphorus. Secondary outcomes were its effects on serum intact parathyroid hormone (iPTH) and serum lipids.Methods.Phosphate binders were discontinued during a two-week washout period. Patients whose

  7. Use of calcium\\/aluminum ratios as indicators of stress in forest ecosystems

    Microsoft Academic Search

    Christopher S. Cronan; David F. Grigal

    1995-01-01

    The calcium\\/aluminum (Ca\\/Al) molar ratio of the soil solution provides a valuable measurement endpoint or ecological indicator for identification of approximate thresholds beyond which the risk of forest damage from Al stress and nutrient imbalances increases. The Ca\\/Al ratio can also be used as an indicator to assess forest ecosystem changes over time in response to acidic deposition, forest harvesting,

  8. Growth of aragonite calcium carbonate nanorods in the biomimetic anodic aluminum oxide template

    NASA Astrophysics Data System (ADS)

    Lee, Inho; Han, Haksoo; Lee, Sang-Yup

    2010-04-01

    In this study, a biomimetic template was prepared and applied for growing calcium carbonate (CaCO 3) nanorods whose shape and polymorphism were controlled. A biomimetic template was prepared by adsorbing catalytic dipeptides into the pores of an anodic aluminum oxide (AAO) membrane. Using this peptide-adsorbed template, mineralization and aggregation of CaCO 3 was carried out to form large nanorods in the pores. The nanorods were aragonite and had a structure similar to nanoneedle assembly. This aragonite nanorod formation was driven by both the AAO template and catalytic function of dipeptides. The AAO membrane pores promoted generation of aragonite polymorph and guided nanorod formation by guiding the nanorod growth. The catalytic dipeptides promoted the aggregation and further dehydration of calcium species to form large nanorods. Functions of the AAO template and catalytic dipeptides were verified through several control experiments. This biomimetic approach makes possible the production of functional inorganic materials with controlled shapes and crystalline structures.

  9. Calcium-aluminum-silicate-hydrate “cement” phases and rare Ca-zeolite association at Colle Fabbri, Central Italy

    Microsoft Academic Search

    Francesco Stoppa; Fernando Scordari; Ernesto Mesto; Victor V. Sharygin; Giorgio Bortolozzi

    2010-01-01

    Very high temperature, Ca-rich alkaline magma intruded an argillite formation at Colle Fabbri, Central Italy, producing cordierite-tridymite\\u000a metamorphism in the country rocks. An intense Ba-rich sulphate-carbonate-alkaline hydrothermal plume produced a zone of mineralization\\u000a several meters thick around the igneous body. Reaction of hydrothermal fluids with country rocks formed calcium-silicate-hydrate\\u000a (CSH), i.e., tobermorite-afwillite-jennite; calcium-aluminum-silicate-hydrate (CASH) — “cement” phases - i.e., thaumasite,

  10. Elemental and isotopic fractionation of Type B calcium-, aluminum-rich inclusions: experiments, theoretical considerations, and constraints on their thermal evolution

    Microsoft Academic Search

    Frank M. Richter; Andrew M. Davis; Denton S. Ebel; Akihiko Hashimoto

    2002-01-01

    Experiments exposing Type B calcium-, aluminum-rich inclusion (CAI)-like melts at high temperatures to high vacuum or reducing hydrogen-rich gas mixtures were used to determine the rates and consequences of elemental and isotopic fractionation by evaporation. Silicon and magnesium were found to evaporate much faster than calcium and aluminum, and the resulting residual liquid trajectories in composition space are reproduced via

  11. Calcium and aluminum impacts on sugar maple physiology in a northern hardwood forest.

    PubMed

    Halman, Joshua M; Schaberg, Paul G; Hawley, Gary J; Pardo, Linda H; Fahey, Timothy J

    2013-11-01

    Forests of northeastern North America have been exposed to anthropogenic acidic inputs for decades, resulting in altered cation relations and disruptions to associated physiological processes in multiple tree species, including sugar maple (Acer saccharum Marsh.). In the current study, the impacts of calcium (Ca) and aluminum (Al) additions on mature sugar maple physiology were evaluated at the Hubbard Brook Experimental Forest (Thornton, NH, USA) to assess remediation (Ca addition) or exacerbation (Al addition) of current acidified conditions. Fine root cation concentrations and membrane integrity, carbon (C) allocation, foliar cation concentrations and antioxidant activity, foliar response to a spring freezing event and reproductive ability (flowering, seed quantity, filled seed and seed germination) were evaluated for dominant sugar maple trees in a replicated plot study. Root damage and foliar antioxidant activity were highest in Al-treated trees, while growth-associated C, foliar re-flush following a spring frost and reproductive ability were highest in Ca-treated trees. In general, we found that trees on Ca-treated plots preferentially used C resources for growth and reproductive processes, whereas Al-treated trees devoted C to defense-based processes. Similarities between Al-treated and control trees were observed for foliar cation concentrations, C partitioning and seed production, suggesting that sugar maples growing in native forests may be more stressed than previously perceived. Our experiment suggests that disruption of the balance of Ca and Al in sugar maples by acid deposition continues to be an important driver of tree health. PMID:24300338

  12. Calcium

    MedlinePLUS

    ... Consumer Datos en español Health Professional Other Resources Calcium Fact Sheet for Consumers What is calcium and what does it do? Calcium is a ... find out more about calcium? Disclaimer How much calcium do I need? The amount of calcium you ...

  13. Effect of calcium and aluminum concentrations on the survival of brown trout (Salmo trutta) at low pH

    SciTech Connect

    Brown, D.J.A.

    1983-01-01

    In this paper, the results of experiments to determine the survival times of yolk sac fry of brown trout (Salmo trutta) in a range of pHs, calcium and aluminium solutions are described, and the relevance of the results to the field situation is also discussed. In the absence of aluminum, mortalities occur at pH 4.5 only with 0.25 and 0.5 mg 1/sup -1/ of calcium. In solutions containing 0.25 mg 1/sup -1/ of aluminium, however, a complete range of responses is seen, from no or very low survival with 0.25 mg 1/sup -1/ of calcium to almost complete survival with 2.0 mg 1/sup -1/ of calcium. Solutions containing 0.5 mg 1/sup -1/ of aluminium lead to almost complete mortalities with calcium concentrations of 0.25 and 0.5 mg 1/sup -1/ and still significant mortalities at higher calcium concentrations. In general, the effect of pH throughout the range tested is not so marked, but there is a tendency for higher pHs to be more toxic especially in solutions containing 0.5 mg 1/sup -1/ of aluminium.

  14. Calcium

    MedlinePLUS

    ... of calcium dietary supplements are carbonate and citrate. Calcium carbonate is inexpensive, but is absorbed best when taken ... antacid products, such as Tums® and Rolaids®, contain calcium carbonate. Each pill or chew provides 200–400 mg ...

  15. Calcium

    MedlinePLUS

    ... you eat. Foods rich in calcium include Dairy products such as milk, cheese, and yogurt Leafy, green vegetables Fish with soft bones that you eat, such as canned sardines and salmon Calcium-enriched foods such as breakfast ... tofu. Check the product labels. The exact amount of calcium you need ...

  16. Calcium-aluminum-silicate-hydrate "cement" phases and rare Ca-zeolite association at Colle Fabbri, Central Italy

    NASA Astrophysics Data System (ADS)

    Stoppa, F.; Scordari, F.; Mesto, E.; Sharygin, V.; Bortolozzi, G.

    2010-06-01

    Very high temperature, Ca-rich alkaline magma intruded an argillite formation at Colle Fabbri, Central Italy, producing cordierite-tridymite metamorphism in the country rocks. An intense Ba-rich sulphate-carbonate-alkaline hydrothermal plume produced a zone of mineralization several meters thick around the igneous body. Reaction of hydrothermal fluids with country rocks formed calcium-silicate-hydrate (CSH), i.e., tobermorite-afwillite-jennite; calcium-aluminum-silicate-hydrate (CASH) — "cement" phases - i.e., thaumasite, strätlingite and an ettringite-like phase and several different species of zeolites: chabazite-Ca, willhendersonite, gismon-dine, three phases bearing Ca with the same or perhaps lower symmetry of phillipsite-Ca, levyne-Ca and the Ca-rich analogue of merlinoite. In addition, apophyllite-(KF) and/or apophyllite-(KOH), Ca-Ba-carbonates, portlandite and sulphates were present. A new polymorph from the pyrrhotite group, containing three layers of sphalerite-type structure in the unit cell, is reported for the first time. Such a complex association is unique. Most of these minerals are specifically related to hydration processes of: (1) pyrometamorphic metacarbonate/metapelitic rocks (natural analogues of cement clinkers); (2) mineralization between intrusive stocks and slates; and (3) high-calcium, alkaline igneous rocks such as melilitites and foidites as well as carbonatites. The Colle Fabbri outcrop offers an opportunity to study in situ complex crystalline overgrowth and specific crystal chemistry in mineral phases formed in igneous to hydrothermal conditions.

  17. SOURCE ASSESSMENT: MAJOR BARIUM CHEMICALS

    EPA Science Inventory

    This report summarizes data on air emissions from the production of major barium chemicals. Compounds studied include barium sulfide, barium carbonate, barium chloride, barium hydroxide, and barium sulfate. In order to evaluate potential environmental effects the source severity,...

  18. ORIGINAL PAPER Effects of soil calcium and aluminum on the physiology of balsam

    E-print Network

    carbohydrates Á Antioxidant enzyme activity Introduction The northeastern US has received considerable inputs and competes with Ca for plant uptake (Marschner 2012). Calcium is an essential plant nutrient, and Ca

  19. Growth of calcium-aluminum-rich inclusions by coagulation and fragmentation in a turbulent protoplanetary disk: observations and modelisation

    E-print Network

    Charnoz, S; Chaumard, N; Baillie, K; Tallifet, E

    2015-01-01

    Whereas it is generally accepted that calcium-aluminum-rich inclusions (CAIs) from chondritic meteorites formed in a hot environment in the solar protoplanetary disk, the conditions of their formation remain debated. Recent laboratory studies of CAIs have provided new kind of data: their size distributions. We show that size distributions of CAIs measured in laboratory from sections of carbonaceous chondrites have a power law size distribution with cumulative size exponent between -1.7 and -1.9, which translates into cumulative size exponent between -2.5 and -2.8 after correction for sectioning. To explain these observations, numerical simulations were run to explore the growth of CAIs from micrometer to centimeter sizes, in a hot and turbulent protoplanetary disk through the competition of coagulation and fragmentation. We show that the size distributions obtained in growth simulations are in agreement with CAIs size distributions in meteorites. We explain the CAI sharp cut-off of their size distribution at ...

  20. Microstructure characterization and micro- and nanoscale mechanical behaviour of magnesium-aluminum and magnesium-aluminum-calcium alloys

    NASA Astrophysics Data System (ADS)

    Han, Lihong

    The application in the automotive industry of the as-cast AM50 alloy (Mg-5.0 wt.%%Al-0.3 wt.%Mn) has been limited by its low creep resistance at elevated temperatures. Permanent mold cast (PM) Mg-Al-Ca alloys with calcium additions (0 ˜ 2.0 wt.%) were investigated in this study due to their potential for improving the high temperature creep strength. The microstructures of the die cast (DC) or PM AM50 alloys consisted of an intergranular beta-Mg17Al12 phase surrounded by a region of Al-rich eutectic alpha-Mg phase, sometimes with attached Al8Mn5 particles. In this study, significant grain refinement was observed in the PM Mg-Al-Ca alloys with Ca addition to the AM50 alloy. The grain refining effect was confirmed by quantitative image analysis through measurement of the secondary dendrite arm spacing (SDAS). The intergranular phases in Mg-Al-Ca alloys with 0.5 or 1.0 wt.% Ca were beta-Mg17Al 12 and (Al, Mg)2Ca phases. As the Ca addition was increased to 1.5 wt.% Ca, the (beta-Mg17Al12 phase was completely replaced by a (Al, Mg)2Ca phase. Differential scanning calorimetry (DSC) results showed that the (Al, Mg)2Ca phase was thermally more stable than the beta-Mg 17Al12 phase, which contributed to the better creep strength of the Mg-Al-Ca alloys. The change in heating/cooling rates played an important role in the redistribution of alloying elements and the dissolution or precipitation of the eutectic phases in the as-cast Mg alloys during DSC runs. The micro- and nano-scale hardness and composite modulus of the PM Mg-Al-Ca alloys increased with increasing Ca content, and the indentation size effect (ISE) was also observed in the as-cast Mg-Al and Mg-Al-Ca alloys. PM AC52 alloy (Mg-5.0wt.%Al-2.0wt.%Ca) was a much more creep resistant alloy than other Mg-Al-Ca alloys with lower Ca contents because of the higher solute content in the primary alpha-Mg in the as-cast state and also because of the presence of nano precipitates within the primary alpha-Mg. The size and volume fraction of the precipitates and the solute content within the primary alpha-Mg of the AC52 alloys were related to the different solidification rates, which directly influence the nano indentation creep strength of the alloys.

  1. Incorporation of Short-Lived Be in a Calcium-Aluminum

    E-print Network

    in meteorites are controversial: These isotopes can be pro- duced by nucleosynthesis in different stellar canonical abundance of aluminum-26 may still require seeding of the solar system by radioactive stellar with the destruction of these elements in stellar interiors by nuclear burning, accounts for the depleted cosmic

  2. Heat storage material comprising calcium chloride-hexahydrate and a nucleating agent

    SciTech Connect

    Gawron, K.; Schroder, J.

    1980-02-19

    The utility of calcium chloride-hexahydrate as a heat storage material is improved when barium carbonate, strontium carbonate, barium fluoride, barium fluoride-hydrofluoride and/or strontium fluoride is used as a nucleating agent to prevent supercooling.

  3. Calcium

    MedlinePLUS

    ... prevent falls in women, but not in men. Metabolic syndrome. Some evidence suggests that getting more calcium from ... vitamin D, might lower the risk of developing metabolic syndrome. Cancer. Research shows that healthy older women who ...

  4. Calcium phosphate sol-gel-derived coatings on titanium-aluminum-vanadium substrate for biomedical applications

    Microsoft Academic Search

    Lu Gan

    2003-01-01

    Osseointegration of implants to host bone is a necessary requirement for dental and orthopaedic implants. The rate and quality of osseointegration were enhanced through the use of calcium phosphate (Ca-P) films on metallic substrates. The present study investigates the characteristics of Ca-P films applied using sol-gel dip coating methods to sintered porous-surfaced implants. Ca-P films have been formed using Inorganic

  5. Calcium and aluminum cycling in a temperate broadleaved deciduous forest of the eastern USA: relative impacts of tree species, canopy state, and flux type.

    PubMed

    Levia, Delphis F; Shiklomanov, Alexey N; Van Stan, John T; Scheick, Carrie E; Inamdar, Shreeram P; Mitchell, Myron J; McHale, Patrick J

    2015-07-01

    Ca/Al molar ratios are commonly used to assess the extent of aluminum stress in forests. This is among the first studies to quantify Ca/Al molar ratios for stemflow. Ca/Al molar ratios in bulk precipitation, throughfall, stemflow, litter leachate, near-trunk soil solution, and soil water were quantified for a deciduous forest in northeastern MD, USA. Data were collected over a 3-year period. The Ca/Al molar ratios in this study were above the threshold for aluminum stress (<1). Fagus grandifolia Ehrh. (American beech) had a median annual stemflow Ca/Al molar ratio of 15.7, with the leafed and leafless values of 12.4 and 19.2, respectively. The corresponding Ca/Al molar ratios for Liriodendron tulipifera L. (yellow poplar) were 11.9 at the annual time scale and 11.9 and 13.6 for leafed and leafless periods, respectively. Bayesian statistical analysis showed no significant effect of canopy state (leafed, leafless) on Ca/Al molar ratios. DOC was consistently an important predictor of calcium, aluminum, and Ca/Al ratios. pH was occasionally an important predictor of calcium and aluminum concentrations, but was not a good predictor of Ca/Al ratio in any of the best-fit models (of >500 examined). This study supplies new data on Ca/Al molar ratios for stemflow from two common deciduous tree species. Future work should examine Ca/Al molar ratios in stemflow of other species and examine both inorganic and organic aluminum species to better gauge the potential for, and understand the dynamics of, aluminum toxicity in the proximal area around tree boles. PMID:26100445

  6. High-calcium flue gas desulfurization products reduce aluminum toxicity in an Appalachian soil

    SciTech Connect

    Wendell, R.R.; Ritchey, K.D. [USDA-ARS, Beaver, WV (United States)

    1996-11-01

    An acid Appalachian soil was amended with two flue gas desulfurization (FGD) by-products, one consisting of wallboard-quality gypsum (CaSO{sub 4}{center_dot}2H{sub 2}) and the other containing CaSO{sub 3}{center_dot}0.5H{sub 2}O as a major component. Soil columns treated with FGD by-products were leached with deionized H{sub 2}O under unsaturated conditions. Aluminum amounts leached increased 25-fold over the control when CaSO{sub 4}{center_dot}2H{sub 2}O FGD by-product was incorporated into the soil. Leachate pH decreased with FGD product treatment, but bulk soil pH increased, and exchangeable Al and total soil acidity decreased. Mean 4-d root lengths of sudangrass (Sorghum bicolor L. Moench) seedlings grown in the leached soils were as much as 440 and 310% the value of the control for CaSO{sub 3}{center_dot}0.5H{sub 2}O and CaSO{sub 4}{center_dot}2H{sub 2}O treatments, respectively. Mechanisms by which mitigation of Al toxicity occurs with addition of high-Ca FGD by-products to acid soils are discussed. 48 refs., 8 figs., 6 tabs.

  7. Calcium phosphate sol-gel-derived coatings on titanium-aluminum-vanadium substrate for biomedical applications

    NASA Astrophysics Data System (ADS)

    Gan, Lu

    Osseointegration of implants to host bone is a necessary requirement for dental and orthopaedic implants. The rate and quality of osseointegration were enhanced through the use of calcium phosphate (Ca-P) films on metallic substrates. The present study investigates the characteristics of Ca-P films applied using sol-gel dip coating methods to sintered porous-surfaced implants. Ca-P films have been formed using Inorganic Route and Organic Route processes. It has been shown that both approaches resulted in the formation of carbonated hydroxyapatite but with different Ca/P ratios as well as different surface textures and film structures, the Inorganic Route-formed film being more porous at its outermost surface, and having a more irregular topography. An interfacial reaction product (calcium titanium oxide) was detected for the Inorganic Route-formed coatings while this interfacial phase was not detectable in the Organic Route-formed coatings. The interface tensile and shear adhesion strength properties of Ca-P films have been evaluated using an improved direct pull-off testing (ASTM C633) and a substrate straining method, respectively. For both Ca-P films, the adhesive tensile strength was higher than the failure stress of ˜38 MPa occurring between the Ca-P films and the glue or in the glue. A shear lag approach revealed a shear strength of 347 +/- 64MPa and 280 +/- 28MPa for the Inorganic Route and the Organic Route Ca-P films, respectively. In vivo animal model studies have been performed to compare the effect on early bone formation of sintered porous-surfaced implants that had been modified through the addition of Ca-P film. In Group I study (i.e. Inorganic Route-formed Ca-P-coated implants vs. non-coated implants), it has been found that the Inorganic Route-formed Ca-P film significantly enhances the early rate of bone ingrowth for sintered porous-surfaced implants. However, in Group II study (i.e. Organic Route-formed Ca-P-coated implants vs. non-coated implants), significant improvement was not observed for the Organic Route-formed Ca-P film. It is speculated that the slightly different surface topography and film density between the two Ca-P films result in a different amounts of protein adsorption on the implant surface at the early stage, which further affects the following processes leading to osseointegration.

  8. Emission spectrographic determination of barium in sea water using a cation exchange concentration procedure

    USGS Publications Warehouse

    Szabo, B. J.; Joensuu, O.

    1967-01-01

    A concentration technique employing Dowex 50W cation exchange resin is described for the determination of barium in sea water. The separated barium is precipitated as fluoride together with calcium and strontium and measured by emission spectrographic analysis. The vertical distribution of barium in sea water has been measured in the Caribbean Sea and the Atlantic Ocean. The barium content varied between 7 and 23 ??g. per liter; in two profiles, the lowest concentrations were at a depth of about 1000 meters.

  9. Growth of calcium-aluminum-rich inclusions by coagulation and fragmentation in a turbulent protoplanetary disk: Observations and simulations

    NASA Astrophysics Data System (ADS)

    Charnoz, Sébastien; Aléon, Jérôme; Chaumard, Noël; Baillié, Kévin; Taillifet, Esther

    2015-05-01

    Whereas it is generally accepted that calcium-aluminum-rich inclusions (CAIs) from chondritic meteorites formed in a hot environment in the solar protoplanetary disk, the conditions of their formation remain debated. Recent laboratory studies of CAIs have provided new kind of data: their size distributions. We report that size distributions of CAIs measured in laboratory from sections of carbonaceous chondrites have a power law size distribution with cumulative size exponent between -1.7 and -1.9, which translates into cumulative size exponent between -2.5 and -2.8 after correction for sectioning. To explain these observations, numerical simulations were run to explore the growth of CAIs from micrometer to centimeter sizes, in a hot and turbulent protoplanetary disk through the competition of coagulation and fragmentation. We show that the size distributions obtained in growth simulations are in agreement with CAIs size distributions in meteorites. We explain the CAI sharp cut-off of their size distribution at centimeter sizes as the direct result from the famous fragmentation barrier, provided that CAI fragment for impact velocities larger than 10 m/s. The growth/destruction timescales of millimeter- and centimeter-sized CAIs is inversely proportional to the local dust/gas ratio and is about 10 years at 1300 K and up to 104 years at 1670 K. This implies that the most refractory CAIs are expected to be smaller in size owing to their long growth timescale compared to less refractory CAIs. Conversely, the least refractory CAIs could have been recycled many times during the CAI production era which may have profound consequences for their radiometric age.

  10. Constraints on formation processes of two coarse-grained calcium- aluminum-rich inclusions: a study of mantles, islands and cores

    USGS Publications Warehouse

    Meeker, G.P.

    1995-01-01

    Many coarse-grained calcium- aluminum-rich inclusions (CAIs) contain features that are inconsistent with equilibrium liquid crystallization models of origin. Spinel-free islands (SFIs) in spinel-rich cores of Type B CAIs are examples of such features. One model previously proposed for the origin of Allende 5241, a Type B1 CAI containing SFIs, involves the capture and assimilation of xenoliths by a liquid droplet in the solar nebula (El Goresy et al, 1985; MacPherson et al 1989). This study reports new textural and chemical zoning data from 5241 and identifies previously unrecognized chemical zoning patterns in the melilite mantle and in a SFI. -from Author

  11. Mineral interactions and absorption in the equine digestive tract: calcium, phosphorus, and magnesium interaction with aluminum, and calcium digestibility of alfalfa in ponies 

    E-print Network

    Kapusniak, Linda J.

    1987-01-01

    experimental support. Furthermore, insoluble mineral compounds within a feedstuff can limit mineral digestibility. A critical example has been the discovery of calcium oxalate crystals in alfalfa hay which appear resistant to ruminal digestion and account... as insoluble calcium oxalate, is included in this analysis of the plant and may not be available to the horse. In the grazing animal, mineral deficiencies and excesses in forages are often a result of shortages and surpluses found in the soils in which...

  12. Infrared Study of Superconductivity: Grating Coupled Plasmons in Yttrium BARIUM(2) COPPER(3) OXYGEN(7) and Gap Features in BARIUM(1-X) Potassium(x) Bismuth OXYGEN(3)

    Microsoft Academic Search

    Franklin John Dunmore

    1995-01-01

    The electrodynamic properties of two different superconductors, Barium Potassium Bismuth Oxide (BKBO) and Yttrium Barium Copper Oxide (YBCO) have been studied using the technique of transmission Fourier transform spectroscopy with liquid helium temperature bolometric detection. Plasmon resonances have been observed in far infrared transmission measurements on superconducting YBCO films. An Aluminum\\/Nichrome grating is used to couple infrared radiation to collective

  13. Effect of calcium on intermetallic compound layer at interface of calcium added magnesium–aluminum alloy and titanium joint by friction stir welding

    Microsoft Academic Search

    Masayuki Aonuma; Kazuhiro Nakata

    2010-01-01

    Commercial AMCa602 alloy (Mg–6% Al–2% Ca) and AM60 alloy (Mg–6% Al) were joined to titanium plates by friction stir welding to evaluate the effect of a calcium on the reaction layer at the dissimilar joint interface and the joint tensile strength. At the titanium and AM60 joint interface, a TiAl3 intermetallic compound layer was formed. The thickness of this layer

  14. Effects of aluminum and other cations on the structure of brain and liver chromatin

    SciTech Connect

    Walker, P.R.; LeBlanc, J.; Sikorska, M. (National Research Council of Canada, Ottawa, Ontario)

    1989-05-02

    The reactivity of aluminum and several other divalent and trivalent metallic cations toward chromatin from rat brain and liver has been investigated. Two criteria are used to determine the relative reactivity of these cations toward chromatin. The first involves the ability of the ions to compact the chromatin fibers to the point where chromatin precipitates. The second criterion measures the ability of cations to interfere with the accessibility of exogenous structural probes (nucleases) to chromatin. Of the divalent cations tested, nickel, cobalt, zinc, cadmium, and mercury were the most reactive toward chromatin, on the basis of their ability to induce precipitation of chromatin in the micromolar concentration range. The divalent cations magnesium, calcium, copper, strontium, and barium were much less effective, although all cations precipitate chromatin if their concentration is increased. Of the trivalent cations tested, aluminum indium, and gallium were very effective precipitants, whereas iron and scandium were without effect at the concentrations tested. Of all the cations tested, aluminum was the most reactive. Aluminum's ability to alter the structure of chromatin was investigated further by testing its ability to interfere with nuclease accessibility. This test confirmed that aluminum does induce considerable changes in chromatin structure at micromolar concentrations. Furthermore, chromatin from cortical areas of the brain was much more sensitive to aluminum than chromatin from liver. These results are discussed in light of the known toxicity of these cations, with particular emphasis on the possible role of aluminum in Alzheimer's disease.

  15. VS-501: A NOVEL, NON-ABSORBED, CALCIUM- AND ALUMINUM-FREE, HIGHLY EFFECTIVE PHOSPHATE BINDER DERIVED FROM NATURAL PLANT POLYMER.

    PubMed

    Wu-Wong, J Ruth; Chen, Yung-Wu; Gaffin, Robert; Hall, Andy; Wong, Jonathan T; Xiong, Joseph; Wessale, Jerry L

    2014-06-01

    Inadequate control of serum phosphate in chronic kidney disease can lead to pathologies of clinical importance. Effectiveness of on-market phosphate binders is limited by safety concerns and low compliance due to high pill size/burden and gastrointestinal discomfort. VS-501 is a non-absorbed, calcium- and aluminum-free, chemically-modified, plant-derived polymer. In vitro studies show that VS-501 has a high density and a low swell volume when exposed to simulated gastric fluid (vs. sevelamer). When male Sprague Dawley (SD) rats on normal diet were treated with VS-501 or sevelamer, serum phosphate was not significantly altered, but urinary phosphate levels decreased by >90%. VS-501 had no effect on serum calcium (Ca) or urinary Ca, while 3% sevelamer significantly increased serum and urine Ca. In 5/6 nephrectomized (NX) uremic SD rats on high-phosphate diet, increasing dietary phosphate led to an increase in serum and urine phosphate, which was prevented in rats treated with VS-501 or sevelamer (0.2-5% in food). High phosphate diet also increased serum FGF-23 and parathyroid hormone in 5/6 NX rats, which was prevented by VS-501 or sevelamer. VS-501 or sevelamer increased fecal phosphate in a dose-dependent manner. More aortic calcification was observed in 5/6 NX rats treated with 5% sevelamer, while VS-501 and sevelamer did not show significant effects on cardiac parameters, fibrosis, intestine histology and intestinal sodium-dependent phosphate cotransporter gene expression. These results suggest that VS-501 is effective in binding phosphate with no effects on calcium homeostasis, and may have improved pill burden and gastrointestinal side effects. PMID:25197556

  16. Effect of calcium and aluminum concentrations on the survival of brown trout ( Salmo trutta ) at low pH

    Microsoft Academic Search

    D. J. A. Brown

    1983-01-01

    Experimental evidence suggests that the two most important ions with respect to survival of fish at low pHs are calcium (BROWN 1981, 1982a and b; BROWN and LYNAM 1981) and aluminium (SCHOFIELD and TROJNAR 1980; BAKER and SCHOFIELD 1980, 1982). A minimal concentration of the former ion is necessary for survival, and in general, elevated concentrations of aluminium reduce survival.

  17. Salicylic acid alleviates aluminum toxicity in rice seedlings better than magnesium and calcium by reducing aluminum uptake, suppressing oxidative damage and increasing antioxidative defense.

    PubMed

    Pandey, Poonam; Srivastava, Rajneesh Kumar; Dubey, R S

    2013-05-01

    Aluminum toxicity is a major constraint to crop production in acid soils. The present study was undertaken to examine the comparative ameliorating effects of salicylic acid, Ca and Mg on Al toxicity in rice (Oryza sativa L.) seedlings grown in hydroponics. Al treatment (0.5 mM AlCl3) caused decrease in plant vigour, loss of root plasma membrane integrity, increased contents of O 2 (?-) , H2O2, lipid peroxidation, protein carbonyls and decline in the level of protein thiol. Al treatment caused significant changes in activity of antioxidative enzymes in rice seedlings. Exogenously added salicylic acid (60 ?M), Ca (1 mM) and Mg (0.25 mM) significantly alleviated Al toxicity effects in the seedlings marked by restoration of growth, suppression of Al uptake, restoration of root plasma membrane integrity and decline in O 2 (?-) , H2O2, lipid peroxidation and protein carbonyl contents. Salicylic acid, Ca and Mg suppressed Al-induced increase in SOD, GPX and APX activities while it elevated Al-induced decline in CAT activity. By histochemical staining of O 2 (?-) using NBT and H2O2 using DAB, it was further confirmed that added salicylic acid, Ca or Mg decreased Al-induced accumulation of O 2 (?-) and H2O2 in the leaf tissues. Results indicate that exogenously added salicylic acid, Ca or Mg alleviates Al toxicity in rice seedlings by suppressing Al uptake, restoring root membrane integrity, reducing ROS level and ROS induced oxidative damage and regulating the level of antioxidative enzyme activities. Further salicylic appears to be superior to Mg and Ca in alleviating Al toxicity effects in rice plants. PMID:23479061

  18. Temperature effects on non-bridging oxygen and aluminum coordination number in calcium aluminosilicate glasses and melts

    Microsoft Academic Search

    Jonathan F. Stebbins; Emily V. Dubinsky; Koji Kanehashi; Kimberly E. Kelsey

    2008-01-01

    Configurational changes with temperature are important for the thermodynamic and transport properties of most aluminosilicate melts, but in general are not well understood. Here, we present high-resolution 27Al and 17O NMR data on several calcium aluminosilicate glasses prepared with varying quench rates and thus with fictive temperatures that span ranges up to about 200K. In all compositions the content of

  19. Barium bright and heavy

    NASA Astrophysics Data System (ADS)

    Fromm, Katharina M.

    2013-02-01

    Katharina M. Fromm relates how barium and its ores went from a magical, glowing species that attracted witches and alchemists to components in a variety of compounds that are key parts of modern life.

  20. Quench Rate Studies of Aluminum Coordination and Oxygen Speciation in Calcium Aluminosilicate Glasses: Implications for Temperature Effects on the Structure of Aluminosilicate Melts

    NASA Astrophysics Data System (ADS)

    Dubinsky, E. V.; Stebbins, J. F.

    2006-12-01

    The atomic-scale structure of aluminosilicate glasses and melts is subject to temperature-induced rearrangement, which in turn controls variations in measurable thermodynamic properties. In order to investigate the effect of temperature on the structure of calcium aluminosilicate melts, we have used Al-27 MAS NMR, Al-27 3QMAS NMR, and O-17 MAS NMR to study fast- and slow-quenched calcium aluminosilicate glasses. Our previous work using O-17 3QMAS NMR to study lithium and sodium aluminosilicate glasses demonstrates disordering of bridging oxygen species with increasing sample fictive temperature, indicating temperature-induced rearrangement of framework units in the melt. Simple thermodynamic calculations using these results illustrate that while these structural changes may account for a portion of the experimentally-determined heat capacity of the melt, other modifications must occur to produce the observed temperature dependence of this property (Dubinsky and Stebbins 2006). The new data presented here allow us to observe changes in four-and five-coordinated aluminum and bridging and non- bridging oxygen (NBO) populations with fictive temperature in two calcium aluminosilicate glass compositions (CASx.y, where x=mol% Al2O3 and y=mol% SiO2) prepared by slow- and fast-quenching. We find that in CAS25.50 glasses, the percentage of five-coordinated Al per total Al increases from 7.6±1.9 to 9.4±2.4 and the percentage of NBO per total oxygen increases from 7.2±1.8 to 8.9±2.2 over a 150 to 200 degree fictive temperature interval. In CAS10.60 glasses representing a similar fictive temperature interval, we find that the percentage of five-coordinated Al per total Al increases from 4.0±1.0 to 4.9±1.2 and the percentage of non-bridging oxygen (NBO) per total oxygen increases from 22.8±2.3 to 23.0±2.3. Uncertainties in fitting procedures producing overlap in quantification of species in fast- and slow-quenched samples do not preclude the conclusion that robust changes in their relative proportions are visible in NMR spectra. Normalizing for sample composition, in both CAS25.50 and CAS10.60 glasses the increase in NBO over the studied fictive temperature interval exceeds the increase in five-coordinated Al, indicating that formation of these species is not necessarily coupled in a simple stoichiometric ratio. These results signify that complex structural changes involving high-coordinated Al and multiple high-coordinated oxygen species must be included in consideration of temperature effects on aluminosilicate melt structure.

  1. Factors controlling soil water and stream water aluminum concentrations after a clearcut in a forested watershed with calcium-poor soils

    USGS Publications Warehouse

    McHale, M.R.; Burns, D.A.; Lawrence, G.B.; Murdoch, P.S.

    2007-01-01

    The 24 ha Dry Creek watershed in the Catskill Mountains of southeastern New York State USA was clearcut during the winter of 1996-1997. The interactions among acidity, nitrate (NO3- ), aluminum (Al), and calcium (Ca2+) in streamwater, soil water, and groundwater were evaluated to determine how they affected the speciation, solubility, and concentrations of Al after the harvest. Watershed soils were characterized by low base saturation, high exchangeable Al concentrations, and low exchangeable base cation concentrations prior to the harvest. Mean streamwater NO3- concentration was about 20 ??mol l-1 for the 3 years before the harvest, increased sharply after the harvest, and peaked at 1,309 ??mol l -1 about 5 months after the harvest. Nitrate and inorganic monomeric aluminum (Alim) export increased by 4-fold during the first year after the harvest. Alim mobilization is of concern because it is toxic to some fish species and can inhibit the uptake of Ca2+ by tree roots. Organic complexation appeared to control Al solubility in the O horizon while ion exchange and possibly equilibrium with imogolite appeared to control Al solubility in the B horizon. Alim and NO3- concentrations were strongly correlated in B-horizon soil water after the clearcut (r2 = 0.96), especially at NO3- concentrations greater than 100 ??mol l-1. Groundwater entering the stream from perennial springs contained high concentrations of base cations and low concentrations of NO3- which mixed with acidic, high Alim soil water and decreased the concentration of Alim in streamwater after the harvest. Five years after the harvest soil water NO 3- concentrations had dropped below preharvest levels as the demand for nitrogen by regenerating vegetation increased, but groundwater NO3- concentrations remained elevated because groundwater has a longer residence time. As a result streamwater NO3- concentrations had not fallen below preharvest levels, even during the growing season, 5 years after the harvest because of the contribution of groundwater to the stream. Streamwater NO3- and Alim concentrations increased more than reported in previous forest harvesting studies and the recovery was slower likely because the watershed has experienced several decades of acid deposition that has depleted initially base-poor soils of exchangeable base cations and caused long-term acidification of the soil. ?? 2007 Springer Science+Business Media B.V.

  2. Ultra-low temperature processing of barium tellurate dielectrics

    NASA Astrophysics Data System (ADS)

    Kwon, Do-Kyun

    Ceramics, metals and polymers have unique electrical properties that are combined for electronic devices and systems. It necessitates lower processing temperatures for ceramics to be compatible with metal and polymer systems. In this thesis, the synthesis, crystal structure, and dielectric properties of barium tellurate are studied for temperatures between 500 and 900°C. Barium tellurate dielectric ceramics (BaTe4O9, BaTe 2O5, BaTe2O6, BaTeO3, BaTeO 4, and Ba2TeO5) are extensively investigated as new LTCC (Low-Temperature Cofired Ceramics) dielectric systems integrated with low resistivity metal electrodes such as silver and aluminum for microwave application. Studies on the phase formation and crystal structure through thermal analyses (Differential Scanning Calorimetry and Thermogravimetric Analysis, DSC-TGA) and X-ray diffraction phase analysis attest that barium tellurates are formed in the temperature range of 500 ˜ 900°C, through the sequential phase formations from Te-rich to Ba-rich phases. The oxygen coordination of the tellurium ion progresses from TeO4 to TeO6 via TeO 3+1 and TeO3 with increasing barium content as confirmed by structural analysis using infrared spectroscopy. High density barium tellurate ceramics are achieved at temperatures as low as 550°C, which provides the potential to be co-fired with low-melting aluminum metal electrodes in LTCC processing. Dielectric permittivity, loss, and temperature stability of barium tellurate dielectric ceramics were measured from 100 Hz to 13 GHz. Barium tellurate ceramics exhibit excellent microwave dielectric properties with intermediate dielectric permittivities and high quality factors (Q). The dielectric properties at microwave frequencies are epsilonr = 17.5, Qxf = 54700 GHz, TCf = -90 ppm/°C for BaTe4O9, epsilonr = 21, Qxf = 50300 GHz, TCf = -51 ppm/°C for BaTe2O6, epsilonr = 10, Qxf = 34000 GHz, TCf = -54 ppm/°C for BaTeO3, and epsilonr = 17, Qx f = 49600 GHz, TCf = -124 ppm/°C for Ba 2TeO5. Co-firing studies of barium tellurate ceramics with metal electrodes establish new LTCC systems for microwave devices. Chemical compatibility of barium tellurates with silver electrodes was achieved in the barium rich compositions. Ba2TeO5 was found to be covetable with silver electrodes at 850°C by adding CuO and B2O3 as fluxing agents. During the co-firing, a thin interfacial layer of AgTe is metastable according to the thermodynamic equilibrium between the Ba2TeO5-Ag/Ag 2O pseudo-binary system. A breakthrough LTCC technology with aluminum is based upon the ultra-low processing temperature and chemical compatibility of BaTe4O 9, which enables co-firing and fabrication of multilayer ceramic capacitors (MLCCs) with aluminum inner electrodes. The aluminum base metal electrode (BME) BaTe4O9 MLCCs provide good dielectric properties of epsilonr = 17.5, TCepsilon = 100 ppm/°C, and tan delta = 2.1 x 10-3 (Q ? 500) at 1 MHz, which are suitable for the class-1 MLCCs. Aluminum microstrip ring resonators on the BaTe4O9 substrates realized good electromagnetic performance of the new materials at microwave frequency exhibiting resonant frequency of 2.97 GHz and Q factor of 278.

  3. Semiconducting barium titanate

    Microsoft Academic Search

    W. Heywang

    1971-01-01

    Barium titanate, which is well known as a basic ferroelectric material, is also of interest when doped because of the interaction between semiconductivity and ferroelectricity. The resistance of blocking layers at surfaces and grain-boundaries is governed mainly by the ferroelectric properties, so that a resistance jump of four decades is observed on heating above the Curie temperature. A survey of

  4. Setting process of lime-based conservation mortars with barium hydroxide

    SciTech Connect

    Karatasios, Ioannis [Institute of Materials Science, NCSR Demokritos, Aghia Paraskevi, 153 10 Athens (Greece)]. E-mail: ikarat@ims.demokritos.gr; Kilikoglou, Vassilis [Institute of Materials Science, NCSR Demokritos, Aghia Paraskevi, 153 10 Athens (Greece); Colston, Belinda [Department of Forensic and Biomedical Sciences, University of Lincoln, Lincoln, LN6 7TS (United Kingdom); Theoulakis, Panagiotis [Department of Conservation of Antiquities and Works of Art, TEI of Athens, Athens, 122 10 (Greece); Watt, David [Hutton and Rostron Environmental Investigations Limited/Centre for Sustainable Heritage, University College London (United Kingdom)

    2007-06-15

    This paper presents the effect of barium hydroxide on the setting mechanism of lime-based conservation mortars, when used as an additive material. The study focuses on the monitoring of the setting process and the identification of the mineral phases formed, which are essential for furthering the study of the durability of barium mixtures against chemical degradation. X-ray diffraction analysis (XRD), scanning electron microscopy (SEM) and thermal analysis (DTA-TG) were used to monitor the setting processes of these mixtures and identify new phases formed. The results suggest that barium hydroxide is evenly distributed within the lime and produces a homogeneous binding material, consisting of calcite (CaCO{sub 3}), witherite (BaCO{sub 3}) and barium-calcium carbonate [BaCa(CO{sub 3}){sub 2}]. Finally, it was found that barium carbonate can be directly bonded to calcitic aggregates and therefore increases its chemical compatibility with the binding material.

  5. Silicosis in barium miners.

    PubMed Central

    Seaton, A; Ruckley, V A; Addison, J; Brown, W R

    1986-01-01

    Four men who mined barytes in Scotland and who developed pneumoconiosis are described. Three developed progressive massive fibrosis, from which two died; and one developed a nodular simple pneumoconiosis after leaving the industry. The radiological and pathological features of the men's lungs were those of silicosis and high proportions of quartz were found in two of them post mortem. The quartz was inhaled from rocks associated with the barytes in the mines. The features of silicosis in barium miners are contrasted with the benign pneumoconiosis, baritosis, that occurs in workers exposed to crushed and ground insoluble barium salts. Diagnostic difficulties arise when silicosis develops in workers mining minerals known to cause a separate and benign pneumoconiosis. These difficulties are compounded when, as not infrequently happens, the silicotic lesions develop or progress after exposure to quartz has ceased. Images PMID:3787542

  6. An Improved Qualitative Analysis Procedure for Aluminum Subgroup Cations.

    ERIC Educational Resources Information Center

    Kistner, C. R.; Robinson, Patricia J.

    1983-01-01

    Describes a procedure for the qualitative analysis of aluminum subgroup cations designed to avoid failure to obtain lead or barium chromate precipitates or failure to report aluminum hydroxide when present (due to staining). Provides a flow chart and step-by-step explanation for the new procedure, indicating significantly improved student results.…

  7. Properties of Semiconductive Barium Titanates

    Microsoft Academic Search

    Osamu Saburi

    1959-01-01

    The resistivity of barium titanate which is usually of the order of 109˜1012 ohm-cm, may be remarkably reduced with suitable control in valency. The valency-controlled barium titanate, whose resistivity is of the order of 10˜104 ohm-cm at room temperature, shows anomalous positive character in the temperature dependency of the resistivity. For example, the resistivity of barium titanate containing 0.1 mol.

  8. Barium Vanadate Microspheres

    NASA Astrophysics Data System (ADS)

    Yosinski, Shari; Tweeton, Landon; Feller, Steve; Affatigato, Mario

    2009-11-01

    It has been found that many glass powders can form micro- or nanospheres when heated in a flame or by a laser. Much of the research in this area of microspheres has concentrated on making hollow spheres, called microballoons, of silica and borosilicate glasses. Our aim was to create highly porous barium vanadate microspheres for possible future applications in material storage. The surface area of porous spheres would provide a greater amount of bonding surface area for dopants than hollow spheres. Barium vanadate glass with a molar fraction of 0.4 to 0.6 barium oxide was used because this glass is stable and has a low Tg. Size distributions of the spheres were quantified and the extent of sphere formation and porosity was examined using a scanning electron microscope. The size of spheres formed is affected by powder size, dropping method, and flame position. The porosity of the microspheres is affected by flame temperature, time spent in flame, and the material onto which the spheres fall. The greatest porosity was achieved by first heating the glass powder at a low temperature and then immediately sending it through the flames of two MAPP gas torches at approximately 2100^oC onto a metal sheet.

  9. 21 CFR 82.1051 - Lakes (D&C).

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ...radical sodium, potassium, aluminum, barium, calcium, strontium...color with the basic radical sodium, potassium, aluminum, barium, calcium, strontium...percent. Soluble chlorides and sulfates (as sodium salts), not more than...

  10. 21 CFR 82.1051 - Lakes (D&C).

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ...radical sodium, potassium, aluminum, barium, calcium, strontium...color with the basic radical sodium, potassium, aluminum, barium, calcium, strontium...percent. Soluble chlorides and sulfates (as sodium salts), not more than...

  11. 21 CFR 82.1051 - Lakes (D&C).

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ...radical sodium, potassium, aluminum, barium, calcium, strontium...color with the basic radical sodium, potassium, aluminum, barium, calcium, strontium...percent. Soluble chlorides and sulfates (as sodium salts), not more than...

  12. 21 CFR 82.1051 - Lakes (D&C).

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ...radical sodium, potassium, aluminum, barium, calcium, strontium...color with the basic radical sodium, potassium, aluminum, barium, calcium, strontium...percent. Soluble chlorides and sulfates (as sodium salts), not more than...

