Science.gov

Sample records for aluminum barium calcium

  1. 40 CFR 721.10011 - Barium calcium manganese strontium oxide.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... 40 Protection of Environment 31 2011-07-01 2011-07-01 false Barium calcium manganese strontium... Specific Chemical Substances § 721.10011 Barium calcium manganese strontium oxide. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as barium...

  2. 40 CFR 721.10011 - Barium calcium manganese strontium oxide.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... 40 Protection of Environment 31 2014-07-01 2014-07-01 false Barium calcium manganese strontium... Specific Chemical Substances § 721.10011 Barium calcium manganese strontium oxide. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as barium...

  3. 40 CFR 721.10011 - Barium calcium manganese strontium oxide.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Barium calcium manganese strontium... Specific Chemical Substances § 721.10011 Barium calcium manganese strontium oxide. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as barium...

  4. 40 CFR 721.10011 - Barium calcium manganese strontium oxide.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... 40 Protection of Environment 32 2013-07-01 2013-07-01 false Barium calcium manganese strontium... Specific Chemical Substances § 721.10011 Barium calcium manganese strontium oxide. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as barium...

  5. 40 CFR 721.10011 - Barium calcium manganese strontium oxide.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... 40 Protection of Environment 32 2012-07-01 2012-07-01 false Barium calcium manganese strontium... Specific Chemical Substances § 721.10011 Barium calcium manganese strontium oxide. (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as barium...

  6. Both barium and calcium activate neuronal potassium currents.

    PubMed Central

    Ribera, A B; Spitzer, N C

    1987-01-01

    Amphibian spinal neurons in culture possess both rapidly inactivating and sustained calcium-dependent potassium current components, similar to those described for other cells. Divalent cation-dependent whole-cell outward currents were isolated by subtracting the voltage-dependent potassium currents recorded from Xenopus laevis neurons in the presence of impermeant cadmium (100-500 microM) from the currents produced without cadmium but in the presence of permeant divalent cations (50-100 microM). These concentrations of permeant ions were low enough to avoid contamination by macroscopic inward currents through calcium channels. Calcium-dependent potassium currents were reduced by 1 microM tetraethylammonium. These currents can also be activated by barium or strontium. Barium as well as calcium activated outward currents in young neurons (6-8 hr) and in relatively mature neurons (19-26 hr in vitro). However, barium influx appeared to suppress the sustained voltage-dependent potassium current in most cells. Barium also activated at least one class of potassium channels observed in excised membrane patches, while blocking others. The blocking action may have masked and hindered detection of the stimulatory action of barium in other systems. PMID:2442762

  7. REMOVING BARIUM AND RADIUM THROUGH CALCIUM CATION EXCHANGE

    EPA Science Inventory

    The removal of barium (Ba) and radium (Ra), which are found in many groundwater sources, was achieved in laboratory studies with an ion exchange process. In the studies, a strong acid resin in the calcium form effectively removed Ba(+2) and Ra (+2) to meet standards. The resin wa...

  8. Endotrophic Calcium, Strontium, and Barium Spores of Bacillus megaterium and Bacillus cereus1

    PubMed Central

    Foerster, Harold F.; Foster, J. W.

    1966-01-01

    Foerster, Harold F. (The University of Texas, Austin), and J. W. Foster. Endotrophic calcium, strontium, and barium spores of Bacillus megaterium and Bacillus cereus. J. Bacteriol. 91:1333–1345. 1966.—Spores were produced by washed vegetative cells suspended in deionized water supplemented with CaCl2, SrCl2, or BaCl2. Normal, refractile spores were produced in each case; a portion of the barium spores lost refractility and darkened. Thin-section electron micrographs revealed no apparent anatomical differences among the three types of spores. Analyses revealed that the different spore types were enriched specifically in the metal to which they were exposed during sporogenesis. The calcium content of the strontium and the barium spores was very small. From binary equimolar mixtures of the metal salts, endotrophic spores accumulated both metals to nearly the same extent. Viability of the barium spores was considerably less than that of the other two types. Strontium and barium spores were heat-resistant; however, calcium was essential for maximal heat resistance. Significant differences existed in the rates of germination; calcium spores germinated fastest, strontium spores were slower, and barium spores were slowest. Calcium-barium and calcium-strontium spores germinated readily. Endotrophic calcium and strontium spores germinated without the prior heat activation essential for growth spores. Chemical germination of the different metal-type spores with n-dodecylamine took place at the same relative rates as physiological germination. Heat-induced release of dipicolinic acid occurred much faster with barium and strontium spores than with calcium spores. The washed “coat fraction” from disrupted spores contained little of the spore calcium but most of the spore barium. The metal in this fraction was released by dilute acid. The demineralized coats reabsorbed calcium and barium at neutral pH. Images PMID:4956334