  13. Barium uranyl diphosphonates

    SciTech Connect

    Nelson, Anna-Gay D., E-mail: nelsoa@umich.edu [Department of Civil Engineering and Geological Sciences and Department of Chemistry and Biochemistry, University of Notre Dame, Notre Dame, IN 46556 (United States); Department of Earth and Environmental Sciences, University of Michigan, Ann Arbor, MI 48109-1005 (United States); Alekseev, Evgeny V. [Institute of Energy and Climate Research (IEK-6), Forschungszentrum Juelich Wilhelm-Johnen-Strasse, Juelich 52428 (Germany); Ewing, Rodney C. [Department of Earth and Environmental Sciences, University of Michigan, Ann Arbor, MI 48109-1005 (United States); Albrecht-Schmitt, Thomas E. [Department of Civil Engineering and Geological Sciences and Department of Chemistry and Biochemistry, University of Notre Dame, Notre Dame, IN 46556 (United States)

    2012-08-15

    Three Ba{sup 2+}/UO{sub 2}{sup 2+} methylenediphosphonates have been prepared from mild hydrothermal treatment of uranium trioxide, methylendiphosphonic acid (C1P2) with barium hydroxide octahydrate, barium iodate monohydrate, and small aliquots of HF at 200 Degree-Sign C. These compounds, Ba[UO{sub 2}[CH{sub 2}(PO{sub 3}){sub 2}]{center_dot}1.4H{sub 2}O (Ba-1), Ba{sub 3}[(UO{sub 2}){sub 4}(CH{sub 2}(PO{sub 3}){sub 2}){sub 2}F{sub 6}]{center_dot}6H{sub 2}O (Ba-2), and Ba{sub 2}[(UO{sub 2}){sub 2}(CH{sub 2}(PO{sub 3}){sub 2})F{sub 4}]{center_dot}5.75H{sub 2}O (Ba-3) all adopt layered structures based upon linear uranyl groups and disphosphonate molecules. Ba-2 and Ba-3 are similar in that they both have UO{sub 5}F{sub 2} pentagonal bipyramids that are bridged and chelated by the diphosphonate moiety into a two-dimensional zigzag anionic sheet (Ba-2) and a one-dimensional ribbon anionic chain (Ba-3). Ba-1, has a single crystallographically unique uranium metal center where the C1P2 ligand solely bridges to form [UO{sub 2}[CH{sub 2}(PO{sub 3}){sub 2}]{sup 2-} sheets. The interlayer space of the structures is occupied by Ba{sup 2+}, which, along with the fluoride ion, mediates the structure formed and maintains overall charge balance. - Graphical abstract: Illustration of the stacking of the layers in Ba{sub 3}[(UO{sub 2}){sub 4}(CH{sub 2}(PO{sub 3}){sub 2}){sub 2})F{sub 6}]{center_dot}6H{sub 2}O viewed along the c-axis. The structure is constructed from UO{sub 7} pentagonal bipyramidal units, U(1)O{sub 7}=gray, U(2)O{sub 7}=yellow, barium=blue, phosphorus=magenta, fluorine=green, oxygen=red, carbon=black, and hydrogen=light peach. Highlights: Black-Right-Pointing-Pointer The polymerization of the UO{sub 2}{sup 2+} sites to form uranyl dimers leads to structural variations in compounds. Black-Right-Pointing-Pointer Barium cations stitch uranyl diphosphonate anionic layers together, and help mediate structure formation. Black-Right-Pointing-Pointer HF acts as both a mineralizing agent and a ligand.

  14. Barium uranyl diphosphonates

    NASA Astrophysics Data System (ADS)

    Nelson, Anna-Gay D.; Alekseev, Evgeny V.; Ewing, Rodney C.; Albrecht-Schmitt, Thomas E.

    2012-08-01

    Three Ba2+/UO22+ methylenediphosphonates have been prepared from mild hydrothermal treatment of uranium trioxide, methylendiphosphonic acid (C1P2) with barium hydroxide octahydrate, barium iodate monohydrate, and small aliquots of HF at 200 °C. These compounds, Ba[UO2[CH2(PO3)2]·1.4H2O (Ba-1), Ba3[(UO2)4(CH2(PO3)2)2F6]·6H2O (Ba-2), and Ba2[(UO2)2(CH2(PO3)2)F4]·5.75H2O (Ba-3) all adopt layered structures based upon linear uranyl groups and disphosphonate molecules. Ba-2 and Ba-3 are similar in that they both have UO5F2 pentagonal bipyramids that are bridged and chelated by the diphosphonate moiety into a two-dimensional zigzag anionic sheet (Ba-2) and a one-dimensional ribbon anionic chain (Ba-3). Ba-1, has a single crystallographically unique uranium metal center where the C1P2 ligand solely bridges to form [UO2[CH2(PO3)2]2- sheets. The interlayer space of the structures is occupied by Ba2+, which, along with the fluoride ion, mediates the structure formed and maintains overall charge balance.

  15. Formation of ettringite, Ca 6Al 2(SO 4) 3(OH) 12·26H 2O, AFt, and monosulfate, Ca 4Al 2O 6(SO 4)·14H 2O, AFm-14, in hydrothermal hydration of Portland cement and of calcium aluminum oxide—calcium sulfate dihydrate mixtures studied by in situ synchrotron X-ray powder diffraction

    NASA Astrophysics Data System (ADS)

    Christensen, Axel Nørlund; Jensen, Torben R.; Hanson, Jonathan C.

    2004-06-01

    In the hydration of calcium aluminum oxide-gypsum mixtures, i.e., Ca 3Al 2O 6, Ca 12Al 14O 33 and CaSO 4·2H 2O, the reaction products can be ettringite, Ca 6Al 2(SO 4) 3(OH) 12·26H 2O, monosulfate, Ca 4Al 2O 6(SO 4)·14H 2O, or the calcium aluminum oxide hydrate, Ca 4Al 2O 7·19H 2O. Ettringite is formed if sufficient CaSO 4·2H 2O is present in the mixture. Ettringite is converted to monosulfate when all CaSO 4·2H 2O is consumed in the synthesis of ettringite. The reactions were investigated in the temperature range 25-170°C using in situ synchrotron X-ray powder diffraction. This technique allows the study of very fast chemical reactions that are observed here under hydrothermal conditions. A new experimental approach was developed to perform in situ mixing of the reactants during X-ray data collection.

  16. Discovery of the Barium Isotopes

    E-print Network

    A. Shore; A. Fritsch; J. Q. Ginepro; M. Heim; A. Schuh; M. Thoennessen

    2009-08-13

    Thirty-eight barium isotopes have so far been observed; the discovery of these isotopes is discussed. For each isotope a brief summary of the first refereed publication, including the production and identification method, is presented.

  17. Barium light source method and apparatus

    NASA Technical Reports Server (NTRS)

    Curry, John J. (Inventor); MacDonagh-Dumler, Jeffrey (Inventor); Anderson, Heidi M. (Inventor); Lawler, James E. (Inventor)

    2002-01-01

    Visible light emission is obtained from a plasma containing elemental barium including neutral barium atoms and barium ion species. Neutral barium provides a strong green light emission in the center of the visible spectrum with a highly efficient conversion of electrical energy into visible light. By the selective excitation of barium ionic species, emission of visible light at longer and shorter wavelengths can be obtained simultaneously with the green emission from neutral barium, effectively providing light that is visually perceived as white. A discharge vessel contains the elemental barium and a buffer gas fill therein, and a discharge inducer is utilized to induce a desired discharge temperature and barium vapor pressure therein to produce from the barium vapor a visible light emission. The discharge can be induced utilizing a glow discharge between electrodes in the discharge vessel as well as by inductively or capacitively coupling RF energy into the plasma within the discharge vessel.

  18. Uranium Sequestration by Aluminum Phosphate Minerals in Unsaturated Soils

    SciTech Connect

    Jerden, James L. Jr. [Argonne National Laboratory, 9700 South Cass Avenue, Argonne, IL, 60439 (United States)

    2007-07-01

    A mineralogical and geochemical study of soils developed from the unmined Coles Hill uranium deposit (Virginia) was undertaken to determine how phosphorous influences the speciation of uranium in an oxidizing soil/saprolite system typical of the eastern United States. This paper presents mineralogical and geochemical results that identify and quantify the processes by which uranium has been sequestered in these soils. It was found that uranium is not leached from the saturated soil zone (saprolites) overlying the deposit due to the formation of a sparingly soluble uranyl phosphate mineral of the meta-autunite group. The concentration of uranium in the saprolites is approximately 1000 mg uranium per kg of saprolite. It was also found that a significant amount of uranium was retained in the unsaturated soil zone overlying uranium-rich saprolites. The uranium concentration in the unsaturated soils is approximately 200 mg uranium per kg of soil (20 times higher than uranium concentrations in similar soils adjacent to the deposit). Mineralogical evidence indicates that uranium in this zone is sequestered by a barium-strontium-calcium aluminum phosphate mineral of the crandallite group (gorceixite). This mineral is intimately inter-grown with iron and manganese oxides that also contain uranium. The amount of uranium associated with both the aluminum phosphates (as much as 1.4 weight percent) has been measured by electron microprobe micro-analyses and the geochemical conditions under which these minerals formed has been studied using thermodynamic reaction path modeling. The geochemical data and modeling results suggest the meta-autunite group minerals present in the saprolites overlying the deposit are unstable in the unsaturated zone soils overlying the deposit due to a decrease in soil pH (down to a pH of 4.5) at depths less than 5 meters below the surface. Mineralogical observations suggest that, once exposed to the unsaturated environment, the meta-autunite group minerals react to form U(VI)- bearing aluminum phosphates. (author)

  19. Determination of Aluminum, Calcium, and Magnesium in Fraser Fir ( Abies fraseri) Foliage from Five Native Sites by Atomic Absorption Spectrometry: The Effect of Elevation upon Nutritional Status

    Microsoft Academic Search

    Chad E. Lee; Jeremy M. Cox; Derek M. Foster; Holly L. Humphrey; Royce S. Woosley; David J. Butcher

    1997-01-01

    The Fraser fir (Abies fraseri) is a conifer native to high elevation sites in the southern Appalachians that has recently suffered severe mortality because of an exotic insect, the balsam woolly adelgid (BWA). The companion tree of the Fraser fir, the red spruce (Piceae rubens) has suffered relatively mild decline induced by acidic deposition, due to reduction of extractable calcium

  20. Barium and iron abundances in red giants

    SciTech Connect

    Fernandez-Villacanas, J.L.; Rego, M.; Cornide, M. (Madrid Universidad Complutense (Spain))

    1990-06-01

    An intermediate-dispersion abundance analysis has been carried out on a sample of 21 barium and 14 comparison stars. The excess of barium over iron has been used as the most representative indicator of peculiarity. These excesses are higher in the peculiar stars than in the nonpeculiar stars. Particularly interesting is the case of HD 67447, included in the comparison stars, with an excess Ba/Fe abundance = 1.61, probably a new barium star. A trend indicating a possible anticorrelation between barium overabundance and metallicity favors the suggestion that the barium strong group is older than the barium weak one. 36 refs.

  1. Optimized photorefractive barium titanate

    NASA Astrophysics Data System (ADS)

    Warde, Cardinal; Jenssen, Hans P.

    1992-03-01

    The goal of this research program was to investigate new and modified crystal-growth techniques that would lead to high-optical-quality BaTiO3 with increased photorefractive speed and sensitivity. The research program consisted of four parts: (1) feed material purification; (2) crystal growth by the top-seeded-solution technique as well as by a barium borate flux technique; (3) new furnace design studies; and (4) photorefractive characterization experiments. Iron and nickel-doped BaTiO3 crystals were grown under the program. BaTiO3 is a promising photorefractive material due to its large electrooptic coefficient and excellent self-pumped phase conjugation. Our furnaces were limited by certain design and operating characteristics, and crystals grown in these furnaces were easily contaminated by the furnace itself. Two new furnaces, cylindrical and octagonal furnaces, were developed with commercially available parts that are cleaner, more mechanically reproducible, more uniform in temperature and more responsive to control action through reduced thermal mass. The two furnaces are equipped with precise computer control of the pulling and rotation system. The cylindrical furnace was found to be susceptible to cracking due to expansion when heated and to shrinkage after heating. To prevent cracking, expansion joints were provided and the insulation set was made of flat plates set up in an octagonal pattern.

  2. Aluminum: Reflective Aluminum Chips

    SciTech Connect

    Recca, L.

    1999-01-29

    This fact sheet reveals how the use of reflective aluminum chips on rooftops cuts down significantly on heat absorption, thus decreasing the need for air conditioning. The benefits, including energy savings that could reach the equivalent of 1.3 million barrels of oil annually for approximately 100,000 warehouses, are substantial.

  3. Interaction between Barium Oxide and Barium Containing Chloride Melt

    NASA Astrophysics Data System (ADS)

    Nikolaeva, Elena V.; Zakiryanova, Irina D.; Korzun, Iraida V.; Bovet, Andrey L.; Antonov, Boris D.

    2015-05-01

    Thermal analysis was applied to determine the liquidus temperatures in the NaCl-KCl-BaCl2-BaO system, with BaO concentration varied from 0 to 6 mole%. The temperature dependence of the BaO solubility in the NaCl-KCl-BaCl2 eutectic melt was investigated; the thermodynamic parameters of BaO dissolution were calculated. The caloric effects of melting of the NaCl-KCl-BaCl2 eutectic with barium oxide and barium oxychloride additions were studied. The type, morphology, and composition of oxychloride ionic groupings in the melt were determined in situ using Raman spectroscopy.

  4. Calcium supplements

    MedlinePLUS

    ... The two main forms of calcium pills are: Calcium carbonate: Over-the-counter antacid products, such as Tums and Rolaids contain calcium carbonate. These sources of calcium carbonate do not cost ...

  5. Barium Stars and Thermohaline Mixing

    SciTech Connect

    Husti, Laura [Dipartimento di Fisica Generale, Universita di Torino, Via Pietro Giuria 1, 10125 Turin (Italy)

    2008-01-24

    Barium stars are formed in binary systems through mass transfer from the carbon and s-element rich primary in the AGB phase, to the secondary star which is in a less evolved evolutionary stage. The mixing of the accreted material from the AGB donor with the envelope of the secondary results in a dilution of the s-element abundances. Dilution in red giants is explained by the occurence of the first dredge up, while in case of dwarfs thermohaline mixing would determine it. A comparison between the theoretical predictions of the AGB stellar models and the spectroscopical observations of a large sample of barium stars has been made. Dilution due to thermohaline mixing was taken into account when searching for best fits of the observational data. The importance of thermohaline mixing in barium dwarfs is discussed.

  6. Barium as a potential indicator of phosphorus in agricultural runoff.

    PubMed

    Ahlgren, Joakim; Djodjic, Faruk; Wallin, Mats

    2012-01-01

    In many catchments, anthropogenic input of contaminants, and in particular phosphorus (P), into surface water is a mixture of agricultural and sewage runoff. Knowledge about the relative contribution from each of these sources is vital for mitigation of major environmental problems such as eutrophication. In this study, we investigated whether the distribution of trace elements in surface waters can be used to trace the contamination source. Water from three groups of streams was investigated: streams influenced only by agricultural runoff, streams influenced mainly by sewage runoff, and reference streams. Samples were collected at different flow regimes and times of year and analyzed for 62 elements using ICP-MS. Our results show that there are significant differences between the anthropogenic sources affecting the streams in terms of total element composition and individual elements, indicating that the method has the potential to trace anthropogenic impact on surface waters. The elements that show significant differences between sources are strontium (p < 0.001), calcium (p < 0.004), potassium (p < 0.001), magnesium (p < 0.001), boron (p < 0.001), rhodium (p = 0.001), and barium (p < 0.001). According to this study, barium shows the greatest potential as a tracer for an individual source of anthropogenic input to surface waters. We observed a strong relationship between barium and total P in the investigated samples (R(2) = 0.78), which could potentially be used to apportion anthropogenic sources of P and thereby facilitate targeting of mitigation practices. PMID:22218189

  7. Comparison of Barium and Arsenic Concentrations in Well Drinking Water and in Human Body Samples and a Novel Remediation System for These Elements in Well Drinking Water.

    PubMed

    Kato, Masashi; Kumasaka, Mayuko Y; Ohnuma, Shoko; Furuta, Akio; Kato, Yoko; Shekhar, Hossain U; Kojima, Michiyo; Koike, Yasuko; Dinh Thang, Nguyen; Ohgami, Nobutaka; Ly, Thuy Bich; Jia, Xiaofang; Yetti, Husna; Naito, Hisao; Ichihara, Gaku; Yajima, Ichiro

    2013-01-01

    Health risk for well drinking water is a worldwide problem. Our recent studies showed increased toxicity by exposure to barium alone (?700 µg/L) and coexposure to barium (137 µg/L) and arsenic (225 µg/L). The present edition of WHO health-based guidelines for drinking water revised in 2011 has maintained the values of arsenic (10 µg/L) and barium (700 µg/L), but not elements such as manganese, iron and zinc. Nevertheless, there have been very few studies on barium in drinking water and human samples. This study showed significant correlations between levels of arsenic and barium, but not its homologous elements (magnesium, calcium and strontium), in urine, toenail and hair samples obtained from residents of Jessore, Bangladesh. Significant correlation between levels of arsenic and barium in well drinking water and levels in human urine, toenail and hair samples were also observed. Based on these results, a high-performance and low-cost adsorbent composed of a hydrotalcite-like compound for barium and arsenic was developed. The adsorbent reduced levels of barium and arsenic from well water in Bangladesh and Vietnam to <7 µg/L within 1 min. Thus, we have showed levels of arsenic and barium in humans and propose a novel remediation system. PMID:23805262

  8. Fictive Temperature Effects on Non-Bridging Oxygen and Five-Coordinated Aluminum in Calcium Aluminosilicate Glasses: High Resolution 17O and 27Al NMR Spectroscopy

    NASA Astrophysics Data System (ADS)

    Thompson, L. M.; Stebbins, J. F.

    2012-12-01

    Despite the importance of aluminosilicate melts to both the geological and technological communities, the configurational changes with temperature remain poorly understood. However, configurational changes with temperature play an important role in changes in thermodynamic and transport properties, as well as offering insight into potential relationships between minor structural species such as non-bridging oxygen (NBO) and VAl (AlO5). A previous study indicated changes in VAl with temperature in multiple calcium aluminosilicate glasses, while changes in NBO were only observed on the metaluminous join (Stebbins et al., 2008). Here we have expanded this to look at two series of calcium aluminosilicate glasses crossing the metaluminous join on a constant SiO2 isopleth at multiple fictive temperatures. In all cases, the amount of VAl present increased with increasing fictive temperature, although the magnitude of the increase varied with larger increases in the peraluminous regions versus the peralkaline earth regions. Increases in NBO are also observed with increasing fictive temperature in the metaluminous and peraluminous regions. Comparison of these results with those from the earlier study suggests that the changes may be most pronounced in the regions where the deviation from conventional wisdom are at their peak (e.g., in the metaluminous region of alkaline earth aluminosilicate glasses). Comparison of the increases in VAl and NBO with increasing fictive temperature support previous suggestions (Thompson and Stebbins 2011; Thompson and Stebbins 2012) that multiple mechanisms must exist to produce excess VAl and NBO and that at least some of these mechanisms must be decoupled from each other.

  9. Are There Any Stars Lacking Neutron-Capture Elements? Evidence from Strontium and Barium

    E-print Network

    Roederer, Ian U

    2012-01-01

    The cosmic dispersion in the abundances of the heavy elements strontium and barium in halo stars is well known. Strontium and barium are detected in most cool, metal-poor giants, but are these elements always detectable? To identify stars that could be considered probable candidates for lacking these elements, I examine the stellar abundance data available in the literature for 1148 field stars and 226 stars in dwarf galaxies, 776 of which have metallicities lower than [Fe/H]Strontium or barium have been detected in all field, globular cluster, and dwarf galaxy environments studied. All upper limits are consistent with the lowest detected ratios of [Sr/H] and [Ba/H]. The frequent appearance of these elements raises the intriguing prospect that at least one kind of neutron-capture reaction operates as often as the nucleosynthesis mechanisms that produce lighter elements, like magnesium, calcium, or iron, although the yields of heavy elements may be more variable.

  10. IEEE TRANSACTIONS ON MAGNETICS, VOL. 45, NO. 5, MAY 2009 2053 Magnetic and Dielectric Excitations in the W-Band in Aluminum

    E-print Network

    Srinivasan, Gopalan

    in the W-Band in Aluminum Substituted Barium and Strontium Hexaferrites Maksym A. Popov1;2, Igor V, Ukraine Moscow Power Engineering Institute, Moscow 111250, Russia Single crystal strontium and barium forward volume waves and dielectric resonances in such ferrites. Data on the mode frequencies were

  11. A comparison of the calcium-free phosphate binder sevelamer hydrochloride with calcium acetate in the treatment of hyperphosphatemia in hemodialysis patients

    Microsoft Academic Search

    Anthony J. Bleyer; Steven K. Burke; Maureen Dillon; Bruce Garrett; K. Shashi Kant; David Lynch; S. Noor Rahman; Patricia Schoenfeld; Isaac Teitelbaum; Steven Zeig; Eduardo Slatopolsky

    1999-01-01

    Current phosphate binders used in hemodialysis patients include calcium-based binders that result in frequent hypercalcemia and aluminum-based binders that result in total body aluminum accumulation over time. This investigation describes the use of a calcium- and aluminum-free phosphate-binding polymer in hemodialysis patients and compares it with a standard calcium-based phosphate binder. An open-label, randomized, crossover study was performed to evaluate

  12. INDEX TO VOLUME 154 This index covers both the Initial Reports and Scientific Results portions of Vol-

    E-print Network

    aluminum inorganic sediments, B:509­516 vs. calcium, B:517 vs. potassium, B:517 vs. silicon, B:517 vs. titanium, B:517 See also barium/aluminum ratio; calcium/aluminum ratio; phosphorus/aluminum ratio; potassium/aluminum ratio; silicon/aluminum ratio; titanium/aluminum ratio aluminum oxide geochemical logs, A

  13. Barium-induced skeletal muscle paralysis in the rat, and its relationship to human familial periodic paralysis

    Microsoft Academic Search

    G. D. Schott; B. McArdle

    1974-01-01

    An in vivo study of skeletal muscle paralysis induced by intravenous barium chloride has been made in curarized and non-curarized rats. The influence of potassium and calcium chlorides, propranolol, ouabain, and prior adrenalectomy on the paralysis has also been studied. Paralysis is found to be due to a direct effect on skeletal muscle, and to correlate well with the development

  14. Calcium Carbonate

    MedlinePLUS

    Calcium carbonate is a dietary supplement used when the amount of calcium taken in the diet is not ... for healthy bones, muscles, nervous system, and heart. Calcium carbonate also is used as an antacid to relieve ...

  15. Aluminum Boats

    NSDL National Science Digital Library

    2012-06-26

    Test the buoyancy of an aluminum foil boat and an aluminum foil ball. Why does the same material in different shapes sink or float? This activity explores the fact that the amount of water pushed aside by an object equals the force of water pushing upward on the object.

  16. REMOVAL OF BARIUM AND RADIUM FROM GROUNDWATER

    EPA Science Inventory

    A research project was undertaken to investigate processes for removing barium and radium from drinking water. Special emphasis was placed on ion exchange processes that can be used without adding large concentrations of sodium to the water. The wastes from radium and barium remo...

  17. Quantum manipulation on the Barium quadrupolar transition

    E-print Network

    Blatt, Rainer

    and stabilization of a new fiber laser system to ma- nipulate the Barium quadrupolar transition, with the aim . . . . . . . . . . . . . . . 55 6 Spectroscopy and sideband cooling on a single 138 Ba+ 58 6.1 Quantum jumps using the fiber laser . . . . . . . . . . . . .Quantum manipulation on the Barium quadrupolar transition A diploma thesis in physics submitted

  18. INDEX TO VOLUME 154 This index covers both the Initial Reports and Scientific Results portions of Vol-

    E-print Network

    . depth, A:103, 184, 256, 305, 381 aluminum inorganic sediments, B:509­516 vs. calcium, B:517 vs. potassium, B:517 vs. silicon, B:517 vs. titanium, B:517 See also barium/aluminum ratio; calcium/aluminum ratio; phosphorus/aluminum ratio; potassium/aluminum ratio; silicon/aluminum ratio; titanium/aluminum

  19. NTP Toxicology and Carcinogenesis Studies of Barium Chloride Dihydrate (CAS No. 10326-27-9) in F344/N Rats and B6C3F1 Mice (Drinking Water Studies).

    PubMed

    1994-01-01

    Barium chloride dihydrate, a white crystalline granule or powder, is used in pigments, aluminum refining, leather tanning and coloring, the manufacture of magnesium metal, ceramics, glass, and paper products, as a pesticide, and in medicine as a cardiac stimulant. Toxicology and carcinogenicity studies were conducted by administering barium chloride dihydrate (99% pure) in drinking water to F344/N rats and B6C3F1 mice for 15 days, 13 weeks, and 2 years. Genetic toxicology studies were conducted in Salmonella typhimurium, cultured Chinese hamster ovary cells, and mouse lymphoma cells. 15-DAY STUDY IN RATS: Groups of five males and five females received barium chloride dihydrate in the drinking water at concentrations of 0, 125, 250, 500, 1,000, or 2,000 ppm for 15 days, corresponding to average daily doses of 10, 15, 35, 60, or 110 mg barium/kg body weight to males and females. No chemical-related deaths, differences in final mean body weights, or clinical findings of toxicity were observed. Water consumption by male and female rats exposed to 2,000 ppm was slightly less (S16%) than controls during week 2. There were no significant differences in absolute or relative organ weights between exposed and control rats. No biologically significant differences in hematology, clinical chemistry, or neurobehavioral parameters occurred in rats. 15-DAY STUDY IN MICE: Groups of five males and five females received barium chloride dihydrate in the drinking water at concentrations of 0, 40, 80,173, 346, or 692 ppm for 15 days, corresponding to average daily doses of 5,10, 20, 40, or 70 mg barium/kg body weight to males and 5, 10, 15, 40, or 85 mg barium/kg body weight to females. No chemical-related deaths, differences in mean body weights or in water consumption, or clinical findings of toxicity were observed in mice. The relative liver weight of males receiving 692 ppm was significantly greater than that of the controls. The absolute and relative liver weights of females that received 692 ppm were significantly greater than those of the controls. No histopathologic evidence of toxicity was observed in mice. 13-WEEK STUDY IN RATS: Groups of 10 males and 10 females received barium chloride dihydrate in the drinking water at concentrations of 0, 125, 500, 1,000, 2,000, or 4,000 ppm for 13 weeks, corresponding to average daily doses of 10, 30, 65, 110, or 200 mg barium/kg body weight to males and 10, 35, 65, 115, or 180 mg barium/kg body weight to females. Three males and one female in the 4,000 ppm groups died during the last week of the study. The final mean body weights of male and female rats receiving 4,000 ppm were significantly lower (13% and 8%) than those of the controls. Water consumption by male and female rats in the 4,000 ppm groups was approximately 30% lower than that by the controls. No clearly chemical-related clinical findings of toxicity or neurobehavioral or cardiovascular effects were noted. Serum phosphorus levels in 2,000 and 4,000 ppm male and female rats were significantly higher than those in controls, but there were no biologically significant differences in hematology parameters or in serum sodium, potassium, or calcium levels. Renal tubule dilatation in the outer stripe of the outer medulla and cortex occurred in male and female rats receiving 4,000 ppm. 13-WEEK STUDY IN MICE: Groups of 10 males and 10 females received barium chloride dihydrate in the drinking water at concentrations of 0, 125, 500, 1,000, 2,000, or 4,000 ppm for 13 weeks, corresponding to average daily doses of 15, 55, 100, 205, or 450 mg barium/kg body weight to males and 15, 60, 110, 200, or 495 mg barium/kg body weight to females. Six males and seven females that received 4,000 ppm and one male that received 125 ppm died during the study. Final mean body weights of male and female mice receiving 4,000 ppm were significantly lower (>30%) than those of controls. Water consumption by male mice in the 4,000 ppm group was 18% lower than that by the controls; water consumption by other exposed groups of male and female mice was similar to th

  20. Aluminum Contamination in Parenteral Nutrition Admixtures for Low-Birth-Weight Preterm Infants in Mexico.

    PubMed

    Lima-Rogel, Victoria; Romano-Moreno, Silvia; de Jesús López-López, Esperanza; de Jesús Escalante-Padrón, Francisco; Hurtado-Torres, Gilberto Fabian

    2014-09-16

    Background: Aluminum contamination from intravenous solutions still represents an unsolved clinical and biochemical problem. Increased aluminum intake constitutes a risk factor for the development to metabolic bone disease, anemia, cholestasis, and neurocognitive alterations. Low-birth-weight preterm infants (LBWPIs) are one of the most exposed populations for aluminum toxicity. Methods: To determine the presence of aluminum in components employed in the preparation of parenteral nutrition (PN) admixtures in Mexico and compare with the maximal aluminum recommended intake from the Food and Drug Administration. Results: Cysteine, trace elements, levocarnitine, phosphate, and calcium salts tested positive for aluminum contamination. All components analyzed were contained in glass vials. Total aluminum intake for 2 sample PN admixtures were calculated in basis to cover nutrition requirements of 2 hypothetical LBWPIs. Aluminum contents, stratified in micrograms per kilogram of weight, exceeded maximal aluminum recommendations, particularly for the very LBWPIs. Substituting sodium phosphate for potassium phosphate salts reduced aluminum intake by 52.7%. Calcium gluconate was the leading aluminum contamination source and confers the greatest risk for aluminum overdose, even with the salt substitution of potassium phosphate by sodium phosphate salts. Adding cysteine and trace elements might increase aluminum content in PN admixtures. Conclusion: Cysteine, trace elements, phosphate, and gluconate salts are the main sources of aluminum in PN prepared in Mexico. Substituting sodium phosphate for potassium phosphate salts reduces aluminum intake but does not resolve aluminum contamination risk. Mineral salts contained in plastic vials should be explored as an additional measure to reduce aluminum contamination. PMID:25227670

  1. Aluminum Analysis.

    ERIC Educational Resources Information Center

    Sumrall, William J.

    1998-01-01

    Presents three problems based on the price of aluminum designed to encourage students to be cooperative and to use an investigative approach to learning. Students collect and synthesize information, analyze results, and draw conclusions. (AIM)

  2. Electric field tunable 60 GHz ferromagnetic resonance response in barium ferrite-barium strontium titanate multiferroic heterostructures

    E-print Network

    Patton, Carl

    Electric field tunable 60 GHz ferromagnetic resonance response in barium ferrite-barium strontium barium strontium titanate films on Nb-doped strontium titanate substrates were capped with an unbonded comprised of a nominal 7 m thick yttrium iron garnet YIG film in contact with a 500 m thick barium strontium

  3. Distribution and source of barium in ground water at Cattaraugus Indian Reservation, southwestern New York

    USGS Publications Warehouse

    Moore, R.B.; Staubitz, W.W.

    1984-01-01

    High concentrations of dissolved barium have been found in ground water from bedrock wells on the Seneca Nation of Indians Reservation on Cattaraugus Creek in southwestern New York. Concentrations in 1982 were as high as 23.0 milligrams per liter , the highest found reported from any natural ground-water system in the world. The highest concentrations are in a bedrock aquifer and in small lenses of saturated gravel between bedrock and the overlying till. The bedrock aquifer is partly confined by silt, clay, and till. The high barium concentrations are attributed to dissolution of the mineral barite (BaSO4), which is present in the bedrock and possibly in overlying silt, clay, or till. The dissolution of barite seems to be controlled by action of sulfate-reducing bacteria, which alter the BaSO4 equilibrium by removing sulfate ions and permitting additional barite to dissolve. Ground water from the surficial, unconsolidated deposits and surface water in streams contain little or no barium. Because barium is chemically similar to calcium, it probably could be removed by cation exchange or treatments similar to those used for water softening. (USGS)

  4. Barium ions for quantum computation

    NASA Astrophysics Data System (ADS)

    Dietrich, Matthew

    Barium ion is investigated as a hyperfine qubit. 137Ba + is trapped in a linear Paul trap and laser cooled. Isotope selective photoionization is employed to improve trapping from an isotopically inpure source. Optical pumping into the magnetically insensitive 2S 1/2(F=2) mF = 0 state is shown, and readout by electron shelving into the 2D5/2 is demonstrated both directly and by adiabatic passage. Rabi flops between the 2S1/2 F=1 and F=2 states is accomplished by exposure to 8.037 GHz microwave radiation. Several methods of locking the cooling lasers have been attempted and are discussed. Stabilization of the infrared laser used to drive the D 5/2 ? S1/2 transition is of particular interest, and several novel technologies are tested in this purpose.

  5. Barium Ions for Quantum Computation Matthew Dietrich

    E-print Network

    Blinov, Boris

    Barium Ions for Quantum Computation Matthew Dietrich A dissertation submitted in partial for Quantum Computation Matthew Dietrich Chair of the Supervisory Committee: Assistant Professor Boris Blinov trap and laser cooled. Isotope selective photoionization is employed to improve trapping from

  6. Dielectric and Piezoelectric Properties of Barium Titanate

    Microsoft Academic Search

    Shepard Roberts

    1947-01-01

    The dielectric constant and loss of barium titanate and barium-strontium titanate have been measured at biasing field strengths from 0 to 5 megavolts per meter, at temperatures from -50°C to +135°C and at frequencies from 0.1 to 25 megacycles. The measurements versus temperature indicate the expected agreement with the Curie-Weiss law at temperatures above the Curie point. Measurements versus field

  7. Regeneration of barium carbonate from barium sulphide in a pilot-scale bubbling column reactor and utilization for acid mine drainage.

    PubMed

    Mulopo, J; Zvimba, J N; Swanepoel, H; Bologo, L T; Maree, J

    2012-01-01

    Batch regeneration of barium carbonate (BaCO(3)) from barium sulphide (BaS) slurries by passing CO(2) gas into a pilot-scale bubbling column reactor under ambient conditions was used to assess the technical feasibility of BaCO(3) recovery in the Alkali Barium Calcium (ABC) desalination process and its use for sulphate removal from high sulphate Acid Mine Drainage (AMD). The effect of key process parameters, such as BaS slurry concentration and CO(2) flow rate on the carbonation, as well as the extent of sulphate removal from AMD using the recovered BaCO(3) were investigated. It was observed that the carbonation reaction rate for BaCO(3) regeneration in a bubbling column reactor significantly increased with increase in carbon dioxide (CO(2)) flow rate whereas the BaS slurry content within the range 5-10% slurry content did not significantly affect the carbonation rate. The CO(2) flow rate also had an impact on the BaCO(3) morphology. The BaCO(3) recovered from the pilot-scale bubbling column reactor demonstrated effective sulphate removal ability during AMD treatment compared with commercial BaCO(3). PMID:22233912

  8. Aluminum Pannier

    USGS Multimedia Gallery

    This aluminum pannier was made for the storage of meat, vegetables and other food products. The pannier could be buried in the ground or placed in water in order to keep the contents cool. It was designed by Dr. J. D. Love and made for him in 1945. For transportation, this pannier, along with two re...

  9. Functional Properties of Cardiac L-Type Calcium Channels Transiently Expressed in HEK293 Cells Roles of oLi and f3 Subunits

    Microsoft Academic Search

    TIMOTHY J. KAMP; EDUARDO MARB

    The cardiac dihydropyridine-sensitive calcium channel was transiently expressed in HEK293 cells by transfecting the rabbit cardiac calcium channel al subunit (alc) alone or in combination with the rabbit calcium channel 13 subunit cloned from skeletal muscle. Transfection with ~1c alone leads to the expression of inward, voltage-activated, calcium or barium currents that exhibit dihydropyridine sensitivity and voltage- as well as

  10. The solubility and thermodynamic properties of ettringite, its chromium analogs, and calcium aluminum monochromate (3CaO*Al(2)O(3)*CaCrO(4)*nH(2)O)

    NASA Astrophysics Data System (ADS)

    Perkins, Robert Benjamin

    Ettringite (Ca6[(Al(OH)6)]2(SO 4)3·26H2O) is a naturally-occurring mineral and an important product of the hydration of Portland cements and fly ash. Substitution of Cr(III) for Al(III) and CrO4 for SO4 in the ettringite structure has been demonstrated and may be important with respect to the fate and transport of chromium in alkaline environments. Ettringite and its chromium analogs were synthesized and their solubilities measured via dissolution and precipitation experiments over a range of temperatures between 5 and 75°C and pH values between 10 and 13. The log KSP,298 for the reaction Ca6AlOH 62SO 43?26H2O =6Ca2++2AlOH -4 +3SO 2-4 +4OH-+26H2O is -44.9 +/- 0.3. The enthalpy and entropy of reaction are 205 +/- 12 kJ mol-1 and 170 +/- 38 J mol -1 K-1, respectively. The free energy, enthalpy, and entropy of formation are -15211 +/- 20, -17550 +/- 16 kJ mol-1, and 1870 +/- 59 J mol -1 K-1, respectively, based on the reaction parameters and partial molar properties for the dissolved ions. The log KSP, free energy, and enthalpy of reaction for the Cr(III) ettringite analog, bentorite, are KSP,298 = -52.9 +/- 0.8, DeltaG°r,298 = 302 +/- 10 and DeltaH°r = 320 +/- 76 kJ mol-1 based on an equivalent dissolution reaction. Dissolution of bentorite is incongruent due to precipitation of another phase tentatively identified as Ca2Cr2O5·8H 2O. The log KSP, free energy and enthalpy of reaction for the dissolution of Ca6[(Al(OH)6)]2(CrO4 )3·26H2O are KSP,298 = -41.46 +/- 0.30, DeltaG°r,298 = 236.6 +/- 3.9 and DeltaH°r = 77.5 +/- 9.6 kJ mol-1. The log KSP varies with pH unless a CaCrO4(aq) complex is included in the speciation model. A log formation constant of K = 2.77 +/- 0.16 was obtained for the reaction Ca2+ + CrO42- = CaCrO 4(aq) by minimizing the variance of the IAP for Ca6[(Al(OH) 6)]2(CrO4)3·26H2O. A secondary precipitate, identified as calcium aluminum monochromate or (3CaO·Al2O3·CaCrO4·nH 2O) was present in Cr(VI)-analog experimental residues. The log K SP for the reaction 3CaO?Al2O3?CaCrO4 ?15H2O=4Ca2++2AlOH -4 + CrO42-+4OH-+ 9H2O is -30.38 +/- 0.28. Ca6[(Al(OH)6)]2(SO4(1-x) , CrO4x)3·26H2O solids were synthesized and solid-solution aqueous-solution interactions were investigated through dissolution pathway studies. Although thermodynamic equilibrium was not achieved, dissolution pathways approximated stoichiometric saturation curves when plotted on Lippman diagrams.

  11. Effect of calcium silicate substrate on thermal

    Microsoft Academic Search

    Robert H. White

    A recent revision of the ICBO building code specified the use of a calcium silicate substrate in the fire testing of thermal barriers for foam plastics. Twelve small-scale vertical ASTM E 119 fire exposure tests were conducted on specimens of 1\\/2-inch gypsum board or 5\\/8-inch plywood as the thermal barrier and 1\\/2-inch calcium silicate board or l-inch aluminum foil-faced foam

  12. Spatiotemporal distribution of airborne elements monitored with the moss bags technique in the Greater Thriasion Plain,

    E-print Network

    Palmer, Michael W.

    . Heavy metals . Sodium . Aluminum . Chlorine . Calcium . Scandium . Titanium . Vanadium . Chromium, USA #12;Strontium . Molybdenum . Antimony. Iodine . Barium . Lanthanum . Mercury. Uranium Introduction

  13. Temperature-dependent coherent oscillation in photorefractive relaxor strontium barium

    E-print Network

    Osnabrück, Universität

    Temperature-dependent coherent oscillation in photorefractive relaxor strontium barium niobate M of the photorefractive light-induced scattering (beam fanning) in Sr0.61Ba0.39Nb2O6 (strontium barium niobate) doped

  14. Preparation and Properties of Barium Titanate Nanopowder\\/Epoxy Composites

    Microsoft Academic Search

    J. Chandradass; Dong-sik Bae

    2008-01-01

    This article is focused on the preparation of barium titanate nanopowder\\/epoxy composites and studying the effect of barium titanate nanopowder on improving mechanical and thermal characteristics of the epoxy polymer. Composites are prepared by dispersing barium titanate nanopowder in epoxy resin and, subsequently, cross-linking by using diamino diphenyl methane (DDM) curing agents. Synthesis of barium titanate nanopowder\\/epoxy composites is carried

  15. Noradrenaline, somatostatin and opioids inhibit activity of single HVA\\/N-type calcium channels in excised neuronal membranes

    Microsoft Academic Search

    K.-Z. Shen; A. Surprenant

    1991-01-01

    Unitary barium currents were measured in outside-out patches of membrane from acutely dissociated guinea-pig submucosal neurones. A single set of HVA\\/N-like calcium channels with unitary conductance in 110 mM barium of approximately 10 pS was activated by depolarization; channel activity did not show inactivation during 100 ms duration depolarizing pulses. Somatostatin, [Met5]enkephalin and a2-adrenoceptor agonists, which are known to partially

  16. Molecular Structure of Calcium Monoxide

    NSDL National Science Digital Library

    2003-06-03

    Calcium Oxide is a caustic white solid sparingly soluble in water; the commercial form is prepared by roasting calcium carbonate limestone in kilns until all the carbon dioxide is driven off. Calcium oxide is also known as burnt lime or caustic lime. This lime was used in glass production. Its ability to work with silicates is also used in modern metal production (steel, magnesium, aluminum, and other non-ferrous metals) industries to remove impurities as slag. It is also used in water and sewage treatment to reduce acidity; in agriculture to improve acid soils; and in pottery, concrete, paints and the food industry (pH adjuster for ice milk mix, dietary Supplements, dough conditioner, and yeast food).

  17. 21 CFR 82.2051 - Lakes (Ext. D&C).

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ...combined the basic radical sodium, potassium, barium, or...color with the basic radical sodium, potassium, aluminum, barium, calcium, strontium...percent. Soluble chlorides and sulfates (as sodium salts), not more than...

  18. 21 CFR 82.2051 - Lakes (Ext. D&C).

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ...combined the basic radical sodium, potassium, barium, or...color with the basic radical sodium, potassium, aluminum, barium, calcium, strontium...percent. Soluble chlorides and sulfates (as sodium salts), not more than...

  19. 21 CFR 82.2051 - Lakes (Ext. D&C).

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ...combined the basic radical sodium, potassium, barium, or...color with the basic radical sodium, potassium, aluminum, barium, calcium, strontium...percent. Soluble chlorides and sulfates (as sodium salts), not more than...

  20. 21 CFR 82.2051 - Lakes (Ext. D&C).

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ...combined the basic radical sodium, potassium, barium, or...color with the basic radical sodium, potassium, aluminum, barium, calcium, strontium...percent. Soluble chlorides and sulfates (as sodium salts), not more than...

  1. Recycling of automotive aluminum

    Microsoft Academic Search

    Jirang CUI; Hans J. ROVEN

    2010-01-01

    With the global warming of concern, the secondary aluminum stream is becoming an even more important component of aluminum production and is attractive because of its economic and environmental benefits. In this work, recycling of automotive aluminum is reviewed to highlight environmental benefits of aluminum recycling, use of aluminum alloys in automotive applications, automotive recycling process, and new technologies in

  2. Improved spectrophotometric analysis of barium styphnate

    SciTech Connect

    Brown, N E; Blasi, J A

    1983-01-01

    A spectrophotometric procedure to determine the purity of barium styphnate monohydrate based upon the absorbance of the styphnate ion at 326 and 413.3 nm has been developed. The purity is determined by comparing the absorbance of the styphnate ion in barium styphnate and in styphnic acid. Our investigation has shown that the molar absorptivity and lambda maxima of the styphnate ion are quite pH dependent; therefore, the pH is buffered to 6.8 to 7.0 with ammonium acetate. Under these conditions the molar absorptivity is 1.6 x 10/sup 4/ L/mol-cm. Analyses following the procedure in the Navy specification WS13444A using water were found to give low molar absorptivities (1.3 x 10/sup 4/ L/mol-cm) for the styphnic acid calibration resulting in erroneous values for barium styphnate purity.

  3. Kinetics of photoplasma of dense barium vapour

    NASA Astrophysics Data System (ADS)

    Kosarev, N. I.

    2015-03-01

    Barium vapour ionisation under laser photoexcitation of the resonance line at a wavelength of ? = 553.5 nm is studied numerically. Seed electrons, arising due to the associative ionisation of atoms, gain energy in superelastic collisions and lead to electron avalanche ionisation of the medium. The influence of radiative transfer in a cylindrical gas volume on the excitation kinetics of barium atoms, absorption dynamics of laser radiation and oscillation of ionisation-brightening wave under competition between ionising and quenching collisions of electrons with excited atoms is studied.

  4. Interaction between Calcium Ions and Bacillus thuringiensis Toxin Activity against Sf9 Cells (Spodoptera frugiperda, Lepidoptera)

    PubMed Central

    Monette, R.; Potvin, L.; Baines, D.; Laprade, R.; Schwartz, J. L.

    1997-01-01

    The effects of calcium ions and modulators of calcium movement on Bacillus thuringiensis insecticidal protein toxicity were investigated with Sf9 cells (Spodoptera frugiperda, fall armyworm) by a new B. thuringiensis toxicity assay based on measurement of fluorescence of ethidium homodimer, a high-affinity DNA stain. CryIC toxicity was substantially stimulated by extracellular calcium in a dose-dependent way (in the millimolar range), while toxicity enhancement could not be replicated when calcium was replaced by barium. This incremental toxicity was reduced by cobalt and lanthanum ions, two inorganic-calcium transport inhibitors. Methoxyverapamil, a voltage-dependent calcium channel blocker, and nifedipine, an inhibitor of dihydropyridine-sensitive L-type calcium channels, had no effect on CryIC toxin activity, but BAY K 8644, an L-type calcium channel activator, increased CryIC activity at high concentrations of extracellular calcium. While A23187, a calcium ionophore, and TMB-8, an inhibitor of intracellular-calcium mobilization, did not change CryIC-induced mortality, thapsigargin, an inhibitor of calcium uptake in intracellular stores, and more particularly trifluoperazine, which inhibits calcium-calmodulin-dependent processes, increased CryIC-mediated toxicity. The incremental effect of extracellular calcium on CryIC-induced toxicity was consistent with an increased concentration of intracellular calcium. PMID:16535509

  5. Brazing dissimilar aluminum alloys

    NASA Technical Reports Server (NTRS)

    Dalalian, H.

    1979-01-01

    Dip-brazing process joins aluminum castings to aluminum sheet made from different aluminum alloy. Process includes careful cleaning, surface preparation, and temperature control. It causes minimum distortion of parts.

  6. The chemistry of the calcium carbonate shells (i.e., tests) of certain foraminifera can be used to reconstruct records of past

    E-print Network

    Coull, Bruce C.

    160 The chemistry of the calcium carbonate shells (i.e., tests) of certain foraminifera can be used- cipitation (Emiliani 1955; Hester and Boyle 1982; Lea and Boyle 1989). For example, the stable carbon isotope; Zahn et al. 1986). The incorporation of the nutri- ent proxies barium and cadmium into the calcium

  7. ARE THERE ANY STARS LACKING NEUTRON-CAPTURE ELEMENTS? EVIDENCE FROM STRONTIUM AND BARIUM

    SciTech Connect

    Roederer, Ian U., E-mail: iur@obs.carnegiescience.edu [Carnegie Observatories, 813 Santa Barbara Street, Pasadena, CA 91101 (United States)

    2013-01-01

    The cosmic dispersion in the abundances of the heavy elements strontium and barium in halo stars is well known. Strontium and barium are detected in most cool, metal-poor giants, but are these elements always detectable? To identify stars that could be considered probable candidates for lacking these elements, I examine the stellar abundance data available in the literature for 1148 field stars and 226 stars in dwarf galaxies, 776 of which have metallicities lower than [Fe/H] <-2.0. Strontium or barium have been detected in all field, globular cluster, and dwarf galaxy environments studied. All upper limits are consistent with the lowest detected ratios of [Sr/H] and [Ba/H]. The frequent appearance of these elements raises the intriguing prospect that at least one kind of neutron-capture reaction operates as often as the nucleosynthesis mechanisms that produce lighter elements, such as magnesium, calcium, or iron, although the yields of heavy elements may be more variable.

  8. Calcium - urine

    MedlinePLUS

    ... much calcium Too much production of parathyroid hormone (PTH) by the parathyroid glands in the neck (hyperparathyroidism) ... glands in the neck do not produce enough PTH (hypoparathyroidism) Use of a water pill called a ...

  9. Aluminum extraction from aluminum industrial wastes

    NASA Astrophysics Data System (ADS)

    Amer, A. M.

    2010-05-01

    Aluminum dross tailings, an industrial waste from the Egyptian Aluminum Company (Egyptalum), was used to produce two types of alums: aluminum sulfate alum (Al2(SO4)3·12H2O) and ammonium aluminum alum {(NH4)2SO4AL2 (SO4)3·24H2O}. This was carried out in two processes. The first involves leaching the impurities using diluted H2SO4 with different solid/liquid ratios at different temperatures to dissolve the impurities present in the starting material in the form of aluminum sulfates. The second process is the extraction of aluminum (as aluminum sulfate) from the purified aluminum dross tailings thus produced. This was carried out in an autoclave. The effects of temperature, time of reaction, and acid concentration on pressure leaching and extraction processes were studied in order to specify the optimum conditions to be applied in the bench scale production as well as the kinetics of leaching process.

  10. Calcium orthophosphates

    PubMed Central

    Dorozhkin, Sergey V.

    2011-01-01

    The present overview is intended to point the readers’ attention to the important subject of calcium orthophosphates. This type of materials is of special significance for human beings, because they represent the inorganic part of major normal (bones, teeth and antlers) and pathological (i.e., those appearing due to various diseases) calcified tissues of mammals. For example, atherosclerosis results in blood vessel blockage caused by a solid composite of cholesterol with calcium orthophosphates, while dental caries and osteoporosis mean a partial decalcification of teeth and bones, respectively, that results in replacement of a less soluble and harder biological apatite by more soluble and softer calcium hydrogenphosphates. Therefore, the processes of both normal and pathological calcifications are just an in vivo crystallization of calcium orthophosphates. Similarly, dental caries and osteoporosis might be considered an in vivo dissolution of calcium orthophosphates. Thus, calcium orthophosphates hold a great significance for humankind, and in this paper, an overview on the current knowledge on this subject is provided. PMID:23507744

  11. Calcium Hydroxylapatite

    PubMed Central

    Yutskovskaya, Yana Alexandrovna; Philip Werschler, WM.

    2015-01-01

    Background: Calcium hydroxylapatite is one of the most well-studied dermal fillers worldwide and has been extensively used for the correction of moderate-to-severe facial lines and folds and to replenish lost volume. Objectives: To mark the milestone of 10 years of use in the aesthetic field, this review will consider the evolution of calcium hydroxylapatite in aesthetic medicine, provide a detailed injection protocol for a global facial approach, and examine how the unique properties of calcium hydroxylapatite provide it with an important place in today’s market. Methods: This article is an up-to-date review of calcium hydroxylapatite in aesthetic medicine along with procedures for its use, including a detailed injection protocol for a global facial approach by three expert injectors. Conclusion: Calcium hydroxylapatite is a very effective agent for many areas of facial soft tissue augmentation and is associated with a high and well-established safety profile. Calcium hydroxylapatite combines high elasticity and viscosity with an ability to induce long-term collagen formation making it an ideal agent for a global facial approach. PMID:25610523

  12. Recognition and prevention of barium enema complications.

    PubMed

    Williams, S M; Harned, R K

    1991-01-01

    The barium enema is a safe and accurate diagnostic study of the colon but, in rare cases, complications may result. Many of these can be prevented by proper equipment and careful attention to technique. When a complication does occur, prompt recognition and management is vital in decreasing morbidity and mortality. Perforation of the bowel is the most frequent serious complication, occurring in approximately 0.02% to 0.04% of patients. Rarely the colon may burst due to excessive transmural pressure alone. However, a colon weakened by iatrogenic trauma or disease is more likely to perforate during an enema than is a normal healthy bowel. Injury to the rectal mucosa or anal canal due to the enema tip or retention balloon is probably the most common traumatic cause of barium enema perforation. Inflation of a retention balloon within a stricture, neoplasm, inflamed rectum, or colostomy stoma is particularly hazardous. Recent deep biopsy or polypectomy with electrocautery makes the bowel more vulnerable to rupture. The tensile strength of the bowel wall is impaired in elderly patients, patients receiving long-term steroid therapy, and in disease states including neoplasm, diverticulitis, inflammatory bowel disease, and ischemia. Intraperitoneal perforation leads to a severe, acute peritonitis with intravascular volume depletion. The ensuing shock may be rapidly fatal. Prompt fluid replacement and laparotomy are essential. If the patient survives the initial shock and sepsis, later complications caused by dense intraperitoneal adhesions may develop. Extraperitoneal perforation is usually less catastrophic but may result in pain, sepsis, cellulitis, abscess, rectal stricture, or fistula. Intramural extravasation often forms a persistent submucosal barium granuloma which may ulcerate or be mistaken for a neoplasm. The most dramatic complication of barium enema is venous intravasation of barium. Fortunately, this is quite rare as it may be immediately lethal. Most cases have been attributed to trauma from the enema tip or retention balloon, mucosal inflammation, or misplacement of the tip in the vagina. Bacteremia has been found in as many as 23% of patients following barium enema and, in rare cases, may cause symptomatic septicemia. Other less common complications include barium impaction, water intoxication, allergic reactions, and cardiac arrhythmias. Preparatory laxatives and cleansing enemas have been implicated in some instances of dehydration, rectal trauma, water intoxication, and perforation. Careful review of the indications for examination, previous radiographs, and clinical history will identify many of the patients at greater risk for complications so that appropriate precautions may be observed.(ABSTRACT TRUNCATED AT 400 WORDS) PMID:1889235

  13. Oilfield scales: controls on precipitation and crystal morphology of barite (barium sulphate)

    NASA Astrophysics Data System (ADS)

    Stark, A. I. R.; Wogelius, R. A.; Vaughan, D. J.

    2003-04-01

    The precipitation and subsequent build up of barite (barium sulphate) inside extraction tubing presents a costly problem for off shore oil wells which use seawater to mobilize oil during hydrocarbon recovery. Mixing of reservoir formation water containing Ba2+ ions and seawater containing SO_42- ions results in barite precipitation within the reservoir well-bore region and piping. Great effort has been expended in designing strategies to minimize scale formation but details of the reaction mechanism and sensitivity to thermodynamic variables are poorly constrained. Furthermore, few detailed studies have been carried out under simulated field conditions. Hence an experimental programme was designed to study barite formation under environmentally relevant conditions with control of several system variables during the precipitation reaction. Synthetic sea-water and formation-water brines containing sodium sulphate and barium chloride, respectively, were mixed to induce BaSO_4 precipitation. Experiments were carried out at high temperature (100^oC) and high pressure (500 bars) in double rocking autoclave bombs. Barite formation as a function of the addition of calcium, magnesium, and a generic phosphonate based scale inhibitor was investigated whilst maintaining constant pH, temperature and ionic strength (0.5159). Additional experiments were performed at ambient conditions for comparison. Data concerning nucleation, growth rates, and crystal morphology were obtained. ICP-AES data from the supernatant product solutions showed considerable variation in quantity of barium sulphate precipitated as a function of the listed experimental variables. For example, ESEM analysis of barium sulphate crystals showed a dramatic shift in crystal habit from the typical tabular habit produced in control experiments; experiments performed in the presence of foreign cations produced more equant crystals, while those experiments completed in the presence of the phosphonate scale inhibitor produced precipitates with distorted anhedral shapes. Based on these preliminary results, further experiments which monitor rate and morphology as a function of Ba/Ca ratio, ionic strength, and ion activity product for barite will also be completed.

  14. Olfactory neurons exhibit heterogeneity in depolarization-induced calcium changes.

    PubMed

    Restrepo, D; Teeter, J H

    1990-06-01

    Olfactory neurons from the channel catfish, Ictalurus punctatus, were isolated by a brief (15 min) treatment with papain. After incubation with fura-2 acetoxymethyl ester (fura-2/AM) for 1 h, the isolated olfactory receptor cells are found to hydrolyze fura-2/AM to fura-2 free acid without detectable traces of intermediate products of hydrolysis. Intracellular calcium measured with fura-2 in single cells covers a wide range (from less than 2 to 100 nM with a median of 17.6 nM, n = 140 cells). Twenty-one percent of the cells respond to potassium-induced depolarization with an increase in intracellular calcium mediated by influx of extracellular calcium. The L-type calcium channel antagonist nimodipine inhibits the increase in intracellular calcium triggered by membrane depolarization and blocks small unitary barium currents displaying the characteristics of L-type calcium currents (unitary conductance of 29 +/- 5 pS in 55 mM BaCl2 and high selectivity for Ba2+ over Na+ and K+) recorded from azolectin bilayers at the tip of patch pipettes into which isolated olfactory cilia membrane vesicles had been incorporated. Olfactory neurons are found to be functionally heterogeneous in their response to membrane depolarization and can be separated into three groups: one in which the increase in intracellular calcium is rapid and transient, another in which calcium increases slowly, and a third group of cells in which depolarization causes no change in intracellular calcium. PMID:2163197

  15. The ultra-high lime with aluminum process for removing chloride from recirculating cooling water

    E-print Network

    Abdel-wahab, Ahmed Ibraheem Ali

    2004-09-30

    Chloride is a deleterious ionic species in cooling water systems because it is important in promoting corrosion. Chloride can be removed from cooling water by precipitation as calcium chloroaluminate using ultra-high lime with aluminum process (UHLA...

  16. Hydrolysis of aluminum dross material to achieve zero hazardous waste.

    PubMed

    David, E; Kopac, J

    2012-03-30

    A simple method with high efficiency for generating high pure hydrogen by hydrolysis in tap water of highly activated aluminum dross is established. Aluminum dross is activated by mechanically milling to particles of about 45 ?m. This leads to removal of surface layer of the aluminum particles and creation of a fresh chemically active metal surface. In contact with water the hydrolysis reaction takes place and hydrogen is released. In this process a Zero Waste concept is achieved because the other product of reaction is aluminum oxide hydroxide (AlOOH), which is nature-friendly and can be used to make high quality refractory or calcium aluminate cement. For comparison we also used pure aluminum powder and alkaline tap water solution (NaOH, KOH) at a ratio similar to that of aluminum dross content. The rates of hydrogen generated in hydrolysis reaction of pure aluminum and aluminum dross have been found to be similar. As a result of the experimental setup, a hydrogen generator was designed and assembled. Hydrogen volume generated by hydrolysis reaction was measured. The experimental results obtained reveal that aluminum dross could be economically recycled by hydrolysis process with achieving zero hazardous aluminum dross waste and hydrogen generation. PMID:22326245

  17. Studies of aluminum in rat brain

    SciTech Connect

    Lipman, J.J.; Brill, A.B.; Som, P.; Jones, K.W.; Colowick, S.; Cholewa, M.

    1985-01-01

    The effects of high aluminum concentrations in rat brains were studied using /sup 14/C autoradiography to measure the uptake of /sup 14/C 2-deoxy-D-glucose (/sup 14/C-2DG) and microbeam proton-induced x-ray emission (microPIXE) with a 20-..mu..m resolution to measure concentrations of magnesium, aluminum, potassium, and calcium. The aluminum was introduced intracisternally in the form of aluminum tartrate (Al-T) while control animals were given sodium tartrate (Na-T). The /sup 14/C was administered intravenously. The animals receiving Al-T developed seizure disorders and had pathological changes that included cerebral cortical atrophy. The results showed that there was a decreased uptake of /sup 14/C-2DG in cortical regions in which increased aluminum levels were measured, i.e., there is a correlation between the aluminum in the rat brain and decreased brain glucose metabolism. A minimum detection limit of about 16 ppM (mass fraction) or 3 x 10/sup 9/ Al atoms was obtained for Al under the conditions employed. 14 refs., 4 figs., 1 tab.

  18. PhotoElastic Effect in Barium Nitrate

    Microsoft Academic Search

    S. Bhagavantam; D. Suryanarayana

    1948-01-01

    DURING the course of our investigations on photo-elasticity, we have found that single crystals of barium nitrate behave in many respects in an exceptional manner. Differences between the stress-optical constants as determined by a Babinet compensator are (q11 - q12) = - 23.81 × 10-13, (q11 - q13) = - 18.06 × 10-13 and q44 = - 1.62 × 10-13

  19. Meteoric calcium

    NASA Astrophysics Data System (ADS)

    Plane, John M. C.

    2011-11-01

    Calcium is found throughout the solar system, the Earth's crust and oceans, and is an essential constituent of cells, shells and bones -- yet it is curiously scarce in the upper atmosphere. John Plane ponders on this 25-year-old mystery.

  20. Project Calcium

    SciTech Connect

    Hurley, J.P.; Benson, S.A.; Erickson, T.A.; Allan, S.E.; Bieber, J.

    1992-09-01

    Fouling problems in utility boilers have been classified into two principal types: high-temperature and low-temperature fouling. A multiclient-sponsored program was initiated at the Energy and Environmental Research Center (EERC) to better understand the causes of low-temperature fouling when burning high-calcium western US coals. The goals of Project Calcium were to define the low-temperature deposition problem, identify the calcium-based components that are responsible for the formation of the deposits, develop ways to predict their formation, and identify possible methods to mitigate the formation of these deposits. To achieve the goals of Project Calcium, detailed sampling of utility boilers and laboratory-scale studies coupled with state-of-the-art methods to determine the inorganic components in coals and coal ash-derived materials were conducted. Boiler Sampling was also performed. The work involved sampling coal, entrained ash, deposits and slags from five full-scale utility boilers combined with detailed advanced characterization of the materials. The results of this work aided in identifying the key phenomena to focus the laboratory studies and in model verification. Field testing was conducted at three utilities.

  1. Elaboration and characterization of barium silicate thin films.

    PubMed

    Genevès, T; Domenichini, B; Imhoff, L; Potin, V; Heintz, O; Peterlé, P M; Bourgeois, S

    2008-12-01

    Room temperature depositions of barium on a thermal silicon oxide layer were performed in ultra high vacuum (UHV). In-situ X-ray photoelectron spectroscopy (XPS) analyses were carried out as well after exposure to air as after subsequent annealings. These analyses were ex-situ completed by secondary ion mass spectrometry (SIMS) profiles and transmission electron microscopy (TEM) cross-sectional images. The results showed that after air exposure, the barium went carbonated. Annealing at sufficient temperature permitted to decompose the carbonate to benefit of a barium silicate. The silicate layer was formed by interdiffusion of barium with the initial SiO2 layer. PMID:18603436

  2. The role of barium esophagography in an endoscopy world.

    PubMed

    Katzka, David A

    2014-10-01

    Barium esophagography, although an old test, remains important to the understanding of esophageal physiology and diagnosis of esophageal disorders. It provides additive and/or confirmatory information to endoscopy and is the more accurate means of yielding diagnosis. Barium esophagography allows correlation of symptoms with barium findings and with varied textures substances. It allows, particularly for oropharyngeal dysfunction, implementation therapeutic maneuvers and instructions while testing. The caveat to maintaining the benefits of barium esophagography is continuing to promote and support expertise from our radiologists in performing these studies, which has been challenged by our cost-efficient and high-tech medical society. PMID:25216903

  3. Original article Availability of calcium from skim milk, calcium sulfate

    E-print Network

    Paris-Sud XI, Université de

    Original article Availability of calcium from skim milk, calcium sulfate and calcium carbonate; accepted 19 November 1999) Abstract --Dairy products provide abundant, accessible calcium for humans, while some calcium sulfate-rich mineral waters could provide appreciable amounts of calcium

  4. Modifier cation (Ba, Ca, La, Y) field strength effects on aluminum and boron coordination in aluminoborosilicate glasses: the roles of fictive temperature and boron content

    NASA Astrophysics Data System (ADS)

    Morin, Elizabeth I.; Wu, Jingshi; Stebbins, Jonathan F.

    2014-08-01

    The field strength of modifier cations has long been known to have important effects on oxide glass properties, but effects on network structure can be complex. For two series of barium, calcium, lanthanum and yttrium aluminoborosilicates with two different B/Si ratios, we report systematic variations in boron and aluminum coordination determined by NMR, and glass transition and heat capacities from differential scanning calorimetry. Data on glasses with different fictive temperatures allow B and Al speciation to be compared on an isothermal basis, rather than as conventionally done for as-quenched structures. Temperature and compositional effects can thus be isolated. These data and comparison to previous studies on glasses with lower B/Si ratios clearly show that higher modifier cation field strength increases the fraction of five- and six-coordinated Al in all compositions. In contrast, the previously documented trend towards more three-coordinated boron (and hence more non-bridging oxygens, NBO) in low B/Si glasses with higher field strength cations reverses in high B/Si and in high NBO compositions. Al and B coordination numbers both decrease with higher fictive temperature in the glasses studied here, suggesting a simple mechanism of coupled structural change.

  5. Relationship of aluminum to Alzheimer's disease.

    PubMed Central

    Perl, D P

    1985-01-01

    Alzheimer's disease is a progressive degenerative brain disease of unknown etiology, characterized by the development of large numbers of neurofibrillary tangles and senile plaques in the brain. Aluminum salts may be used experimentally to produce lesions which are similar, but not identical, to the neurofibrillary tangle. Although some studies have reported increased amounts of aluminum in the brains of Alzheimer's disease victims, these bulk analysis studies have been difficult to replicate and remain controversial. Using scanning electron microscopy with X-ray spectrometry, we have investigated this question on the cellular level. We have identified abnormal accumulations of aluminum within neurons derived from Alzheimer's disease patients containing neurofibrillary tangles. Similar accumulations have been detected in the numerous neurofibrillary tangle-bearing neurons seen in the brains of the indigenous native population of the island of Guam who suffer from amyotrophic lateral sclerosis and parkinsonism with dementia. Epidemiologic evidence strongly suggests a causal role for local environmental conditions relating to availability of aluminum, calcium, and magnesium. In view of the fact that a major consequence of acid rain is the liberation of large amounts of aluminum in bioavailable forms, concerns are raised about possible human health risks of this environmental phenomenon. PMID:4076080

  6. Corrosion of aluminum and aluminum alloys

    SciTech Connect

    Davis, J.R. (ed.)

    1999-01-01

    This new handbook presents comprehensive coverage of the corrosion behavior of aluminum and aluminum alloys, with emphasis on practical information about how to select and process these materials in order to prevent corrosion attack. Described are the characteristics of these materials and the influences of composition, mechanical working, heat treatment, joining methods, microstructure, and environmental variables on their corrosion.

  7. Aluminum hydroxide production

    SciTech Connect

    Martin, E.S.; Weaver, M.L.

    1988-07-05

    A method is described for the production of aluminum hydroxide, comprising reacting water in the liquid phase and aluminum of surface area of at least 20 mm/sup 2/ per gram at a pH above about 12.4 for producing a reaction mixture containing aluminum hydroxide, and collecting solid aluminum hydroxide from the reaction mixture, the reaction being carried out in the presence of choline at a concentration of about 0.05 to 2 mols per liter.

  8. Laboratory and prediction of barium sulfate scaling at high-barium formation water

    Microsoft Academic Search

    Amer Badr BinMerdhah; Abu Azam Mohd Yassin; Mazen Ahmed Muherei

    2010-01-01

    Scale formation in surface and subsurface oil and gas production equipment has been recognized to be a major operational problem. It has been also recognized as major causes of formation damage either in injection or producing wells. This study was conducted to investigate the permeability reduction caused by deposition of barium sulfate in sandstone cores from mixing of injected seawater

  9. Excessive barium and radium 226 in Illinois drinking water

    Microsoft Academic Search

    Calabrese

    1977-01-01

    The Illinois EPA has found 16 cities with drinking water containing barium concentrations exceeding the current state and federal drinking water standard of 1 mg\\/l. In addition, the presence of varying amounts of alpha activity reveal traces of radium-226 in many Illinois water wells. Increased levels of radium and barium are concurrent with a rise in cancer rates in the

  10. Aluminum and Young Artists.

    ERIC Educational Resources Information Center

    Anderson, Thomas

    1980-01-01

    The author suggests a variety of ways in which aluminum and aluminum foil can be used in elementary and junior high art classes: relief drawing and rubbing; printing; repousse; sculpture; mobiles; foil sculpture; and three dimensional design. Sources of aluminum supplies are suggested. (SJL)

  11. Calcium and Vitamin D

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Calcium is required for the bone formation phase of bone remodeling. Typically about 5 nmol (200 mg) of calcium is removed from the adult skeleton and replaced each day. To supply this amount, one would need to consume about 600 mg of calcium, since calcium is not very efficiently absorbed. Calcium ...

  12. Barium Enhancement in NGC 6819 Blue Stragglers

    NASA Astrophysics Data System (ADS)

    Milliman, Katelyn; Mathieu, Robert D.; Schuler, Simon C.

    2015-01-01

    Possible formation pathways for blue straggler stars include mergers in hierarchical triple systems, stellar collisions during dynamical encounters, and mass transfer from a giant companion. Extensive work on the blue stragglers in the old open cluster NGC 188 (7 Gyr) has led to exciting discoveries including a binary secondary mass distribution peaked at 0.5 MSolar and the detection of three young white dwarf binary companions. These indicate that mass transfer from an asymptotic giant branch star is the dominant mechanism for blue straggler formation in open clusters. Such mass transfer events should pollute the surface abundance of the blue straggler with nucleosynthesis products from the evolved donor. The other formation pathways, mergers and collisions, are predicted to produce no such enhancements. In an effort to move beyond NGC 188 and into other open clusters we present the first results of a surface abundance study of the blue stragglers in the intermediate-aged open cluster NGC 6819 (2.5 Gyr) using the Hydra multi-object spectrograph on the WIYN 3.5 m telescope. This part of our study centers on the s-process element barium as a tracer of formation via mass transfer. We compare the blue straggler surface abundance of barium to that of a sample of main-sequence stars in NGC 6819 and find multiple blue stragglers with anomalous abundances. Surprising, most of the blue stragglers with barium anomalies show no radial-velocity evidence for a companion. We gratefully acknowledge funding from the National Science Foundation under grant AST- 0908082 and the Wisconsin Space Grant Consortium.

  13. Short-cavity squeezing in barium

    NASA Technical Reports Server (NTRS)

    Hope, D. M.; Bachor, H-A.; Manson, P. J.; Mcclelland, D. E.

    1992-01-01

    Broadband phase sensitive noise and squeezing were experimentally observed in a system of barium atoms interacting with a single mode of a short optical cavity. Squeezing of 13 +/- 3 percent was observed. A maximum possible squeezing of 45 +/- 8 percent could be inferred for out experimental conditions, after correction for measured loss factors. Noise reductions below the quantum limit were found over a range of detection frequencies 60-170 MHz and were best for high cavity transmission and large optical depths. The amount of squeezing observed is consistent with theoretical predictions from a full quantum statistical model of the system.

  14. Releasing effects in flame photometry: Determination of calcium

    USGS Publications Warehouse

    Dinnin, J.I.

    1960-01-01

    Strontium, lanthanum, neodymium, samarium, and yttrium completely release the flame emission of calcium from the depressive effects of sulfate, phosphate, and aluminate. Magnesium, beryllium, barium, and scandium release most of the calcium emission. These cations, when present in high concentration, preferentially form compounds with the depressing anions when the solution is evaporated rapidly in the flame. The mechanism of the interference and releasing effects is explained on the basis of the chemical equilibria in the evaporating droplets of solution and is shown to depend upon the nature of the compounds present in the aqueous phase of the solution. The need for background correction techniques is stressed. The releasing effect is used in the determination of calcium in silicate rocks without the need for separations.

  15. Effect of hydrothermal synthesis environment on the particle morphology, chemistry and magnetic properties of barium hexaferrite

    Microsoft Academic Search

    A. Ataie; M. R. Piramoon; I. R. Harris; C. B. Ponton

    1995-01-01

    Barium nitrate and iron nitrate have been used as precursors in the hydrothermal synthesis of barium hydroxide, iron oxide and barium hexaferrite sols under specified standard synthesis conditions (temperature, time, stirring, alkali concentration, amount of water and heating rate) as a function of the base species used during synthesis. The hydrothermal synthesis of barium hydroxide and iron oxide has been

  16. Processing of yttrium-doped barium zirconate for high proton conductivity

    E-print Network

    Processing of yttrium-doped barium zirconate for high proton conductivity Peter Babilo Materials the transport properties of yttrium-doped barium zirconate (BYZ) have been explored, with the aim of attaining. INTRODUCTION Doped perovskites, such as barium cerate (BaCeO3), strontium cerate (SrCeO3), and barium zirconate

  17. Get Enough Calcium

    MedlinePLUS

    ... Physical Activity > Nutrition > Get Enough Calcium Get Enough Calcium The Basics Take Action! Ver en español Content ... June 26, 2015 The Basics Your body needs calcium to build strong bones when you are young ...

  18. Calcium and bones (image)

    MedlinePLUS

    Calcium is one of the most important minerals for the growth, maintenance, and reproduction of the human ... body, are continually being re-formed and incorporate calcium into their structure. Calcium is essential for the ...

  19. Coronary Calcium Scan

    MedlinePLUS

    ... the NHLBI on Twitter. What Is a Coronary Calcium Scan? A coronary calcium scan is a test ... you have calcifications in your coronary arteries. Coronary Calcium Scan Figure A shows the position of the ...

  20. Characterization of calcium oxalate defective (cod) 3 mutant from Medicago truncatula

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Many plants invest a considerable amount of resources and energy into the formation of calcium oxalate crystals. Assigned roles for plant crystal formation include functions in defense, calcium regulation, and aluminum tolerance. From a human health standpoint, oxalate present in edible plant tiss...

  1. The flame photometric determination of calcium in phosphate, carbonate, and silicate rocks

    USGS Publications Warehouse

    Kramer, H.

    1957-01-01

    A flame photometric method of determining calcium in phosphate, carbonate, and silicate locks has been developed Aluminum and phosphate interference was overcome by the addition of a large excess of magnesium. The method is rapid and suitable for routine analysis Results obtained are within ?? 2% of the calcium oxide content. ?? 1957.

  2. The anisotropy of aluminum and aluminum alloys

    NASA Astrophysics Data System (ADS)

    Hosford, William F.

    2006-05-01

    The anisotropy of textured aluminum is approximated by a yield criterion with an exponent of eight. The use of this criterion in metal-forming analyses has improved the understanding of the formability of aluminum and other metals. The effect of anisotropy on the limiting drawing ratio in cupping is less than that expected from the quadratic Hill yield criterion and the effect of texture on forming limit diagrams is negligible. A method of predicting the effect of strain-path changes on forming limit curves of aluminum alloy sheets has proven to agree with experiments.

  3. Do all barium stars have a white dwarf companion?

    NASA Technical Reports Server (NTRS)

    Dominy, J. F.; Lambert, D. L.

    1983-01-01

    International Ultraviolet Explorer short-wavelength, low-dispersion spectra were analyzed for four barium, two mild barium, and one R-type carbon star in order to test the hypothesis that the barium and related giants are produced by mass transfer from a companion now present as a white dwarf. An earlier tentative identification of a white dwarf companion to the mild barium star Zeta Cyg is confirmed. For the other stars, no ultraviolet excess attributable to a white dwarf is seen. Limits are set on the bolometric magnitude and age of a possible white dwarf companion. Since the barium stars do not have obvious progenitors among main-sequence and subgiant stars, mass transfer must be presumed to occur when the mass-gaining star is already on the giant branch. This restriction, and the white dwarf's minimum age, which is greater than 8 x 10 to the 8th yr, determined for several stars, effectively eliminates the hypothesis that mass transfer from an asymptotic giant branch star creates a barium star. Speculations are presented on alternative methods of producing a barium star in a binary system.

  4. Aluminum: Recycling of Aluminum Dross\\/Saltcake

    Microsoft Academic Search

    Blazek

    1999-01-01

    As this NICE3 publication details, the objective of this project is to commercialize the process technology to eliminate all landfill waste associated with black dross and saltcake generated from aluminum recycling in the United States.

  5. Infrared Study of Superconductivity: Grating Coupled Plasmons in Yttrium BARIUM(2) COPPER(3) OXYGEN(7) and Gap Features in BARIUM(1-X) Potassium(x) Bismuth OXYGEN(3)

    NASA Astrophysics Data System (ADS)

    Dunmore, Franklin John

    1995-01-01

    The electrodynamic properties of two different superconductors, Barium Potassium Bismuth Oxide (BKBO) and Yttrium Barium Copper Oxide (YBCO) have been studied using the technique of transmission Fourier transform spectroscopy with liquid helium temperature bolometric detection. Plasmon resonances have been observed in far infrared transmission measurements on superconducting YBCO films. An Aluminum/Nichrome grating is used to couple infrared radiation to collective two-dimensional plasma modes. The plasmon dispersion is measured by using different grating periods. The strength of the plasma resonances weaken, then disappear as the temperature approaches the critical temperature. The results are analyzed using a grating coupler theory that includes the hybridization of the plasmons with the diffraction modes. Data taken in a magnetic field of up to 12 Tesla are characteristic of the real part of the conductivity of the YBCO film increasing with field, behavior similar to that with increasing of temperature. These results are consistent with the inducement of vortices in the YBCO film. The far infrared transmission of BKBO thin films, grown on Magnesium Oxide (MgO) substrates, was measured in the frequency range from 15 to 200 wavenumbers, and temperature range from 9 to 100 Kelvin. There is a BCS -like peak in the transmission spectrum. The strong coupling Eliashberg theory gives a better description of the optical data than the weak coupling Mattis-Bardeen theory. For an 18 Kelvin critical temperature (T_{c }) sample the Eliashberg model extrapolated to zero temperature gives a London penetration depth of 5500+/-100A and an energy gap of 6.2 meV (50.1 wavenumbers, or 4.0 kT_{c }). Because BKBO is in the dirty limit, the strong coupling characteristics in the optical conductivity is adequately described by the Allen-Dynes parameter only, as opposed to the full Holstein structure due to the electron -phonon interaction alpha^2F(omega). .

  6. Microstructure and magnetism in barium strontium titanate (BSTO)-barium hexaferrite (BaM) multilayers

    SciTech Connect

    Frey, N.A. [Materials Physics Laboratory, Physics Department, University of South Florida, 4202 East Fowler Avenue, Tampa, FL 33620 (United States); Heindl, R. [Materials Physics Laboratory, Physics Department, University of South Florida, 4202 East Fowler Avenue, Tampa, FL 33620 (United States); Srinath, S. [Materials Physics Laboratory, Physics Department, University of South Florida, 4202 East Fowler Avenue, Tampa, FL 33620 (United States); Srikanth, H. [Materials Physics Laboratory, Physics Department, University of South Florida, 4202 East Fowler Avenue, Tampa, FL 33620 (United States)]. E-mail: sharihar@cas.usf.edu; Dudney, N.J. [Solid State Division, Oak Ridge National Laboratory, Oak Ridge, TN 37831 (United States)

    2005-08-11

    High quality multilayers of barium ferrite (BaM) and barium strontium titanate (BSTO) were grown in optimized conditions on thermally oxidized Si(1 0 0) and Al{sub 2}O{sub 3} substrates using magnetron sputtering. As-grown films were amorphous and different annealing procedures were explored to stabilize crystalline phases. BSTO and BaM phases were identified using X-ray diffraction and cross-sectional scanning electron micrographs showed sharp interfaces between BSTO and BaM layers. Magnetic hysteresis loops obtained at various temperatures and field orientations showed a large coercivity ({approx}2500 Oe) consistent with the hard magnetic hexaferrite component. Hysteresis loops also revealed the distinct influence of magnetocrystalline and shape anisotropies at different temperature ranges.

  7. A high-altitude barium radial injection experiment

    NASA Technical Reports Server (NTRS)

    Wescott, E. M.; Stenbaek-Nielsen, H. C.; Hallinan, T. J.; Deehr, C. S.; Romick, G. J.; Olson, J. V.; Roederer, J. G.; Sydora, R.

    1980-01-01

    A rocket launched from Poker Flat, Alaska, carried a new type of high-explosive barium shaped charge to 571 km, where detonation injected a thin disk of barium vapor with high velocity nearly perpendicular to the magnetic field. The TV images of the injection are spectacular, revealing three major regimes of expanding plasma which showed early instabilities in the neutral gas. The most unusual effect of the injection is a peculiar rayed barium-ion structure lying in the injection plane and centered on a 5 km 'black hole' surrounding the injection point. Preliminary electrostatic computer simulations show a similar rayed development.

  8. Designed microstructures in textured barium hexaferrite

    NASA Astrophysics Data System (ADS)

    Hovis, David Brian

    It is a fundamental principle of materials science that the microstructure of a material defines its properties and ultimately its performance for a given application. A prime example of this can be found in the large conch shell Strombus gigas, which has an intricate microstructure extending across five distinct length scales. This microstructure gives extraordinary damage tolerance to the shell. The structure of Strombus gigas cannot be replicated in a modern engineering ceramic with any existing processing technique, so new processing techniques must be developed to apply this structure to a model material. Barium hexaferrite was chosen as a model material to create microstructures reminiscent of Strombus gigas and evaluate its structure-property relations. This work describes novel processing methods to produce textured barium hexaferrite with no coupling between the sample geometry and the texture direction. This technique, combining magnetic field-assisted gelcasting with templated grain growth, also allows multilayer samples to be fabricated with different texture directions in adjacent layers. The effects of adding either B2O3 or excess BaCO 3 on the densification and grain growth of barium hexaferrite was studied. The texture produced using this technique was assessed using orientation imaging microscopy (OIM) at Oak Ridge National Laboratory. These measurements showed peak textures as high as 60 MRD and sharp interfaces between layers cast with different texture directions. The effect of oxygen on the quality of gelcasting is also discussed, and it is shown that with proper mold design, it is possible to gelcast multiple layers with differing texture directions without delamination. Monolithic and multilayer samples were produced and tested in four point bending to measure the strength and work of fracture. Modulus measurements, made with the ultrasonic pulse-echo technique, show clear signs of microcracking in both the isotropic and textured samples. Both the strength and work of fracture were shown to be affected by the texture direction. The multilayer samples did not show significant improvements in either strength or work of fracture, but they did show much less variability than the monolithic samples.

  9. Aspects of aluminum toxicity

    SciTech Connect

    Hewitt, C.D.; Savory, J.; Wills, M.R. (Univ. of Virginia Health Sciences Center, Charlottesville (USA))

    1990-06-01

    Aluminum is the most abundant metal in the earth's crust. The widespread occurrence of aluminum, both in the environment and in foodstuffs, makes it virtually impossible for man to avoid exposure to this metal ion. Attention was first drawn to the potential role of aluminum as a toxic metal over 50 years ago, but was dismissed as a toxic agent as recently as 15 years ago. The accumulation of aluminum, in some patients with chronic renal failure, is associated with the development of toxic phenomena; dialysis encephalopathy, osteomalacic dialysis osteodystrophy, and an anemia. Aluminum accumulation also occurs in patients who are not on dialysis, predominantly infants and children with immature or impaired renal function. Aluminum has also been implicated as a toxic agent in the etiology of Alzheimer's disease, Guamiam amyotrophic lateral sclerosis, and parkinsonism-dementia. 119 references.

  10. Aluminum powder metallurgy processing

    SciTech Connect

    Flumerfelt, J.F.

    1999-02-12

    The objective of this dissertation is to explore the hypothesis that there is a strong linkage between gas atomization processing conditions, as-atomized aluminum powder characteristics, and the consolidation methodology required to make components from aluminum powder. The hypothesis was tested with pure aluminum powders produced by commercial air atomization, commercial inert gas atomization, and gas atomization reaction synthesis (GARS). A comparison of the GARS aluminum powders with the commercial aluminum powders showed the former to exhibit superior powder characteristics. The powders were compared in terms of size and shape, bulk chemistry, surface oxide chemistry and structure, and oxide film thickness. Minimum explosive concentration measurements assessed the dependence of explosibility hazard on surface area, oxide film thickness, and gas atomization processing conditions. The GARS aluminum powders were exposed to different relative humidity levels, demonstrating the effect of atmospheric conditions on post-atomization processing conditions. The GARS aluminum powders were exposed to different relative humidity levels, demonstrating the effect of atmospheric conditions on post-atomization oxidation of aluminum powder. An Al-Ti-Y GARS alloy exposed in ambient air at different temperatures revealed the effect of reactive alloy elements on post-atomization powder oxidation. The pure aluminum powders were consolidated by two different routes, a conventional consolidation process for fabricating aerospace components with aluminum powder and a proposed alternative. The consolidation procedures were compared by evaluating the consolidated microstructures and the corresponding mechanical properties. A low temperature solid state sintering experiment demonstrated that tap densified GARS aluminum powders can form sintering necks between contacting powder particles, unlike the total resistance to sintering of commercial air atomization aluminum powder.

  11. Phased surgical treatment of barium enema-induced rectal injury and retention of barium in the pelvic floor space

    PubMed Central

    Yang, Xuefei; Xia, Ligang; Huang, Jun; Wang, Jianping

    2014-01-01

    Iatrogenic injuries caused by barium enema are rarely reported. Following a phased surgical protocol for up to one year, we have successfully treated a patient with rectal injury and severe infection of the pelvic floor space complicated with retention of large amounts of barium and vaginal fistula. In this article, the phased surgery planning for the treatment of rectal injury complicated with vaginal fistula is discussed in terms of the pros and cons, and the observed effect and evolution of barium retained in the pelvic floor space are described. PMID:25405155

  12. Influence of addition of rare earth metals to aluminum on the effectiveness of absorption of impurity oxygen from argon in a closed system

    SciTech Connect

    Glavatskii, Y.F.; Kozik, V.V.; Leshchev, S.V.; Serebrennikov, V.V.

    1983-07-10

    Removal of oxygen from closed systems plays a significant part in increasing the life of devices operating in absence of oxygen and other harmful impurities (e.g., in incandescent lamps, electronic tubes, etc.). Harmful gases are removed with the aid of gas absorbents. Magnesium, barium, aluminum, zirconium, titanium, rare earth metals (r.e.m.), and their compounds are used as gas absorbents. However, because of their high activity these substances are generally unsuitable for use in electric lamp production. Some of them, such as barium and magnesium, form deposits in the bulb dome which lower the luminous flux of the lamp, while others, e.g., zirconium, aluminum, and r.e.m., lose their initial activity during the technological assembly operations. In this communication results are reported of an investigation of the influence of rare earth metals added to aluminum on oxygen absorption in a closed space (incandescent lamp) when the oxygen content in the main gas is very low.

  13. Aluminum in automobiles

    SciTech Connect

    Kasper, A.S.

    1983-11-01

    Automotive materials conversion to aluminum is increasing from 35 kgs in the 70's to more than 60 kgs average in the 1983 U.S. vehicles. To control mass, aluminum intensive vehicles with 180 kgs of aluminum are already in production for greater luxury, roominess, performance, and fuel efficiency. Optimization of aluminum designs and processing is achieved through the total design concept of ''Putting It All Together''. A total of 225 kgs improves performance and maximizes the benefits for upsized vehicles by using current production components, drive trains, power plants, and press plant equipment.

  14. Magnetic properties of substituted barium ferrite powders

    SciTech Connect

    Gruskova, A. [Slovak Univ. of Technology, Bratislava (Slovakia). Dept. of Electrotechnology] [Slovak Univ. of Technology, Bratislava (Slovakia). Dept. of Electrotechnology

    1994-03-01

    Hexagonal barium ferrites were prepared using the citrate method. Cobalt and titanium were added in the amounts x from 0.2 to 1.1 ion/f.u. related to the formula BaCo{sub x}Ti{sub x}Fe{sub 12{minus}2x}O{sub 19}. The heat treatment has been applied in three steps of 550 C/5 hrs, 850 C/2 hrs and 1,100 C/2 hrs. The following magnetic properties have been achieved: H{sub c} {approximately} 80 kA/m, J{sub s} {approximately} 120 {times} 10{sup {minus}6} Tkg{sup {minus}1} m{sup 3}, and J{sub r} {approximately} 60 {times} 10{sup {minus}6} Tkg{sup {minus}1} m{sup 3} in the composition for which x is equal to 0.5 ion/f.u. The magnetic parameters have been measured by the vibration magnetometer.

  15. Optimal Intracellular Calcium Signaling

    Microsoft Academic Search

    J. W. Shuai; P. Jung

    2002-01-01

    In many cell types, calcium is released from internal stores through calcium release channels upon external stimulation (e.g., pressure or receptor binding). These channels are clustered with a typical cluster size of about 20 channels, generating stochastic calcium puffs. We find that the clustering of the release channels in small clusters increases the sensitivity of the calcium response, allowing for

  16. Study of the photovoltaic effect in thin film barium titanate

    NASA Technical Reports Server (NTRS)

    Grannemann, W. W.; Dharmadhikari, V. S.

    1983-01-01

    The feasibility of making non-volatile digital memory devices of barium titanate, BaTiO3, that are integrated onto a silicon substrate with the required ferroelectric film produced by processing, compatible with silicon technology was examined.

  17. Calculated emission rates for barium releases in space

    NASA Technical Reports Server (NTRS)

    Stenbaek-Nielsen, H. C.

    1989-01-01

    The optical emissions from barium releases in space are caused by resonance and fluorescent scattering of sunlight. Emission rates for the dominant ion and neutral lines are calculated assuming the release to be optically thin and the barium to be in radiative equilibrium with the solar radiation. The solar spectrum has deep Fraunhofer absorption lines at the primary barium ion resonances. A velocity component toward or away from the sun will Doppler shift the emission lines relative to the absorption lines and the emission rates will increase many-fold over the rest value. The Doppler brightening is important in shaped charge or satellite releases where the barium is injected at high velocities. Emission rates as a function of velocity are calculated for the 4554, 4934, 5854, 6142 and 6497 A ion emission lines and the dominant neutral line at 5535 A. Results are presented for injection parallel to the ambient magnetic field, B, and for injection at an angle to B.

  18. Upper gastrointestinal barium evaluation of duodenal pathology: A pictorial review

    PubMed Central

    Gupta, Pankaj; Debi, Uma; Sinha, Saroj Kant; Prasad, Kaushal Kishor

    2014-01-01

    Like other parts of the gastrointestinal tract (GIT), duodenum is subject to a variety of lesions both congenital and acquired. However, unlike other parts of the GIT viz. esophagus, rest of the small intestine and large intestine, barium evaluation of duodenal lesions is technically more challenging and hence not frequently reported. With significant advances in computed tomography technology, a thorough evaluation including intraluminal, mural and extramural is feasible in a single non-invasive examination. Notwithstanding, barium evaluation still remains the initial and sometimes the only imaging study in several parts of the world. Hence, a thorough acquaintance with the morphology of various duodenal lesions on upper gastrointestinal barium examination is essential in guiding further evaluation. We reviewed our experience with various common and uncommon barium findings in duodenal abnormalities. PMID:25170399

  19. Update on Calcium Signaling Calcium Signaling through Protein Kinases. The

    E-print Network

    Sheen, Jen

    Update on Calcium Signaling Calcium Signaling through Protein Kinases. The Arabidopsis Calcium protein kinase activities occur through calcium-dependent protein kinases (CDPKs). These novel calcium provides a valuable opportunity to understand the plant calcium-signaling network. Calcium is a ubiquitous

  20. Carbothermic Aluminum Production Using Scrap Aluminum As A Coolant

    DOEpatents

    LaCamera, Alfred F. (Trafford, PA)

    2002-11-05

    A process for producing aluminum metal by carbothermic reduction of alumina ore. Alumina ore is heated in the presence of carbon at an elevated temperature to produce an aluminum metal body contaminated with about 10-30% by wt. aluminum carbide. Aluminum metal or aluminum alloy scrap then is added to bring the temperature to about 900-1000.degree. C. and precipitate out aluminum carbide. The precipitated aluminum carbide is filtered, decanted, or fluxed with salt to form a molten body having reduced aluminum carbide content.

  1. Prompt ionization in the CRIT II barium releases

    Microsoft Academic Search

    R. B. Torbert; C. A. Kletzing; K. Liou; D. Rau

    1992-01-01

    Observations of electron and ion distributions inside a fast neutral barium jet in the ionosphere show significant fluxes within 4 km of release, presumably related to beam plasma instability processes involved in the Critical Ionization Velocity (CIV) effect. Electron fluxes exceeding 5 x 10 exp 12\\/sq cm-str-sec-keV were responsible for ionizing both the streaming barium and ambient oxygen. Resulting ion

  2. Calcium Depletion in Forest Soils of the Eastern US

    NSDL National Science Digital Library

    Nannapaneni, Sujani.