  9. Barium can replace calcium in calmodulin-dependent contractions of skinned renal arteries of the rabbit.

    PubMed

    Kreye, V A; Hofmann, F; Mühleisen, M

    1986-03-01

    Renal arteries of the rabbit were chemically skinned using Triton X-100. In EGTA-buffered solutions containing calmodulin and ATP, small strips of the skinned preparations were found to develop contractile force which was dependent on the concentrations of either free calcium or of free barium. However, a 220 times greater concentration of barium than of calcium was necessary for comparable effects. Quantitatively, the response to barium was dependent on the concentration of calmodulin added to the test solutions. The contractile effect of barium was partly antagonized by the calmodulin antagonist, trifluoperazine. PMID:3960707

  10. Ferroelastic domains in lead-free barium zirconate titanate - barium calcium titanate piezoceramics

    NASA Astrophysics Data System (ADS)

    Ehmke, Matthias Claudius

    Piezoelectricity was first discovered by Pierre and Jaque Curie in the year 1880. Nowadays, piezoelectric materials are used in many application such as high voltage generation in gas igniters, actuation in micro-positioning devices, generation and detection of acoustic waves, emitters and receivers for sonar technology, ultrasonic cleaning, ultrasound medical therapy, and micropumps for ink-jet printers. The most commonly used piezoelectric material since the 1950's is the solid solution system lead zirconate titanate (PZT) that offers high piezoelectric performance under a large range of operating conditions. However, the toxicity of lead requires the replacement of PZT. The studied lead-free alternatives are commonly based on potassium sodium niobate (KNN) and bismuth sodium titanate (BNT), and more recently zirconium and calcium substituted barium titanate (BZT-BCT). The BZT-BCT system exhibits large piezoelectric coefficients that can exceed even those of most PZT compositions under certain conditions. Piezoelectricity was first discovered by Pierre and Jaque Curie in the year 1880. Nowadays, piezoelectric materials are used in many application such as high voltage generation in gas igniters, actuation in micro-positioning devices, generation and detection of acoustic waves, emitters and receivers for sonar technology, ultrasonic cleaning, ultrasound medical therapy, and micropumps for ink-jet printers. The most commonly used piezoelectric material since the 1950's is the solid solution system lead zirconate titanate (PZT) that offers high piezoelectric performance under a large range of operating conditions. However, the toxicity of lead requires the replacement of PZT. The studied lead-free alternatives are commonly based on potassium sodium niobate (KNN) and bismuth sodium titanate (BNT), and more recently zirconium and calcium substituted barium titanate (BZT-BCT). The BZT-BCT system exhibits large piezoelectric coefficients that can exceed even those of

  11. Analysis of barium hydroxide and calcium hydroxide slurry carbonation reactors

    SciTech Connect

    Patch, K.D.; Hart, R.P.; Schumacher, W.A.

    1980-05-01

    The removal of CO/sub 2/ from air was investigated by using a continuous-agitated-slurry carbonation reactor containing either barium hydroxide (Ba(OH)/sub 2/) or calcium hydroxide (Ca(OH)/sub 2/). Such a process would be applied to scrub /sup 14/CO/sub 2/ from stack gases at nuclear-fuel reprocessing plants. Decontamination factors were characterized for reactor conditions which could alter hydrodynamic behavior. An attempt was made to characterize reactor performance with models assuming both plug flow and various degrees of backmixing in the gas phase. The Ba(OH)/sub 2/ slurry enabled increased conversion, but apparently the process was controlled under some conditions by phenomena differing from those observed for carbonation by Ca(OH)/sub 2/. Overall reaction mechanisms are postulated.

  12. Nonlinear optical properties of calcium barium niobate epitaxial thin films.

    PubMed

    Bancelin, Stéphane; Vigne, Sébastien; Hossain, Nadir; Chaker, Mohammed; Légaré, François

    2016-07-25

    We investigate the potential of epitaxial calcium barium niobate (CBN) thin film grown by pulsed laser deposition for optical frequency conversion. Using second harmonic generation (SHG), we analyze the polarization response of the generated signal to determine the ratios d15 / d32 and d33 / d32 of the three independent components of the second-order nonlinear susceptibility tensor in CBN thin film. In addition, a detailed comparison to the signal intensity obtained in a y-cut quartz allows us to measure the absolute value of these components in CBN thin film: d15 = 5 ± 2 pm / V, d32 = 3.1 ± 0.6 pm / V and d33 = 9 ± 2 pm / V. PMID:27464195

  13. 21 CFR 582.2122 - Aluminum calcium silicate.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 21 Food and Drugs 6 2011-04-01 2011-04-01 false Aluminum calcium silicate. 582.2122 Section 582.2122 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED....2122 Aluminum calcium silicate. (a) Product. Aluminum calcium silicate. (b) Tolerance. 2 percent....

  14. 21 CFR 582.2122 - Aluminum calcium silicate.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 21 Food and Drugs 6 2012-04-01 2012-04-01 false Aluminum calcium silicate. 582.2122 Section 582.2122 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED....2122 Aluminum calcium silicate. (a) Product. Aluminum calcium silicate. (b) Tolerance. 2 percent....

  15. 21 CFR 182.2122 - Aluminum calcium silicate.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 21 Food and Drugs 3 2013-04-01 2013-04-01 false Aluminum calcium silicate. 182.2122 Section 182.2122 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED....2122 Aluminum calcium silicate. (a) Product. Aluminum calcium silicate. (b) Tolerance. 2 percent....

  16. 21 CFR 182.2122 - Aluminum calcium silicate.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 21 Food and Drugs 3 2012-04-01 2012-04-01 false Aluminum calcium silicate. 182.2122 Section 182.2122 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED....2122 Aluminum calcium silicate. (a) Product. Aluminum calcium silicate. (b) Tolerance. 2 percent....

  17. 21 CFR 582.2122 - Aluminum calcium silicate.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Aluminum calcium silicate. 582.2122 Section 582.2122 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED....2122 Aluminum calcium silicate. (a) Product. Aluminum calcium silicate. (b) Tolerance. 2 percent....

  18. 21 CFR 582.2122 - Aluminum calcium silicate.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 21 Food and Drugs 6 2014-04-01 2014-04-01 false Aluminum calcium silicate. 582.2122 Section 582.2122 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED....2122 Aluminum calcium silicate. (a) Product. Aluminum calcium silicate. (b) Tolerance. 2 percent....

  19. 21 CFR 582.2122 - Aluminum calcium silicate.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 21 Food and Drugs 6 2013-04-01 2013-04-01 false Aluminum calcium silicate. 582.2122 Section 582.2122 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED....2122 Aluminum calcium silicate. (a) Product. Aluminum calcium silicate. (b) Tolerance. 2 percent....

  20. 21 CFR 182.2122 - Aluminum calcium silicate.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Aluminum calcium silicate. 182.2122 Section 182.2122 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED....2122 Aluminum calcium silicate. (a) Product. Aluminum calcium silicate. (b) Tolerance. 2 percent....

  1. 21 CFR 182.2122 - Aluminum calcium silicate.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 21 Food and Drugs 3 2014-04-01 2014-04-01 false Aluminum calcium silicate. 182.2122 Section 182...) SUBSTANCES GENERALLY RECOGNIZED AS SAFE Anticaking Agents § 182.2122 Aluminum calcium silicate. (a) Product. Aluminum calcium silicate. (b) Tolerance. 2 percent. (c) Limitations, restrictions, or explanation....

  2. 21 CFR 182.2122 - Aluminum calcium silicate.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 21 Food and Drugs 3 2011-04-01 2011-04-01 false Aluminum calcium silicate. 182.2122 Section 182.2122 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED....2122 Aluminum calcium silicate. (a) Product. Aluminum calcium silicate. (b) Tolerance. 2 percent....