    This week's In the News focuses on calcium depletion in the forest soils of ten states in the Eastern US. Calcium depletion decreases the ability of trees to "ward off stresses such as temperature changes and insect defoliation". Scientists have noted that sugar maples and red spruce trees in ten different sites now have reduced resistance to "defoliation by insects and low winter temperatures". In a recent report, scientists Gregory Lawrence and Thomas Huntington of the US Geological Survey (USGS) claim that a cause of calcium depletion is acid rain. Lawrence and Huntington describe a mechanism whereby acid rain decreases calcium soil content: ". . . sulfuric and nitric acids from acid deposition . . . tend to remain in solution within the mineral soil where they lower the pH, thereby releasing aluminum to soil water and causing the leaching of calcium". In addition, timber harvesting may also contribute to the depletion of calcium in forest soils because, as trees are removed from the site, the calcium within them is removed as well. Due to the combined effects of acid rain and timber harvest, some areas have low calcium soil content and consequently low forest growth. The nine resources listed provide background information on acid rain and articles and research efforts on the relationship between calcium soil content and acid rain.

  3. Anodizing Aluminum with Frills.

    ERIC Educational Resources Information Center

    Doeltz, Anne E.; And Others

    1983-01-01

    "Anodizing Aluminum" (previously reported in this journal) describes a vivid/relevant laboratory experience for general chemistry students explaining the anodizing of aluminum in sulfuric acid and constrasting it to electroplating. Additions to this procedure and the experiment in which they are used are discussed. Reactions involved are also…

  4. Correlating Aluminum Burning Times

    Microsoft Academic Search

    M. W. Beckstead

    2005-01-01

    Characteristics of aluminum combustion are summarized in an overview of the subject, focusing on the burning time of individual particles. Combustion data from over ten different sources with almost 400 datum points have been cataloged and correlated. Available models have also been used to evaluate combustion trends with key environmental parameters. The fundamental concepts that control aluminum combustion are discussed,

  5. The Aluminum Smelting Process

    PubMed Central

    2014-01-01

    This introduction to the industrial primary aluminum production process presents a short description of the electrolytic reduction technology, the history of aluminum, and the importance of this metal and its production process to modern society. Aluminum's special qualities have enabled advances in technologies coupled with energy and cost savings. Aircraft capabilities have been greatly enhanced, and increases in size and capacity are made possible by advances in aluminum technology. The metal's flexibility for shaping and extruding has led to architectural advances in energy-saving building construction. The high strength-to-weight ratio has meant a substantial reduction in energy consumption for trucks and other vehicles. The aluminum industry is therefore a pivotal one for ecological sustainability and strategic for technological development. PMID:24806722

  6. Aluminum structural applications

    SciTech Connect

    Lucas, G. [Alcan Rolled Products Co., Farmington Hills, MI (United States)

    1996-05-01

    Extensive research by aluminum producers and automakers in the 1980s resulted in the development of technologies that enable building of aluminum cars that meet and exceed all the expectations of today`s drivers and passengers, yet weigh several hundred pounds less than their steel counterparts. The Acura NSX sports car, the Audi A8, and the Jaguar XJ220 have all been introduced. Ford has built 40 aluminum-intensive automobiles based on the Taurus/Sable for test purposes, and General Motors recently announced an aluminum-structured electric vehicle. The design flexibility that aluminum allows is shown by these examples. Each uses a somewhat different technology that is particularly suited to the vehicle and its market.

  7. The aluminum smelting process.

    PubMed

    Kvande, Halvor

    2014-05-01

    This introduction to the industrial primary aluminum production process presents a short description of the electrolytic reduction technology, the history of aluminum, and the importance of this metal and its production process to modern society. Aluminum's special qualities have enabled advances in technologies coupled with energy and cost savings. Aircraft capabilities have been greatly enhanced, and increases in size and capacity are made possible by advances in aluminum technology. The metal's flexibility for shaping and extruding has led to architectural advances in energy-saving building construction. The high strength-to-weight ratio has meant a substantial reduction in energy consumption for trucks and other vehicles. The aluminum industry is therefore a pivotal one for ecological sustainability and strategic for technological development. PMID:24806722

  8. Barium determination in gastric contents, blood and urine by inductively coupled plasma mass spectrometry in the case of oral barium chloride poisoning.

    PubMed

    ?ukasik-G??bocka, Magdalena; Sommerfeld, Karina; Han?, Anetta; Grzegorowski, Adam; Bara?kiewicz, Danuta; Gaca, Micha?; Zieli?ska-Psuja, Barbara

    2014-01-01

    A serious case of barium intoxication from suicidal ingestion is reported. Oral barium chloride poisoning with hypokalemia, neuromuscular and cardiac toxicity, treated with intravenous potassium supplementation and hemodialysis, was confirmed by the determination of barium concentrations in gastric contents, blood, serum and urine using the inductively coupled plasma mass spectrometry method. Barium concentrations in the analyzed specimens were 20.45 µg/L in serum, 150 µg/L in blood, 10,500 µg/L in urine and 63,500 µg/L in gastric contents. Results were compared with barium levels obtained from a non-intoxicated person. PMID:24794066

  9. Aluminum monocarbonyl and aluminum isocarbonyl Steve S. Wesolowski,a)

    E-print Network

    Crawford, T. Daniel

    Aluminum monocarbonyl and aluminum isocarbonyl Steve S. Wesolowski,a) T. Daniel Crawford,b) Justin of the aluminum monocarbonyl species AlCO and AlOC have been performed to predict the geometries, fragmentation, Ogden, and Oswald6 first isolated aluminum dicarbonyls in solid krypton and identified the species

  10. Electrooptic and piezoelectric measurements in photorefractive barium titanate and strontium barium niobate

    SciTech Connect

    Ducharme, S.; Feinberg, J.; Neurgaonkar, R.R.

    1987-12-01

    The authors measured the low-frequency (''unclamped'') electrooptic and piezoelectric coefficients in undoped BaTiO/sub 3/ and Sr/sub x/Ba/sub 1-x/Nb/sub 2/O/sub 6/ (chi - 0.61) crystals using interferometric techniques. The contribution of the piezoelectric effect to the Pockels measurement is discussed. For an applied ac electric field in the range 0.1-200 V/cm, the electrooptic and piezoelectric effects are linear in the magnitude of of the applied field and independent of its frequency in the range of 10 Hz-100 kHz. The unclamped electrooptic coefficients of poled BaTiO/sub 3/ single crystals are r/sub 13/ = 19.5 +- 1 pm/V and r/sub 33/ = 97 +- 7 pm/V, and for strontium barium niobate are r/sub 13/ = 47 +- 5 pm/V and r/sub 33/ = 235 +- 21 pm/V, all measured at a wavelength of 514.5 nm and at T = 23/sup 0/C. For the barium titanate samples the measured Pockels coefficient r/sub c/ identical to r/sub 33/ - (n/sub 1//n/sub 3/)/sup 3/r/sub 13/ = 79 +- 6 pm/V in good agreement with the value r/sub c/ = 76 +- 7 pm/V computed from the above values of r/sub 13/ and r/sub 33/, where n/sub 1/ and n/sub 3/ are the ordinary and extraordinary indexes of refraction, respectively. The measured piezoelectric coefficient is d/sub 23/ = +28.7 +- 2 pm/V for barium titanate, and is d/sub 23/ = +24.6 +- 2 pm/V for strontium barium niobate. They also measured the photoreflective coupling of two optical beams in the crystals, and they show that the dependence of the coupling strength on beam polarization is in fair agreement with the measured values of the Pockels coefficients.

  11. CALCIUM CHLORIDE PLANT LOOKING EAST. CALCIUM CHLORIDE BUILDING IN CENTER, ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    CALCIUM CHLORIDE PLANT LOOKING EAST. CALCIUM CHLORIDE BUILDING IN CENTER, CALCIUM CHLORIDE STORAGE BUILDING ON RIGHT WITH SA (SODA ASH) BUILDING IN RIGHT BACKGROUND. - Solvay Process Company, Calcium Chloride Plant, Between Willis & Milton Avenues, Solvay, Onondaga County, NY

  12. Elemental Content of Calcium Oxalate Stones from a Canine Model of Urinary Stone Disease

    PubMed Central

    Killilea, David W.; Westropp, Jodi L.; Shiraki, Ryoji; Mellema, Matthew; Larsen, Jennifer; Kahn, Arnold J.; Kapahi, Pankaj; Chi, Thomas; Stoller, Marshall L.

    2015-01-01

    One of the most common types of urinary stones formed in humans and some other mammals is composed of calcium oxalate in ordered hydrated crystals. Many studies have reported a range of metals other than calcium in human stones, but few have looked at stones from animal models such as the dog. Therefore, we determined the elemental profile of canine calcium oxalate urinary stones and compared it to reported values from human stones. The content of 19 elements spanning 7-orders of magnitude was quantified in calcium oxalate stones from 53 dogs. The elemental profile of the canine stones was highly overlapping with human stones, indicating similar inorganic composition. Correlation and cluster analysis was then performed on the elemental profile from canine stones to evaluate associations between the elements and test for potential subgrouping based on elemental content. No correlations were observed with the most abundant metal calcium. However, magnesium and sulfur content correlated with the mineral hydration form, while phosphorous and zinc content correlated with the neuter status of the dog. Inter-elemental correlation analysis indicated strong associations between barium, phosphorous, and zinc content. Additionally, cluster analysis revealed subgroups within the stones that were also based primarily on barium, phosphorous, and zinc. These data support the use of the dog as a model to study the effects of trace metal homeostasis in urinary stone disease. PMID:26066810

  13. Elemental Content of Calcium Oxalate Stones from a Canine Model of Urinary Stone Disease.

    PubMed

    Killilea, David W; Westropp, Jodi L; Shiraki, Ryoji; Mellema, Matthew; Larsen, Jennifer; Kahn, Arnold J; Kapahi, Pankaj; Chi, Thomas; Stoller, Marshall L

    2015-01-01

    One of the most common types of urinary stones formed in humans and some other mammals is composed of calcium oxalate in ordered hydrated crystals. Many studies have reported a range of metals other than calcium in human stones, but few have looked at stones from animal models such as the dog. Therefore, we determined the elemental profile of canine calcium oxalate urinary stones and compared it to reported values from human stones. The content of 19 elements spanning 7-orders of magnitude was quantified in calcium oxalate stones from 53 dogs. The elemental profile of the canine stones was highly overlapping with human stones, indicating similar inorganic composition. Correlation and cluster analysis was then performed on the elemental profile from canine stones to evaluate associations between the elements and test for potential subgrouping based on elemental content. No correlations were observed with the most abundant metal calcium. However, magnesium and sulfur content correlated with the mineral hydration form, while phosphorous and zinc content correlated with the neuter status of the dog. Inter-elemental correlation analysis indicated strong associations between barium, phosphorous, and zinc content. Additionally, cluster analysis revealed subgroups within the stones that were also based primarily on barium, phosphorous, and zinc. These data support the use of the dog as a model to study the effects of trace metal homeostasis in urinary stone disease. PMID:26066810

  14. Heat stability and calcium bioavailability of calcium-fortified milk

    Microsoft Academic Search

    G. Singh; S. Arora; G. S. Sharma; J. S. Sindhu; V. K. Kansal; R. B. Sangwan

    2007-01-01

    The objective of the study was to fortify calcium in cow milk in order to prepare calcium-enriched heat-stable milk for individuals who may not ingest enough calcium to meet minimum daily requirements. Therefore, cow milk was fortified with calcium at the rate of 50mg\\/100ml using three salts of calcium, viz. calcium chloride, calcium lactate and calcium gluconate. Upon addition of

  15. 82 2010 USDA Research Forum on Invasive Species GTR-NRS-P-75 MULTITROPHIC EFFECTS OF CALCIUM AVAILABILITY

    E-print Network

    University of Delaware, Departments of Entomology and Wildlife Ecology, Newark, DE 19716 ABSTRACT Acid rain adsorbed to soil surfaces, and (2) aluminum is released to soil water by acid rain and displaces adsorbed, causing calcium to be more readily leached from the soil. The effects of acid rain on soil calcium

  16. Comparision of Uptake Models for Strontium (Sr) and Barium (Ba) in Vine (Vitis vinifera L.) in Castilla-La Mancha (spain).

    NASA Astrophysics Data System (ADS)

    Amorós, José Angel; Pérez-de-los-Reyes, Caridad; García-Navarro, Francisco J.; Bravo, Sandra; Higueras, Pablo; Moreno, Marta

    2015-04-01

    Castilla-La Mancha is the biggest vine-growing region in the world (about 500,000 ha) and one of the most important in terms of production of wine. The soils diversity should induce differences in the uptake of mineral elements by the vineyard. Of over the regional vine extension, 101 plots were selected and analyzed soil samples from each of them, following the description by FAO procedures. Samples of leaves were also taken from each soil plot. We analyzed the contents of mineral elements in both soil and leaf, using the FRX technique. This paper is focused on the elements strontium and barium because they are the trace elements having a higher concentration in the soils of the region, with values in soil range from 22.3 mg•kg-1-3602.7 mg•kg-1 in strontium and from 65.4 mg•kg-1 to 469.3 mg•kg-1 in barium. The contents of both elements in leaves have ranged from 23.3 mg•kg-1 y 1084.5 mg•kg-1 for strontium, and between 3.86 mg•kg-1 and 235.0 mg•kg-1 for barium. The aim of this work is state the behaviour in the soil-plant system for both elements. For this study, different statistical adjustment models have been tested (linear, multiplicative, exponential and logarithmic). The results show that the values of "R" for strontium are higher than barium in all models. Samples have also been studied by soil order (classified according to the FAO criteria). In this case, significant correlation from strontium have been found in all soil orders, except in calcisols. Significant correlations for barium appear only in entisols and luvisols. In conclusion it can be seen how these two elements differ in their behaviour in the soil-plant system. In general, the concentration of strontium in the soil is better correlated with leaf content than barium in the same soil. We can suggest a greater facility for the absorption of strontium by the grapevine. In calcisols, bearing in mind the interference of calcium, this uptake does not present such a high correlation. The correlation soil-leave of barium is better in poorly developed soils (entisols) and highly evolved (luvisols), although this fact may obey other edaphic parameters (pH, electrical conductivity, mineralogy, etc.).

  17. Safety Evaluation of Dietary Aluminum

    Microsoft Academic Search

    Madhusudan G. Soni; Susan M. White; W. Gary Flamm; George A. Burdock

    2001-01-01

    Aluminum is a nonessential metal to which humans are frequently exposed. Aluminum in the food supply comes from natural sources, water used in food preparation, food ingredients, and utensils used during food preparations. The amount of aluminum in the diet is small, compared with the amount of aluminum in antacids and some buffered analgesics. The healthy human body has effective

  18. High H? ionic conductivity in barium hydride.

    PubMed

    Verbraeken, Maarten C; Cheung, Chaksum; Suard, Emmanuelle; Irvine, John T S

    2015-01-01

    With hydrogen being seen as a key renewable energy vector, the search for materials exhibiting fast hydrogen transport becomes ever more important. Not only do hydrogen storage materials require high mobility of hydrogen in the solid state, but the efficiency of electrochemical devices is also largely determined by fast ionic transport. Although the heavy alkaline-earth hydrides are of limited interest for their hydrogen storage potential, owing to low gravimetric densities, their ionic nature may prove useful in new electrochemical applications, especially as an ionically conducting electrolyte material. Here we show that barium hydride shows fast pure ionic transport of hydride ions (H(-)) in the high-temperature, high-symmetry phase. Although some conductivity studies have been reported on related materials previously, the nature of the charge carriers has not been determined. BaH2 gives rise to hydride ion conductivity of 0.2 S cm(-1) at 630 °C. This is an order of magnitude larger than that of state-of-the-art proton-conducting perovskites or oxide ion conductors at this temperature. These results suggest that the alkaline-earth hydrides form an important new family of materials, with potential use in a number of applications, such as separation membranes, electrochemical reactors and so on. PMID:25485988

  19. Chemical compositions of four barium stars

    E-print Network

    Liang, Y C; Chen, Y Q; Qiu, H M; Zhang, B

    2003-01-01

    Chemical compositions of four barium stars HD 26886, HD 27271, HD 50082 and HD 98839 are studied based on high resolution, high signal-to-noise Echelle spectra. Results show that all of them are disk stars. Their \\alpha and iron peak elements are similar to the solar abundances. The neutron-capture process elements are overabundant relative to the Solar. The heavy-element abundances of the strong Ba star HD 50082 are higher than those of other three mild Ba stars. Its mass is 1.32Msun (+0.28,-0.22Msun), and is consistent with the average mass of strong Ba stars (1.5Msun). For mild Ba star HD 27271 and HD 26886, the derived masses are 1.90Msun (+0.25,-0.20Msun) and 2.78Msun (+0.75,-0.78M_sun), respectively, which are consistent with the average mass of mild Ba stars. We also calculate the theoretical abundances of Ba stars by combining the AGB stars nucleosynthesis and wind accretion formation scenario of Ba binary systems. The comparisons between the observed abundance patterns of the sample stars with the th...

  20. Enhancement of Beam Fanning in Barium Titanate

    NASA Astrophysics Data System (ADS)

    Smith, Neil; Yarrison-Rice, Jan

    2001-10-01

    We have made initial measurements of the temporal evolution of beam fanning in photorefractive crystals with and without the use of a diffuser at the sample's input plane. Beam fanning is initiated through two beam coupling between the incident radiation and the light which scatters from impurities at or near the input plane of the crystal. An index of refraction grating is formed between input beam and the scattered beams in the +c-axis direction due to the electro-optic effect. As the index grating grows in strength more light is diverted into the scattered beams' direction. The result is a beam fan that is collected via a series of lenses and is imaged unto a CCD camera that records the build up as a function of time. A diffusing plate placed at the entrance face of the barium titanate increases the scattering of the incident beam. This allows more energy to be diverted from the propagating beam into the scattered beams and thus into the beam fan. The diffuser has been characterized with AFM measurements and typical width and heights of surface features are recorded. An imaging software package provides a method of analyzing the total intensity of the beam fan as it develops and times to steady state are determined. We find that beam fanning efficiency is enhanced with the diffuser.

  1. Prospects for Barium Tagging in Gaseous Xenon

    SciTech Connect

    Sinclair, D.; /Carleton U. /TRIUMF; Rollin, E.; /Carleton U.; Smith, J.; /Carleton U.; Mommers, A.; /Ottawa U.; Ackerman, N.; /SLAC; Aharmim, B.; /Laurentian U.; Auger, M.; /Bern U., LHEP; Barbeau, P.S.; /Stanford U., Phys. Dept.; Benitez-Medina, C.; /Colorado State U.; Breidenbach, M.; /SLAC; Burenkov, A.; /Moscow, ITEP; Cook, S.; /SLAC; Coppens, A.; /Carleton U.; Daniels, T.; /Massachusetts U., Amherst; DeVoe, R.; /Stanford U., Phys. Dept.; Dobi, A.; /Maryland U.; Dolinski, M.J.; Donato, K.; /Stanford U., Phys. Dept.; Fairbank, W., Jr.; /Colorado State U.; Farine, J.; /Laurentian U.; Giroux, G.; /Bern U., LHEP /Carleton U. /Stanford U., Phys. Dept. /Carleton U. /Laurentian U. /Carleton U. /SLAC /Indiana U. /Indiana U., CEEM /Korea U. /Stanford U., Phys. Dept. /SLAC /Alabama U. /Colorado State U. /Stanford U., Phys. Dept. /Alabama U. /SLAC /Stanford U., Phys. Dept. /Alabama U. /Massachusetts U., Amherst /SLAC /Alabama U. /SLAC /Maryland U. /Moscow, ITEP /Stanford U., Phys. Dept. /Maryland U. /Bern U., LHEP /Laurentian U. /SLAC /Maryland U.

    2012-05-03

    Tagging events with the coincident detection of a barium ion would greatly reduce the background for a neutrino-less double beta decay search in xenon. This paper describes progress towards realizing this goal. It outlines a source that can produce large quantities of Ba++ in gas, shows that this can be extracted to vacuum, and demonstrates a mechanism by which the Ba++ can be efficiently converted to Ba+ as required for laser identification. It is clear from this study that electrospray is a convenient mechanism for producing Ba++ is gas at atmospheric pressure. It is likely that the source will perform just as effectively at higher pressures. Even though the source region has water vapour and methanol vapour at the 0.3% level, there is no evidence for molecular formation. The use of TEA offers an effective method to achieve the charge state conversion. The overall design of the ion extraction from high pressure to vacuum is very similar to the scheme proposed for the final detector and this appears to work well although the efficiency is not yet determined.

  2. The influence of copper and bicarbonate ions on the corrosion of aluminum alloys saline solutions

    E-print Network

    Becerra-Diaz, Alcibiades

    1972-01-01

    . Rowe and Walker (19) used the electrical conductance technique for determining variations in corrosion rates of commercially pure aluminum immersed in waters containing such impurities as chloride, sulfate, bicarbonate, calcium, magnesium...THE INFLUENCE OF COPPER AND BICARBONATE IONS ON THE CORROSION OF ALUMINUM ALLOYS IN SALINE SOLUTIONS A Thesis by ALCIBIADES BECERRA-DIAZ Submitted to the Graduate College of Texas A&M University in partial fulfillment of the requirement...

  3. Pyroelectric properties of barium strontium titanate films: Effect of thermal M. W. Cole,2

    E-print Network

    Alpay, S. Pamir

    Pyroelectric properties of barium strontium titanate films: Effect of thermal stresses J. Zhang,1 M pyroelectric properties of 001 -textured polycrystalline barium strontium titanate BaxSr1-xTiO3, BST films

  4. Enhanced dielectric properties from barium strontium titanate films with strontium titanate buffer layers

    E-print Network

    Alpay, S. Pamir

    Enhanced dielectric properties from barium strontium titanate films with strontium titanate buffer in their PE state. One of the leading material candidates for tunable materials is barium strontium titanate

  5. Acceleration of barium ions near 8000 km above an aurora

    NASA Technical Reports Server (NTRS)

    Stenbaek-Nielsen, H. C.; Hallinan, T. J.; Wescott, E. M.; Foeppl, H.

    1984-01-01

    A barium shaped charge, named Limerick, was released from a rocket launched from Poker Flat Research Range, Alaska, on March 30, 1982, at 1033 UT. The release took place in a small auroral breakup. The jet of ionized barium reached an altitude of 8100 km 14.5 min after release, indicating that there were no parallel electric fields below this altitude. At 8100 km the jet appeared to stop. Analysis shows that the barium at this altitude was effectively removed from the tip. It is concluded that the barium was actually accelerated upward, resulting in a large decrease in the line-of-sight density and hence the optical intensity. The parallel electric potential in the acceleration region must have been greater than 1 kV over an altitude interval of less than 200 km. The acceleration region, although presumably auroral in origin, did not seem to be related to individual auroral structures, but appeared to be a large-scale horizontal structure. The perpendicular electric field below, as deduced from the drift of the barium, was temporally and spatially very uniform and showed no variation related to individual auroral structures passing through.

  6. Calcium and Mitosis

    NASA Technical Reports Server (NTRS)

    Hepler, P.

    1983-01-01

    Although the mechanism of calcium regulation is not understood, there is evidence that calcium plays a role in mitosis. Experiments conducted show that: (1) the spindle apparatus contains a highly developed membrane system that has many characteristics of sarcoplasmic reticulum of muscle; (2) this membrane system contains calcium; and (3) there are ionic fluxes occurring during mitosis which can be seen by a variety of fluorescence probes. Whether the process of mitosis can be modulated by experimentally modulating calcium is discussed.

  7. The properties of barium stannate and aluminum oxide-based gas sensor

    Microsoft Academic Search

    I. Kocemba; M. Wróbel-J?drzejewska; A. Szychowska; J. Rynkowski; M. G?ówka

    2007-01-01

    The properties of sensors manufactured by pressing BaSnO3 and BaSnO3 with Al2O3 were studied. An impact of Al2O3 on sensitivity and stability of sensors was established. The results show that an addition of Al2O3 to BaSnO3 improves the mechanical strength, stability and sensitivity of sensors. Moreover, the decrease in the temperature of maximum sensitivity is observed. There is a broad

  8. RESEARCH ARTICLE CALCIUM CHANNEL STRUCTURE

    E-print Network

    Napp, Nils

    RESEARCH ARTICLE CALCIUM CHANNEL STRUCTURE Structural basis for a pH-sensitive calcium leak across,3 Wayne A. Hendrickson,1,2,4,5 Qun Liu1,4 * Calcium homeostasis balances passive calcium leak and active calcium uptake. Human Bax inhibitor­1 (hBI-1) is an antiapoptotic protein that mediates a calcium leak

  9. Evaluation of anti-corrosive pigments by pigment extract studies, atmospheric exposure and electrochemical impedance spectroscopy

    Microsoft Academic Search

    A. Amirudin; C. Barreau; R. Hellouin; D. Thierry

    1995-01-01

    The inhibition efficiencies of zinc chromate, barium metaborate, calcium silicate, amino carboxylate, calcium barium phosphosilicate, aluminum triphosphate and a modified zinc phosphate on the corrosion of steel and zinc were determined by polarization experiments on pigment extracts. Zinc phosphate and zinc chromate were the best and were studied further to determine the effect of pH and chloride concentration on their

  10. Calcium Secretion into Milk

    Microsoft Academic Search

    Margaret C. Neville

    2005-01-01

    Ionized calcium ([Ca2+]) is present in milk at concentrations around 3 mM, a concentration that drives the formation of complexes with citrate, phosphate, and casein, thereby generating compounds that carry the major portion of calcium in milk. In humans and cows, where it has been studied, changes in milk calcium appear to be regulated by the amount of citrate and

  11. Contribution of calcium oxalate to soil-exchangeable calcium

    USGS Publications Warehouse

    Dauer, Jenny M.; Perakis, Steven S.

    2013-01-01

    Acid deposition and repeated biomass harvest have decreased soil calcium (Ca) availability in many temperate forests worldwide, yet existing methods for assessing available soil Ca do not fully characterize soil Ca forms. To account for discrepancies in ecosystem Ca budgets, it has been hypothesized that the highly insoluble biomineral Ca oxalate might represent an additional soil Ca pool that is not detected in standard measures of soil-exchangeable Ca. We asked whether several standard method extractants for soil-exchangeable Ca could also access Ca held in Ca oxalate crystals using spike recovery tests in both pure solutions and soil extractions. In solutions of the extractants ammonium chloride, ammonium acetate, and barium chloride, we observed 2% to 104% dissolution of Ca oxalate crystals, with dissolution increasing with both solution molarity and ionic potential of cation extractant. In spike recovery tests using a low-Ca soil, we estimate that 1 M ammonium acetate extraction dissolved sufficient Ca oxalate to contribute an additional 52% to standard measurements of soil-exchangeable Ca. However, in a high-Ca soil, the amount of Ca oxalate spike that would dissolve in 1 M ammonium acetate extraction was difficult to detect against the large pool of exchangeable Ca. We conclude that Ca oxalate can contribute substantially to standard estimates of soil-exchangeable Ca in acid forest soils with low soil-exchangeable Ca. Consequently, measures of exchangeable Ca are unlikely to fully resolve discrepancies in ecosystem Ca mass balance unless the contribution of Ca oxalate to exchangeable Ca is also assessed.

  12. Advances in aluminum anodizing

    NASA Technical Reports Server (NTRS)

    Dale, K. H.

    1969-01-01

    White anodize is applied to aluminum alloy surfaces by specific surface preparation, anodizing, pigmentation, and sealing techniques. The development techniques resulted in alloys, which are used in space vehicles, with good reflectance values and excellent corrosive resistance.

  13. Corrosion Inhibitors for Aluminum.

    ERIC Educational Resources Information Center

    Muller, Bodo

    1995-01-01

    Describes a simple and reliable test method used to investigate the corrosion-inhibiting effects of various chelating agents on aluminum pigments in aqueous alkaline media. The experiments that are presented require no complicated or expensive electronic equipment. (DDR)

  14. Radiation dose in mass screening for gastric cancer with high-concentration barium sulfate compared with moderate-concentration barium sulfate.

    PubMed

    Yamamoto, K; Azuma, M; Kuroda, C; Kubo, T; Yabunaka, K; Yamazaki, H; Katsuda, T; Takeda, Y

    2009-06-01

    Recently, high-concentration barium sulfate has been developed and is used in many medical facilities. This study compared radiation dose using high-concentration and moderate-concentration barium sulfate. The dose was evaluated with an experimental method using a gastric phantom and with a clinical examination. In the former, the dose and X-ray tube load were measured on the phantom with two concentrations of barium sulfate. In the latter, the fluoroscopic dose-area product (DAP), the radiographic DAP and their sum, the total DAP, were investigated in 150 subjects (112 males, 38 females) treated with both concentrations of barium sulfate. The effective dose was calculated by the software of PCXMC in every case. The results of the experimental evaluation indicated that the effective dose and X-ray tube load were greater with high-concentration barium sulfate than with moderate-concentration barium sulfate (p < 0.05). The results of the clinical evaluation indicated that the fluoroscopic DAP was greater with moderate-concentration barium sulfate than with high-concentration barium sulfate (p < 0.05), but the radiographic DAP was quite the reverse, so the total DAP and effective dose were almost same with both concentrations of barium sulfate. We conclude that high-concentration barium sulfate does not increase radiation dose in mass screening for gastric cancer. PMID:19623859

  15. L = 1.24 Conjugate Magnetic Field Line Tracing Experiments With Barium Shaped Charges

    Microsoft Academic Search

    E. M. Wescott; E. P. Rieger; H. C. Stenbaek-Nielsen; T. N. Davis; H. M. Peek; P. J. Bottoms

    1974-01-01

    Barium ions are well suited for tracing out magnetic field lines, because they resonantly scatter sunlight in several visible wavelengths and because ions are constrained to spiral about magnetic field lines while traveling freely parallel to the field. By use of high explosive shaped charges with hollow conical liners of barium metal, detonated above 500-km altitude, jets of barium plasma

  16. Technical development: CT colonography without cathartic cleansing and with barium as the sole tagging agent

    Microsoft Academic Search

    Philippe Lefere; Stefaan Gryspeerdt; Marc Baekelandt; Bartel Van Holsbeeck

    2004-01-01

    The purpose of this study was to perform CT colonography (CTC) without cathartic colon cleansing. Four groups of 3 patients were prepared the day before CTC with a dedicated low residue diet, a hydration control allowing 2 liters of fluid intake and barium as tagging agent. Four different barium regimens were investigated. Groups 1 and 3 ingested barium over 1

  17. 21 CFR 201.304 - Tannic acid and barium enema preparations.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ...2012-04-01 2012-04-01 false Tannic acid and barium enema preparations. 201...Specific Drug Products § 201.304 Tannic acid and barium enema preparations. (a) It has become a widespread practice for tannic acid to be added to barium enemas to...

  18. 21 CFR 201.304 - Tannic acid and barium enema preparations.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ...2013-04-01 2013-04-01 false Tannic acid and barium enema preparations. 201...Specific Drug Products § 201.304 Tannic acid and barium enema preparations. (a) It has become a widespread practice for tannic acid to be added to barium enemas to...

  19. 21 CFR 201.304 - Tannic acid and barium enema preparations.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ...2014-04-01 2014-04-01 false Tannic acid and barium enema preparations. 201...Specific Drug Products § 201.304 Tannic acid and barium enema preparations. (a) It has become a widespread practice for tannic acid to be added to barium enemas to...

  20. Discrete Barium Strontium Titanate (BST) Thin-Film Interdigital Varactors on Alumina: Design, Fabrication, Characterization, and

    E-print Network

    Discrete Barium Strontium Titanate (BST) Thin-Film Interdigital Varactors on Alumina: Design, Raleigh, NC-27695-7914, USA. Email:jayeshnath@ieee.org Abstract -- Discrete Barium Strontium Titanate (BST, capacitors, BST, ferroelectric, thin-film, barium strontium titanate, bandpass filter, IP3, ACPR, temperature

  1. Optimization of High Tunability Barium Strontium Titanate Thin Films Grown by RF Magnetron

    E-print Network

    York, Robert A.

    Optimization of High Tunability Barium Strontium Titanate Thin Films Grown by RF Magnetron Abstract-- Barium strontium titanate is a solid solution perovskite with a field-dependent permittivity.7 MV/cm. I. INTRODUCTION In recent years there has been much interest in thin-film barium strontium

  2. Spectroscopy of Eu3+ ions in congruent strontium barium niobate crystals

    E-print Network

    Osnabrück, Universität

    Spectroscopy of Eu3+ ions in congruent strontium barium niobate crystals Ä. Andresen, A.-N. Bahar properties of single crystals of strontium barium niobate, grown from the congruently melting composition, electro-optic, pho- torefractive, and dielectric properties, the solid solution strontium barium niobate

  3. Introduction Strontium Barium Niobate k-Space Spectroscopy Results Conclusions Unraveling Relaxor Phase Transitions by

    E-print Network

    Osnabrück, Universität

    Introduction Strontium Barium Niobate k-Space Spectroscopy Results Conclusions Unraveling Relaxor 2009 WILLIAMSBURG WORKSHOP ON FUNDAMENTAL PHYSICS OF FERROELECTRICS #12;Introduction Strontium Barium ferroelectrics Introduction Strontium Barium Niobate k-Space Spectroscopy Results Conclusions SBN ­ SrxBa1-xNb2O6

  4. High tunability barium strontium titanate thin films for rf circuit applications

    E-print Network

    York, Robert A.

    High tunability barium strontium titanate thin films for rf circuit applications N. K. Pervez,a) P) Large variations in the permittivity of rf magnetron sputtered thin-film barium strontium titanate have/cm. © 2004 American Institute of Physics. [DOI: 10.1063/1.1818724] Barium strontium titanate (BST) is a solid

  5. Dielectric tunability of graded barium strontium titanate multilayers: Effect of thermal strains

    E-print Network

    Alpay, S. Pamir

    Dielectric tunability of graded barium strontium titanate multilayers: Effect of thermal strains M TEC of a multilayered barium strontium titanate Ba1-ySryTiO3 BST ferroelectric heterostructure such as barium strontium titanate Ba1-ySryTiO3 BST have emerged as leading candidates for such applications due

  6. Noncollinear Optical Frequency Doubling in Strontium Barium Niobate Arthur R. Tunyagi, Michael Ulex, and Klaus Betzler*

    E-print Network

    Osnabrück, Universität

    Noncollinear Optical Frequency Doubling in Strontium Barium Niobate Arthur R. Tunyagi, Michael Ulex of a novel noncollinear optical second-harmonic generation mechanism is reported. In strontium barium niobate mechanism which we detected in crystals of strontium barium niobate (SBN)--cone-shaped second

  7. Optimization of the tunability of barium strontium titanate films via epitaxial stresses

    E-print Network

    Alpay, S. Pamir

    Optimization of the tunability of barium strontium titanate films via epitaxial stresses Z.-G. Ban The tunability of epitaxial barium strontium titanate films is analyzed theoretically using a phenomenological.1063/1.1524310 I. INTRODUCTION Thin films of barium strontium titanate (BaxSr1 xTiO3, BST have long been recognized

  8. Barium Titanate Nanoparticles in Block Copolymer Tu Lee,*,, Nan Yao, Hiroaki Imai,, and Ilhan A. Aksay,

    E-print Network

    Aksay, Ilhan A.

    Barium Titanate Nanoparticles in Block Copolymer Tu Lee,*,, Nan Yao, Hiroaki Imai,, and Ilhan A-polybutadiene-polystyrene (Kraton D1102). The barium titanated Kraton thin film had remnants of the cylindrical morphology of a plain Kraton thin film with an interdomain spacing of 23 nm. The procedure of barium titanation

  9. 21 CFR 201.304 - Tannic acid and barium enema preparations.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ...2010-04-01 2010-04-01 false Tannic acid and barium enema preparations. 201...Specific Drug Products § 201.304 Tannic acid and barium enema preparations. (a) It has become a widespread practice for tannic acid to be added to barium enemas to...

  10. 21 CFR 201.304 - Tannic acid and barium enema preparations.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ...2011-04-01 2011-04-01 false Tannic acid and barium enema preparations. 201...Specific Drug Products § 201.304 Tannic acid and barium enema preparations. (a) It has become a widespread practice for tannic acid to be added to barium enemas to...

  11. Cation non-stoichiometry in yttrium-doped barium zirconate: phase behavior, microstructure, and proton conductivity

    E-print Network

    Cation non-stoichiometry in yttrium-doped barium zirconate: phase behavior, microstructure as the predominant secondary phase and the barium zirconate reverting to an undoped composition. From the relative conductivity. Barium zirconate, specifically yttrium-doped BaZrO3, has attracted particular attention amongst

  12. Enhanced Sintering of Yttrium-Doped Barium Zirconate by Addition of ZnO

    E-print Network

    Haile, Sossina M.

    Enhanced Sintering of Yttrium-Doped Barium Zirconate by Addition of ZnO Peter Babilo and Sossina M properties of doped barium zirconate have been examined. With the use of zinc ox- ide as a sintering aid, Ba of the material under flowing CO2 showed ZnO-modified barium zirconate to exhibit excellent chemical stability

  13. Defect Chemistry of Yttrium-Doped Barium Zirconate: A Thermodynamic Analysis of Water Uptake

    E-print Network

    Defect Chemistry of Yttrium-Doped Barium Zirconate: A Thermodynamic Analysis of Water Uptake-based SOFCs.3 Of known proton conducting oxides, yttrium-doped barium zirconate (BYZ) is particularly mobile species. Doping with trivalent yttrium onto the tetravalent zirconium in barium zirconate

  14. A Case of Recurrent Renal Aluminum Hydroxide Stone

    PubMed Central

    Cak?roglu, Basri; Dogan, Akif Nuri; Tas, Tuncay; Gozukucuk, Ramazan; Uyanik, Bekir Sami

    2014-01-01

    Renal stone disease is characterized by the differences depending on the age, gender, and the geographic location of the patients. Seventy-five percent of the renal stone components is the calcium (Ca). The most common type of the stones is the Ca oxalate stones, while Ca phosphate, uric acid, struvite, and sistine stones are more rarely reported. Other than these types, triamterene, adenosine, silica, indinavir, and ephedrine stones are also reported in the literature as case reports. However, to the best of our knowledge, aluminum hydroxide stones was not reported reported before. Herein we will report a 38-years-old woman with the history of recurrent renal colic disease whose renal stone was determined as aluminum hydroxide stone in type. Aluminum mineral may be considered in the formation of kidney stones as it is widely used in the field of healthcare and cosmetics. PMID:25013740

  15. A case of recurrent renal aluminum hydroxide stone.

    PubMed

    Cak?roglu, Basri; Dogan, Akif Nuri; Tas, Tuncay; Gozukucuk, Ramazan; Uyanik, Bekir Sami

    2014-01-01

    Renal stone disease is characterized by the differences depending on the age, gender, and the geographic location of the patients. Seventy-five percent of the renal stone components is the calcium (Ca). The most common type of the stones is the Ca oxalate stones, while Ca phosphate, uric acid, struvite, and sistine stones are more rarely reported. Other than these types, triamterene, adenosine, silica, indinavir, and ephedrine stones are also reported in the literature as case reports. However, to the best of our knowledge, aluminum hydroxide stones was not reported reported before. Herein we will report a 38-years-old woman with the history of recurrent renal colic disease whose renal stone was determined as aluminum hydroxide stone in type. Aluminum mineral may be considered in the formation of kidney stones as it is widely used in the field of healthcare and cosmetics. PMID:25013740

  16. Prompt ionization in the CRIT II barium releases

    NASA Astrophysics Data System (ADS)

    Torbert, R. B.; Kletzing, C. A.; Liou, K.; Rau, D.

    1992-05-01

    Observations of electron and ion distributions inside a fast neutral barium jet in the ionosphere show significant fluxes within 4 km of release, presumably related to beam plasma instability processes involved in the Critical Ionization Velocity (CIV) effect. Electron fluxes exceeding 5 x 10 exp 12/sq cm-str-sec-keV were responsible for ionizing both the streaming barium and ambient oxygen. Resulting ion fluxes seem to be consistent with 1-2 percent ionization of the fast barium, as reported by optical observations, although the extended spatial distribution of the optically observed ions is difficult to reconcile with the in situ observations. When the perpendicular velocity of the neutrals falls below critical values, these processes shut off. Although these observations resemble the earlier Porcupine experimental results (Haerendel, 1982), theoretical understanding of the differences between these data and that of earlier negative experiments is still lacking.

  17. Chemical compositions of four barium stars

    E-print Network

    Y. C. Liang; G. Zhao; Y. Q. Chen; H. M. Qiu; B. Zhang

    2003-12-15

    Chemical compositions of four barium stars HD 26886, HD 27271, HD 50082 and HD 98839 are studied based on high resolution, high signal-to-noise Echelle spectra. Results show that all of them are disk stars. Their \\alpha and iron peak elements are similar to the solar abundances. The neutron-capture process elements are overabundant relative to the Solar. The heavy-element abundances of the strong Ba star HD 50082 are higher than those of other three mild Ba stars. Its mass is 1.32Msun (+0.28,-0.22Msun), and is consistent with the average mass of strong Ba stars (1.5Msun). For mild Ba star HD 27271 and HD 26886, the derived masses are 1.90Msun (+0.25,-0.20Msun) and 2.78Msun (+0.75,-0.78M_sun), respectively, which are consistent with the average mass of mild Ba stars. We also calculate the theoretical abundances of Ba stars by combining the AGB stars nucleosynthesis and wind accretion formation scenario of Ba binary systems. The comparisons between the observed abundance patterns of the sample stars with the theoretical results show that wind accretion scenario can explain the abundance patterns of HD 50082 and HD 27271 well, but fail to explain the abundances of HD 26886. It means that the mild Ba star HD 26886, with shorter orbital period (P11000 d), may be either a star with the heavy elements enriched by itself or a "true Ba" star.

  18. Timed barium esophagram in achalasia types.

    PubMed

    Zanoni, A; Rice, T W; Lopez, R; Birgisson, S; Shay, S S; Thota, P N; Baker, M E; Raymond, D P; Blackstone, E H

    2015-01-01

    Relationships of timed barium esophagram (TBE) findings to achalasia types defined by high-resolution manometry (HRM) have not been elucidated. Therefore, we correlated preoperative TBE and HRM measurements in achalasia types and related these to patient symptoms and prior treatments. From 2006 to 2013, 248 achalasia patients underwent TBE and HRM before Heller myotomy. TBE height and width were recorded at 1 and 5 minutes; HRM measured lower esophageal sphincter mean basal pressure, integrated relaxation pressure (IRP), and mean esophageal body contraction amplitude. Achalasia was classified into types I (25%), II (65%), and III (9.7%). TBE height at 5 minutes was higher for I (median 8 cm; interquartile range 6-12) and II (8 cm; 8-11) than for III (1 cm; 0-7). TBE width at 5 minutes was widest (3 cm; 2-4), narrower in II (2 cm; 2-3), and narrowest in I (1 cm; 0-2), P < 0.001. Volume remaining at 1 and 5 minutes was lower in III (1 m(2) ; 0-16) than I (42 m(2) ; 17-106) and II (39 m(2) ; 15-60), highlighting poorer emptying of I and II. Increasing TBE width correlated with deteriorating morphology and function from III to II to I. Symptoms poorly correlated with TBE and HRM. Prior treatment was associated with less regurgitation, faster emptying, and lower IRP. Although TBE and HRM are correlated in many respects, the wide range of their measurements observed in this study reveals a spectrum of morphology and dysfunction in achalasia that is best characterized by the combination of these studies. PMID:24649871

  19. Barium Levels in Soils and Centella asiatica.

    PubMed

    Ong, Ghim Hock; Yap, Chee Kong; Mahmood, Maziah; Tan, Soon Guan; Hamzah, Suhaimi

    2013-08-01

    In this study, Centella asiatica and surface soils were collected from 12 sampling sites in Peninsular Malaysia, and the barium (Ba) concentrations were determined. The Ba concentration [?g/g dry weight (dw)] was 63.72 to 382.01 ?g/g in soils while in C. asiatica, Ba concentrations ranged from 5.05 to 21.88 ?g/g for roots, 3.31 to 11.22 ?g/g for leaves and 2.37 to 6.14 ?g/g for stems. In C. asiatica, Ba accumulation was found to be the highest in roots followed by leaves and stems. The correlation coefficients (r) of Ba between plants and soils were found to be significantly positively correlated, with the highest correlation being between roots-soils (r=0.922, p<005), followed by leaves-soils (r=0.890, p<005) and stems-soils (r=0.848, p<005). This indicates that these three parts of C. asiatica are good biomonitors of Ba pollution. For the transplantation study, four sites were selected as unpolluted [(Universiti Putra Malaysia (UPM)], semi-polluted (Seri Kembangan and Balakong) and polluted sites (Juru). Based on the transplantation study under experimental field and laboratory conditions, Ba concentrations in C. asiatica were significantly (p<0.05) higher after three weeks of exposure at Seri Kembangan, Balakong and Juru. Thus, these experimental findings confirm that the leaves, stems and roots of C. asiatica can reflect the Ba levels in the soils where this plant is found. Three weeks after back transplantation to clean soils, the Ba levels in C. asiatica were still higher than the initial Ba level even though Ba elimination occurred. In conclusion, the leaves, stems and roots of C. asiatica are good biomonitors of Ba pollution. PMID:24575242

  20. The effect of radiopacifiers agents on pH, calcium release, radiopacity, and antimicrobial properties of different calcium hydroxide dressings.