  3. Comparison of Calcium and Barium Microcapsules as Scaffolds in the Development of Artificial Dermal Papillae.

    PubMed

    Liu, Yang; Lin, Changmin; Zeng, Yang; Li, Haihong; Cai, Bozhi; Huang, Keng; Yuan, Yanping; Li, Yu

    2016-01-01

    This study aimed to develop and evaluate barium and calcium microcapsules as candidates for scaffolding in artificial dermal papilla. Dermal papilla cells (DPCs) were isolated and cultured by one-step collagenase treatment. The DPC-Ba and DPC-Ca microcapsules were prepared by using a specially designed, high-voltage, electric-field droplet generator. Selected microcapsules were assessed for long-term inductive properties with xenotransplantation into Sprague-Dawley rat ears. Both barium and calcium microcapsules maintained xenogenic dermal papilla cells in an immunoisolated environment and induced the formation of hair follicle structures. Calcium microcapsules showed better biocompatibility, permeability, and cell viability in comparison with barium microcapsules. Before 18 weeks, calcium microcapsules gathered together, with no substantial immune response. After 32 weeks, some microcapsules were near inflammatory cells and wrapped with fiber. A few large hair follicles were found. Control samples showed no marked changes at the implantation site. Barium microcapsules were superior to calcium microcapsules in structural and mechanical stability. The cells encapsulated in hydrogel barium microcapsules exhibited higher short-term viability. This study established a model to culture DPCs in 3D culture conditions. Barium microcapsules may be useful in short-term transplantation study. Calcium microcapsules may provide an effective scaffold for the development of artificial dermal papilla. PMID:27123456

  4. Comparison of Calcium and Barium Microcapsules as Scaffolds in the Development of Artificial Dermal Papillae

    PubMed Central

    Liu, Yang; Lin, Changmin; Zeng, Yang; Li, Haihong; Cai, Bozhi; Huang, Keng; Yuan, Yanping; Li, Yu

    2016-01-01

    This study aimed to develop and evaluate barium and calcium microcapsules as candidates for scaffolding in artificial dermal papilla. Dermal papilla cells (DPCs) were isolated and cultured by one-step collagenase treatment. The DPC-Ba and DPC-Ca microcapsules were prepared by using a specially designed, high-voltage, electric-field droplet generator. Selected microcapsules were assessed for long-term inductive properties with xenotransplantation into Sprague-Dawley rat ears. Both barium and calcium microcapsules maintained xenogenic dermal papilla cells in an immunoisolated environment and induced the formation of hair follicle structures. Calcium microcapsules showed better biocompatibility, permeability, and cell viability in comparison with barium microcapsules. Before 18 weeks, calcium microcapsules gathered together, with no substantial immune response. After 32 weeks, some microcapsules were near inflammatory cells and wrapped with fiber. A few large hair follicles were found. Control samples showed no marked changes at the implantation site. Barium microcapsules were superior to calcium microcapsules in structural and mechanical stability. The cells encapsulated in hydrogel barium microcapsules exhibited higher short-term viability. This study established a model to culture DPCs in 3D culture conditions. Barium microcapsules may be useful in short-term transplantation study. Calcium microcapsules may provide an effective scaffold for the development of artificial dermal papilla. PMID:27123456

  5. Life Model of Hollow Cathodes Using a Barium Calcium Aluminate Impregnated Tungsten Emitter

    NASA Technical Reports Server (NTRS)

    Kovaleski, S. D.; Burke, Tom (Technical Monitor)

    2001-01-01

    Hollow cathodes with barium calcium aluminate impregnated tungsten emitters for thermionic emission are widely used in electric propulsion. These high current, low power cathodes are employed in ion thrusters, Hall thrusters, and on the International Space Station in plasma contactors. The requirements on hollow cathode life are growing more stringent with the increasing use of electric propulsion technology. The life limiting mechanism that determines the entitlement lifetime of a barium impregnated thermionic emission cathode is the evolution and transport of barium away from the emitter surface. A model is being developed to study the process of barium transport and loss from the emitter insert in hollow cathodes. The model accounts for the production of barium through analysis of the relevant impregnate chemistry. Transport of barium through the approximately static gas is also being treated. Finally, the effect of temperature gradients within the cathode are considered.

  6. Barium oxide, calcium oxide, magnesia, and alkali oxide free glass

    DOEpatents

    Lu, Peizhen Kathy; Mahapatra, Manoj Kumar

    2013-09-24

    A glass composition consisting essentially of about 10-45 mole percent of SrO; about 35-75 mole percent SiO.sub.2; one or more compounds from the group of compounds consisting of La.sub.2O.sub.3, Al.sub.2O.sub.3, B.sub.2O.sub.3, and Ni; the La.sub.2O.sub.3 less than about 20 mole percent; the Al.sub.2O.sub.3 less than about 25 mole percent; the B.sub.2O.sub.3 less than about 15 mole percent; and the Ni less than about 5 mole percent. Preferably, the glass is substantially free of barium oxide, calcium oxide, magnesia, and alkali oxide. Preferably, the glass is used as a seal in a solid oxide fuel/electrolyzer cell (SOFC) stack. The SOFC stack comprises a plurality of SOFCs connected by one or more interconnect and manifold materials and sealed by the glass. Preferably, each SOFC comprises an anode, a cathode, and a solid electrolyte.

  7. Precipitation of Calcium, Magnesium, Strontium and Barium in Tissues of Four Acacia Species (Leguminosae: Mimosoideae)

    PubMed Central

    He, Honghua; Bleby, Timothy M.; Veneklaas, Erik J.; Lambers, Hans; Kuo, John

    2012-01-01

    Precipitation of calcium in plants is common. There are abundant studies on the uptake and content of magnesium, strontium and barium, which have similar chemical properties to calcium, in comparison with those of calcium in plants, but studies on co-precipitation of these elements with calcium in plants are rare. In this study, we compared morphologies, distributional patterns, and elemental compositions of crystals in tissues of four Acacia species grown in the field as well as in the glasshouse. A comparison was also made of field-grown plants and glasshouse-grown plants, and of phyllodes of different ages for each species. Crystals of various morphologies and distributional patterns were observed in the four Acacia species studied. Magnesium, strontium and barium were precipitated together with calcium, mainly in phyllodes of the four Acacia species, and sometimes in branchlets and primary roots. These elements were most likely precipitated in forms of oxalate and sulfate in various tissues, including epidermis, mesophyll, parenchyma, sclerenchyma (fibre cells), pith, pith ray and cortex. In most cases, precipitation of calcium, magnesium, strontium and barium was biologically induced, and elements precipitated differed between soil types, plant species, and tissues within an individual plant; the precipitation was also related to tissue age. Formation of crystals containing these elements might play a role in regulating and detoxifying these elements in plants, and protecting the plants against herbivory. PMID:22848528

  8. Effect of chloride incorporation on the crystallization of zirconium-barium-lanthanum-aluminum fluoride glass

    NASA Technical Reports Server (NTRS)

    Neilson, G. F.; Smith, G. L.; Weinberg, M. C.

    1985-01-01

    One aspect of the influence of preparation procedure on the crystallization behavior of a zirconium-barium-lanthanum-aluminum fluoride glass was studied. The crystallization pattern of this glass may be affected by the chlorine concentration within it. In particular, when such glasses are heated at low temperatures, the alpha-Ba-Zr-F6 crystalline phase forms only in those glasses which contain chloride.

  9. Calcium barium niobate as a functional material for broadband optical frequency conversion.

    PubMed

    Sheng, Yan; Chen, Xin; Lukasiewicz, Tadeusz; Swirkowicz, Marek; Koynov, Kaloian; Krolikowski, Wieslaw

    2014-03-15

    We demonstrate the application of as-grown calcium barium niobate (CBN) crystal with random-sized ferroelectric domains as a broadband frequency converter. The frequency conversion process is similar to broadband harmonic generation in commonly used strontium barium niobate (SBN) crystal, but results in higher conversion efficiency reflecting a larger effective nonlinear coefficient of the CBN crystal. We also analyzed the polarization properties of the emitted radiation and determined the ratio of d32 and d33 components of the second-order susceptibility tensor of the CBN crystal. PMID:24690779