    PubMed

    Ordinola-Zapata, Ronald; Bramante, Clovis Monteiro; GarcÍa-Godoy, Franklin; Moldauer, Bertram Ivan; Minotti, Paloma Gagliardi; TercíLIA Grizzo, Larissa; Duarte, Marco Antonio Hungaro

    2015-07-01

    The aim of this study was to evaluate the antimicrobial activity, pH level, calcium ion release, and radiopacity of calcium hydroxide pastes associated with three radiopacifying agents (iodoform, zinc oxide, and barium sulfate). For the pH and calcium release tests, 45 acrylic teeth were utilized and immersed in ultrapure water. After 24 h, 72 h, and 7 days the solution was analyzed by using a pH meter and an atomic absorption spectrophotometer. Polyethylene tubes filled with the pastes were used to perform the radiopacity test. For the antimicrobial test, 25 dentin specimens were infected intraorally in order to induce the biofilm colonization and treated with the pastes for 7 days. The Live/Dead technique and a confocal microscope were used to obtain the ratio of live cells. Parametric and nonparametric statistical tests were performed to show differences among the groups (P?calcium release test on the 7th day (P?>?0.05). The calcium hydroxide/iodoform samples had the highest radiopacity and antimicrobial activity against the biofilm-infected dentin in comparison to the other pastes (P?Calcium hydroxide mixed with 17% iodoform and 35% propylene glycol into a paste had the highest pH, calcium ion release, radiopacity, and the greatest antimicrobial action versus similar samples mixed with BaSO4 or ZnO. Microsc. Res. Tech. 78:620-625, 2015. © 2015 Wiley Periodicals, Inc. PMID:25990864

  1. Crystal structure of complex natural aluminum magnesium calcium iron oxide

    SciTech Connect

    Rastsvetaeva, R. K., E-mail: rast@ns.crys.ras.ru; Aksenov, S. M.; Verin, I. A. [Russian Academy of Sciences, Shubnikov Institute of Crystallography (Russian Federation)

    2010-07-15

    The structure of a new natural oxide found near the Tashelga River (Eastern Siberia) was studied by X-ray diffraction. The pseudo-orthorhombic unit cell parameters are a = 5.6973(1) A, b = 17.1823(4) A, c = 23.5718(5) A, {beta} = 90{sup o}, sp. gr. Pc. The structure was refined to R = 0.0516 based on 4773 reflections with vertical bar F vertical bar > 7{sigma}(F) taking into account the twin plane perpendicular to the z axis (the twin components are 0.47 and 0.53). The crystal-chemical formula (Z = 4) is Ca{sub 2}Mg{sub 2}{sup IV}Fe{sub 2}{sup (2+)IV}[Al{sub 14}{sup VI}O{sub 31}(OH)][Al{sub 2}{sup IV}O][Al{sup IV}]AL{sup IV}(OH)], where the Roman numerals designate the coordination of the atoms. The structure of the mineral is based on wide ribbons of edge-sharing Al octahedra (an integral part of the spinel layer). The ribbons run along the shortest x axis and are inclined to the y and z axes. The adjacent ribbons are shifted with respect to each other along the y axis, resulting in the formation of step-like layers in which the two-ribbon thickness alternates with the three-ribbon thickness. Additional Al octahedra and Mg and Fe{sup 2+} tetrahedra are located between the ribbons. The layers are linked together to form a three-dimensional framework by Al tetrahedra, Ca polyhedra, and hydrogen bonds with the participation of OH groups.

  2. Crystal structure of complex natural aluminum magnesium calcium iron oxide

    Microsoft Academic Search

    R. K. Rastsvetaeva; S. M. Aksenov; I. A. Verin

    2010-01-01

    The structure of a new natural oxide found near the Tashelga River (Eastern Siberia) was studied by X-ray diffraction. The\\u000a pseudo-orthorhombic unit cell parameters are a = 5.6973(1) Å, b = 17.1823(4) Å, c = 23.5718(5) Å, ? = 90°, sp. gr. Pc. The structure was refined to R = 0.0516 based on 4773 reflections with |F| > 7?(F) taking

  3. Crystal structure of complex natural aluminum magnesium calcium iron oxide

    NASA Astrophysics Data System (ADS)

    Rastsvetaeva, R. K.; Aksenov, S. M.; Verin, I. A.

    2010-07-01

    The structure of a new natural oxide found near the Tashelga River (Eastern Siberia) was studied by X-ray diffraction. The pseudo-orthorhombic unit cell parameters are a = 5.6973(1) Å, b = 17.1823(4) Å, c = 23.5718(5) Å, ? = 90°, sp. gr. Pc. The structure was refined to R = 0.0516 based on 4773 reflections with | F| > 7?( F) taking into account the twin plane perpendicular to the z axis (the twin components are 0.47 and 0.53). The crystal-chemical formula ( Z = 4) is Ca2Mg{2/IV}Fe{2/(2+)IV}[Al{14/VI}O31(OH)][Al{2/IV}O][AlIV]ALIV(OH)], where the Roman numerals designate the coordination of the atoms. The structure of the mineral is based on wide ribbons of edge-sharing Al octahedra (an integral part of the spinel layer). The ribbons run along the shortest x axis and are inclined to the y and z axes. The adjacent ribbons are shifted with respect to each other along the y axis, resulting in the formation of step-like layers in which the two-ribbon thickness alternates with the three-ribbon thickness. Additional Al octahedra and Mg and Fe2+ tetrahedra are located between the ribbons. The layers are linked together to form a three-dimensional framework by Al tetrahedra, Ca polyhedra, and hydrogen bonds with the participation of OH groups.

  4. Barium Tagging from nEXO Using Resonance Ionization Spectroscopy

    NASA Astrophysics Data System (ADS)

    Twelker, K.; Kravitz, S.

    nEXO is a 5-ton liquid enriched-xenon time projection chamber (TPC) to search for neutrinoless double-beta decay, designed to have the sensitivity to completely probe the inverted mass hierarchy of Majorana neutrinos. The detector will accommodate-as a background reduction technique-a system to recover and identify the barium decay product. This upgrade will allow a background-free measurement of neutrinoless double-beta decay and increase the half-life sensitivity of the experiment by at least one order of magnitude. Ongoing research and development includes a system to test barium extraction from liquid xenon using surface adsorption and Resonance Ionization Spectroscopy (RIS).

  5. Tunable dielectric properties of lead barium zirconate niobate films

    NASA Astrophysics Data System (ADS)

    Kuo, Ya-Ling; Wu, Jenn-Ming

    2006-09-01

    The effect of substitution of niobium for zirconium on tunable behavior of lead barium zirconate (PBZ) films was investigated. Lead barium zirconate niobate films were grown on Pt /Ti/SiO2/Si substrates using chemical solution deposition method. The substitution of Nb for Zr enhances tunable properties of PBZ films. The dielectric tunabilities are excellent, all higher than 45% with a maximum=60%. The substitution of Nb for Zr raises values of figure of merit (FOM) of films. The maximum FOM takes place at 5mol% Nb with a value of 90, which is about three times that of the corresponding PBZ film.

  6. Aluminum, parathyroid hormone, and osteomalacia

    SciTech Connect

    Burnatowska-Hledin, M.A.; Kaiser, L.; Mayor, G.H.

    1983-01-01

    Aluminum exposure in man is unavoidable. The occurrence of dialysis dementia, vitamin D-resistant osteomalacia, and hypochromic microcytic anemia in dialysis patients underscores the potential for aluminum toxicity. Although exposure via dialysate and hyperalimentation leads to significant tissue aluminum accumulation, the ubiquitous occurrence of aluminum and the severe pathology associated with large aluminum burdens suggest that smaller exposures via the gastrointestinal tract and lungs could represent an important, though largely unrecognized, public health problem. It is clear that some aluminum absorption occurs with the ingestion of small amounts of aluminum in the diet and medicines, and even greater aluminum absorption is seen in individuals consuming large amounts of aluminum present in antacids. Aluminum absorption is enhanced in the presence of elevated circulating parathyroid hormone. In addition, elevated PTH leads to the preferential deposition of aluminum in brain and bone. Consequently, PTH is likely to be involved in the pathogenesis of toxicities in those organs. PTH excess also seems to lead to the deposition of aluminum in the parathyroid gland. The in vitro demonstration that aluminum inhibits parathyroid hormone release is consistent with the findings of a euparathyroid state in dialysis patients with aluminum related vitamin D-resistant osteomalacia. Nevertheless, it seems likely that hyperparathyroidism is at least initially involved in the pathogenesis of aluminum neurotoxicity and osteomalacia; the increases in tissue aluminum stores are followed by suppression of parathyroid hormone release, which is required for the evolution of osteomalacia. Impaired renal function is not a prerequisite for increased tissue aluminum burdens, nor for aluminum-related organ toxicity. Consequently, it is likely that these diseases will be observed in populations other than those with chronic renal disease.

  7. Results of critical velocity experiments with barium, strontium, and calcium releases from CRRES satellite

    SciTech Connect

    Wescott, E.M.; Stenbaek-Nielsen, H.C.; Hampton, D.L.; Delamere, P.A. [Univ. of Alaska, Fairbanks, AK (United States)] [Univ. of Alaska, Fairbanks, AK (United States)

    1994-02-01

    As part of the NASA CRRES chemical release program in September 1990, two Ba and also one each Sr and Ca canisters of a boron-titanium thermite mixture, which vaporizes the element on ignition, were released near perigee after dusk in the South Pacific to study the critical velocity effect proposed by Alfven. The critical velocities of these three elements are 2.7, 3.5, and 5.4 km/s respectively, all well below the orbital velocity of 9.4 km/s. On September 10, 1990 a Sr and Ba pair (G-13, or critical ionization velocity (CIV) I) was released near Rarotonga at {approximately} 515 km altitude in a background electron density of 3.4 x 10{sup 6} cm{sup {minus}3}. On September 14, 1990, G-14 or CIV II released a Ca and Ba pair west of New Caledonia near 595 km at an electron density of 1.5 x 10{sup 6} cm{sup {minus}3}. Ions of all three elements were observed with low-light level imagers from two aircraft after they had transited up the magnetic field lines into the sunlight. Inventories of the observed ions indicate yields of 0.15% and 1.84% for Ba in the first and second experiments, 0.02% for Sr and 0.27% for Ca. Ionization from all the releases continued along the satellite trajectory much longer (>45 s) than expected for a CIV process. The ion production along the satellite track versus time typically shows a rapid rise to a peak in a few seconds followed by an exponential decrease to a level essentially constant rate. The characteristic distances for CIV I and II are 47 and 62 km, respectively. The authors interpret the early time rise and exponential fall to be due to CIV ionization, of 0.014% (CIV I) and 0.40% (CIV II) for the Ba releases. The later ions produced at a constant rate probably have origins from other such processes as stripping and associative ionization collisions with atmospheric constituents primarily O, and charge exchange with O{sup +}, He{sup +}, and H{sup +}. 44 refs., 9 figs., 1 tab.

  8. Straczekite, a new calcium barium potassium vanadate mineral from Wilson Springs, Arkansas.

    USGS Publications Warehouse

    Evans, H.T., Jr.; Nord, G.; Marinenko, J.; Milton, C.

    1984-01-01

    Straczekite occurs as a rare secondary mineral in fibrous seams, along with other V minerals (A.M. 64-713), in ore from the vanadium mine in Wilson Springs (formerly Potash Sulfur Springs), Garland County, Arkansas. It forms soft, thin laths of dark greenish black crystals up to 0.5 mm in length. Indexed XRD data are tabulated; strongest lines 3.486(100), 10.449(50), 1.8306(50), 1.9437(15) A; a 11.679, b 3.6608, c 10.636 A, beta 100.53o; space group C2/m, C2 or Cm. Chemical analysis gave V2O5 66.4, V2O4 15.3, Fe2O3 0.9, Na2O 0.4, K2O 1.8, CaO 2.5, BaO 5.5, H2O 7.2, = 100.0, leading to the formula (Ca0.39Ba0.31K0.33Na0.11)- 196(V4+1.59V5+6.31Fe3+0.10)O20.02(H2O)2.9; Dcalc. 3.21 g/cm3. A possible layer structure is discussed. The name is for J. A. Straczek, Chief Geologist at Union Carbide Corp.-R.A.H.

  9. Highly-textured thallium-barium-calcium-copper-oxide polycrystalline superconducting films on silver substrates

    SciTech Connect

    Arendt, P.; Elliott, N.; Cooke, D.W.; Dye, R.; Gray, E.; Hubbard, K.; Martin, J.; Reeves, G.; Brown, D.; Klapetzky, A.

    1990-01-01

    Thick (8 to 10 {mu}m) Ba--Ca--Cu--O films have been rf magnetron sputtered onto Ag alloy (Consil 995) substrates. The films were given a post-deposition anneal in an over pressure of Tl in order to form the superconducting phases. Annealing protocols were done which result in predominantly the 1212 and 2212 phases. The substrate orientation was varied to determine its effect on film orientation. Material properties of the films were characterized by x-ray diffraction (XRD), ion beam backscattering spectroscopy, energy dispersive x-ray analysis (EDAX), and scanning electron microscopy (SEM). Electrical characterization of the films was done using dynamic impedance (DI) at 10 kHz and rf surface resistance (R{sub s}) at 18 GHz in a TE{sub 011} fundamental mode cavity. 19 refs., 7 figs.

  10. Ion-dependent Inactivation of Barium Current through L-type Calcium Channels

    PubMed Central

    Ferreira, Gonzalo; Yi, Jianxun; Ríos, Eduardo; Shirokov, Roman

    1997-01-01

    It is widely believed that Ba2+ currents carried through L-type Ca2+ channels inactivate by a voltage- dependent mechanism similar to that described for other voltage-dependent channels. Studying ionic and gating currents of rabbit cardiac Ca2+ channels expressed in different subunit combinations in tsA201 cells, we found a phase of Ba2+ current decay with characteristics of ion-dependent inactivation. Upon a long duration (20 s) depolarizing pulse, IBa decayed as the sum of two exponentials. The slow phase (? ? 6 s, 21°C) was parallel to a reduction of gating charge mobile at positive voltages, which was determined in the same cells. The fast phase of current decay (? ? 600 ms), involving about 50% of total decay, was not accompanied by decrease of gating currents. Its amplitude depended on voltage with a characteristic U-shape, reflecting reduction of inactivation at positive voltages. When Na+ was used as the charge carrier, decay of ionic current followed a single exponential, of rate similar to that of the slow decay of Ba2+ current. The reduction of Ba2+ current during a depolarizing pulse was not due to changes in the concentration gradients driving ion movement, because Ba2+ entry during the pulse did not change the reversal potential for Ba2+. A simple model of Ca2+-dependent inactivation (Shirokov, R., R. Levis, N. Shirokova, and E. Ríos. 1993. J. Gen. Physiol. 102:1005–1030) robustly accounts for fast Ba2+ current decay assuming the affinity of the inactivation site on the ?1 subunit to be 100 times lower for Ba2+ than Ca2+. PMID:9101404

  11. Results of critical velocity experiments with barium, strontium, and calcium releases from CRRES satellite

    NASA Technical Reports Server (NTRS)

    Wescott, E. M.; Stenbaek-Nielsen, H. C.; Hampton, D. L.; Delamere, P. A.

    1994-01-01

    As part of the NASA Combined Release and Radiation Effects Satellite (CRRES) chemical release program in September 1990, two Ba and also one each Sr and Ca canisters of a boron-titanium thermite mixture, which vaporizes the element on ignition, were released near perigee after dusk in the South Pacific to study the critical velocity effect proposed by Alfven. The critical velocities of these three elements are 2.7, 3.5, and 5.4 km/s respectively, all well below the orbital velocity of 9.4 km/s. On September 10, 1990, a Sr and Ba pair (G-13, or critical ionization velocity (CIV) I) was released near Rarotonga at approximately 515 km altitude in a background electron density of 3.4 x 10(exp 6)/cu cm. On September 14, 1990, G-14 or CIV II released a Ca and Ba pair west of New Caledonia near 595 km at an electron density of 1.5 x 10(exp 6)/cu cm. Ions of all three elements were observed with low-light level imagers from two aircraft after they had transited up the magnetic field lines into the sunlight. Emissions from the spherically expanding neutral gas shells below the solar terminator, observed with cameras filtered for the Ba(+) ion line at 4554 A and also in unfiltered imagers for approximately 15 s after release, are probably due to excitation by hot electrons created in the CIV process. The ions created clearly lost much of their energy, which we now show can be explained by elastic collisions: Ba(+) + O. Inventories of the observed ions indicate yields of 0.15% and 1.84% for Ba in the first and second experiments, 0.02% for Sr and 0.27% for Ca. Ionization from all the releases continued along the satellite trajectory much longer (greater than 45 s) than expected for a CIV process. The ion production along the satellite track versus time typically shows a rapid rise to a peak in a few seconds followed by an exponential decrease to a level essentially constant rate. The characteristic distances for CIV I and II are 47 and 62 km, respectively. We interpret the early time rise and exponential fall to be due to CIV ionization, of 0.014% (CIV I) and 0.40% (CIV II) for the Ba releases. The later ions produced at a constant rate probably have origins from other such processes as stripping and associative ionization collisions with atmospheric constituents primarily O, and charge exchange with O(+), He(+), and H(+). We suggest that the much larger Ba ionization rate in CIV II than CIV I is due to the fact that the release occurred in the peak Ca density where hot electrons were already present.

  12. Results of critical velocity experiments with barium, strontium, and calcium releases from CRRES satellite

    NASA Astrophysics Data System (ADS)

    Wescott, E. M.; Stenbaek-Nielsen, H. C.; Hampton, D. L.; Delamere, P. A.

    1994-02-01

    As part of the NASA Combined Release and Radiation Effects Satellite (CRRES) chemical release program in September 1990, two Ba and also one each Sr and Ca canisters of a boron-titanium thermite mixture, which vaporizes the element on ignition, were released near perigee after dusk in the South Pacific to study the critical velocity effect proposed by Alfven. The critical velocities of these three elements are 2.7, 3.5, and 5.4 km/s respectively, all well below the orbital velocity of 9.4 km/s. On September 10, 1990, a Sr and Ba pair (G-13, or critical ionization velocity (CIV) I) was released near Rarotonga at approximately 515 km altitude in a background electron density of 3.4 x 10(exp 6)/cu cm. On September 14, 1990, G-14 or CIV II released a Ca and Ba pair west of New Caledonia near 595 km at an electron density of 1.5 x 10(exp 6)/cu cm. Ions of all three elements were observed with low-light level imagers from two aircraft after they had transited up the magnetic field lines into the sunlight. Emissions from the spherically expanding neutral gas shells below the solar terminator, observed with cameras filtered for the Ba(+) ion line at 4554 A and also in unfiltered imagers for approximately 15 s after release, are probably due to excitation by hot electrons created in the CIV process. The ions created clearly lost much of their energy, which we now show can be explained by elastic collisions: Ba(+) + O. Inventories of the observed ions indicate yields of 0.15% and 1.84% for Ba in the first and second experiments, 0.02% for Sr and 0.27% for Ca. Ionization from all the releases continued along the satellite trajectory much longer (greater than 45 s) than expected for a CIV process. The ion production along the satellite track versus time typically shows a rapid rise to a peak in a few seconds followed by an exponential decrease to a level essentially constant rate. The characteristic distances for CIV I and II are 47 and 62 km, respectively. We interpret the early time rise and exponential fall to be due to CIV ionization, of 0.014% (CIV I) and 0.40% (CIV II) for the Ba releases. The later ions produced at a constant rate probably have origins from other such processes as stripping and associative ionization collisions with atmospheric constituents primarily O, and charge exchange with O(+), He(+), and H(+). We suggest that the much larger Ba ionization rate in CIV II than CIV I is due to the fact that the release occurred in the peak Ca density where hot electrons were already present.

  13. HEALTH EFFECTS OF HUMAN EXPOSURE TO BARIUM IN DRINKING WATER

    EPA Science Inventory

    The overall objective of this study was to examine by epidemiologic and supportive laboratory studies, the human health effects associated with ingestion of barium in drinking water exceeding the U.S. drinking water standard of 1.0 mg/l. The incidence of cardiovascular mortality ...

  14. Barium strontium titanate powders prepared by spray pyrolysis

    Microsoft Academic Search

    G. Brankovi?; Z. Brankovi?; M. S. Góes; C. O. Paiva-Santos; M. Cilense; J. A. Varela; E. Longo

    2005-01-01

    Ultasonic spray pyrolysis (SP) has been investigated for the production of the barium strontium titanate (BST) powders from the polymeric precursors. The processing parameters, such as flux of aerosol and temperature profile inside the furnace, were optimized to obtain single phase BST. The powders were characterized by the methods of X-ray diffraction analysis, SEM, EDS and TEM. The obtained powders

  15. Original article Response to barium selenate supplementation in sheep

    E-print Network

    Boyer, Edmond

    group did not receive any supplement of Se and/or vitamin E. The two groups were managed under the sameOriginal article Response to barium selenate supplementation in sheep kept at pasture supplements in the prevention of dis- orders related to Se deficiency in sheep maintained at pasture

  16. BARIUM AND RADIUM REMOVAL FROM GROUNDWATER BY ION EXCHANGE

    EPA Science Inventory

    The primary objective of this study was to determine the applicability of weak acid exchange resin in the hydrogen form for removal of hardness, barium and radium from groundwater. Weak acid resin in the hydrogen form eliminates the addition of sodium to drinking water. The capac...

  17. PROPOSED ORAL REFERENCE DOSE (RFD) FOR BARIUM AND COMPOUNDS

    EPA Science Inventory

    The Integrated Risk Information System (IRIS) is a database of EPA's consensus opinion of the human health effects that may result from exposure to various substances found in the environment. A Toxicological Review and IRIS Summary were prepared for barium and compounds in 1998 ...

  18. Recycled Aluminum Ornaments

    NSDL National Science Digital Library

    Wishart, Ray

    This lesson plan from ATEEC will explain the principles of recycling. The activity would be most appropriate for technology studies or high school science classes. In all, it would require 2-5 hours of class time to complete. The purpose of the lesson is to demonstrate how aluminum is recycled. This laboratory activity does require some special equipment including a heat source capable of melting aluminum and an outdoor work area. Extension activities are also provided. The lesson plan is available for download as a PDF; users must create a free, quick login with ATEEC to access the materials.

  19. Regeneration of aluminum hydride

    DOEpatents

    Graetz, Jason Allan (Mastic, NY); Reilly, James J. (Bellport, NY)

    2009-04-21

    The present invention provides methods and materials for the formation of hydrogen storage alanes, AlH.sub.x, where x is greater than 0 and less than or equal to 6 at reduced H.sub.2 pressures and temperatures. The methods rely upon reduction of the change in free energy of the reaction between aluminum and molecular H.sub.2. The change in free energy is reduced by lowering the entropy change during the reaction by providing aluminum in a state of high entropy, by increasing the magnitude of the change in enthalpy of the reaction or combinations thereof.

  20. Molecular Structure of Aluminum Fluoride

    NSDL National Science Digital Library

    2003-06-02

    Aluminum Fluoride is a solid, off-white, free-flowing granular material, insoluble in most organic and inorganic liquids at room temperatures. It is soluble in many fused salts. Aluminum Fluoride is used by aluminum producers to increase the conductivity of electrolytes in the smelting process. It is used as a flux ingredient for the removal of magnesium in refining aluminum scrap, by the ceramic industry for some body and glazing mixtures, and in the production of specialty refractory products.

  1. Mechanism and kinetics of aluminum and iron leaching from coal fly ash by sulfuric acid

    Microsoft Academic Search

    A. Seidel; Y. Zimmels

    1998-01-01

    The mechanism and kinetics of leaching of aluminum and iron from Coal Fly Ash (CFA), by sulfuric acid, involves a rate controlling step of mass transfer. It is shown that, in the leaching process, particles follow the shrinking core model with respect to formation of unreacted core that is encapsulated by a leached, porous, layer. Formation of diffusion resistant calcium

  2. CALCIUM EQUILIBRIUM IN MUSCLE

    PubMed Central

    Gilbert, Daniel L.; Fenn, Wallace O.

    1957-01-01

    1. A study of the calcium equilibrium in isolated frog muscle has been attempted. 2. When sartorius muscles were immersed in Ca45 Ringer's solution, the surface phase took up the Ca45 in about 1 minute; the extracellular water space and connective tissue in about 30 minutes; and the intracellular space in about 300 minutes. 3. The percentages of total calcium in the whole muscle immersed in Ringer's solution was as follows: 10 per cent in the surface phase; 12 per cent in the extracellular water space; 17 per cent in the dry connective tissue; 24 per cent in the intracellular space; and 37 per cent as non-exchangeable calcium. 4. The exchange constants of isolated frog sartorius muscle to calcium has been determined. The flux of intracellular calcium in the steady state was approximately 0.8 mM/(liter hr). 5. It appears that there is a calcium pump pushing calcium out of the cell against an electrochemical gradient of about 4 cal./mM of calcium. However, since the flux is low, the maximum energy required per hour to pump calcium out of the cell against this high gradient is only about 2 cal./kg. muscle or about 1 per cent of the resting energy. PMID:13398571

  3. RECLAMATION OF ALUMINUM FINISHING SLUDGES

    EPA Science Inventory

    The research study of the reclamation of aluminum-anodizing sludges was conducted in two sequential phases focused on enhanced dewatering of aluminum-anodizing sludges to produce commercial-strength solutions of aluminum sulfate, i.e., liquid alum. The use of high-pressure (14 to...

  4. Aluminum-lithium for aerospace

    Microsoft Academic Search

    P. S. Fielding; G. J. Wolf

    1996-01-01

    Aluminum-lithium alloys were developed primarily to reduce the weight of aircraft and aerospace structures. Lithium is the lightest metallic element, and each 1% of lithium added to aluminum reduces alloy density by about 3% and increases modulus by about 5%. Though lithium has a solubility limit of 4.2% in aluminum, the amount of lithium ranges between 1 and 3% in

  5. Building an aluminum car

    SciTech Connect

    Ashley, S.

    1994-05-01

    This article examines the increasing use of aluminum in automobiles to decrease weight and consequently increase fuel economy. The topics of the article include federal fuel economy goals, the development of optimum body structure and manufacturing techniques, comparison with steel, cost of materials, weight reduction and recycling of materials.

  6. Hydrogen diffusion in aluminum

    Microsoft Academic Search

    R MCLELLAN

    1983-01-01

    Although the diffusivity of hydrogen in aluminum has been measured by several different authors, there is essentially no mutual agreement and the sets of data are separated by orders of magnitude. There is little doubt these mass-flow determinations of the H-diffusivity are subject to great uncertainties connected with the presence of the surface oxide layer, as has been discussed recently

  7. Aluminum Sulfate 18 Hydrate

    ERIC Educational Resources Information Center

    Young, Jay A.

    2004-01-01

    A chemical laboratory information profile (CLIP) of the chemical, aluminum sulfate 18 hydrate, is presented. The profile lists physical and harmful properties, exposure limits, reactivity risks, and symptoms of major exposure for the benefit of teachers and students using the chemical in the laboratory.

  8. Aluminum Coatings for Steel

    Microsoft Academic Search

    Aruna Bahadur

    1996-01-01

    Aluminum coated steel possesses excellent oxidation and corrosion resistance in sulfur and marine: environments and can substitute for expensive alloy of steels. Hot dip aluminizing (HAD) and pack cementation calorizing (CAL) are dealt with in detail. IN HDA coats, some alloying action takes place, when the substrate is dipped in molten Al at 973 K for 1-2 minutes. The coat

  9. Penicillin- and barium-induced epileptiform bursting in hippocampal neurons: actions on Ca++ and K+ potentials.

    PubMed

    Hotson, J R; Prince, D A

    1981-07-01

    Both barium (Ba++) and penicillin produce spontaneous epileptiform burst generation in hippocampal neurons in vitro. Recent investigations suggest that Ba++ acts by both adding to a calcium (Ca++)-mediated depolarization and reducing potassium (K+) conductance. In contrast, it has been proposed that penicillin produces burst generation by attenuating inhibitory postsynaptic potentials. However, some evidence suggests that penicillin may also directly alter intrinsic membrane properties. We therefore compared the actions of penicillin and Ba++ on three intrinsic Ca++- or K+-mediated membrane events, namely, CA++ spikes, Ca++-dependent anomalous rectification, and K+-dependent afterhyperpolarization. Ba++ augmented the Ca++ potentials and attenuated the K+-dependent afterhyperpolarization; penicillin had no demonstrable effect on these events. Ba++ produced rhythmical burst firing and oscillations of the membrane potentials, while penicillin caused sporadic burst generation followed by a longlasting afterhyperpolarization. Synchronized, orthodromically evoked burst firing occurred after exposure to penicillin but not to Ba++. Ba++ and penicillin are prototypes of agents which induce epileptogenesis in mammalian cortical neurons by two different but probably interrelated mechanisms. Ba++ causes burst generation by disrupting a delicate balance between depolarizing Ca++ potentials and repolarizing, hyperpolarizing K+ potentials. Penicillin does not affect Ca++- or K+-mediated membrane events; other data suggest that it produces burst generation in hippocampal pyramidal neurons by attenuating gamma-aminobutyric acid-mediated synaptic inhibition, which in turn ordinarily limits intrinsic bursting. PMID:7271228

  10. ALUMINUM SOLUBILITY, CALCIUM-ALUMINUM EXCHANGE, AND PH IN ACID FOREST SOILS

    EPA Science Inventory

    Important components in several models designed to describe the effects of acid deposition on soils and surface waters are the pH-A1 and Ca-A1 exchange relationships. f A1 solubility is controlled by A1 trihydroxide minerals, the theoretical pH-A1 relationship can be described by...

  11. Mesoporous aluminum phosphite

    SciTech Connect

    El Haskouri, Jamal, E-mail: haskouri@uv.e [Institut de Ciencia dels Materials de la Universitat de Valencia (ICMUV), P. O. Box 22085, 46071 Valencia (Spain); Perez-Cabero, Monica; Guillem, Carmen; Latorre, Julio; Beltran, Aurelio; Beltran, Daniel [Institut de Ciencia dels Materials de la Universitat de Valencia (ICMUV), P. O. Box 22085, 46071 Valencia (Spain); Amoros, Pedro, E-mail: pedro.amoros@uv.e [Institut de Ciencia dels Materials de la Universitat de Valencia (ICMUV), P. O. Box 22085, 46071 Valencia (Spain)

    2009-08-15

    High surface area pure mesoporous aluminum-phosphorus oxide-based derivatives have been synthesized through an S{sup +}I{sup -} surfactant-assisted cooperative mechanism by means of a one-pot preparative procedure from aqueous solution and starting from aluminum atrane complexes and phosphoric and/or phosphorous acids. A soft chemical extraction procedure allows opening the pore system of the parent as-prepared materials by exchanging the surfactant without mesostructure collapse. The nature of the pore wall can be modulated from mesoporous aluminum phosphate (ALPO) up to total incorporation of phosphite entities (mesoporous aluminum phosphite), which results in a gradual evolution of the acidic properties of the final materials. While phosphate groups in ALPO act as network building blocks (bridging Al atoms), the phosphite entities become basically attached to the pore surface, what gives practically empty channels. The mesoporous nature of the final materials is confirmed by X-ray diffraction (XRD), transmission electron microscopy (TEM) and N{sub 2} adsorption-desorption isotherms. The materials present regular unimodal pore systems whose order decreases as the phosphite content increases. NMR spectroscopic results confirm the incorporation of oxo-phosphorus entities to the framework of these materials and also provide us useful information concerning the mechanism through which they are formed. - Abstract: TEM image of the mesoporous aluminum phosphite showing the hexagonal disordered pore array that is generated by using surfactant micelles as template. Also a scheme emphasizing the presence of an alumina-rich core and an ALPO-like pore surface is presented.

  12. Disorders of Calcium Metabolism

    Microsoft Academic Search

    John F. O’Toole

    2011-01-01

    The genetic contribution to calcium metabolism is well recognized. Many of the proteins that contribute to calcium homeostasis through intestinal absorption, bone deposition and resorption, renal reabsorption and the molecules regulating these processes have been identified. Mutations in many of the genes coding for these proteins have been identified and often have clear clinical phenotypes. These mutations are generally rare

  13. Calcium signaling in neurodegeneration

    PubMed Central

    Marambaud, Philippe; Dreses-Werringloer, Ute; Vingtdeux, Valérie

    2009-01-01

    Calcium is a key signaling ion involved in many different intracellular and extracellular processes ranging from synaptic activity to cell-cell communication and adhesion. The exact definition at the molecular level of the versatility of this ion has made overwhelming progress in the past several years and has been extensively reviewed. In the brain, calcium is fundamental in the control of synaptic activity and memory formation, a process that leads to the activation of specific calcium-dependent signal transduction pathways and implicates key protein effectors, such as CaMKs, MAPK/ERKs, and CREB. Properly controlled homeostasis of calcium signaling not only supports normal brain physiology but also maintains neuronal integrity and long-term cell survival. Emerging knowledge indicates that calcium homeostasis is not only critical for cell physiology and health, but also, when deregulated, can lead to neurodegeneration via complex and diverse mechanisms involved in selective neuronal impairments and death. The identification of several modulators of calcium homeostasis, such as presenilins and CALHM1, as potential factors involved in the pathogenesis of Alzheimer's disease, provides strong support for a role of calcium in neurodegeneration. These observations represent an important step towards understanding the molecular mechanisms of calcium signaling disturbances observed in different brain diseases such as Alzheimer's, Parkinson's, and Huntington's diseases. PMID:19419557

  14. Calcium Nutrition in Adolescence

    Microsoft Academic Search

    Marta Mesías; Isabel Seiquer; M. Pilar Navarro

    2011-01-01

    Adolescence is an important period of nutritional vulnerability due to increased dietary requirements for growth and development and special dietary habits. Calcium needs are elevated as a result of the intensive bone and muscular development and thus adequate calcium intake during growth is extremely important to reach the optimum peak bone mass and to protect against osteoporosis in the adult

  15. Lead in calcium supplements.

    PubMed Central

    Scelfo, G M; Flegal, A R

    2000-01-01

    Intercalibrated measurements of lead in calcium supplements indicate the importance of rigorous analytical techniques to accurately quantify contaminant exposures in complex matrices. Without such techniques, measurements of lead concentrations in calcium supplements may be either erroneously low, by as much as 50%, or below the detection limit needed for new public health criteria. In this study, we determined the lead content of 136 brands of supplements that were purchased in 1996. The calcium in the products was derived from natural sources (bonemeal, dolomite, or oyster shell) or was synthesized and/or refined (chelated and nonchelated calcium). The dried products were acid digested and analyzed for lead by high resolution-inductively coupled plasma-mass spectrometry. The method's limit of quantitation averaged 0.06 microg/g, with a coefficient of variation of 1.7% and a 90-100% lead recovery of a bonemeal standard reference material. Two-thirds of those calcium supplements failed to meet the 1999 California criteria for acceptable lead levels (1.5 microg/daily dose of calcium) in consumer products. The nonchelated synthesized and/or refined calcium products, specifically antacids and infant formulas, had the lowest lead concentrations, ranging from nondetectable to 2.9 microg Pb/g calcium, and had the largest proportion of brands meeting the new criteria (85% of the antacids and 100% of the infant formulas). Images Figure 1 Figure 2 PMID:10753088

  16. Surface studies of barium and barium oxide on tungsten and its application to understanding the mechanism of operation of an impregnated tungsten cathode

    NASA Technical Reports Server (NTRS)

    Forman, R.

    1976-01-01

    Surface studies have been made of multilayer and monolayer films of barium and barium oxide on a tungsten substrate. The purpose of the investigation was to synthesize the surface conditions that exist on an activated impregnated tungsten cathode and obtain a better understanding of the mechanism of operation of such cathodes. The techniques employed in these measurements were Auger spectroscopy and work-function measurements. The results of this study show that the surface of an impregnated cathode is identical to that observed for a synthesized monolayer or partial monolayer of barium on oxidized tungsten by evaluating Auger spectra and work-function measurements. Data obtained from desorption studies of barium monolayers on a tungsten substrate in conjunction with Auger and work-function results have been interpreted to show that throughout most of its life an impreganated cathode has a partial monolayer, rather than a monolayer, of barium on its surface.

  17. Interactions between chloride and sulfate or silica removals from wastewater using an advanced lime-aluminum softening process: equilibrium modeling.

    PubMed

    Abdel-Wahab, Ahmed; Batchelor, Bill

    2007-05-01

    Interactions among chloride, sulfate, and silica removals from recycled industrial wastewater using an ultra-high lime with aluminum process (UHLA) were studied. An equilibrium model that is able to accurately predict the chemical behavior and interactions between chloride and sulfate or silica with UHLA at various initial conditions and chemical reagents was developed. X-ray diffraction (XRD) analysis was conducted to identify the precipitated solids formed in the UHLA process. Model predictions indicated that simultaneous removal of sulfate and chloride can be best described by the formation of a solid solution containing calcium chloroaluminate, calcium sulfoaluminate (ettringite), calcium monosulfate, tricalcium hydroxyaluminate, and tetracalcium hydroxyaluminate. However, simultaneous removal of silica and chloride can be best described by precipitation of calcium silicate and calcium aluminosilicate in addition to a solid solution containing calcium chloroaluminate, tricalcium hydroxyaluminate, and tetracalcium hydroxyaluminate. The XRD results indicated the presence of the same solids assumed by the equilibrium model. PMID:17571843

  18. Current perspectives in colon radiography: the postendoscopy and postbiopsy barium enema.

    PubMed

    Lappas, J C; Maglinte, D D

    1985-01-01

    Controversy prevails regarding the same-day performance of barium enema examinations and endoscopy. Concerns focus upon the diagnostic quality of the postendoscopy barium enema and the risk of perforation if colorectal biopsy is performed during the endoscopy. Results of a study of 295 patients support that rigid or fiberoptic sigmoidoscopy can be performed the same day as single- or double-contrast barium enemas without adversely affecting the quality or interpretation of the barium examination. Animal studies suggest that a barium enema may be performed safely immediately after a superficial biopsy of a nondiseased colon and 6 days after a deep biopsy. Barium sulfate appears to have no deleterious effect on the healing of colorectal biopsy sites. These findings have important implications when considering health care logistics and cost containment. PMID:3896653

  19. NASA/Max Planck Institute Barium Ion Cloud Project.

    NASA Technical Reports Server (NTRS)

    Brence, W. A.; Carr, R. E.; Gerlach, J. C.; Neuss, H.

    1973-01-01

    NASA and the Max Planck Institute for Extraterrestrial Physics (MPE), Munich, Germany, conducted a cooperative experiment involving the release and study of a barium cloud at 31,500 km altitude near the equatorial plane. The release was made near local magnetic midnight on Sept. 21, 1971. The MPE-built spacecraft contained a canister of 16 kg of Ba CuO mixture, a two-axis magnetometer, and other payload instrumentation. The objectives of the experiment were to investigate the interaction of the ionized barium cloud with the ambient medium and to deduce the properties of electric fields in the proximity of the release. An overview of the project is given to briefly summarize the organization, responsibilities, objectives, instrumentation, and operational aspects of the project.

  20. The Skylab barium plasma injection experiments. I - Convection observations

    NASA Technical Reports Server (NTRS)

    Wescott, E. M.; Stenbaek-Nielsen, H. C.; Davis, T. N.; Peek, H. M.

    1976-01-01

    Two barium-plasma injection experiments were carried out during magnetically active periods in conjunction with the Skylab 3 mission. The high-explosive shaped charges were launched near dawn on November 27 and December 4, 1973, UT. In both cases, the AE index was near 400 gammas, and extensive pulsating auroras covered the sky. The first experiment, Skylab Alpha, occurred in the waning phase of a 1000-gamma substorm, and the second, Skylab Beta, occurred in the expansive phase of an 800-gamma substorm. In both, the convection was generally magnetically eastward, with 100-km-level electric fields near 40 mV/m. However, in the Alpha experiment the observed orientation of the barium flux tube fit theoretical field lines having no parallel current, but the Beta flux-tube orientation indicated a substantial upward parallel sheet current.

  1. Preparation of a metalorganic deposition precursor for barium titanate

    SciTech Connect

    Apblett, A.W.; Georgieva, G.D.; Raygoza-Maceda, I. [Tulane Univ., New Orleans, LA (United States)

    1994-12-31

    A new, facile preparative route for BaTiO(Ox){sub 2} has been developed (Ox=oxalate). This involves passing a solution of K{sub 2}TiO(Ox){sub 2} through an ion-exchange resin to convert it to the proteo-derivative, H{sub 2}TiO(Ox){sub 2}. Treatment of the latter with BaCl{sub 2} results in precipitation of BaTiO(Ox){sub 2} with a ratio of barium:titanium of 1:1.009. Finally, reaction of BaTiO(Ox){sub 2} with refluxing methoxyacetic acid produces an alcohol and chlorocarbon soluble ceramic precursor that may be used to prepare thin films of barium titanate by metalorganic deposition.

  2. Dielectric function for doped graphene layer with barium titanate

    NASA Astrophysics Data System (ADS)

    Martinez Ramos, Manuel; Garces Garcia, Eric; Magana, Fernado; Vazquez Fonseca, Gerardo Jorge

    2015-03-01

    The aim of our study is to calculate the dielectric function for a system formed with a graphene layer doped with barium titanate. Density functional theory, within the local density approximation, plane-waves and pseudopotentials scheme as implemented in Quantum Espresso suite of programs was used. We considered 128 carbon atoms with a barium titanate cluster of 11 molecules as unit cell with periodic conditions. The geometry optimization is achieved. Optimization of structural configuration is performed by relaxation of all atomic positions to minimize their total energies. Band structure, density of states and linear optical response (the imaginary part of dielectric tensor) were calculated. We thank Dirección General de Asuntos del Personal Académico de la Universidad Nacional Autónoma de México, partial financial support by Grant IN-106514 and we also thank Miztli Super-Computing center the technical assistance.

  3. Absorbing properties and structural design of microwave absorbers based on carbonyl iron and barium ferrite

    Microsoft Academic Search

    Y. B. Feng; T. Qiu; C. Y. Shen

    2007-01-01

    Carbonyl iron and barium ferrite powder (BaZn1.5Co0.5Fe16O27) were prepared in this work. The complex permittivity and permeability spectra for rubber radar absorbing materials employing carbonyl iron and barium ferrite powders were measured. A database describing the frequency dependence of the permittivities and permeabilities of the carbonyl iron and barium ferrite microwave absorbers with various powder percentage compositions in 2–18GHz was

  4. Absorbing properties and structural design of microwave absorbers based on carbonyl iron and barium ferrite

    Microsoft Academic Search

    Y. B. Feng; T. Qiu; C. Y. Shen

    2007-01-01

    Carbonyl iron and barium ferrite powder (BaZn1.5Co0.5Fe16O27) were prepared in this work. The complex permittivity and permeability spectra for rubber radar absorbing materials employing carbonyl iron and barium ferrite powders were measured. A database describing the frequency dependence of the permittivities and permeabilities of the carbonyl iron and barium ferrite microwave absorbers with various powder percentage compositions in 2 18

  5. Synthesis of barium titanate films by plasma electrolytic oxidation at room electrolyte temperature

    Microsoft Academic Search

    Chu-Tsun Wu; Fu-Hsing Lu

    2005-01-01

    Crystalline barium titanate films were directly synthesized onto Ti plates by plasma electrolytic oxidation at room temperature using barium acetate and 2 M NaOH as electrolytes. The effect of the concentration of barium acetate ranging from 0.05 M to 0.5 M on the synthesis of BaTiO3 was investigated. XRD results showed that the formation of BaTiO3 required a minimum of

  6. The determination of calcium in phosphate, carbonate, and silicate rocks by flame photometer

    USGS Publications Warehouse

    Kramer, Henry

    1956-01-01

    A method has been developed for the determination of calcium in phosphate, carbonate, and silicate rocks using the Beckman flame photometer, with photomultiplier attachement. The sample is dissolved in hydrofluoric, nitric, and perchloric acids, the hydrofluoric and nitric acids are expelled, a radiation buffer consisting of aluminum, magnesium, iron, sodium, potassium, phosphoric acid, and nitric acid is added, and the solution is atomized in an oxy-hydrogen flame with an instrument setting of 554 mµ. Measurements are made by comparison against calcium standards, prepared in the same manner, in the 0 to 50 ppm range. The suppression of calcium emission by aluminum and phosphate was overcome by the addition of a large excess of magnesium. This addition almost completely restores the standard curve obtained from a solution of calcium nitrate. Interference was noted when the iron concentration in the aspirated solution (including the iron from the buffer) exceeded 100 ppm iron. Other common rock-forming elements did not interfere. The results obtained by this procedure are within ± 2 percent of the calcium oxide values obtained by other methods in the range 1 to 95 percent calcium oxide. In the 0 to 1 percent calcium oxide range the method compares favorably with standard methods.

  7. CALCIUM CHLORIDE PLANT LOOKING EAST. CALCIUM CHLORIDE BUILDING ON LEFT, ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    CALCIUM CHLORIDE PLANT LOOKING EAST. CALCIUM CHLORIDE BUILDING ON LEFT, CALCIUM CHLORIDE STORAGE BUILDING ON RIGHT OF CENTER WITH TOP OF SA (SODA ASH) BUILDING IN RIGHT BACKGROUND. - Solvay Process Company, Calcium Chloride Plant, Between Willis & Milton Avenues, Solvay, Onondaga County, NY

  8. Releasing-addition method for the flame-photometric determination of calcium in thermal waters

    USGS Publications Warehouse

    Rowe, J.J.

    1963-01-01

    Study of the interferences of silica and sulfate in the flame-photometric determination of calcium in thermal waters has led to the development of a method requiring no prior chemical separations. The interference effects of silica, sulfate, potassium, sodium, aluminum, and phosphate are overcome by an addition technique coupled with the use of magnesium as a releasing agent. ?? 1963.

  9. [Concentrations of fluorine, aluminum and magnesium in some structures of the central nervous system of rats exposed to aluminum and fluorine in drinking water].

    PubMed

    Lubkowska, Anna; Chlubek, Dariusz; Machoy-Mokrzy?ska, Anna; Noce?, Iwona; Zyluk, Beata; Nowacki, Przemys?aw

    2004-01-01

    Fluorine and aluminum are able to pass through the blood-brain barrier and accumulate in the central nervous system (CNS) of exposed animals. Chronic intoxication is accompanied by behavioral disorders, degenerative changes, and abnormalities of aerobic metabolism of the neurons. Awareness of the role of aluminum in Alzheimer's disease stems from epidemiological studies demonstrating increased prevalence of this condition in areas with relatively high content of aluminum in drinking water. The uptake of aluminum in the gastrointestinal tract is decreased in the presence of iron, calcium, magnesium, phosphate, or fluoride. Many magnesium-containing enzymes are affected by aluminum, which is able to replace magnesium and thus reduce their activity. The purpose of this study was to determine the concentrations of fluorine, aluminum, and magnesium in some structures of the CNS of rats exposed to fluorine and aluminum in water. Our material consisted of 64 Wistar rats divided into eight equal groups. Groups I, II and III were female rats exposed, respectively, to 100 ppm fluorine ions, 300 ppm aluminum ions or both at same doses alternating every second day. Groups IA, IIA and IIIA consisted of male rats exposed like the respective female groups. Control groups K1--females and K2--males received distilled water ad libitum. Exposure lasted 31 days whereupon the animals were anesthetized with ketamine and sacrificed. The brain was collected and the cerebellum, brain cortex, and hippocampus were isolated. Concentrations of fluorine, aluminum, and magnesium were measured with prior mineralization of wet tissues in a microwave oven. Fluorine concentrations were determined with a potentiometric method and ion-selective electrode. Aluminum was measured with ICP (inductively coupled plasma) and magnesium with ASA (atomic absorption spectrometry). The highest concentrations of fluorine were observed in rats exposed to fluorine only. The same pattern was true for aluminum. Groups exposed alternatively to both elements demonstrated lower accumulation of fluorine whereas accumulation of aluminum did not change significantly. Apparently, aluminum reduced the availability of fluorine but there was no reciprocal effect. No significant changes in the concentrations of magnesium were noted, regardless of the brain structure or group. It can thus be concluded that exposure to fluorine, aluminum or both has little effect on the concentration of magnesium in the CNS of rats. PMID:16892590

  10. Aluminum microstructures on anodic alumina for aluminum wiring boards.

    PubMed

    Jha, Himendra; Kikuchi, Tatsuya; Sakairi, Masatoshi; Takahashi, Hideaki

    2010-03-01

    The paper demonstrates simple methods for the fabrication of aluminum microstructures on the anodic oxide film of aluminum. The aluminum sheets were first engraved (patterned) either by laser beam or by embossing to form deep grooves on the surface. One side of the sheet was then anodized, blocking the other side by using polymer mask to form the anodic alumina. Because of the lower thickness at the bottom part of the grooves, the part was completely anodized before the complete oxidation of the other parts. Such selectively complete anodizing resulted in the patterns of metallic aluminum on anodic alumina. Using the technique, we fabricated microstructures such as line patterns and a simple wiring circuit-board-like structure on the anodic alumina. The aluminum microstructures fabricated by the techniques were embedded in anodic alumina/aluminum sheet, and this technique is promising for applications in electronic packaging and devices. PMID:20356280

  11. The positive temperature coefficient of resistivity in barium titanate

    Microsoft Academic Search

    B. Huybrechts; K. Ishizaki; M. Takata

    1995-01-01

    Positive temperature coefficient of resistivity (PTCR) materials have become very important components, and among these materials\\u000a barium titanate compounds make up the most important group. When properly processed these compounds show a high PTCR at the\\u000a Curie temperature (the transition temperature from the ferroelectric tetragonal phase to the paraelectric cube phase). In\\u000a the first half of this paper literature related

  12. Isotopic Masses of Hydrogen, Chlorine, Barium, Cerium, and Neodymium

    Microsoft Academic Search

    Jay L. Benson; Walter H. Johnson

    1966-01-01

    The 16-in. double-focusing mass spectrometer at the University of Minnesota has been employed to measure the atomic mass of H1 and the atomic masses and isotopic mass differences of chlorine, barium, cerium, and neodymium. Recent improvements in instrumentation have increased the precision of both narrow and wide doublet measurements. The doublet C11H22-C12H10 was used to relate the H1 mass directly

  13. Elastic and Piezoelectric Coefficients of Single-Crystal Barium Titanate

    Microsoft Academic Search

    Don Berlincourt; Hans Jaffe

    1958-01-01

    Mechanical resonance and antiresonance frequencies were measured on barium titanate single-crystal elements maintained under electric dc bias from -50°C to +150°C. A complete set of elastic, piezoelectric, and dielectric constants of the tetragonal modification at 25°C is obtained. The elastic compliances show substantial deviation from cubic symmetry. Measurements in the orthorhombic state show longitudinal compliance four times higher than in

  14. Luminescence of re 2+ (re = Sm, Yb) in barium octoborate

    Microsoft Academic Search

    Qinghua Zeng; Zhiwu Pei; Shubing Wang; Qiang Su; Shaozhe Lu

    1999-01-01

    The reduction process from trivalent to divalent state for Sm3+ and Yb3+ ions in barium borates (BaB8O13) prepared in air was observed. The luminescence properties of these divalent rare-earth ions were studied. Yb2+ shows an f-d broad emission band, due to the 4f14 ? 4f135d transition, while the Sm2+ ion shows an f ? f transition. From the spectra of

  15. Anomalous permittivity in fine-grain barium titanate

    Microsoft Academic Search

    Steven Paul Ostrander

    1997-01-01

    Fine-grain barium titanate capacitors exhibit anomalously large permittivity. It is often observed that these materials will double or quadruple the room temperature permittivity of a coarse-grain counterpart. However, aside from a general consensus on this permittivity enhancement, the properties of the fine-grain material are poorly understood. This thesis examines the effect of grain size on dielectric properties of a self-consistent

  16. Aluminum toxicity and albumin.

    PubMed

    Kelly, A T; Short, B L; Rains, T C; May, J C; Progar, J J

    1989-01-01

    During a study of priming solutions for extracorporeal membrane oxygenation (ECMO) in the intensive care nursery, it was discovered that those solutions using certain brands of 25% albumin contained aluminum levels within the toxic range. When the brand was changed to a brand known to have a lower aluminum (Al) content, a marked drop in priming solution Al levels was measured. The heat exchanger was examined as a possible source of soluble Al. No evidence of elevated Al levels was found in fluids perfusing this heat exchanger when compared with a stainless steel heat exchanger. The Al content of various blood products was evaluated along with various brands of 5% albumin and 25% albumin. PMID:2597561

  17. Aluminum permanganate battery

    SciTech Connect

    Marsh, C.; Licht, S.L.

    1993-11-30

    A battery is provided comprising an aluminum anode, an aqueous solution of permanganate as the cathodic species and a second electrode capable of reducing permanganate. Such a battery system is characterized by its high energy density and low polarization losses when operating at high temperatures in a strong caustic electrolyte, i.e., high concentration of hydroxyl ions. A variety of anode and electrocatalyst materials are suitable for the efficient oxidation-reduction process and are elucidated.

  18. Toward remote ion-ion entanglement with barium

    NASA Astrophysics Data System (ADS)

    Noel, Thomas W.; Auchter, Carolyn; Chou, Chen-Kuan; Blinov, Boris B.

    2015-03-01

    We present work toward remote entanglement of barium ions in traps separated by a few meters. A new version of an ion trap specialized for remote entanglement is introduced. The new trap allows for highly efficient collection of ion fluorescence while simultaneously minimizing ion micromotion and aligning the trap position precisely to the focus of an in-vacuum parabolic mirror by using a set of bias electrodes and a piezoelectric micro-positioning system. The success rate of the remote entanglement procedure depends strongly on the efficiency with which ion fluorescence can be coupled into an optical fiber. Characterization of our system in terms of ion fluorescence collection and fiber coupling efficiency is presented. Results demonstrating entanglement between a single barium ion and single spontaneously emitted photons are shown. The entanglement fidelity of the ion-photon state is measured to be 0.84(1) and a CHSH Bell signal of 2.303(36) finds violation of the CHSH version of the Bell inequality by over eight standard deviations. Barium's relatively long wavelength transitions make it an ideal candidate for our longer term goal of remote entanglement of ions separated by a kilometer or more. Such long distance remote entanglement should allow for a loophole-free verification of the violation of the Bell inequality.

  19. Structural properties of barium strontium titanate films grown under different technological conditions

    NASA Astrophysics Data System (ADS)

    Tumarkin, A. V.; Al'myashev, V. I.; Razumov, S. V.; Gaidukov, M. M.; Gagarin, A. G.; Altynnikov, A. G.; Kozyrev, A. B.

    2015-03-01

    The structural properties of ferroelectric barium strontium titanate films with different compositions prepared under different deposition conditions have been investigated. It has been shown that the deposition temperature directly affects the phase and component compositions of the films, crystal lattice parameters, and crystallite sizes. At a deposition temperature of approximately 600°C, impurity phases of strontium polytitanates are formed in addition to the barium strontium titanate phase. An increase in the deposition temperature to 880°C leads to a barium deficiency as compared to the sputtering target. The deposition temperature providing a stoichiometric transfer of the component composition of the target into the barium strontium titanate film has been estimated.

  20. SCALE MODELING OF ALUMINUM MELTING FURNACE

    Microsoft Academic Search

    Sita rama raju S Penmetsa

    2004-01-01

    Secondary (recycled) aluminum constitutes around 48% of the total aluminum used in the United States. Secondary aluminum melting is accomplished in large reverberatory furnaces, and improving its energy efficiency has been one of the major interests to aluminum industries. To assist the industries in improving energy efficiency in aluminum melting, an experimental research furnace (ERF), with 907 kg (2000 lbs)

  1. Calcium oxyhalide batteries - a review

    Microsoft Academic Search

    Peled

    1983-01-01

    The electrochemistry, safety aspects and performance of calcium-thionyl chloride (TC) and calcium sulfuryl chloride (SC) batteries containing lithium or calcium based electrolytes are reviewed. In Ca -oxyhalide solutions, the calcium anode is covered by CaClâ passivating layer which is a good ionic conductor and good electronic insulator. Therefore it is called Solid Electrolyte Interphase (SEI) and these batteries are called

  2. Aluminum Carbothermic Technology

    SciTech Connect

    Bruno, Marshall J.

    2005-03-31

    This report documents the non-proprietary research and development conducted on the Aluminum Carbothermic Technology (ACT) project from contract inception on July 01, 2000 to termination on December 31, 2004. The objectives of the program were to demonstrate the technical and economic feasibility of a new carbothermic process for producing commercial grade aluminum, designated as the ''Advanced Reactor Process'' (ARP). The scope of the program ranged from fundamental research through small scale laboratory experiments (65 kW power input) to larger scale test modules at up to 1600 kW power input. The tasks included work on four components of the process, Stages 1 and 2 of the reactor, vapor recovery and metal alloy decarbonization; development of computer models; and economic analyses of capital and operating costs. Justification for developing a new, carbothermic route to aluminum production is defined by the potential benefits in reduced energy, lower costs and more favorable environmental characteristics than the conventional Hall-Heroult process presently used by the industry. The estimated metrics for these advantages include energy rates at approximately 10 kWh/kg Al (versus over 13 kWh/kg Al for Hall-Heroult), capital costs as low as $1250 per MTY (versus 4,000 per MTY for Hall-Heroult), operating cost reductions of over 10%, and up to 37% reduction in CO2 emissions for fossil-fuel power plants. Realization of these benefits would be critical to sustaining the US aluminum industries position as a global leader in primary aluminum production. One very attractive incentive for ARP is its perceived ability to cost effectively produce metal over a range of smelter sizes, not feasible for Hall-Heroult plants which must be large, 240,000 TPY or more, to be economical. Lower capacity stand alone carbothermic smelters could be utilized to supply molten metal at fabrication facilities similar to the mini-mill concept employed by the steel industry. Major accomplishments for the program include definition of the system thermo-chemistry, demonstration of reactor stage 1, development of reactor stage 2 critical components in a 500 kW module, experimental determination of the vapor recovery reactor fundamentals, detailed design and installation of an advanced stage 1/vapor recovery reactor, feasibility of efficient separation of Al-C metal alloy product, updated capital and operating cost estimates, and development of computer models for all steps of the Advanced Reactor Process.

  3. Unintentional poisoning by phosphine released from aluminum phosphide.

    PubMed

    Shadnia, S; Mehrpour, O; Abdollahi, M

    2008-01-01

    Aluminum phosphide as a releaser of phosphine gas is used as a grain preservative. In this case report, we describe an accidental severe poisoning in a 35-year-old woman, her 18-year-old daughter, and 6-year-old son caused by inhalation of phosphine gas released from 20 tablets of aluminum phosphide stored in 15 rice bags. The boy died 2 days after exposure before admission to hospital and any special treatment, but the others were admitted 48 h after exposure. They had signs and symptoms of severe toxicity, and their clinical course included metabolic acidosis, electrocardiographic changes, and hypotension. They were treated by intravenous administration of sodium bicarbonate, magnesium sulfate, and calcium gluconate. The patients were discharged after 3 days and followed up for 1 week after discharge. Rapid absorption of phosphine by inhalation, induction of hyperglycemia, and surviving of patients are interesting issues of this case report. PMID:18480154

  4. The Thermoelectric Power of Calcium (1-X) Aluminum(x), CALCIUM(.60) ALUMINUM(.40-Y) Gallium(y), and LANTHANUM(1 - Aluminum(x) Metallic Glasses.

    NASA Astrophysics Data System (ADS)

    Delgado, Rolando

    The thermopower, S, and normalized resistance, R(T)/R(,o), as a function of temperature of some Ca(,1 -x)Al(,x), .20 < x < .45, Ca(,.60)Al(,.40-y)Ga(,y), y = .10 and .20, and La(,1-x)Al(,x), .18 < x < .35 metallic glasses have been measured. It is found that the temperature coefficient of resistivity, (alpha) = (rho)('-1)d(rho)/dT, for all the samples is negative and the thermopower is positive for the Ca(,1-x)Al(,x) and Ca(,.60)Al(,.40-y)Ga(,y) alloys while it is negative for the La(,1-x)Al(,x) alloys. The thermopower and resistivity of the Ca(,.55)Al(,.45), Ca(,.60)Al(,.40) and both Ca-Al-Ga alloys are anomalously high. The value of 502 (mu)(OMEGA)-cm and 32 (eta)V/K('2) for the Ca(,.60)Al(,.20)Ga(,.20) alloy are the largest reported room temperature value of (rho) and S/T, respectively, of any non-magnetic amorphous alloy. The value of S/T for the Ca(,1-x)Al(,x) alloys with x = .30, .33, .40 and .45 increase steadily as the temperature decreases and exhibit a small shoulder like structure at approximately 50 K. Below this temperature S/T increases much more rapidly and reaches a maximum value at very low temperatures. This type of temperature dependence in S/T is also observed in both Ca-Al-Ga alloys with the exception that the shoulder like structure is much less pronounced. The value of S/T for the La(,1-x)Al(,x) alloys remains relatively constant at high temperatures, ((theta)(,D) < T < 300 K). However, below (theta)(,D), the value of S/T exhibits a smooth and rapid increase as the temperature decreases and reaches a maximum value just before the onset of superconductivity. The observed temperature dependence of the thermopower at low temperatures, (T < (theta)(,D)), may be understood in terms of the electron-phonon mass enhancement. Neither the Ziman-Faber diffraction model nor the Mott s-d scattering model are able to explain the magnitude and compositional dependence of the thermopower and resistivity of these three alloy systems.

  5. Recycling of aluminum salt cake

    Microsoft Academic Search

    B. J. Jody; E. J. Daniels; P. V. Bonsignore; D. E. Karvelas

    1991-01-01

    The secondary aluminum industry generates more than 110 à 10³ tons of salt-cake waste every year. This waste stream contains about 3--5% aluminum, 15--30% aluminum oxide, 30--40% sodium chloride, and 20--30% potassium chloride. As much as 50% of the content of this waste is combined salt (sodium and potassium chlorides). Salt-cake waste is currently disposed of in conventional landfills. In

  6. Molecular aspects of aluminum toxicity

    Microsoft Academic Search

    Alfred Haug; Charles E. Foy

    1984-01-01

    The focus in this review is directed to molecular aspects of aluminum toxicity in animal and plant cells. Unique thermodynamic features of Al(lII) ions impart biological specificity which may form the biochemical basis of aluminum interactions with cellular constituents. Current knowledge about aluminum?specific, molecular interactions is rather scanty. Al(III) ions may coordinate with nucleotides or complex to phospholipids resulting in

  7. Quasicrystalline particulate reinforced aluminum composite

    SciTech Connect

    Anderson, I.E.; Biner, S.B.; Sordelet, D.J.; Unal, O.

    1997-07-01

    Particulate reinforced aluminum and aluminum alloy composites are rapidly emerging as new commercial materials for aerospace, automotive, electronic packaging and other high performance applications. However, their low processing ductility and difficulty in recyclability have been the key concern. In this study, two composite systems having the same aluminum alloy matrix, one reinforced with quasicrystals and the other reinforced with the conventional SiC reinforcements were produced with identical processing routes. Their processing characteristics and tensile mechanical properties were compared.

  8. Oxygen octahedral rotation mapping in calcium titanate/strontium titanate superlattices by transmission electron microscopy

    NASA Astrophysics Data System (ADS)

    Stone, Greg; Ciston, Jim; Haislmaier, Ryan; Vanleeuwen, Brian; Alem, Nasim; Schlom, Darrell; Gopalan, Venkatraman

    2014-03-01

    We report the investigation of oxygen octahedral rotation mapping in calcium titanate/barium titanate superlattices epitaxially grown on LSAT (001) with transmission electron microscopy. Analysis of the images shows induced antiphase rotations of the oxygen octahedral the strontium titanate layers that is absent in the bulk material at room temperature. These rotations play a key role in breaking the centrosymmetry of the material leading to polar properties as seen by second harmonic generation. We also map the local position of the cations to provide a complete picture of any relative local displacements and the oxygen-cation-oxygen bond angles.

  9. Voltage-activated calcium channels that must be phosphorylated to respond to membrane depolarization.

    PubMed Central

    Armstrong, D; Eckert, R

    1987-01-01

    Two classes of calcium channels were activated by membrane depolarization in cell-free membrane patches from GH3 cells, an electrically excitable cell line derived from a mammalian pituitary tumor. One class had a conductance of approximately 10 pS in 90 mM barium, had a threshold of activation near -40 mV, and was inactivated rapidly at holding potentials more positive than -80 mV. The other class, with a conductance of approximately 23 pS and a threshold nearer -20 mV, did not inactivate in barium but stopped responding to depolarization altogether when the cytoplasmic side of the patch was exposed to a standard physiological saline solution. Buffering the concentration of calcium ions to less than 10 nM on the cytoplasmic side did not prevent this loss of activity. However, activity was restored and maintained for the duration of the patch when the catalytic subunit of cAMP-dependent protein kinase was added with MgATP to the cytoplasmic side of the membrane. Cell-free patch formation in the presence of the dihydropyridine, BAY K 8644, also delayed the loss of activity, but unlike the catalytic subunit plus ATP, BAY K 8644 alone did not restore activity when it was added after the channels no longer responded to depolarization. Evidently the dihydropyridine-sensitive class of voltage-activated calcium channels must be phosphorylated in order to open when the membrane is depolarized. That hypothesis provides a simple framework for understanding the modulation of calcium channel gating by neurotransmitters, calcium ions, and dihydropyridines. PMID:2436233

  10. SNX-325, a novel calcium antagonist from the spider Segestria florentina.

    PubMed

    Newcomb, R; Palma, A; Fox, J; Gaur, S; Lau, K; Chung, D; Cong, R; Bell, J R; Horne, B; Nadasdi, L

    1995-07-01

    A novel selective calcium channel antagonist peptide, SNX-325, has been isolated from the venom of the spider Segestria florentina. The peptide was isolated using as bioassays the displacement of radioiodinated omega-conopeptide SNX-230 (MVIIC) from rat brain synaptosomal membranes, as well as the inhibition of the barium current through cloned expressed calcium channels in oocytes. The primary sequence of SNX-325 is GSCIESGKSCTHSRSMKNGLCCPKSRCNCRQIQHRHDYLGKRKYSCRCS, which is a novel amino acid sequence. Solid-phase synthesis resulted in a peptide that is chromatographically identical with the native peptide and which has the same configuration of cysteine residues as the spider venom peptide omega-Aga-IVa [Mintz, I. M., et al., (1992) Nature 355, 827-829]. At micromolar concentrations, SNX-325 is an inhibitor of most calcium, but not sodium or potassium, currents. At nanomolar concentrations, SNX-325 is a selective blocker of the cloned expressed class B (N-type), but not class C (cardiac L), A, or E, calcium channels. SNX-325 is approximately equipotent with the N-channel selective omega-conopeptides (GVIA and MVIIA as well as closely related synthetic derivatives) in blocking the potassium induced release of tritiated norepinephrine from hippocampal slices (IC50s, 0.1-0.5 nM) and in blocking the barium current through cloned expressed N-channels in oocytes (IC50s 3-30 nM). By contrast, SNX-325 is 4-5 orders of magnitude less potent than is SNX-111 (synthetic MVIIA) at displacing radioiodinated SNX-111 from rat brain synaptosomal membranes. SNX-325 will be a useful comparative tool in further defining the function and pharmacology of the N- and possibly other types of high-voltage activated calcium channels. PMID:7541240

  11. Laser welding of aluminum alloys

    SciTech Connect

    Leong, K.H.; Sabo, K.R.; Sanders, P.G. [Argonne National Lab., IL (United States). Technology Development Div.; Spawr, W.J.

    1997-03-01

    Recent interest in reducing the weight of automobiles to increase fuel mileage has focused attention on the use of aluminum and associated joining technologies. Laser beam welding is one of the more promising methods for high speed welding of aluminum. Consequently, substantial effort has been expended in attempting to develop a robust laser beam welding process. Early results have not been very consistent in the process requirements but more definitive data has been produced recently. This paper reviews the process parameters needed to obtain consistent laser welds on 5,000 series aluminum alloys and discusses the research necessary to make laser processing of aluminum a reality for automotive applications.

  12. Aluminum-lithium for aerospace

    SciTech Connect

    Fielding, P.S.; Wolf, G.J. [Reynolds Metals Co., Richmond, VA (United States)

    1996-10-01

    Aluminum-lithium alloys were developed primarily to reduce the weight of aircraft and aerospace structures. Lithium is the lightest metallic element, and each 1% of lithium added to aluminum reduces alloy density by about 3% and increases modulus by about 5%. Though lithium has a solubility limit of 4.2% in aluminum, the amount of lithium ranges between 1 and 3% in commercial alloys. Aluminum-lithium alloys are most often selected for aerospace components because of their low density, high strength, and high specific modulus. However, other applications now exploit their excellent fatigue resistance and cryogenic toughness.

  13. Calcium, Bone, and Life

    Microsoft Academic Search

    Robert P. Heaney

    \\u000a Calcium is a divalent mineral cation that functions as an intracellular messenger in virtually all life forms. In multicellular\\u000a organisms it functions also as an integrator tying body systems together, and in land-living vertebrates it provides the principal\\u000a mineral component of the endoskeleton (bone). Calcium cannot be synthesized and must be ingested, first to build an adult\\u000a skeleton and then

  14. Separation of lanthanum, hafnium, barium and radiotracers yttrium-88 and barium-133 using crystalline zirconium phosphate and phosphonate compounds as prospective materials for a Ra-223 radioisotope generator.

    PubMed

    Möller, Teresia; Bestaoui, Naima; Wierzbicki, Melissa; Adams, Todd; Clearfield, Abraham

    2011-07-01

    Crystalline hybrid organic/inorganic ion exchangers based on zirconium phosphate and phosphonate compounds were evaluated for application in radium-223 generator for radiopharmaceutical applications. Various compositions were synthesized and the selectivity of these materials was determined for inactive lanthanum, hafnium and barium, and radiotracers yttrium-88 and barium-133. The hybrid materials show very efficient lanthanum/barium separation; the response for zirconium phosphate was even better. A small-scale column loaded with pelletized zirconium phosphate compound demonstrated excellent retention of (88)Y and release of (133)Ba. PMID:21421323

  15. Modeling Texture Evolution during Recrystallization in Aluminum

    E-print Network

    Rollett, Anthony D.

    Modeling Texture Evolution during Recrystallization in Aluminum Abhijit Brahme1,2 , Joseph Fridy3, Aluminum, Grain Boundary Mobility, Nucleation, Oriented Growth, Oriented Nucleation, Stored Energy, Monte Carlo Modeling. #12;Modeling Texture Evolution during Recrystallization in Aluminum 2 1. Introduction

  16. 75 FR 80527 - Aluminum Extrusions From China

    Federal Register 2010, 2011, 2012, 2013, 2014

    2010-12-22

    ...Final) and 731-TA-1177 (Final)] Aluminum Extrusions From China AGENCY: United...less-than-fair-value imports from China of aluminum extrusions, primarily provided for in...these investigations is contained in Aluminum Extrusions From the People's...

  17. Characterization of ultradispersed aluminum

    SciTech Connect

    Simpson, R.L.; Maienschein, J.L.; Swansiger, R.W.; Garcia, F.; Darling, D.H.

    1994-12-08

    Samples of ultradispersed Al were received, which were produced by electrically exploding Al wires in argon. These samples comprised very small particles that were not significantly oxidized and that were stable in air. Particle morphology were studied with SE, micropycnometry, and gas adsorption surface area. Composition were determined using various techniques, as were thermal stability and reaction exotherms. The inexplicable reports of an Al-Ar compound and of an exothermic reaction were not confirmed. The material is a stable, nonoxidized, small-particle, highly reactive form of aluminum that is of interest in energetic materials formulations.

  18. Observation and theory of the barium releases from the CRRES satellite

    Microsoft Academic Search

    P. A. Bernhardt; J. D. Huba; W. A. Scales; E. M. Wescott; H. C. Stenbaek-Nielsen

    1992-01-01

    The relationship between releases of barium from the NASA Combined Release and Radiation Effects Satellite (CRRES) and enhanced auroral activity is discussed with reference to observational data. Barium releases were conducted at a variety of altitudes and injection velocities, and plasma irregularities are reported as a result of the interactions. Auroral activity increased within 5 min of each release, and

  19. Differential pulse anodic stripping voltammetry of barium and lead in gunshot residues

    Microsoft Academic Search

    Curt A. Woolever; Howard D. Dewald

    2001-01-01

    Differential pulse anodic stripping voltammetry (DPASV) has been applied for characterization and quantitative detection of barium and lead from gunshot residues (GSR). Previous electrochemical techniques have detected antimony and lead from GSR, however barium has never been detected. This technique allows for simultaneous detection of Ba and Pb that is simple, fast, and nondestructive.

  20. Electric fields and plasma waves resulting from a barium injection experiment

    Microsoft Academic Search

    H. C. Koons; Morris B. Pongratz

    1981-01-01

    A shaped-charge, barium plasma injection experiment was performed in June 1976 from the DOE Kauai test facility. The rocket payload contained seven shaped charges, a sevenfold larger package than the typical payloads employed in previous barium plasma injections conducted in this program. An attitude control system oriented the injection perpendicular to the local geomagnetic field. The injection altitude was 450

  1. The effect of barium on perceptions of taste intensity and palatability

    PubMed Central

    Dietsch, Angela M.; Solomon, Nancy Pearl; Steele, Catriona M.; Pelletier, Cathy A.

    2015-01-01

    Purpose Barium may affect the perception of taste intensity and palatability. Such differences are important considerations in the selection of dysphagia assessment strategies and interpretation of results. Methods Eighty healthy women grouped by age (younger, older) and genetic taste status (supertaster, non-taster) rated intensity and palatability for seven tastants prepared in deionized water with and without 40% w/v barium: non-carbonated and carbonated water, diluted ethanol, and high concentrations of citric acid (sour), sodium chloride (salty), caffeine (bitter) and sucrose (sweet). Mixed model analyses explored the effects of barium, taster status, and age on perceived taste intensity and acceptability of stimuli. Results Barium was associated with lower taste intensity ratings for sweet, salty, and bitter tastants, higher taste intensity in carbonated water, and lower palatability in water, sweet, sour, and carbonated water. Older subjects reported lower palatability (all barium samples, sour) and higher taste intensity scores (ethanol, sweet, sour) compared to younger subjects. Supertasters reported higher taste intensity (ethanol, sweet, sour, salty, bitter) and lower palatability (ethanol, salty, bitter) than non-tasters. Refusal rates were highest for younger subjects and supertasters, and for barium (regardless of tastant), bitter, and ethanol. Conclusions Barium suppressed the perceived intensity of some tastes and reduced palatability. These effects are more pronounced in older subjects and supertasters, but younger supertasters are least likely to tolerate trials of barium and strong tastant solutions. PMID:24037100

  2. Vanadium doping effects on microstructure and dielectric properties of barium titanate ceramics

    Microsoft Academic Search

    Wei Cai; Chunlin Fu; Zebin Lin; Xiaoling Deng

    2011-01-01

    V-doped barium titante ceramics were prepared by conventional solid state reaction method. XRD patterns show that V5+ ions have entered into the tetragonal perovskite structure of solid solution to substitute for Ti4+ ions on the B sites. Addition of vanadium accelerates grain growth of BTO ceramics and there is abnormal grain growth of barium titanate ceramics with higher vanadium concentration.

  3. Relative sensitivity of colonoscopy and barium enema for detection of colorectal cancer in clinical practice

    Microsoft Academic Search

    DK Rex; EY Rahmani; JH Haseman; GT Lemmel; S Kaster; JS Buckley

    1997-01-01

    BACKGROUND & AIMS: The relative sensitivities of barium enema and colonoscopy for colorectal cancer are still debated. The aim of this study was to determine the relative sensitivity of barium enema and colonoscopy in general clinical practice. METHODS: Medical records of 2193 consecutive colorectal cancer cases identified in 20 central Indiana hospitals were reviewed. All procedures performed within 3 years

  4. Dielectric properties of MgO-doped compositionally graded multilayer barium strontium titanate films

    E-print Network

    Alpay, S. Pamir

    Dielectric properties of MgO-doped compositionally graded multilayer barium strontium titanate shifters and filters operat- ing in the microwave regime.1­4 Ferroelectrics FEs such as barium strontium in monolithic BST films especially with low strontium content, although the addition of MgO causes a reduction

  5. Impact of thermal strain on the dielectric constant of sputtered barium strontium titanate thin films

    E-print Network

    York, Robert A.

    Impact of thermal strain on the dielectric constant of sputtered barium strontium titanate thin, California 93106 Received 6 November 2001; accepted for publication 10 January 2002 Barium strontium titanate: magnesium oxide, strontium titanate, sapphire, silicon, and vycor glass. These substrates were chosen

  6. Fabrication, characterization and microwave properties of polyurethane nanocomposites reinforced with iron oxide and barium titanate

    E-print Network

    Guo, John Zhanhu

    with iron oxide and barium titanate nanoparticles Z. Guo a,*, S.-E. Lee a , H. Kim a , S. Park a , H.T. Hahn titanate nanoparticles fabricated by the surface-initiated-polymerization approach were investigated the introduction of the dielectric barium titanate nanoparticle into Fe2O3/PU nanocomposites. The permeability

  7. 59 FR- Barium Sulfate; Toxic Chemical Release Reporting; Community Right-To-Know

    Federal Register 2010, 2011, 2012, 2013, 2014

    1994-06-28

    ...of the statement regarding the water solubility of barium sulfate and how it relates...with the commenters that, at the water solubility of 2.4 mg/ L (2.4 ppm) at 25...However, due to its limited water solubility, barium sulfate is not expected...

  8. IEEE TRANSACTIONS ON MAGNETICS, VOL. 37, NO. 4, JULY 2001 2589 Barium and Strontium Ferrite Perpendicular Thin

    E-print Network

    Laughlin, David E.

    IEEE TRANSACTIONS ON MAGNETICS, VOL. 37, NO. 4, JULY 2001 2589 Barium and Strontium FerriteAlSi) as the soft magnetic underlayer for hexagonal barium ferrite (BaM) and strontium ferrite (SrM) was studied--Barium ferrite, multi-layer, sendust, soft under- layer, strontium ferrite, textured growth. I. INTRODUCTION M

  9. AlGaN/GaN metal-oxide-semiconductor heterostructure field-effect transistors using barium strontium titanate

    E-print Network

    York, Robert A.

    AlGaN/GaN metal-oxide-semiconductor heterostructure field-effect transistors using barium strontium-effect transistors have been formed by incorporating barium strontium titanate (BST) deposited by rf magnetron in increased leakage. Due to its large dielectric constant, barium strontium ti- tanate [Ba1-xSrxTiO3, (BST

  10. The effect of biaxial texture on the effective electromechanical constants of polycrystalline barium titanate and lead titanate thin films

    E-print Network

    Atwater, Harry

    barium titanate and lead titanate thin films Jennifer L. Ruglovsky a,*, Jiangyu Li b , Kaushik to an enhanced piezoelectric effect for barium titanate films, but not for lead titanate. Twist texturing about for a polycrystalline film. We explore tetragonal 4MM materials, and give specific results for barium titanate and lead

  11. Environmental monitoring of offshore oil and gas drilling discharges—A caution on the use of barium as a tracer

    Microsoft Academic Search

    John P. Hartley

    1996-01-01

    Commonly used methods for extracting barium from marine sediments are inefficient when high concentrations of barium sulphate are present in samples. Comparative data on sea-bed barium concentrations around a single exploration well are presented to highlight the influence of different extraction methods which can result in 2–3 order of magnitude differences in levels recorded. This suggests that in many monitoring

  12. Aluminum Nanoholes for Optical Biosensing.

    PubMed

    Barrios, Carlos Angulo; Canalejas-Tejero, Víctor; Herranz, Sonia; Urraca, Javier; Moreno-Bondi, María Cruz; Avella-Oliver, Miquel; Maquieira, Ángel; Puchades, Rosa

    2015-09-01

    Sub-wavelength diameter holes in thin metal layers can exhibit remarkable optical features that make them highly suitable for (bio)sensing applications. Either as efficient light scattering centers for surface plasmon excitation or metal-clad optical waveguides, they are able to form strongly localized optical fields that can effectively interact with biomolecules and/or nanoparticles on the nanoscale. As the metal of choice, aluminum exhibits good optical and electrical properties, is easy to manufacture and process and, unlike gold and silver, its low cost makes it very promising for commercial applications. However, aluminum has been scarcely used for biosensing purposes due to corrosion and pitting issues. In this short review, we show our recent achievements on aluminum nanohole platforms for (bio)sensing. These include a method to circumvent aluminum degradation-which has been successfully applied to the demonstration of aluminum nanohole array (NHA) immunosensors based on both, glass and polycarbonate compact discs supports-the use of aluminum nanoholes operating as optical waveguides for synthesizing submicron-sized molecularly imprinted polymers by local photopolymerization, and a technique for fabricating transferable aluminum NHAs onto flexible pressure-sensitive adhesive tapes, which could facilitate the development of a wearable technology based on aluminum NHAs. PMID:26184330

  13. Lost-Soap Aluminum Casting.

    ERIC Educational Resources Information Center

    Mihalow, Paula

    1980-01-01

    Lost-wax casting in sterling silver is a costly experience for the average high school student. However, this jewelry process can be learned at no cost if scrap aluminum is used instead of silver, and soap bars are used instead of wax. This lost-soap aluminum casting process is described. (Author/KC)

  14. The Benefits of Aluminum Windows.

    ERIC Educational Resources Information Center

    Goyal, R. C.

    2002-01-01

    Discusses benefits of aluminum windows for college construction and renovation projects, including that aluminum is the most successfully recycled material, that it meets architectural glass deflection standards, that it has positive thermal energy performance, and that it is a preferred exterior surface. (EV)

  15. Primary Aluminum Plants Worldwide - 1998

    USGS Publications Warehouse

    1999-01-01

    The 1990 U.S. Bureau of Mines publication, Primary Aluminum Plants Worldwide, has been updated and is now available. The 1998 USGS edition of Primary Aluminum Plants Worldwide is published in two parts. Part I—Detail contains information on individual primary smelter capacity, location, ownership, sources of energy, and other miscellaneous information. Part II—Summary summarizes the capacity data by country

  16. Deformation Twinning in Nanocrystalline Aluminum

    Microsoft Academic Search

    Mingwei Chen; En Ma; Kevin J. Hemker; Hongwei Sheng; Yinmin Wang; Xuemei Cheng

    2003-01-01

    We report transmission electron microscope observations that provide evidence of deformation twinning in plastically deformed nanocrystalline aluminum. The presence of these twins is directly related to the nanocrystalline structure, because they are not observed in coarse-grained pure aluminum. We propose a dislocation-based model to explain the preference for deformation twins and stacking faults in nanocrystalline materials. These results underscore a

  17. Aluminum vehicle breaks new ground

    SciTech Connect

    Ashley, S.

    1994-02-01

    This article examines the efforts of automobile manufacturers and aluminum producers to develop a light weight crash resistant automobile. The topics of the article include alloys used, production techniques, fastening and bonding techniques, rigidity and crush resistance, weight reduction, die-casting and extruding of aluminum, design and construction of space frame.

  18. Centrifugal Jet Spinning for Highly Efficient and Large-scale Fabrication of Barium Titanate Nanofibers

    PubMed Central

    Ren, Liyun; Kotha, Shiva P.

    2014-01-01

    The centrifugal jet spinning (CJS) method has been developed to enable large-scale synthesis of barium titanate nanofibers. Barium titanate nanofibers with fiber diameters down to 50 nm and grain sizes around 25 nm were prepared with CJS by spinning a sol-gel solution of barium titanate and poly(vinylpyrrolidone) with subsequent heat treatment at 850 °C. XRD and FTIR analysis demonstrated high purity and tetragonal perovskite structured barium titanate nanofibers. SEM and TEM images confirm the continuous high aspect ratio structure of barium titanate nanofibers after heat treatment. It is demonstrated that the CJS technique offers a highly efficient method for large-scale fabrication of ceramic nanofibers at production rates of up to 0.3 gram/minute. PMID:24563566

  19. Investigation of flame retardancy and physical–mechanical properties of zinc borate and aluminum hydroxide propylene composites

    Microsoft Academic Search

    S. A. Ahmad Ramazani; Arash Rahimi; Massoud Frounchi; Saeed Radman

    2008-01-01

    In this paper, the effects of flame retardant fillers mixture, zinc borate and aluminum hydroxide, on polypropylene including various ratios of their accumulated concentrations, have been studied. Maleic anhydrate grafted polypropylene and calcium stearate have been used to increase filler–matrix interactions and filler dispersion in matrix. Effects of filler types and their concentrations on fire resistibility of different composite samples

  20. Wideband and enhanced microwave absorption performance of doped barium ferrite

    NASA Astrophysics Data System (ADS)

    Meng, Pingyuan; Xiong, Kun; Ju, Kui; Li, Shengnan; Xu, Guangliang

    2015-07-01

    To achieve stronger microwave attenuation and larger bandwidth in electromagnetic absorber, the nickel ions (Ni2+) and manganese ions (Mn2+) were employed to partially replace the cobalt ions (Co2+) in BaCoTiFe10O19, and the doped barium hexaferrite (Ba(MnNi)0.2Co0.6TiFe10O19 and Ba(MnNi)0.25Co0.5TiFe10O19) powders were synthesized via the sol-gel combustion method. Subsequently, the microwave absorbing composites were prepared by mixing the ferrite powders with the paraffin. The X-ray diffraction (XRD) patterns of the doped ferrites confirmed the formation of the M-type barium ferrite, and no other types of barium ferrite could be found. Based on the electromagnetic parameters measured by the vector net-analyzer, it was found that the composite (Ba(MnNi)0.2Co0.6TiFe10O19) possessed a minimum reflection loss of -52.8 dB at 13.4 GHz with a matching thickness of 1.8 mm and the bandwidth below -15 dB was 5.8 GHz. Moreover, the maximum attenuation of Ba(MnNi)0.25Co0.5TiFe10O19 could reach -69 dB when its thickness was 1.8 mm, and also the bandwidth less than -20 dB was ranging from 13.2 GHz to 18 GHz. Thus, Ba(MnNi)0.2Co0.6TiFe10O19 and Ba(MnNi)0.25Co0.5TiFe10O19 could be the good microwave absorbers, which have great potentials to be applied in the high frequency fields of the microwave absorbing materials.

  1. Nanodielectric system for cryogenic applications: Barium titanate filled polyvinyl alcohol

    SciTech Connect

    Tuncer, Enis [ORNL; Sauers, Isidor [ORNL; James, David Randy [ORNL; Ellis, Alvin R [ORNL; Duckworth, Robert C [ORNL

    2008-01-01

    In the current study the focus is on dielectric properties (as a function of frequency and temperature) of a polymeric composite system composed of polyvinyl alcohol and barium titanate nano powder. In the investigations, the temperature range is between 50-295 K, and the frequency range is between $20\\ \\hertz-1\\ \\mega\\hertz$. Polarization and conduction processes are investigated in the linear regime. Dielectric breakdown strengths of samples are also reported. The materials presented have potential to be implemented in cryogenic capacitor or field grading applications.

  2. The barium ion jet experiments of the Porcupine project

    NASA Astrophysics Data System (ADS)

    Haerendel, G.

    1980-06-01

    The injection of a barium plasma from a sounding rocket by the shaped charge technique offers several possibilities that cannot be achieved by conventional releases. This is due to high initial velocities of the atoms of up to 14 km/sec. Most of the the applications are related to the great heights that the ions can reach, but some depend directly on the initial momentum. Typical applications are: tracing at high altitudes, modifications, and alternate Ionization processes. Project Porcupine contributions in this field are summarized.

  3. Strain engineered barium strontium titanate for tunable thin film resonators

    SciTech Connect

    Khassaf, H.; Khakpash, N. [Department of Materials Science and Engineering and Institute of Materials Science, University of Connecticut, Storrs, Connecticut 06269 (United States); Sun, F. [Department of Physics, University of Connecticut, Storrs, Connecticut 06269 (United States); Sbrockey, N. M.; Tompa, G. S. [Structured Materials Industries, Inc., Piscataway, New Jersey 08854 (United States); Kalkur, T. S. [Department of Electrical and Computer Engineering, University of Colorado at Colorado Springs, Colorado Springs, Colorado 80918 (United States); Alpay, S. P., E-mail: p.alpay@ims.uconn.edu [Department of Materials Science and Engineering and Institute of Materials Science, University of Connecticut, Storrs, Connecticut 06269 (United States); Department of Physics, University of Connecticut, Storrs, Connecticut 06269 (United States)

    2014-05-19

    Piezoelectric properties of epitaxial (001) barium strontium titanate (BST) films are computed as functions of composition, misfit strain, and temperature using a non-linear thermodynamic model. Results show that through adjusting in-plane strains, a highly adaptive rhombohedral ferroelectric phase can be stabilized at room temperature with outstanding piezoelectric response exceeding those of lead based piezoceramics. Furthermore, by adjusting the composition and the in-plane misfit, an electrically tunable piezoelectric response can be obtained in the paraelectric state. These findings indicate that strain engineered BST films can be utilized in the development of electrically tunable and switchable surface and bulk acoustic wave resonators.

  4. Strain engineered barium strontium titanate for tunable thin film resonators

    NASA Astrophysics Data System (ADS)

    Khassaf, H.; Khakpash, N.; Sun, F.; Sbrockey, N. M.; Tompa, G. S.; Kalkur, T. S.; Alpay, S. P.

    2014-05-01

    Piezoelectric properties of epitaxial (001) barium strontium titanate (BST) films are computed as functions of composition, misfit strain, and temperature using a non-linear thermodynamic model. Results show that through adjusting in-plane strains, a highly adaptive rhombohedral ferroelectric phase can be stabilized at room temperature with outstanding piezoelectric response exceeding those of lead based piezoceramics. Furthermore, by adjusting the composition and the in-plane misfit, an electrically tunable piezoelectric response can be obtained in the paraelectric state. These findings indicate that strain engineered BST films can be utilized in the development of electrically tunable and switchable surface and bulk acoustic wave resonators.

  5. Dielectric behavior of barium modified strontium bismuth titanate ceramic

    NASA Astrophysics Data System (ADS)

    Nayak, P.; Badapanda, T.; Anwar, S.; Panigrahi, S.

    2014-04-01

    Barium Modified Strontium Bismuth Titanate(SBT) ceramic with general formula Sr1-xBaxBi4Ti4O15 is prepared by solid state reaction route. The structural analysis of the ceramics was done by X-ray diffraction technique. The X-ray patterns show that all the compositions are of single phase with orthorhombic structure. The temperature dependent dielectric behavior shows that the transition temperature decreases with Ba content but the maximum dielectric constant increases. The decreases of the transition with increase in Ba2+ ion, may be due to the decrease of orthorhombicity by the incorporation of Ba2+ ion in SBT lattice.

  6. Aluminum Zintl anion moieties within sodium aluminum clusters

    SciTech Connect

    Wang, Haopeng; Zhang, Xinxing; Ko, Yeon Jae; Grubisic, Andrej; Li, Xiang; Ganteför, Gerd; Bowen, Kit H., E-mail: AKandalam@wcupa.edu, E-mail: kiran@mcneese.edu, E-mail: kbowen@jhu.edu [Department of Chemistry, Johns Hopkins University, Baltimore, Maryland 21218 (United States); Schnöckel, Hansgeorg [Institute of Inorganic Chemistry, Karlsruhe Institute of Technology, 76128 Karlsruhe (Germany)] [Institute of Inorganic Chemistry, Karlsruhe Institute of Technology, 76128 Karlsruhe (Germany); Eichhorn, Bryan W. [Department of Chemistry, University of Maryland at College Park, College Park, Maryland 20742 (United States)] [Department of Chemistry, University of Maryland at College Park, College Park, Maryland 20742 (United States); Lee, Mal-Soon; Jena, P. [Department of Physics, Virginia Commonwealth University, Richmond, Virginia 23284 (United States)] [Department of Physics, Virginia Commonwealth University, Richmond, Virginia 23284 (United States); Kandalam, Anil K., E-mail: AKandalam@wcupa.edu, E-mail: kiran@mcneese.edu, E-mail: kbowen@jhu.edu [Department of Physics, West Chester University of Pennsylvania, West Chester, Pennsylvania 19383 (United States); Kiran, Boggavarapu, E-mail: AKandalam@wcupa.edu, E-mail: kiran@mcneese.edu, E-mail: kbowen@jhu.edu [Department of Chemistry, McNeese State University, Lake Charles, Louisiana 70609 (United States)] [Department of Chemistry, McNeese State University, Lake Charles, Louisiana 70609 (United States)

    2014-02-07

    Through a synergetic combination of anion photoelectron spectroscopy and density functional theory based calculations, we have established that aluminum moieties within selected sodium-aluminum clusters are Zintl anions. Sodium–aluminum cluster anions, Na{sub m}Al{sub n}{sup ?}, were generated in a pulsed arc discharge source. After mass selection, their photoelectron spectra were measured by a magnetic bottle, electron energy analyzer. Calculations on a select sub-set of stoichiometries provided geometric structures and full charge analyses for both cluster anions and their neutral cluster counterparts, as well as photodetachment transition energies (stick spectra), and fragment molecular orbital based correlation diagrams.

  7. 21 CFR 172.410 - Calcium silicate.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ...Drugs 3 2014-04-01 2014-04-01 false Calcium silicate. 172.410 Section 172.410 Food...HUMAN CONSUMPTION Anticaking Agents § 172.410 Calcium silicate. Calcium silicate, including synthetic calcium...

  8. 21 CFR 172.410 - Calcium silicate.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ...Drugs 3 2012-04-01 2012-04-01 false Calcium silicate. 172.410 Section 172.410 Food...HUMAN CONSUMPTION Anticaking Agents § 172.410 Calcium silicate. Calcium silicate, including synthetic calcium...

  9. 21 CFR 172.410 - Calcium silicate.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ...Drugs 3 2013-04-01 2013-04-01 false Calcium silicate. 172.410 Section 172.410 Food...HUMAN CONSUMPTION Anticaking Agents § 172.410 Calcium silicate. Calcium silicate, including synthetic calcium...

  10. 21 CFR 172.410 - Calcium silicate.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ...Drugs 3 2011-04-01 2011-04-01 false Calcium silicate. 172.410 Section 172.410 Food...HUMAN CONSUMPTION Anticaking Agents § 172.410 Calcium silicate. Calcium silicate, including synthetic calcium...

  11. Nuclear calcium signaling.

    PubMed

    Bengtson, C Peter; Bading, Hilmar

    2012-01-01

    Calcium is the major intracellular messenger linking synaptic activity in neurons to gene expression to control diverse functions including adaptive responses to synaptic activity as well as survival and death (Bading et al. 1993; Hardingham et al. 1997; Chawla and Bading 2001; West et al. 2001; Zhang et al. 2007; Flavell and Greenberg 2008; Mellstrom et al. 2008; Redmond 2008; Wayman et al. 2008; Bootman et al. 2009; Zhang et al. 2009; Hardingham and Bading 2010). Calcium entry at the synapse acts locally to activate signaling cascades which regulate posttranslational modifications essential for synaptic plasticity, such as the insertion of alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid receptors (AMPARs) into the postsynaptic membrane (Soderling 2000; Malinow and Malenka 2002; Ehrlich and Malinow 2004). Synaptic activity can also evoke calcium signals in the nucleus which regulate gene pools largely through the phosphorylation of cAMP response element-binding protein (CREB) and its coactivator, CREB-binding protein (CBP) (Bading et al. 1993; Hardingham et al. 1997; Hardingham et al. 1999; Hu et al. 1999; Hardingham et al. 2001b; Impey et al. 2002; Zhang et al. 2009). Distinct mechanisms have been proposed to mediate synaptically generated calcium signals in subcompartments of pyramidal neurons; N-methyl-D -aspartate receptors (NMDARs) and ryanodine receptors have been implicated in the spine, inositol 3,4,5 triphosphate (IP3) receptors in the dendrites, and L-type voltage-gated calcium channels (VGCCs) at the soma and nucleus, although both NMDARs and IP3 receptors can also contribute to somatic and nuclear calcium signals under certain stimulation conditions (Nakamura et al. 1999; Bardo et al. 2006; Raymond and Redman 2006; Watanabe et al. 2006; Hong and Ross 2007; Hagenston et al. 2008; Bengtson et al. 2010). We review here the calcium signaling pathways underlying synaptically activated gene transcription leading to long-lasting changes in synaptic efficacy and memory as well as the physiological mechanisms by which synaptic activity evokes nuclear calcium signals. PMID:22351065

  12. Calcium carbonate with magnesium overdose

    MedlinePLUS

    The combination of calcium carbonate and magnesium is commonly found in antacids, which are medicines that provide heartburn relief. Calcium carbonate with magnesium overdose occurs when someone accidentally or ...

  13. Barium titanate core – gold shell nanoparticles for hyperthermia treatments

    PubMed Central

    FarrokhTakin, Elmira; Ciofani, Gianni; Puleo, Gian Luigi; de Vito, Giuseppe; Filippeschi, Carlo; Mazzolai, Barbara; Piazza, Vincenzo; Mattoli, Virgilio

    2013-01-01

    The development of new tools and devices to aid in treating cancer is a hot topic in biomedical research. The practice of using heat (hyperthermia) to treat cancerous lesions has a long history dating back to ancient Greece. With deeper knowledge of the factors that cause cancer and the transmissive window of cells and tissues in the near-infrared region of the electromagnetic spectrum, hyperthermia applications have been able to incorporate the use of lasers. Photothermal therapy has been introduced as a selective and noninvasive treatment for cancer, in which exogenous photothermal agents are exploited to achieve the selective destruction of cancer cells. In this manuscript, we propose applications of barium titanate core–gold shell nanoparticles for hyperthermia treatment against cancer cells. We explored the effect of increasing concentrations of these nanoshells (0–100 ?g/mL) on human neuroblastoma SH-SY5Y cells, testing the internalization and intrinsic toxicity and validating the hyperthermic functionality of the particles through near infrared (NIR) laser-induced thermoablation experiments. No significant changes were observed in cell viability up to nanoparticle concentrations of 50 ?g/mL. Experiments upon stimulation with an NIR laser revealed the ability of the nanoshells to destroy human neuroblastoma cells. On the basis of these findings, barium titanate core–gold shell nanoparticles resulted in being suitable for hyperthermia treatment, and our results represent a promising first step for subsequent investigations on their applicability in clinical practice. PMID:23847415

  14. EUROSPF Conference APPLICATION TECHNOLOGY OF ALUMINUM BLOW

    E-print Network

    Paris-Sud XI, Université de

    6th EUROSPF Conference APPLICATION TECHNOLOGY OF ALUMINUM BLOW FORMING FOR AUTOMOTIVE CLOSURE PANEL Replacement by aluminum for the closure panels is one of the common methods for lightening car body. However. As a solution to cover the low stamping formability of aluminum, Blow forming technology of aluminum which

  15. Liquid-Phase Processing of Barium Titanate Thin Films

    NASA Astrophysics Data System (ADS)

    Harris, David Thomas

    Processing of thin films introduces strict limits on the thermal budget due to substrate stability and thermal expansion mismatch stresses. Barium titanate serves as a model system for the difficulty in producing high quality thin films because of sensitivity to stress, scale, and crystal quality. Thermal budget restriction leads to reduced crystal quality, density, and grain growth, depressing ferroelectric and nonlinear dielectric properties. Processing of barium titanate is typically performed at temperatures hundreds of degrees above compatibility with metalized substrates. In particular integration with silicon and other low thermal expansion substrates is desirable for reductions in costs and wider availability of technologies. In bulk metal and ceramic systems, sintering behavior has been encouraged by the addition of a liquid forming second phase, improving kinetics and promoting densification and grain growth at lower temperatures. This approach is also widespread in the multilayer ceramic capacitor industry. However only limited exploration of flux processing with refractory thin films has been performed despite offering improved dielectric properties for barium titanate films at lower temperatures. This dissertation explores physical vapor deposition of barium titanate thin films with addition of liquid forming fluxes. Flux systems studied include BaO-B2O3, Bi2O3-BaB2O 4, BaO-V2O5, CuO-BaO-B2O3, and BaO-B2O3 modified by Al, Si, V, and Li. Additions of BaO-B2O3 leads to densification and an increase in average grain size from 50 nm to over 300 nm after annealing at 900 °C. The ability to tune permittivity of the material improved from 20% to 70%. Development of high quality films enables engineering of ferroelectric phase stability using residual thermal expansion mismatch in polycrystalline films. The observed shifts to TC match thermodynamic calculations, expected strain from the thermal expansion coefficients, as well as x-ray diffract measurements . Our system exhibits flux-film-substrate interactions that can lead to dramatic changes to the microstructure. This effect is especially pronounced onc -sapphire, with Al diffusion from the substrate leading to formation of an epitaxial BaAl2O4 second phase at the substrate-film interface. The formation of this second phase in the presence of a liquid phase seeds {111} twins that drive abnormal grain growth. The orientation of the sapphire substrate determines the BaAl2O 4 morphology, enabling control the abnormal grain growth behavior. CuO additions leads to significant grain growth at 900 °C, with average grain size approaching 500 nm. The orthorhombic-tetragonal phase transition is clearly observable in temperature dependent measurements and both linear and nonlinear dielectric properties are improved. All films containing CuO are susceptible to aging. A number of other systems were investigated for efficacy at temperatures below 900 °C. Pulsed laser deposition was used to study flux + BaTiO 3 targets, layered flux films, and in situ liquids. RF-magnetron sputtering using a dual-gun approach was used to explore integration on flexible foils with Ba1-xSrxTiO3. Many of these systems were based on the BaO-B2O3 system, which has proven effective in thin films, multilayer ceramic capacitors, and bulk ceramics. Modifiers allow tailoring of the microstructure at 900 °C, however no compositions were found, and no reports exist in the open literature, that provide significant grain growth or densification below 900 °C. Liquid phase fluxes offer a promising path forward for low temperature processing of barium titanate, with the ultimate goal of integration with metalized silicon substrates. This work demonstrates significant improvements to dielectric properties and the necessity of understanding interactions in the film-flux-substrate system.

  16. Subsurface Aluminum Nitride Formation in Iron-Aluminum Alloys

    NASA Astrophysics Data System (ADS)

    Bott, June H.

    Transformation-induced plasticity (TRIP) steels containing higher amounts of aluminum than conventional steels are ideal for structural automotive parts due to their mechanical properties. However, the aluminum tends to react with any processing environment at high temperatures and therefore presents significant challenges during manufacturing. One such challenge occurs during secondary cooling, reheating, and hot-rolling and is caused by a reaction with nitrogen-rich atmospheres wherein subsurface aluminum nitride forms in addition to internal and external oxides. The nitrides are detrimental to mechanical properties and cause surface cracks. It is important to understand how these nitrides and oxides form and their consequences for the quality of steel products. This study looks at model iron-aluminum (up to 8 wt.% aluminum) alloys and uses confocal laser scanning microscopy, x-ray diffraction, scanning electron microscopy with energy dispersive x-ray spectrometry, and transmission electron microscopy to study the effect of various conditions on the growth and development of these precipitates in a subsurface oxygen-depleted region. By using model alloys and controlling the experimental atmosphere, this study is able to understand some of the more fundamental materials science behind aluminum nitride formation in aluminum-rich iron alloys and the relationship between internal nitride and oxide precipitation and external oxide scale morphology and composition. The iron-aluminum alloys were heated in N2 atmospheres containing oxygen impurities. It was found that nitrides formed when bulk aluminum content was below 8 wt.% when oxygen was sufficiently depleted due to the internal oxidation. In the samples containing 1 wt.% aluminum, the depth of the internal oxide and nitride zones were in agreement with a diffusion-based model. Increasing aluminum content to 3 and 5 wt% had the effects of modifying the surface-oxide scale composition and increasing its continuity, which gradually decreased the internal precipitation zones with increasing aluminum content. In samples containing 8 wt.% aluminum, a thick continuous oxide scale formed and prevented nitrogen and oxygen penetration into the bulk of the sample, thus preventing the formation of any internal precipitates. The effect of modifying the heating rate in pure N2 atmospheres was examined. Samples were heated over the course of 1, 10, or 100 minutes. Faster heating rates increased the aluminum content in the oxide scale on all samples. Additionally, these rapid heating rate samples had either had lower internal precipitation depths or no internal precipitates. Experiments were conducted in N2--2.5% H2/H 2O mixtures with varying dew points to lower the oxygen potential of the reaction gas and prevent the formation of external iron oxide scales. In the 3 and 5 wt.% Al alloys, this produced an internal aluminum-rich oxide band which inhibited further internal precipitation. Samples treated in atmospheres to simulate the reheat furnace combustion atmosphere experienced dramatically increased external oxidation in addition to inward growth of the oxide scale and internal precipitation of oxides and nitrides within the metal. The most important scientific findings of this dissertation are the dramatic effect of heating rate on modifying the external scale of the alloys presented and the presence of continuous internal oxide bands in several samples throughout the study. Oxidation studies typically occur for longer times and in higher oxygen contents than the present results, so the influence of heating rate is either largely unnoticed or is overcome by oxide growth at long times. Oxide bands have been observed in literature, but few aluminum oxide bands have been seen before this study. vi.

  17. Calcium nutrition and metabolism during infancy

    Microsoft Academic Search

    J. Kirk Bass; Gary M. Chan

    2006-01-01

    Calcium is a vital mineral for the developing newborn infant. This review discusses perinatal and neonatal calcium metabolism, with an emphasis on enteral calcium absorption and the nutritional factors affecting calcium bioavailability including the three major endocrine hormones involved in calcium metabolism: parathyroid hormone, vitamin D, and calcitonin. The placenta transports calcium to the fetus throughout pregnancy, with the largest

  18. Osteoinduction by calcium phosphate biomaterials

    Microsoft Academic Search

    Huipin Yuan; Zongjian Yang; Yubao Li; Xingdong Zhang; J. D. De Bruijn; K. De Groot

    1998-01-01

    Different materials were implanted in muscles of dogs to study the osteoinduction of calcium phosphate biomaterials. Bone formation was only seen in calcium phosphate biomaterials with micropores, and could be found in hydroxyapatite (HA) ceramic, tricalcium phosphate\\/hydroxyapatite ceramic (BCP), ß-TCP ceramic and calcium phosphate cement. The osteoinductive potential was different in different materials. The results indicate that osteoinduction can be

  19. Mechanisms of Renal Calcium Transport

    Microsoft Academic Search

    Peter A. Friedman

    2000-01-01

    The kidneys play a key role in the integrated regulation of calcium homeostasis. Calcium absorption takes place throughout the nephron. Proximal tubules, thick ascending limbs of Henle’s loop, and distal tubules are the major sites of calcium absorption. The mechanisms of absorption vary significantly from one segment to another, as does the extent of hormonal regulation. At one extreme is

  20. Plant protein and calcium balance

    Microsoft Academic Search

    Olufunmike A. Ajayi

    1977-01-01

    The effect of low protein intake from plant sources on calcium excretions and calcium balance of seven young adults was investigated. The diets (four combinations of egg, groundnut and soyabean nitrogen) furnished 43 g protein (0.58 g protein\\/kg) and 550 mg calcium daily.

  1. Ion scattering spectroscopy studies of barium and oxygen on tungsten and tungsten-based dispenser cathodes

    NASA Astrophysics Data System (ADS)

    Marrian, C. R. K.; Shih, A.; Haas, G. A.

    1985-12-01

    In order to use Ion Scattering Spectroscopy (ISS) for studies of tungsten dispenser cathodes, the relevant ISS sensitivities must be measured. Calibrations have been made using a polycrystalline tungsten ribbon with controlled coverages of oxygen, barium and combinations thereof. Auger Electron Spectroscopy (AES) was used to monitor these controlled surfaces and the escape depths of the tungsten Auger electrons in barium and oxygen have been measured. The absolute ISS sensitivities of all three elements were found to be strongly dependent on the barium coverage of the tungsten surface. This effect has been attributed to the lowering of the work function of the tungsten surface caused by the barium adsorption. However, the relative ISS sensitivities of the three elements are not affected in this way when both barium and oxygen (or oxygen alone) are present on the tungsten surface. ISS spectra of such surfaces have been analyzed quantitatively and found to be in reasonable agreement with AES measurements. The analysis has also been applied to ISS spectra of uncoated tungsten matrix dispenser cathodes in an active state and following exposure to oxygen. Compared to AES, these spectra indicate less oxygen on the active cathode surfaces as a result of the oxygen (associated with barium) not contributing to the oxygen ISS signal. Comparisons of the spectra from the active and oxygen poisoned cathodes suggest that oxygen adsorbed during the oxygen exposure sits on the topmost barium layer whereas the oxygen on the active cathode surface does not.

  2. Lysosomal calcium regulates autophagy.

    PubMed

    Medina, Diego L; Ballabio, Andrea

    2015-06-01

    Recent evidence has indicated that the lysosome is able to act as a signaling organelle that senses nutrient availability and generates an adaptive response that is important for cellular homeostasis. We recently discovered another example of lysosomal signaling where lysosomal calcium release activates the master autophagy regulator TFEB via the phosphatase calcineurin. PMID:26000950

  3. Calcium silicate insulation structure

    DOEpatents

    Kollie, Thomas G. (Oak Ridge, TN); Lauf, Robert J. (Oak Ridge, TN)

    1995-01-01

    An insulative structure including a powder-filled evacuated casing utilizes a quantity of finely divided synthetic calcium silicate having a relatively high surface area. The resultant structure-provides superior thermal insulating characteristics over a broad temperature range and is particularly well-suited as a panel for a refrigerator or freezer or the insulative barrier for a cooler or a insulated bottle.

  4. Calcium biofortification of crops

    Technology Transfer Automated Retrieval System (TEKTRAN)

    More than half of the world's population is deficient in calcium (Ca), iron (Fe), iodine (I), magnesium (Mg), selenium (Se), or zinc (Zn). The consumption of plants, directly or via livestock, containing inadequate concentrations of particular minerals causes these deficiencies. Agronomic and geneti...

  5. Neurotransmitters Calcium ions

    E-print Network

    Cai, Long

    Actin Nerve terminal Active zone Neurotransmitters Calcium ions Sodium ions Ultrafast endocytosis.These`bouton-type'ter- minalscontainapproximately200synapticves- icles (30­40 nanometres across), each packed with about 2,000 neurotransmitter). It is thought that one to three of those docked vesicles are primed to release neurotransmitters by a process

  6. Calcium and Vitamin D

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Adequate intakes of vitamin D and calcium are essential preventative measures and essential components of any therapeutic regimen for osteoporosis. Vitamin D is also important for the prevention of falls. Current evidence suggests that a 25-hydroxyvitamin D level of 75 nmol/L (30 ng/ml) or higher ...

  7. Creep of laminated aluminum composites

    Microsoft Academic Search

    W. Moore; T. J. Davies

    1980-01-01

    The creep behavior of a laminate system consisting of alternate layers of pure aluminum and SAP (sintered aluminum powder)\\u000a sheet has been examined in the temperature range 323 to 473 K and in the stress range 35 to 68 MN m?2. It was observed that secondary creep strain in the laminates was greater than in elemental SAP; the secondary creep

  8. Chrome - Free Aluminum Coating System

    NASA Technical Reports Server (NTRS)

    Bailey, John H.; Gugel, Jeffrey D.

    2010-01-01

    This slide presentation concerns the program to qualify a chrome free coating for aluminum. The program was required due to findings by OSHA and EPA, that hexavalent chromium, used to mitigate corrosion in aerospace aluminum alloys, poses hazards for personnel. This qualification consisted of over 4,000 tests. The tests revealed that a move away from Cr+6, required a system rather than individual components and that the maximum corrosion protection required pretreatment, primer and topcoat.

  9. Aluminum-air battery crystallizer

    Microsoft Academic Search

    A. Maimoni

    1987-01-01

    A prototype crystallizer system for the aluminum-air battery operated reliably through simulated startup and shutdown cycles and met its design objectives. The crystallizer system allows for crystallization and removal of the aluminium hydroxide reaction product; it is required to allow steady-state and long-term operation of the aluminum-air battery. The system has to minimize volume and maintain low turbulence and shear

  10. 75 FR 70689 - Kaiser Aluminum Fabricated Products, LLC; Kaiser Aluminum-Greenwood Forge Division; Currently...

    Federal Register 2010, 2011, 2012, 2013, 2014

    2010-11-18

    ...Administration [TA-W-70,376] Kaiser Aluminum Fabricated Products, LLC; Kaiser Aluminum- Greenwood Forge Division; Currently Known...2, 2009, applicable to workers of Kaiser Aluminum Fabricated Products, LLC, Kaiser...

  11. Pigment-derived inhibitors for aluminum alloy 2024-T3

    SciTech Connect

    Cook, R.L. Jr.; Taylor, S.R.

    2000-03-01

    Inhibitor characteristics of 27 compounds considered as possible replacements for chromate pigments in aerospace paint were investigated. These compounds were tested and screened in solution and not as actual paint additives. In initial testing, aluminum alloy (AA) 2024-T3 (UNS A92024) samples were exposed to 0.6 M sodium chloride (NaCl, pH adjusted to 7, T = 23 C) with 3.4 mM of the candidate compound dissolved in solution. Corrosion inhibition characteristics were assessed via electrochemical impedance spectroscopy (EIS) performed over 10 days, and the statistical analysis of pit depths was analyzed at the conclusion of each exposure. Promising candidates then were exposed to more extreme environments to simulate possible service-life conditions. These environments included unbuffered 0.6 M NaCl initially adjusted to pH 3, T = 23 C and pH 10, T = 23 C. Several candidate inhibitors appeared promising: barium metaborate, cerium chloride, cerium oxalate, lanthanum chloride, and sodium metavanadate. Under the conditions of these tests, sodium metavanadate consistently displayed the best performance. EIS data indicated the corrosion performance of sodium metavanadata was within an order of magnitude of sodium chromate (Na{sub 2}CrO{sub 4}), while pit depth values for metavanadate were comparable to those observed for Na{sub 2}CrO{sub 4}. Rankings of inhibitor performance as determined by EIS was supported by the extreme value analysis of pit depth.

  12. Stochastic calcium mechanisms cause dendritic calcium spike variability.

    PubMed

    Anwar, Haroon; Hepburn, Iain; Nedelescu, Hermina; Chen, Weiliang; De Schutter, Erik

    2013-10-01

    Bursts of dendritic calcium spikes play an important role in excitability and synaptic plasticity in many types of neurons. In single Purkinje cells, spontaneous and synaptically evoked dendritic calcium bursts come in a variety of shapes with a variable number of spikes. The mechanisms causing this variability have never been investigated thoroughly. In this study, a detailed computational model using novel simulation routines is applied to identify the roles that stochastic ion channels, spatial arrangements of ion channels, and stochastic intracellular calcium have toward producing calcium burst variability. Consistent with experimental recordings from rats, strong variability in the burst shape is observed in simulations. This variability persists in large model sizes in contrast to models containing only voltage-gated channels, where variability reduces quickly with increase of system size. Phase plane analysis of Hodgkin-Huxley spikes and of calcium bursts identifies fluctuation in phase space around probabilistic phase boundaries as the mechanism determining the dependence of variability on model size. Stochastic calcium dynamics are the main cause of calcium burst fluctuations, specifically the calcium activation of mslo/BK-type and SK2 channels. Local variability of calcium concentration has a significant effect at larger model sizes. Simulations of both spontaneous and synaptically evoked calcium bursts in a reconstructed dendrite show, in addition, strong spatial and temporal variability of voltage and calcium, depending on morphological properties of the dendrite. Our findings suggest that stochastic intracellular calcium mechanisms play a crucial role in dendritic calcium spike generation and are therefore an essential consideration in studies of neuronal excitability and plasticity. PMID:24089492

  13. Commonwealth Aluminum: Manufacturer Conducts Plant-Wide Energy Assessments at Two Aluminum Sheet Production Operations;

    SciTech Connect

    Not Available

    2006-04-01

    DOE Industrial Technologies Program case study describes the savings possible if Commonwealth Aluminum (now Aleris Rolled Products) makes improvements noted in energy assessments at two aluminum mills.

  14. Phase structures and stability in barium titanate ferroelectric ultrathin films

    NASA Astrophysics Data System (ADS)

    Zhang, Jian; Yin, Zhen; Zhang, Ming-Sheng

    2003-04-01

    Under taking into account both stress and surface effects, an extended Landau-Devonshire theory is developed to investigate the phase structures and ferroelectric stability in barium titanate ultrathin films. The phase diagrams of temperature-stress, film thickness-stress and polarization-film thickness are calculated. For the surface polarization smaller than the bulk, the paraelectric phase starts at temperature below the bulk Curie temperature under small stresses and the ferroelectric phases can be stabilized in the ultrathin films under large stresses. For the surface polarization larger than the bulk, the paraelectric phase appears at temperature above the bulk Curie temperature and the ferroelectricity can be sustained in the ultrathin films by the “superpolarized” surface layer.

  15. Coralline barium records temporal variability in equatorial Pacific upwelling

    NASA Astrophysics Data System (ADS)

    Lea, David W.; Shen, Glen T.; Boyle, Edward A.

    1989-08-01

    LATTICE-BOUND cadmium in scleractinian corals has been shown to be a sensitive tracer of historical changes in the nutrient content of surface waters1,2. Barium also substitutes into the lattice of aragonite reef-building corals because there is solid solution between orthorhombic BaCO3 (witherite) and CaCO3(aragonite)3. It is expected that the substitution should be proportional to the Ba content of sea water, which increases from low values in warm surface waters to higher values in cold deep waters. Here we present a high-resolution coralline Ba record from the Galapagos Islands spanning the period 1965-1978. Coralline Ba/Ca tracks historical sea surface temperatures, reflecting the vertical displacement of warm nutrient-poor surface waters by cold, nutrient-rich source waters. Differences between coralline Ba and Cd records may be due to preferential uptake of Cd by phytoplankton during times of lower surface nutrients.

  16. Piezoresistive ceramic sensor based on PTCR barium titanate

    SciTech Connect

    Capurso, J.S.; Schulze, W.A.; Alles, A.B. [Alfred Univ., NY (United States)

    1994-12-31

    High purity, chemically prepared barium titanate was doped with 0.3 atom% La and 0.04 atom% Mn by precipitation. Using standard techniques, tape-cast sheets of the PTCR composition as well as the base insulating powder were made. A three-layer sensor was laminated with the upper and lower PTCR layers separated by an insulating BaTiO{sub 3} layer. After binder burnout, the device was sintered at 1350{degrees}C in flowing N{sub 2} followed by cooling in flowing O{sub 2} at 300{degrees}C/hour. The sensor was loaded using a standard four-point bend test configuration. The change in resistivity with increasing load was observed to the linear, with positive and negative piezoresistive coefficients for the PTCR layers under compression and tension, respectively. These trends are in general agreement with the Heywang-Jonker model of grain boundary potential barriers.

  17. Synthesis and optical study of barium magnesium aluminate blue phosphors

    NASA Astrophysics Data System (ADS)

    Jeet, Suninder; Sharma, Manoj; Pandey, O. P.

    2015-05-01

    Europium doped barium magnesium aluminate (BaMgAl10O17:Eu2+) phosphor was prepared via solution combustion method at 550°C using urea as a fuel. Morphological and optical properties of the prepared sample was studied by X-ray diffraction (XRD), Transmission electron microscopy (TEM) and Photoluminescence spectroscopy (PL). XRD result showed the formation of pure phase BaMgAl10O17(JCPDS 26-0163) along with an additional phase BaAl2O4(JCPDS 01-082-1350). TEM image indicated the formation of faceted particles with average particle size 40 nm. From PL spectra, a broad emission band obtained at about 450 nm attributes to 4f6 5d ? 4f7 transition of Eu2+ which lies in the blue region of the visible spectrum.

  18. Barium titanate nanocomposite capacitor FY09 year end report.

    SciTech Connect

    Stevens, Tyler E.; DiAntonio, Christopher Brian; Yang, Pin; Chavez, Tom P.; Winter, Michael R.; Monson, Todd C.; Roesler, Alexander William; Fellows, Benjamin D.

    2009-11-01

    This late start RTBF project started the development of barium titanate (BTO)/glass nanocomposite capacitors for future and emerging energy storage applications. The long term goal of this work is to decrease the size, weight, and cost of ceramic capacitors while increasing their reliability. Ceramic-based nanocomposites have the potential to yield materials with enhanced permittivity, breakdown strength (BDS), and reduced strain, which can increase the energy density of capacitors and increase their shot life. Composites of BTO in glass will limit grain growth during device fabrication (preserving nanoparticle grain size and enhanced properties), resulting in devices with improved density, permittivity, BDS, and shot life. BTO will eliminate the issues associated with Pb toxicity and volatility as well as the variation in energy storage vs. temperature of PZT based devices. During the last six months of FY09 this work focused on developing syntheses for BTO nanoparticles and firing profiles for sintering BTO/glass composite capacitors.

  19. Barium strontium oxide coated carbon nanotubes as field emitters

    NASA Astrophysics Data System (ADS)

    Jin, Feng; Liu, Yan; Day, Christopher M.

    2007-04-01

    The authors report a field emitter structure based on oxide coated carbon nanotubes (CNTs). This emitter consists of a thin tungsten ribbon with CNTs on the surface and a thin layer of low work function barium strontium oxide coating on the CNTs. This oxide coated CNT emitter was designed to combine the benefits of the high field enhancement factor from CNTs and the low work function from the emissive oxide coating. The field emission properties of the emitters were characterized. A field enhancement factor of 467 and a work function of 1.9eV were obtained for the oxide coated CNTs. Compared to the uncoated CNTs, the field emission from the oxide coated CNTs increased by a factor of 2-3. At 4.4V/?m, the field emission current of 23.6?A was obtained from an emitting surface of 0.012cm2.

  20. Impact of vanadium ions in barium borate glass

    NASA Astrophysics Data System (ADS)

    Abdelghany, A. M.; Hammad, Ahmed H.

    2015-02-01

    Combined optical and infrared spectral measurements of prepared barium borate glasses containing different concentrations of V2O5 were carried out. Vanadium containing glasses exhibit extended UV-visible (UV/Vis.) bands when compared with base binary borate glass. UV/Vis. spectrum shows the presence of an unsymmetrical strong UV broad band centered at 214 nm attributed to the presence of unavoidable trace iron impurities within the raw materials used for the preparation of such glass. The calculated direct and indirect optical band gaps are found to decrease with increasing the vanadium content (2.9:137 for indirect and 3.99:2.01 for direct transition). This change was discussed in terms of structural changes in the glass network. Infrared absorption spectra of the glasses reveal the appearance of both triangular and tetrahedral borate units. Electron spin resonance analyses indicate the presence of unpaired species in sufficient quantity to be identified and to confirm the spectral data.

  1. Communication: Barium ions and helium nanodroplets: Solvation and desolvation

    NASA Astrophysics Data System (ADS)

    Zhang, Xiaohang; Drabbels, Marcel

    2012-08-01

    The solvation of Ba+ ions created by the photoionization of barium atoms located on the surface of helium nanodroplets has been investigated. The excitation spectra corresponding to the 6p 2P1/2 ? 6s 2S1/2 and 6p 2P3/2 ? 6s 2S1/2 transitions of Ba+ are found to be identical to those recorded in bulk He II [H. J. Reyher, H. Bauer, C. Huber, R. Mayer, A. Schafer, and A. Winnacker, Phys. Lett. A 115, 238 (1986)], indicating that the ions formed at the surface of the helium droplets become fully solvated by the helium. Time-of-flight mass spectra suggest that following the excitation of the solvated Ba+ ions, these are being ejected from the helium droplets either as bare Ba+ ions or as small Ba+Hen (n < 20) complexes.

  2. Conoscopic study of strontium-barium niobate single crystals

    NASA Astrophysics Data System (ADS)

    Kolesnikov, Aleksandr; Grechishkin, Rostislav; Malyshkina, Olga; Malyshkin, Yury; Dec, Jan; ?ukasiewicz, Tadeusz; Ivanova, Aleksandra

    2013-12-01

    Optically transparent single crystals of strontium-barium niobate, SrxBa1-xNb2O6, of different compositions (x = 0.26...0.7) were examined with the aid of conoscopic light interference figures. A regular change of the isochrome concentric ring number and diameters consistent with the temperature variation of the value of birefringence is demonstrated by direct observations of polar cuts of optically uniaxial samples. Anomalous violations of the conventional (uniaxial) interference patterns occur occasionaly in some samples being indicative of the existence of biaxial trait in their behaviour even though no voltage is applied. These features may depend on annealing treatments at elevated temperatures. The results of the study show that conoscopic images may serve as a sensitive indicator of the structural state of SBN crystals related to the effects of stress-induced change of optical anisotropy and temperature dependent birefringence parameters.

  3. Supercritical fluid route for synthesizing crystalline Barium Strontium Titanate nanoparticles.

    PubMed

    Reverón, H; Elissalde, C; Aymonier, C; Bidault, O; Maglione, M; Cansell, F

    2005-10-01

    Pure and well-crystallized Barium Strontium Titanate (BST) nanoparticles with controlled Ba/Sr ratio have been successfully synthesized under supercritical conditions using a continuous-flow reactor in the temperature range of 150-380 degrees C at 26 MPa. To synthesize the Ba0.6Sr0.4TiO3 composition, alkoxides, ethanol and water were used. The resulting nanopowder consists of fine particles with an average particle size of 23 nm. The results show that the Ba/Sr ratio of this powder can be accurately controlled from the composition of precursor. The characterization of the as-synthesized Ba0.6Sr0.4TiO3 solid-solution and the dielectric properties of the sintered ceramics are here reported. PMID:16245539

  4. A new type of microphone using flexoelectric barium strontium titnate

    NASA Astrophysics Data System (ADS)

    Kwon, Seol ryung; Huang, Wenbin; Zhang, Shujun; Yuan, Fuh-Gwo; Jiang, Xiaoning

    2014-03-01

    A flexoelectric bridge-structured microphone using bulk barium strontium titanate (Ba0.65Sr0.35TiO3 or BST) ceramic was investigated in this study. The flexoelectric microphone was installed in an anechoic box and exposed to the sound pressure emitted from a loud speaker. Charge sensitivity of the flexoelectric microphone was measured and calibrated using a reference microphone. The 1.5 mm×768 ?m×50 ?m micro-machined bridge-structured flexoelectric microphone has a sensitivity of 0.92 pC/Pa, while its resonance frequency was calculated to be 98.67 kHz. The analytical and experimental results show that the flexoelectric microphone has both high sensitivity and broad bandwidth, indicating that flexoelectric microphones are potential candidates for many applications.

  5. Raman scattering study of barium borate glasses and melts

    NASA Astrophysics Data System (ADS)

    Osipov, Armenak A.; Osipova, Leyla M.

    2013-07-01

    Glasses and melts of xBaO-(100-x)B2O3 (x=20, 25, 30, 35, 40, 45, 50, 55, 60 and 67 mol%) composition have been prepared and studied using high-temperature Raman spectroscopy. It was shown that the structure of the glassy and molten samples with relatively low concentrations of barium oxide (x=20-35 mol%) consists of [B?4]- charged tetrahedra (? is a bridging oxygen atom), B?2O- asymmetric triangles (O- is a non-bridging oxygen atom) and B?3 neutral units. The concentration of [B?4]- tetrahedra (N4) monotonously decreases with increasing BaO content in the melts structure, whereas N4 demonstrates a maximum at x?40 mol% in the glassy samples. B?O22- pyroborate units appear at x?40 mol%, and BO33- orthoborate anions are also formed in the melts structure when x=60 and 67 mol%. The dominant mechanisms for the structural reorganizations generated by changes in temperature depend on the melt composition. The changes in the short range order (SRO) structures can be described by the [B?4]-?B?2O- isomerization reaction at 2550 is most likely described by the 2B?2O?B?O22-+B?3 disproportionation reaction. In both cases, the equilibrium shifts to the right with an increase in temperature. Significant changes in the local structures of melts with a low concentration of barium oxide (x?20 mol%) were not found.

  6. Synthesis of calcium superoxide

    NASA Technical Reports Server (NTRS)

    Rewick, R. T.; Blucher, W. G.; Estacio, P. L.

    1972-01-01

    Efforts to prepare Ca(O2) sub 2 from reactions of calcium compounds with 100% O3 and with O(D-1) atoms generated by photolysis of O3 at 2537 A are described. Samples of Ca(OH) sub 2, CaO, CaO2, Ca metal, and mixtures containing suspected impurities to promote reaction have been treated with excess O3 under static and flow conditions in the presence and absence of UV irradiation. Studies with KO2 suggest that the superoxide anion is stable to radiation at 2537 A but reacts with oxygen atoms generated by the photolysis of O3 to form KO3. Calcium superoxide is expected to behave in an analogous.

  7. Calcium in Plants

    PubMed Central

    WHITE, PHILIP J.; BROADLEY, MARTIN R.

    2003-01-01

    Calcium is an essential plant nutrient. It is required for various structural roles in the cell wall and membranes, it is a counter?cation for inorganic and organic anions in the vacuole, and the cytosolic Ca2+ concentration ([Ca2+]cyt) is an obligate intracellular messenger coordinating responses to numerous developmental cues and environmental challenges. This article provides an overview of the nutritional requirements of different plants for Ca, and how this impacts on natural flora and the Ca content of crops. It also reviews recent work on (a) the mechanisms of Ca2+ transport across cellular membranes, (b) understanding the origins and specificity of [Ca2+]cyt signals and (c) characterizing the cellular [Ca2+]cyt?sensors (such as calmodulin, calcineurin B?like proteins and calcium?dependent protein kinases) that allow plant cells to respond appropriately to [Ca2+]cyt signals. PMID:12933363

  8. Use of Bisacodyl in Preparation of the Bowels for a Barium Enema

    Microsoft Academic Search

    J. G. Sowerbutts

    1960-01-01

    This account of a new and successful technique in preparing patients for a barium enema examination will interest clinicians, for its eventual adoption by radiologists would greatly reduce the discomfort of this invaluable but disagreeable investigation.

  9. Numberical simulation of the effects of radially injected barium plasma in the ionosphere

    NASA Technical Reports Server (NTRS)

    Swift, D. W.

    1985-01-01

    The morphology of the ion cloud in the radial shaped charge barium injection was studied. The shape of the ion cloud that remains after the explosive products and neutral barium clears away was examined. The ion cloud which has the configuration of a rimless wagon wheel is shown. The major features are the 2.5 km radius black hole in the center of the cloud, the surrounding ring of barium ion and the spokes of barium ionization radiating away from the center. The cloud shows no evolution after it emerges from the neutral debris and it is concluded that it is formed within 5 seconds of the event. A numerical model is used to calculate the motion of ions and electrons subject to the electrostatic and lorenz forces.

  10. Calcium signaling in lymphocytes

    PubMed Central

    Oh-hora, Masatsugu; Rao, Anjana

    2008-01-01

    In cells of the immune system, calcium signals are essential for diverse cellular functions including differentiation, effector function and gene transcription. After engagement of immunoreceptors such as T-cell and B-cell antigen receptors and the Fc receptors on mast cells and NK cells, the intracellular concentration of calcium ions is increased through the sequential operation of two interdependent processes: depletion of endoplasmic reticulum Ca2+ stores as a result of binding of inositol trisphosphate (IP3) to IP3 receptors, followed by “store-operated” Ca2+ entry through plasma membrane Ca2+ channels. In lymphocytes, mast cells and other immune cell types, store-operated Ca2+ entry through specialised Ca2+ release-activated calcium (CRAC) channels constitutes the major pathway of intracellular Ca2+ increase. A recent breakthrough in our understanding of CRAC channel function is the identification of STIM and ORAI, two essential regulators of CRAC channel function. This review focuses on the signaling pathways upstream and downstream of Ca2+ influx (the STIM/ ORAI and calcineurin/ NFAT pathways respectively). PMID:18515054

  11. Barium isotopes in Allende meteorite: evidence against an extinct superheavy element

    Microsoft Academic Search

    R. S. Lewis; E. Anders; T. Shimamura; G. W. Lugmair

    1983-01-01

    Carbon and chromite fractions from the Allende meteorite that contain isotopically anomalous xenon-131 to xenon-136 (carbonaceous chondrite fission or CCF xenon) at up to 5 x 10¹¹ atoms per gram show no detectable isotopic anomalies in barium-130 to barium-138. This rules out the possibility that the CCF xenon was formed by in situ fission of an extinct superheavy element. Apparently

  12. Barium isotopes in Allende meteorite - Evidence against an extinct superheavy element

    NASA Technical Reports Server (NTRS)

    Lewis, R. S.; Anders, E.; Shimamura, T.; Lugmair, G. W.

    1983-01-01

    Carbon and chromite fractions from the Allende meteorite that contain isotopically anomalous xenon-131 to xenon-136 (carbonaceous chondrite fission or CCF xenon) at up to 5 x 10 to the 11th atoms per gram show no detectable isotopic anomalies in barium-130 to barium-138. This rules out the possibility that the CCF xenon was formed by in situ fission of an extinct superheavy element. Apparently the CCF xenon and its carbonaceous carrier are relics from stellar nucleosynthesis.

  13. Application of an intensified narrow channel reactor to the aqueous phase precipitation of barium sulphate

    Microsoft Academic Search

    E. D. McCarthy; W. A. E. Dunk; K. V. K. Boodhoo

    2007-01-01

    A homogeneous liquid phase reaction between barium chloride (BaCl2) and sodium sulphate (Na2SO4) was conducted in a narrow channel reactor to produce barium sulphate (BaSO4) precipitate. The effects of channel dimensions and channel residence times on crystal size, crystal size distribution, nucleation rates, crystal morphology and conversion of reactants were investigated at different levels of reactant supersaturation ratio. Our results

  14. Dynamic Release of Vitamin B2 from Floating Barium Alginate Beads for Gastric Delivery

    Microsoft Academic Search

    S. K. Bajpai; Seema Dubey

    2007-01-01

    The present study is focused on the development of floating barium alginate beads, which after oral administration, are intended to prolong the gastric residence time and increase the drug bioavailability. Out of three different barium alginate bead samples prepared using NaHCO3 as porogen, the beads prepared with 4 and 5 percent solutions of sodium alginate and with 1.5% content of

  15. Comparison of the reflectance characteristics of polytetrafluoroethylene and barium sulfate paints

    NASA Technical Reports Server (NTRS)

    Butner, C. L.; Schutt, J. B.; Shai, M. C.

    1984-01-01

    Preliminary results are presented of the directional reflectance measurements taken on two tetrafluorethylene (TFE) paints formulated with silicone binders. Both paints are found to be more Lambertian than barium sulfate paint and pressed powder, although the pigment to binder ratios for barium sulfate and TFE paints are about 133 and 3.3 to 1, respectively. The TFE paints exhibit total visible reflectances above 90 percent and offer surfaces that are not significantly affected by water.

  16. Barium isotopes in allende meteorite: evidence against an extinct superheavy element.

    PubMed

    Lewis, R S; Anders, E; Shimamura, T; Lugmair, G W

    1983-12-01

    Carbon and chromite fractions from the Allende meteorite that contain isotopically anomalous xenon-131 to xenon-136 (carbonaceous chondrite fission or CCF xenon) at up to 5 x 10(11) atoms per gram show no detectable isotopic anomalies in barium-130 to barium-138. This rules out the possibility that the CCF xenon was formed by in situ fission of an extinct superheavy element. Apparently the CCF xenon and its carbonaceous carrier are relics from stellar nucleosynthesis. PMID:17776244

  17. Experimental investigations on barium titanate nanocomposite thin films as an opto-electronic humidity sensor

    Microsoft Academic Search

    Nidhi Verma; Satyendra Singh; B. C. Yadav

    2012-01-01

    This article reports the synthesis and characterisation of Barium titanate (BaTiO3) nanocomposite and its application as opto-electronic humidity sensor. Titanium tetrachloride and barium hydroxide were mixed in molar ratio 1?:?1 in deionised water under continuous stirring at room temperature. Later, sodium hydroxide solution was added to above solution with continuous stirring. Finally, BaTiO3 gel was obtained. The synthesised nano-composite material

  18. Highly aluminium doped barium and strontium ferrite nanoparticles prepared by citrate auto-combustion synthesis

    Microsoft Academic Search

    Neil J.. Shirtcliffe; Simon Thompson; Eoin S. O’Keefe; Steve Appleton; Carole C.. Perry

    2007-01-01

    Aluminium doped barium and strontium hexaferrite nanoparticles BaAlxFe(12?x)O19 and SrAlxFe(12?x)O19 were synthesised via a sol–gel route using citric acid to complex the ions followed by an auto-combustion reaction. This method shows promise for the synthesis of complex ferrite powders with small particle size. It was found that around half of the iron could be substituted for aluminium in the barium

  19. Ammonia fuel cell using doped barium cerate proton conducting solid electrolytes

    Microsoft Academic Search

    L. Pelletier; A. McFarlan; N. Maffei

    2005-01-01

    Proton-conducting solid electrolytes composed of gadolinium-doped barium cerate (BCG) or gadolinium and praseodymium-doped barium cerate (BCGP) were tested in an intermediate-temperature fuel cell in which hydrogen or ammonia was directly fed. At 700°C, BCG electrolytes with porous platinum electrodes showed essentially no loss in performance in pure hydrogen. Under direct ammonia at 700°C, power densities were only slightly lower compared

  20. The role of barium swallow in the management of the globus pharyngeus

    Microsoft Academic Search

    A. Alaani; S. Vengala; M. N. Johnston

    2007-01-01

    Globus pharyngeus is a common benign condition with controversial management. Patients with globus pharyngeus are usually\\u000a investigated to exclude the possibility of upper aerodiagestive malignancies. There is a great debate about the role of barium\\u000a swallow in the management of this condition. Review of 1,145 barium swallow repourts of patients presented with globus pharyngeus\\u000a between 1999 and 2004 has failed

  1. [Glucagon-based cleansing enemas prior to a double-contrast barium enema].

    PubMed

    Pietilä, J A

    1992-01-01

    The cleansing effect of large-volume enemas supported or unsupported by glucagon was studied in 20 each outpatients before a double-contrast barium enema. There was no statistically significant difference in respect of the remaining rests of faeces and the contrast medium coat. Patients suffering from intestinal spasms and anal insufficiency experience a feeling of relief by the intramuscular administration of glucagon during the preparatory enema; the quality of the double-contrast barium enema is not affected. PMID:1547292

  2. Weld Repair of Thin Aluminum Sheet

    NASA Technical Reports Server (NTRS)

    Beuyukian, C. S.; Mitchell, M. J.

    1986-01-01

    Weld repairing of thin aluminum sheets now possible, using niobium shield and copper heat sinks. Refractory niobium shield protects aluminum adjacent to hole, while copper heat sinks help conduct heat away from repair site. Technique limits tungsten/inert-gas (TIG) welding bombardment zone to melt area, leaving surrounding areas around weld unaffected. Used successfully to repair aluminum cold plates on Space Shuttle, Commercial applications, especially in sealing fractures, dents, and holes in thin aluminum face sheets or clad brazing sheet in cold plates, heat exchangers, coolers, and Solar panels. While particularly suited to thin aluminum sheet, this process also used in thicker aluminum material to prevent surface damage near weld area.

  3. Aluminum Metal Matrix Composites

    SciTech Connect

    Hunt, Warren; Herling, Darrell R.

    2004-02-01

    Metal matrix composites comprise a relatively wide range of materials defined by the metal matrix, reinforcement type, and reinforcement geometry. In the area of the matrix, most metallic systems have been explored for use in metal matrix composites, including Al, Be, Mg, Ti, Fe, Ni, Co, and Ag. By far, the largest usage is in aluminum matrix composites. From a reinforcement perspective, the materials used are typically ceramics since they provide a very desirable combination of stiffness, strength, and relatively low density. Candidate reinforcement materials include SiC, Al2O3, B4C, TiC, TiB2, graphite, and a number of other ceramics. In addition, there has been work on metallic materials as reinforcements, notably W and steel fibers. The morphology of the reinforcement material is another variable of importance in metal matrix composites. The three major classes of reinforcement morphology are continuous fiber, chopped fiber or whisker, and particulate. Typically, the selection of the reinforcement morphology is determined by the desired property/cost combination. Generally, continuous fiber reinforced MMCs provide the highest properties in the direction of the fiber orientation but are the most expensive. Chopped fiber and whisker reinforced materials can produce significant property improvements in the plane or direction of their orientation, at somewhat lower cost. Particulates provide a comparatively more moderate but isotropic increase in properties and are typically available at the lowest cost. By adding to the three variables of metallic matrix, reinforcement material, and reinforcement morphology the further options of reinforcement volume fraction, orientation, and matrix alloy composition and heat treatment, it is apparent that there is a very wide range of available material combinations and resultant properties. This paper will focus on how MMCs have been applied in specific application areas.

  4. Barium swallow study in routine clinical practice: a prospective study in patients with chronic cough*,**

    PubMed Central

    Nin, Carlos Shuler; Marchiori, Edson; Irion, Klaus Loureiro; Paludo, Artur de Oliveira; Alves, Giordano Rafael Tronco; Hochhegger, Daniela Reis; Hochhegger, Bruno

    2013-01-01

    OBJECTIVE: To assess the routine use of barium swallow study in patients with chronic cough. METHODS: Between October of 2011 and March of 2012, 95 consecutive patients submitted to chest X-ray due to chronic cough (duration > 8 weeks) were included in the study. For study purposes, additional images were obtained immediately after the oral administration of 5 mL of a 5% barium sulfate suspension. Two radiologists systematically evaluated all of the images in order to identify any pathological changes. Fisher's exact test and the chi-square test for categorical data were used in the comparisons. RESULTS: The images taken immediately after barium swallow revealed significant pathological conditions that were potentially related to chronic cough in 12 (12.6%) of the 95 patients. These conditions, which included diaphragmatic hiatal hernia, esophageal neoplasm, achalasia, esophageal diverticulum, and abnormal esophageal dilatation, were not detected on the images taken without contrast. After appropriate treatment, the symptoms disappeared in 11 (91.6%) of the patients, whereas the treatment was ineffective in 1 (8.4%). We observed no complications related to barium swallow, such as contrast aspiration. CONCLUSIONS: Barium swallow improved the detection of significant radiographic findings related to chronic cough in 11.5% of patients. These initial findings suggest that the routine use of barium swallow can significantly increase the sensitivity of chest X-rays in the detection of chronic cough-related etiologies. PMID:24473762

  5. Plasma deposition of thin layers containing titanium and barium with the use of DBD

    NASA Astrophysics Data System (ADS)

    Majdak, Ma?gorzata; Opali?ska, Teresa; Wn?k, Bart?omiej; Konarski, Piotr

    2013-02-01

    Two different methods of deposition of thin layers containing titanium and barium with the use of dielectric barrier discharge were investigated. The first was carried out in two stages. The first stage consisted in transferring compounds containing titanium and barium from the vapor of the organic precursor to the copper substrate, while the second stage involved the etching of the organic layer in oxygen. The second method consisted in transferring titanium and barium to the copper substrate from the ceramic plate made of barium titanate, which was one of the electrodes during the plasma process. The results of analysis obtained by SIMS showed directly that both methods gave a positive result in the deposition of the thin layers containing a certain amount of titanium and barium on the surface of the copper plate. However, more effective method was that involving the properties of reaction with the metallorganic precursor. FTIR study of the layers prepared from the organic precursor indirectly showed that layers deposited on the copper plate contained compounds of barium and titanium. FTIR study also revealed that during the process of etching in oxygen, the organic layer was decreased, but it was not completely removed. Contribution to the Topical Issue "13th International Symposium on High Pressure Low Temperature Plasma Chemistry (Hakone XIII)", Edited by Nicolas Gherardi, Henryca Danuta Stryczewska and Yvan Ségui.

  6. Scaleable Clean Aluminum Melting Systems

    SciTech Connect

    Han, Q.; Das, S.K. (Secat, Inc.)

    2008-02-15

    The project entitled 'Scaleable Clean Aluminum Melting Systems' was a Cooperative Research and Development Agreements (CRADAs) between Oak Ridge National Laboratory (ORNL) and Secat Inc. The three-year project was initially funded for the first year and was then canceled due to funding cuts at the DOE headquarters. The limited funds allowed the research team to visit industrial sites and investigate the status of using immersion heaters for aluminum melting applications. Primary concepts were proposed on the design of furnaces using immersion heaters for melting. The proposed project can continue if the funding agency resumes the funds to this research. The objective of this project was to develop and demonstrate integrated, retrofitable technologies for clean melting systems for aluminum in both the Metal Casting and integrated aluminum processing industries. The scope focused on immersion heating coupled with metal circulation systems that provide significant opportunity for energy savings as well as reduction of melt loss in the form of dross. The project aimed at the development and integration of technologies that would enable significant reduction in the energy consumption and environmental impacts of melting aluminum through substitution of immersion heating for the conventional radiant burner methods used in reverberatory furnaces. Specifically, the program would couple heater improvements with furnace modeling that would enable cost-effective retrofits to a range of existing furnace sizes, reducing the economic barrier to application.

  7. Induction in an Aluminum Can

    NSDL National Science Digital Library

    This activity demonstrates Lenz's Law, which states that an induced electromotive force generates a current that induces a counter magnetic field that opposes the magnetic field generating the current. In the demonstration, an empty aluminum can floats on water in a tray, such as a Petri dish. Students spin a magnet just inside the can without touching the can. The can begins to spin. Understanding what happens can be explained in steps: first, the twirling magnet creates an alternating magnetic field. Students can use a nearby compass to observe that the magnetic field is really changing. Second, the changing magnetic field permeates most things around it, including the aluminum can itself. A changing magnetic field will cause an electric current to flow when there is a closed loop of an electrically conducting material. Even though the aluminum can is not magnetic, it is metal and will conduct electricity. So the twirling magnet causes an electrical current to flow in the aluminum can. This is called an "induced current." Third, all electric currents create magnetic fields. So, in essence, the induced electrical current running through the can creates its very own magnetic field, making the aluminum can magnetic. This is activity four of "Exploring Magnetism." The guide includes science background information, student worksheets, glossary and related resources.

  8. [Calcium--essential for everybody].

    PubMed

    Cichosz, Grazyna; Czeczot, Hanna

    2014-06-01

    Calcium regulates majority of metabolic processes within human organism and its optimal intake decreases risk of metabolic illnesses conditioned by diet. Deficiency of calcium results in higher body max index, increase risk of insulin resistance, diabetes type 2 and osteoporosis. Diet delivering full calcium load diminished impendency of hypertension; calcium regulates tension of smooth muscles of blood vessels, limits neurotransmitters activity and also diminish hazardous activity of sodium chloride. Anticancerogenic activity of calcium results from formation insoluble bile acids and fat acids salts, and most of all, from inhibition of intestine mucosa cells hyper proliferation. Due to presence of vitamin D3, CLA, proteins and bioactive peptides emerging from them, milk is more efficient in prophylaxis of diet conditioned illnesses than calcium supplements. Efficiency of milk and dairy products in treatment of obesity, sclerosis and hypertension has been proved by DASH diet. PMID:25095643

  9. Arsenic stabilization of calcium arsenate waste by hydrothermal precipitation of arsenical natroalunite

    Microsoft Academic Search

    J. Viñals; A. Sunyer; P. Molera; M. Cruells; N. Llorca

    2010-01-01

    The stabilisation of calcium arsenate waste from a copper smelter by precipitation of arsenical natroalunite has been investigated. This procedure could solve the problem of arsenical gypsum production because it is transformed into arsenic-free anhydrite. Natroalunite precipitation was studied at 180-200°C from the slurry obtained after H2SO4-leaching and ozonation of the original waste - using sodium and aluminum sulfates as

  10. Calcium Kinetics During Space Flight

    NASA Technical Reports Server (NTRS)

    Smith, Scott M.; Wastney, Meryl E.; OBrien, Kimberly O.; Lane, Helen W.

    1999-01-01

    Bone loss is one of the most detrimental effects of space flight, threatening to limit the duration of human space missions. The ability to understand and counteract this loss will be critical for crew health and safety during and after extended-duration missions. The hypotheses to be tested in this project are that space flight alters calcium homeostasis and bone mineral metabolism, and that calcium homeostasis and bone mineral metabolism will return to baseline within days to weeks of return to Earth. These hypotheses will be evidenced by elevated rates of bone mineral resorption and decreased bone mineral deposition, decreased absorption of dietary calcium, altered calcitropic endocrine profiles, elevated excretion of calcium in urine and feces, and elevated excretion of markers of bone resorption. The second hypothesis will be evidenced by return of indices of calcium homeostasis and bone metabolism to preflight levels within days to weeks of return to Earth. Studies will be conducted on International Space Station astronauts before, during, and after extended-duration flights. Measurements of calcium kinetics, bone mass, and endocrine/biochemical markers of bone and calcium homeostasis will be conducted. Kinetic studies utilizing dual isotope tracer kinetic studies and mathematical modeling techniques will allow for determination of bone calcium deposition, bone calcium resorption, dietary calcium absorption and calcium excretion (both urinary and endogenous fecal excretion). These studies will build upon preliminary work conducted on the Russian Mir space station. The results from this project will be critical for clarifying how microgravity affects bone and calcium homeostasis, and will provide an important control point for assessment of countermeasure efficacy. These results are expected to aid in developing countermeasures for bone loss, both for space crews and for individuals on Earth who have metabolic bone diseases.

  11. Calcium Phosphate Biomaterials: An Overview

    Microsoft Academic Search

    Huipin Yuan; KLAAS DE GROOT

    Calcium phosphates are used by our body to build bones and are being applied to produce biomaterials for bone repair. It is\\u000a well-known that calcium phosphate biomaterials guide new bone formation, form a tight bond with the newly formed bone, and\\u000a are therefore, by definition, osteoconductive. Besides their osteoconductive property, it was found that calcium phosphate\\u000a biomaterials, only with specific

  12. Calcium signaling in immune cells

    Microsoft Academic Search

    Jean-Pierre Kinet; Monika Vig

    2008-01-01

    Calcium acts as a second messenger in many cell types, including lymphocytes. Resting lymphocytes maintain a low concentration of Ca2+. However, engagement of antigen receptors induces calcium influx from the extracellular space by several routes. A chief mechanism of Ca2+ entry in lymphocytes is through store-operated calcium (SOC) channels. The identification of two important molecular components of SOC channels, CRACM1

  13. The bioavailability of dietary calcium.

    PubMed

    Guéguen, L; Pointillart, A

    2000-04-01

    This update focuses on the bioavailability of dietary calcium for humans. Fundamentals of calcium metabolism, intestinal absorption, urinary excretion and balance are recalled. Dietary factors, especially lactose and other milk components, influencing calcium bioavailability at intestinal and renal levels are reviewed. A critical examination of all the methods used for evaluating calcium bioavailability is made. This includes in vitro assays, classical and isotopic balances, urinary excretion, isotope labeling in the urine, plasma and bones, long term evaluation of bone mineralization and the use of biological bone markers. Importance and advantages of animal models are discussed. The state of the art in the comparative bioavailability of calcium in foods is detailed including a comparison of sources of calcium (dairy products and calcium salts) in human studies and in some animal studies, casein phosphopeptides, proteins, lactose and lactase and their relation with calcium bioavailability (in humans and rats). An update on the consumption of dairy products and bone mass is presented. Emphasis on peculiarities and advantages of calcium in milk and dairy products is given. PMID:10759138

  14. Thiosulfate Reduces Calcium Phosphate Nephrolithiasis

    PubMed Central

    Asplin, John R.; Donahue, Susan E.; Lindeman, Christina; Michalenka, Anne; Strutz, Kelly Laplante; Bushinsky, David A.

    2009-01-01

    An uncontrolled trial reported that sodium thiosulfate reduces formation of calcium kidney stones in humans, but this has not been established in a controlled human study or animal model. Using the genetic hypercalciuric rat, an animal model of calcium phosphate stone formation, we studied the effect of sodium thiosulfate on urine chemistries and stone formation. We fed genetic hypercalciuric rats normal food with or without sodium thiosulfate for 18 wk and measured urine chemistries, supersaturation, and the upper limit of metastability of urine. Eleven of 12 untreated rats formed stones compared with only three of 12 thiosulfate-treated rats (P < 0.002). Urine calcium and phosphorus were higher and urine citrate and volume were lower in the thiosulfate-treated rats, changes that would increase calcium phosphate supersaturation. Thiosulfate treatment lowered urine pH, which would lower calcium phosphate supersaturation. Overall, there were no statistically significant differences in calcium phosphate supersaturation or upper limit of metastability between thiosulfate-treated and control rats. In vitro, thiosulfate only minimally affected ionized calcium, suggesting a mechanism of action other than calcium chelation. In summary, sodium thiosulfate reduces calcium phosphate stone formation in the genetic hypercalciuric rat. Controlled trials testing the efficacy and safety of sodium thiosulfate for recurrent kidney stones in humans are needed. PMID:19369406

  15. 40 CFR 180.1091 - Aluminum isopropoxide and aluminum secondary butoxide; exemption from the requirement of a...

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ...25 2012-07-01 2012-07-01 false Aluminum isopropoxide and aluminum secondary butoxide; exemption from the requirement... Exemptions From Tolerances § 180.1091 Aluminum isopropoxide and aluminum secondary...

  16. 40 CFR 180.1091 - Aluminum isopropoxide and aluminum secondary butoxide; exemption from the requirement of a...

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ...23 2010-07-01 2010-07-01 false Aluminum isopropoxide and aluminum secondary butoxide; exemption from the requirement... Exemptions From Tolerances § 180.1091 Aluminum isopropoxide and aluminum secondary...

  17. 40 CFR 180.1091 - Aluminum isopropoxide and aluminum secondary butoxide; exemption from the requirement of a...

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ...25 2013-07-01 2013-07-01 false Aluminum isopropoxide and aluminum secondary butoxide; exemption from the requirement... Exemptions From Tolerances § 180.1091 Aluminum isopropoxide and aluminum secondary...

  18. 40 CFR 180.1091 - Aluminum isopropoxide and aluminum secondary butoxide; exemption from the requirement of a...

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ...24 2011-07-01 2011-07-01 false Aluminum isopropoxide and aluminum secondary butoxide; exemption from the requirement... Exemptions From Tolerances § 180.1091 Aluminum isopropoxide and aluminum secondary...

  19. 40 CFR 180.1091 - Aluminum isopropoxide and aluminum secondary butoxide; exemption from the requirement of a...

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ...24 2014-07-01 2014-07-01 false Aluminum isopropoxide and aluminum secondary butoxide; exemption from the requirement... Exemptions From Tolerances § 180.1091 Aluminum isopropoxide and aluminum secondary...

  20. 46 CFR 148.255 - Ferrosilicon, aluminum ferrosilicon, and aluminum silicon containing more than 30% but less than...

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ...Ferrosilicon, aluminum ferrosilicon, and aluminum silicon containing more than 30% but less than 90% silicon. 148.255 Section 148.255 Shipping...Ferrosilicon, aluminum ferrosilicon, and aluminum silicon containing more than 30% but less than...

  1. Micro Joining of Aluminum Graphite Composites

    E-print Network

    Velamati, Manasa

    2012-07-16

    Advanced aluminum graphite composites have unique thermal properties due to opposing coefficients of thermal expansion of aluminum and graphite. The thermal and mechanical properties of such composites are anisotropic due to directional properties...

  2. Recycling of aluminum salt cake

    SciTech Connect

    Jody, B.J.; Daniels, E.J.; Bonsignore, P.V.; Karvelas, D.E.

    1991-12-01

    The secondary aluminum industry generates more than 110 {times} 10{sup 3} tons of salt-cake waste every year. This waste stream contains about 3--5% aluminum, 15--30% aluminum oxide, 30--40% sodium chloride, and 20--30% potassium chloride. As much as 50% of the content of this waste is combined salt (sodium and potassium chlorides). Salt-cake waste is currently disposed of in conventional landfills. In addition, over 50 {times} 10{sup 3} tons of black dross that is not economical to reprocess a rotary furnace for aluminum recovery ends up in landfills. The composition of the dross is similar to that of salt cake, except that it contains higher concentrations of aluminum (up to 20%) and correspondingly lower amounts of salts. Because of the high solubility of the salts in water, these residues, when put in landfills, represent a potential source of pollution to surface-water and groundwater supplies. The increasing number of environmental regulations on the generation and disposal of industrial wastes are likely to restrict the disposal of these salt-containing wastes in conventional landfills. Processes exist that employ the dissolution and recovery of the salts from the waste stream. These wet-processing methods are economical only when the aluminum concentration in that waste exceeds about 10%. Argonne National Laboratory (ANL) conducted a study in which existing technologies were reviewed and new concepts that are potentially more cost-effective than existing processes were developed and evaluated. These include freeze crystallization, solvent/antisolvent extraction, common-ion effect, high-pressure/high-temperature process, and capillary-effect systems. This paper presents some of the technical and economic results of the aforementioned ANL study.

  3. Nanotube Fabrication byNanotube Fabrication by Anodic Aluminum Oxide,Anodic Aluminum Oxide,

    E-print Network

    Rubloff, Gary W.

    Nanotube Fabrication byNanotube Fabrication by Anodic Aluminum Oxide,Anodic Aluminum Oxide, Self-regulating phenomena in materials science: Self-assembly of nanopores during anodic oxidation of aluminum (AAO) Self combined anodic aluminum oxide (AAO) nanostructures with atomic layer deposition (ALD) to fabricate

  4. Epidemic aluminum intoxication in hemodialysis patients traced to use of an aluminum pump

    Microsoft Academic Search

    Dale R Burwen; Steven M Olsen; Lee A Bland; Matthew J Arduino; Marie H Reid; William R Jarvis

    1995-01-01

    Epidemic aluminum intoxication in hemodialysis patients traced to use of an aluminum pump. This study was designed to identify the source, risk factors, and clinical consequences of an outbreak of aluminum intoxication in hemodialysis patients using case-control and cohort studies. In 1991, a dialysis center in Pennsylvania [Dialysis Center A (DCA)] identified a number of patients with elevated serum aluminum

  5. Laterally proximized aluminum tunnel junctions

    NASA Astrophysics Data System (ADS)

    Koski, J. V.; Peltonen, J. T.; Meschke, M.; Pekola, J. P.

    2011-05-01

    This letter presents experiments on junctions fabricated by a technique that enables the use of high-quality aluminum oxide tunnel barriers with normal metal electrodes at low temperatures. Inverse proximity effect is applied to diminish the superconductivity of an aluminum dot through a clean lateral connection to a normal metal electrode. To demonstrate the effectiveness of this method, fully normal-state single electron transistors (SETs) and normal metal-insulator-superconductor (NIS) junctions applying proximized Al junctions were fabricated. The transport characteristics of the junctions were similar to those obtained from standard theoretical models of regular SETs and NIS junctions.

  6. Aluminum-carbon composite electrode

    DOEpatents

    Farahmandi, C. Joseph (Auburn, AL); Dispennette, John M. (Auburn, AL)

    1998-07-07

    A high performance double layer capacitor having an electric double layer formed in the interface between activated carbon and an electrolyte is disclosed. The high performance double layer capacitor includes a pair of aluminum impregnated carbon composite electrodes having an evenly distributed and continuous path of aluminum impregnated within an activated carbon fiber preform saturated with a high performance electrolytic solution. The high performance double layer capacitor is capable of delivering at least 5 Wh/kg of useful energy at power ratings of at least 600 W/kg.

  7. Aluminum-air battery crystallizer

    SciTech Connect

    Maimoni, A.

    1987-01-23

    A prototype crystallizer system for the aluminum-air battery operated reliably through simulated startup and shutdown cycles and met its design objectives. The crystallizer system allows for crystallization and removal of the aluminium hydroxide reaction product; it is required to allow steady-state and long-term operation of the aluminum-air battery. The system has to minimize volume and maintain low turbulence and shear to minimize secondary nucleation and energy consumption while enhancing agglomeration. A lamella crystallizer satisfies system constraints.

  8. Multi-Colony Calibrations of Coral Ba/Ca With a Contemporaneous In Situ Seawater Barium Record

    NASA Astrophysics Data System (ADS)

    LaVigne, M.; Matthews, K. A.; Grottoli, A. G.; Palardy, J.; Sherrell, R. M.

    2014-12-01

    The coral skeleton barium to calcium ratio (Ba/Cacoral), a proxy for seawater barium concentration (BaSW), has been interpreted as an upwelling tracer based on the "nutrient like" depth profile of BaSW. However, terrestrial runoff and differences between the vertical distribution of BaSW and that of the major nutrients in the upper water column can compromise the reliability of Ba/Cacoral as an upwelled nutrient proxy in some coastal locations. For example, a 6-month time series record of BaSW, SST, SSS, and surface nutrients in the Gulf of Panamá shows that maximum seasonal inputs from terrestrial runoff occur during the upwelling minimum. In contrast to nutrients, BaSW variations resulting from upwelling are overwhelmed by the runoff influence at this location. High resolution Ba/Cacoral records from multiple colonies of Porites lobata, Pavona gigantea, and Pavona clavus corals growing during this period record the nearly two-fold runoff-induced change in BaSW in Gulf of Panamá surface waters as an ~20-70% increase in skeletal Ba/Ca, providing an opportunity to calibrate the Ba proxy with a contemporaneous BaSW record. Compiling the Ba/Cacoral records from three co-located colonies of each species into taxa-specific composite regressions reveal statistically significant correlations with the BaSW time-series (r2=0.7; p <0.001). The application of the Pavona clavus calibration to a previously published Galapágos Ba/Cacoral record and offsets in regression variables between taxa demonstrate the necessity of using taxa-specific calibrations for quantitative BaSW reconstructions. Similar studies using longer high-resolution multi-colony records could further our understanding of intercolony-reproducibility and reduce the uncertainty in the regressions. These results support the application of Ba/Cacoral to reconstruct past changes in BaSW and underscore the value of combining multiple skeletal proxies to provide a complete picture of surface water biogeochemistry.

  9. Measurement of calcium transients and slow calcium current in myotubes

    PubMed Central

    1994-01-01

    The purpose of this study was to characterize excitation-contraction (e- c) coupling in myotubes for comparison with e-c coupling of adult skeletal muscle. The whole cell configuration of the patch clamp technique was used in conjunction with the calcium indicator dye Fluo-3 to study the calcium transients and slow calcium currents elicited by voltage clamp pulses in cultured myotubes obtained from neonatal mice. Cells were held at -80 mV and stimulated with 15-20 ms test depolarizations preceded and followed by voltage steps designed to isolate the slow calcium current. The slow calcium current had a threshold for activation of about 0 mV; the peak amplitude of the current reached a maximum at 30 to 40 mV a and then declined for still stronger depolarizations. The calcium transient had a threshold of about -10 mV, and its amplitude increased as a sigmoidal function of test potential and did not decrease again even for test depolarizations sufficiently strong (> or = 50 mV) that the amplitude of the slow calcium current became very small. Thus, the slow calcium current in myotubes appears to have a negligible role in the process of depolarization-induced release of intracellular calcium and this process in myotubes is essentially like that in adult skeletal muscle. After repolarization, however, the decay of the calcium transient in myotubes was very slow (hundreds of ms) compared to adult muscle, particularly after strong depolarizations that triggered larger calcium transients. Moreover, when cells were repolarized after strong depolarizations, the transient typically continued to increase slowly for up to several tens of ms before the onset of decay. This continued increase after repolarization was abolished by the addition of 5 mM BAPTA to the patch pipette although the rapid depolarization-induced release was not, suggesting that the slow increase might be a regenerative response triggered by the depolarization-induced release of calcium. The addition of either 0.5 mM Cd2+ + 0.1 mM La3+ or the dihydropyridine (+)-PN 200-110 (1 microM) reduced the amplitude of the calcium transient by mechanisms that appeared to be unrelated to the block of current that these agents produce. In the majority of cells, the decay of the transient was accelerated by the addition of the heavy metals or the dihydropyridine, consistent with the idea that the removal system becomes saturated for large calcium releases and becomes more efficient when the size of the release is reduced. PMID:8169594

  10. Decontamination and reuse of ORGDP aluminum scrap

    Microsoft Academic Search

    A. L. Compere; W. L. Griffith; H. W. Hayden; D. F. Wilson

    1996-01-01

    The Gaseous Diffusion Plants, or GDPs, have significant amounts of a number of metals, including nickel, aluminum, copper, and steel. Aluminum was used extensively throughout the GDPs because of its excellent strength to weight ratios and good resistance to corrosion by UFâ. This report is concerned with the recycle of aluminum stator and rotor blades from axial compressors. Most of

  11. Aluminum: Principled Scenario Exploration through Minimality

    E-print Network

    Dougherty, Daniel J.

    Aluminum: Principled Scenario Exploration through Minimality Tim Nelson1, Salman Saghafi1, Daniel J. We present Aluminum, a modification of Alloy that presents only minimal scenarios: those that contain no more than is necessary. Aluminum lets users explore the scenario space by adding to scenarios

  12. ECONOMIC IMPACT OF CENTURY ALUMINUM OF

    E-print Network

    Mohaghegh, Shahab

    ECONOMIC IMPACT OF CENTURY ALUMINUM OF WEST VIRGINIA, INC. By Randall A represent those of the West Virginia University Board of Trustees. #12;2 OVERVIEW Century Aluminum of West Virginia, Inc. (Century) is located in Ravenswood, West Virginia and produces aluminum products

  13. Aluminum: Principled Scenario Exploration through Minimality

    E-print Network

    Krishnamurthi, Shriram

    Aluminum: Principled Scenario Exploration through Minimality Tim Nelson1, Salman Saghafi1, Daniel J Aluminum, a modification of Alloy that presents only minimal scenarios: those that contain no more than is necessary. Aluminum lets users explore the scenario space by adding to scenarios and backtracking. It also

  14. Aluminum in Superconducting Magnets Robert J. Weggel

    E-print Network

    McDonald, Kirk

    Aluminum in Superconducting Magnets Robert J. Weggel Magnet Optimization Research Engineering is aluminum, either ultrapure, as quenchstabilization matrix metal, and/or alloyed and coldworked and heat for magnets in which the stresses and strains are modest. The strongest aluminum alloy commercially available

  15. Aluminum--2004 5. Areferencethatincludesasectionmark()isfoundintheinternet

    E-print Network

    Aluminum--2004 5. Areferencethatincludesasectionmark(§)isfoundintheinternet ReferenceCitedsection. Aluminum ByPatriciaA.Plunkert Domestic survey data and tables were prepared by Benjamin S. Goff.S.GeologicalSurvey(uSGS)requestforproductiondata. CommercialDevelopmentCo.(CDC)ofSt.louis,mO, boughtKaiserAluminumCorp.'s200,000-metric-ton-per-year (t

  16. 76 FR 23490 - Aluminum tris (O

    Federal Register 2010, 2011, 2012, 2013, 2014

    2011-04-27

    ...aluminum tris (O-ethylphosphonate) on pineapple fodder and forage because they are not...aluminum tris (O-ethylphosphonate) on pineapple fodder and forage because they are...aluminum tris (O-ethylphosphonate) on pineapple fodder and forage because they...

  17. Aluminum in 2012 North American Light Vehicles

    NSDL National Science Digital Library

    2013-07-03

    This study was carried out by Ducker Worldwide and funded by The Aluminum Association to evaluate the aluminum content in 2012 model year vehicles and the projected aluminum content growth through 2025. To gather data and form projections, Ducker surveyed original equipment manufactures (OEMs) and The Aluminum Association to create a metallic materials database with 32,000 cells per light vehicle. Using their database and other information from OEMs, Ducker concluded in the 2012 model year the average weight of aluminum on light vehicles will be approximately 348lbs, 30% of hoods will be aluminum, and 50% of cast aluminum wheels will be sourced from China. To meet corporate average fuel economy (CAFE) standards in 2025 Ducker speculates vehicle aluminum content will grow by 80% (671lbs avg. truck and 451lbs avg. for cars), milled aluminum components will increase, 50% of hoods will be aluminum, and manifolds will be made from magnesium rather than aluminum. Based on this study’s conclusions, it’s clear that aluminum content in vehicles will continue to grow to meet CAFE standards by 2025. For more info on Ducker Worldwide, visit http://www.ducker.com/. Ducker has also performed studies for the Environmental Protection Agency (EPA) and the Department of Energy (DOE).

  18. MODELING OF ALUMINUM NANOPARTICLE FORMATION R. Schefflan

    E-print Network

    of the gaseous aluminum has solidified, a moment equation is employed to calculate the number of particles and data were collected so as to give direction to the modeling process. The lab-scale process is carried. At this point all of the aluminum has solidified into nanoparticles. The oxygen reacts with the surface aluminum

  19. Novel aqueous aluminum/sulfur batteries

    SciTech Connect

    Licht, S.; Peramunage, D. (Clark Univ., Worcester, MA (United States))

    1993-01-01

    Aluminum sulfur batteries based on concentrated polysulfide catholytes and an alkaline aluminum anode are introduced and investigated. The new battery is expressed by aluminum oxidation and aqueous sulfur reduction for an overall battery discharge consisting of 2Al + S[sub 4][sup 2[minus

  20. 21 CFR 182.8217 - Calcium phosphate.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ...2010-04-01 2009-04-01 true Calcium phosphate. 182.8217 Section 182.8217 Food...RECOGNIZED AS SAFE Nutrients § 182.8217 Calcium phosphate. (a) Product. Calcium phosphate (mono-, di-, and tribasic)....

  1. 21 CFR 182.1217 - Calcium phosphate.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ...2011-04-01 2011-04-01 false Calcium phosphate. 182.1217 Section 182.1217 Food...Purpose GRAS Food Substances § 182.1217 Calcium phosphate. (a) Product. Calcium phosphate (mono-, di-, and tribasic)....

  2. 21 CFR 182.8217 - Calcium phosphate.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ...2011-04-01 2011-04-01 false Calcium phosphate. 182.8217 Section 182.8217 Food...RECOGNIZED AS SAFE Nutrients § 182.8217 Calcium phosphate. (a) Product. Calcium phosphate (mono-, di-, and tribasic)....

  3. 21 CFR 182.1217 - Calcium phosphate.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ...2013-04-01 2013-04-01 false Calcium phosphate. 182.1217 Section 182.1217 Food...Purpose GRAS Food Substances § 182.1217 Calcium phosphate. (a) Product. Calcium phosphate (mono-, di-, and tribasic)....

  4. 21 CFR 582.6197 - Calcium diacetate.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 2014-04-01 2014-04-01 false Calcium diacetate. 582.6197 Section 582.6197...RECOGNIZED AS SAFE Sequestrants 2 § 582.6197 Calcium diacetate. (a) Product. Calcium diacetate. (b) Conditions of use....

  5. 21 CFR 172.715 - Calcium lignosulfonate.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 3 2012-04-01 2012-04-01 false Calcium lignosulfonate. 172.715 Section 172.715... Other Specific Usage Additives § 172.715 Calcium lignosulfonate. Calcium lignosulfonate may be safely used in or on...

  6. 7 CFR 58.434 - Calcium chloride.

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ...Agriculture 3 2011-01-01 2011-01-01 false Calcium chloride. 58.434 Section 58.434 Agriculture...Quality Specifications for Raw Material § 58.434 Calcium chloride. Calcium chloride, when used, shall meet the...

  7. 21 CFR 582.6197 - Calcium diacetate.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 2013-04-01 2013-04-01 false Calcium diacetate. 582.6197 Section 582.6197...RECOGNIZED AS SAFE Sequestrants 2 § 582.6197 Calcium diacetate. (a) Product. Calcium diacetate. (b) Conditions of use....

  8. 21 CFR 182.6197 - Calcium diacetate.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 2014-04-01 2014-04-01 false Calcium diacetate. 182.6197 Section 182.6197...RECOGNIZED AS SAFE Sequestrants 1 § 182.6197 Calcium diacetate. (a) Product. Calcium diacetate. (b) Conditions of use....

  9. 21 CFR 182.6197 - Calcium diacetate.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ...3 2010-04-01 2009-04-01 true Calcium diacetate. 182.6197 Section 182.6197...RECOGNIZED AS SAFE Sequestrants 1 § 182.6197 Calcium diacetate. (a) Product. Calcium diacetate. (b) Conditions of use....

  10. 21 CFR 182.6197 - Calcium diacetate.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 2011-04-01 2011-04-01 false Calcium diacetate. 182.6197 Section 182.6197...RECOGNIZED AS SAFE Sequestrants 1 § 182.6197 Calcium diacetate. (a) Product. Calcium diacetate. (b) Conditions of use....

  11. 21 CFR 182.6197 - Calcium diacetate.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 2013-04-01 2013-04-01 false Calcium diacetate. 182.6197 Section 182.6197...RECOGNIZED AS SAFE Sequestrants 1 § 182.6197 Calcium diacetate. (a) Product. Calcium diacetate. (b) Conditions of use....

  12. 21 CFR 172.715 - Calcium lignosulfonate.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 3 2013-04-01 2013-04-01 false Calcium lignosulfonate. 172.715 Section 172.715... Other Specific Usage Additives § 172.715 Calcium lignosulfonate. Calcium lignosulfonate may be safely used in or on...

  13. 21 CFR 182.6197 - Calcium diacetate.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 2012-04-01 2012-04-01 false Calcium diacetate. 182.6197 Section 182.6197...RECOGNIZED AS SAFE Sequestrants 1 § 182.6197 Calcium diacetate. (a) Product. Calcium diacetate. (b) Conditions of use....

  14. 7 CFR 58.434 - Calcium chloride.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ...Agriculture 3 2010-01-01 2010-01-01 false Calcium chloride. 58.434 Section 58.434 Agriculture...Quality Specifications for Raw Material § 58.434 Calcium chloride. Calcium chloride, when used, shall meet the...

  15. 21 CFR 172.720 - Calcium lactobionate.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 2011-04-01 2011-04-01 false Calcium lactobionate. 172.720 Section 172...Other Specific Usage Additives § 172.720 Calcium lactobionate. The food additive calcium lactobionate may be safely used in food...

  16. 7 CFR 58.434 - Calcium chloride.

    Code of Federal Regulations, 2012 CFR

    2012-01-01

    ...Agriculture 3 2012-01-01 2012-01-01 false Calcium chloride. 58.434 Section 58.434 Agriculture...Quality Specifications for Raw Material § 58.434 Calcium chloride. Calcium chloride, when used, shall meet the...

  17. 7 CFR 58.434 - Calcium chloride.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ...Agriculture 3 2014-01-01 2014-01-01 false Calcium chloride. 58.434 Section 58.434 Agriculture...Quality Specifications for Raw Material § 58.434 Calcium chloride. Calcium chloride, when used, shall meet the...

  18. 21 CFR 582.6197 - Calcium diacetate.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 2012-04-01 2012-04-01 false Calcium diacetate. 582.6197 Section 582.6197...RECOGNIZED AS SAFE Sequestrants 2 § 582.6197 Calcium diacetate. (a) Product. Calcium diacetate. (b) Conditions of use....

  19. 21 CFR 172.720 - Calcium lactobionate.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 2014-04-01 2014-04-01 false Calcium lactobionate. 172.720 Section 172...Other Specific Usage Additives § 172.720 Calcium lactobionate. The food additive calcium lactobionate may be safely used in food...

  20. 21 CFR 582.6199 - Calcium gluconate.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 2014-04-01 2014-04-01 false Calcium gluconate. 582.6199 Section 582.6199...RECOGNIZED AS SAFE Sequestrants 2 § 582.6199 Calcium gluconate. (a) Product. Calcium gluconate. (b) Conditions of use....

  1. 21 CFR 172.720 - Calcium lactobionate.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 2012-04-01 2012-04-01 false Calcium lactobionate. 172.720 Section 172...Other Specific Usage Additives § 172.720 Calcium lactobionate. The food additive calcium lactobionate may be safely used in food...

  2. 21 CFR 582.6199 - Calcium gluconate.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 2010-04-01 2010-04-01 false Calcium gluconate. 582.6199 Section 582.6199...RECOGNIZED AS SAFE Sequestrants 2 § 582.6199 Calcium gluconate. (a) Product. Calcium gluconate. (b) Conditions of use....

  3. 21 CFR 582.6197 - Calcium diacetate.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 2010-04-01 2010-04-01 false Calcium diacetate. 582.6197 Section 582.6197...RECOGNIZED AS SAFE Sequestrants 2 § 582.6197 Calcium diacetate. (a) Product. Calcium diacetate. (b) Conditions of use....

  4. 21 CFR 582.6197 - Calcium diacetate.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 2011-04-01 2011-04-01 false Calcium diacetate. 582.6197 Section 582.6197...RECOGNIZED AS SAFE Sequestrants 2 § 582.6197 Calcium diacetate. (a) Product. Calcium diacetate. (b) Conditions of use....

  5. 21 CFR 172.715 - Calcium lignosulfonate.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 3 2011-04-01 2011-04-01 false Calcium lignosulfonate. 172.715 Section 172.715... Other Specific Usage Additives § 172.715 Calcium lignosulfonate. Calcium lignosulfonate may be safely used in or on...

  6. 21 CFR 172.720 - Calcium lactobionate.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 2013-04-01 2013-04-01 false Calcium lactobionate. 172.720 Section 172...Other Specific Usage Additives § 172.720 Calcium lactobionate. The food additive calcium lactobionate may be safely used in food...

  7. 21 CFR 172.715 - Calcium lignosulfonate.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 3 2014-04-01 2014-04-01 false Calcium lignosulfonate. 172.715 Section 172.715... Other Specific Usage Additives § 172.715 Calcium lignosulfonate. Calcium lignosulfonate may be safely used in or on...

  8. 7 CFR 58.434 - Calcium chloride.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ...Agriculture 3 2013-01-01 2013-01-01 false Calcium chloride. 58.434 Section 58.434 Agriculture...Quality Specifications for Raw Material § 58.434 Calcium chloride. Calcium chloride, when used, shall meet the...

  9. 21 CFR 582.6199 - Calcium gluconate.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 2011-04-01 2011-04-01 false Calcium gluconate. 582.6199 Section 582.6199...RECOGNIZED AS SAFE Sequestrants 2 § 582.6199 Calcium gluconate. (a) Product. Calcium gluconate. (b) Conditions of use....

  10. 21 CFR 172.720 - Calcium lactobionate.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 2010-04-01 2009-04-01 true Calcium lactobionate. 172.720 Section 172...Other Specific Usage Additives § 172.720 Calcium lactobionate. The food additive calcium lactobionate may be safely used in food...

  11. 21 CFR 582.6199 - Calcium gluconate.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 2012-04-01 2012-04-01 false Calcium gluconate. 582.6199 Section 582.6199...RECOGNIZED AS SAFE Sequestrants 2 § 582.6199 Calcium gluconate. (a) Product. Calcium gluconate. (b) Conditions of use....

  12. 21 CFR 582.6199 - Calcium gluconate.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 2013-04-01 2013-04-01 false Calcium gluconate. 582.6199 Section 582.6199...RECOGNIZED AS SAFE Sequestrants 2 § 582.6199 Calcium gluconate. (a) Product. Calcium gluconate. (b) Conditions of use....

  13. 21 CFR 172.715 - Calcium lignosulfonate.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 3 2010-04-01 2009-04-01 true Calcium lignosulfonate. 172.715 Section 172.715... Other Specific Usage Additives § 172.715 Calcium lignosulfonate. Calcium lignosulfonate may be safely used in or on...

  14. The first barium tin(II) bromide fluoride

    NASA Astrophysics Data System (ADS)

    Dénès, Georges; Merazig, Hocine; Muntasar, Abdualhafeed; Porterfield, Robyn

    2014-04-01

    In an effort to prepare barium tin(II) bromide fluorides for the first time, possibly similar to the chloride fluorides obtained earlier in our laboratory, precipitation reactions were carried out by mixing aqueous solutions of SnF2 and of BaBr2.2H2O. In contrast with the chloride fluoride system, a single powdered phase was obtained throughout the SnF2 - BaBr2 system, with the yield being maximum at X ? 0.25, where X is the molar fraction of barium bromide in the reaction mixture. Phase identification with the JCPDS database failed to produce a match, confirming that a new phase had been produced. The exact chemical composition of the new compound has not been obtained yet. Based on the X value for the maximum yield, the Sn/Ba ratio is likely to be 3/1 or 2/1. The Mössbauer spectrum at ambient conditions shows that bonding to tin(II) is covalent, therefore with the tin lone pair being stereoactive. The Mössbauer parameters ( ? = 3.68 mm/s, ? = 0.99 mm/s) are similar to those of SnBrF and of Sn2BrF5, thereby showing that tin is bonded to both fluorine and bromine. The larger isomer shift and lower quadrupole splitting than in tin(II) fluorides show that the stereoactivity of the tin lone pair is lower than in the fluorides. The Mössbauer parameters fit well the linear correlation of the quadrupole splitting versus the isomer shift" that has been shown to be present in other series of tin(II) compounds. The linear decrease on this correlation shows that the contribution of non-spherical orbitals ( p and d) to the lone pair is a much larger contributor to the quadrupole splitting than lattice distortions. The structure is likely made of Ba2+ cations and tin(II) fluoride bromide polyatomic anions, with covalent bonding withinthe anions.

  15. Recovering aluminum from aluminum dross in a DC electric-arc rotary furnace

    NASA Astrophysics Data System (ADS)

    Tzonev, Tz.; Lucheva, B.

    2007-11-01

    The recycling of aluminum scrap and dross yields significant economic and energy savings, as well environmental benefits. The recovery of aluminum depends on many factors. The aim of this work is to experimentally investigate aluminum recovery under different conditions. In this study, aluminum dross was processed in a direct-current electric-arc rotary furnace. The presence of crushing refractory bodies during processing was found to increase the degree of aluminum recovery by about ten percent.

  16. Extracellular calcium sensing and extracellular calcium signaling

    NASA Technical Reports Server (NTRS)

    Brown, E. M.; MacLeod, R. J.; O'Malley, B. W. (Principal Investigator)

    2001-01-01

    The cloning of a G protein-coupled extracellular Ca(2+) (Ca(o)(2+))-sensing receptor (CaR) has elucidated the molecular basis for many of the previously recognized effects of Ca(o)(2+) on tissues that maintain systemic Ca(o)(2+) homeostasis, especially parathyroid chief cells and several cells in the kidney. The availability of the cloned CaR enabled the development of DNA and antibody probes for identifying the CaR's mRNA and protein, respectively, within these and other tissues. It also permitted the identification of human diseases resulting from inactivating or activating mutations of the CaR gene and the subsequent generation of mice with targeted disruption of the CaR gene. The characteristic alterations in parathyroid and renal function in these patients and in the mice with "knockout" of the CaR gene have provided valuable information on the CaR's physiological roles in these tissues participating in mineral ion homeostasis. Nevertheless, relatively little is known about how the CaR regulates other tissues involved in systemic Ca(o)(2+) homeostasis, particularly bone and intestine. Moreover, there is evidence that additional Ca(o)(2+) sensors may exist in bone cells that mediate some or even all of the known effects of Ca(o)(2+) on these cells. Even more remains to be learned about the CaR's function in the rapidly growing list of cells that express it but are uninvolved in systemic Ca(o)(2+) metabolism. Available data suggest that the receptor serves numerous roles outside of systemic mineral ion homeostasis, ranging from the regulation of hormonal secretion and the activities of various ion channels to the longer term control of gene expression, programmed cell death (apoptosis), and cellular proliferation. In some cases, the CaR on these "nonhomeostatic" cells responds to local changes in Ca(o)(2+) taking place within compartments of the extracellular fluid (ECF) that communicate with the outside environment (e.g., the gastrointestinal tract). In others, localized changes in Ca(o)(2+) within the ECF can originate from several mechanisms, including fluxes of calcium ions into or out of cellular or extracellular stores or across epithelium that absorb or secrete Ca(2+). In any event, the CaR and other receptors/sensors for Ca(o)(2+) and probably for other extracellular ions represent versatile regulators of numerous cellular functions and may serve as important therapeutic targets.

  17. Molecular Structure of Calcium Sulfide

    NSDL National Science Digital Library

    2003-06-03

    Calcium sulfide in pure form is white and shaped like cubic crystals, and is slightly soluble in water. This is used as a base for luminescent materials. Calcium sulfide is also known as hepar calcies; sulfurated lime. This substance is used in phosphors and as a direct fungicide on powdery mildews and insecticides.

  18. An Improved Calcium Flame Test.

    ERIC Educational Resources Information Center

    Pearson, Robert S.

    1985-01-01

    Indicates that the true red color of calcium can be obtained (using the procedure described by Sorm and Logowski) if the calcium ion solution is mixed with an equal volume of saturated ammonium bromide solution. Suggestions for flame tests of other elements are also noted. (JN)

  19. Calcium Intake: A Lifelong Proposition.

    ERIC Educational Resources Information Center

    Amschler, Denise H.

    1985-01-01

    This article reviews the current problem of low calcium intake in the United States among all age groups, the role of calcium in the formation and maintenance of bone mass, and major factors influencing absorption. Osteoporosis is discussed, and current recommendations for Recommended Dietary allowance are provided. (Author/MT)

  20. Aluminum and its light alloys

    NASA Technical Reports Server (NTRS)

    Merica, Paul D

    1920-01-01

    Report is a summary of research work which has been done here and abroad on the constitution and mechanical properties of the various alloy systems with aluminum. The mechanical properties and compositions of commercial light alloys for casting, forging, or rolling, obtainable in this country are described.