  10. Effect of aluminum substitution on microwave absorption properties of barium hexaferrite

    NASA Astrophysics Data System (ADS)

    Qiu, Jianxun; Zhang, Qiguo; Gu, Mingyuan; Shen, Haigen

    2005-11-01

    Aluminum substituted barium hexaferrites were prepared by the self-propagating combustion method and subsequent calcination at 850 °C. The crystalline structure, complex permittivity, complex permeability, and hyperfine parameters of BaFe12-xAlxO19 (x varies from 1.5 to 2.3 in steps of 0.2) were measured with x-ray diffraction (XRD), vector network analyzer and Mössbauer spectroscopy. The XRD results show that all Al3+ ions enter into the lattice of hexagonal barium ferrite. The substitution of Al3+ ions can greatly affect the complex permittivity and permeability of barium ferrite. With increasing substitution, the real part of complex permittivity increases gradually, and the peaks of the imaginary part of complex permeability shift into higher frequency band. When the substitution amount x is 1.9, the largest movement of the peaks is 1.95 GHz, which indicates that the ferromagnetic resonant frequency of barium ferrite increases by 1.95 GHz. The Al3+ ions preferentially occupy the 4f2, 2a, 4f1, and 12k sites in the subcrystalline structure up to x =1.9, and then the Al3+ ions mainly occupy 12k sites. This change also results in 2b sites with a large quadrupole splitting. These occupations lead to a variable magnetocrystalline anisotropy field.

  11. Aluminum citrate prevents renal injury from calcium oxalate crystal deposition.

    PubMed

    Besenhofer, Lauren M; Cain, Marie C; Dunning, Cody; McMartin, Kenneth E

    2012-12-01

    Calcium oxalate monohydrate crystals are responsible for the kidney injury associated with exposure to ethylene glycol or severe hyperoxaluria. Current treatment strategies target the formation of calcium oxalate but not its interaction with kidney tissue. Because aluminum citrate blocks calcium oxalate binding and toxicity in human kidney cells, it may provide a different therapeutic approach to calcium oxalate-induced injury. Here, we tested the effects of aluminum citrate and sodium citrate in a Wistar rat model of acute high-dose ethylene glycol exposure. Aluminum citrate, but not sodium citrate, attenuated increases in urea nitrogen, creatinine, and the ratio of kidney to body weight in ethylene glycol-treated rats. Compared with ethylene glycol alone, the addition of aluminum citrate significantly increased the urinary excretion of both crystalline calcium and crystalline oxalate and decreased the deposition of crystals in renal tissue. In vitro, aluminum citrate interacted directly with oxalate crystals to inhibit their uptake by proximal tubule cells. These results suggest that treating with aluminum citrate attenuates renal injury in rats with severe ethylene glycol toxicity, apparently by inhibiting calcium oxalate's interaction with, and retention by, the kidney epithelium. PMID:23138489

  12. Aluminum Citrate Prevents Renal Injury from Calcium Oxalate Crystal Deposition

    PubMed Central

    Besenhofer, Lauren M.; Cain, Marie C.; Dunning, Cody

    2012-01-01

    Calcium oxalate monohydrate crystals are responsible for the kidney injury associated with exposure to ethylene glycol or severe hyperoxaluria. Current treatment strategies target the formation of calcium oxalate but not its interaction with kidney tissue. Because aluminum citrate blocks calcium oxalate binding and toxicity in human kidney cells, it may provide a different therapeutic approach to calcium oxalate-induced injury. Here, we tested the effects of aluminum citrate and sodium citrate in a Wistar rat model of acute high-dose ethylene glycol exposure. Aluminum citrate, but not sodium citrate, attenuated increases in urea nitrogen, creatinine, and the ratio of kidney to body weight in ethylene glycol–treated rats. Compared with ethylene glycol alone, the addition of aluminum citrate significantly increased the urinary excretion of both crystalline calcium and crystalline oxalate and decreased the deposition of crystals in renal tissue. In vitro, aluminum citrate interacted directly with oxalate crystals to inhibit their uptake by proximal tubule cells. These results suggest that treating with aluminum citrate attenuates renal injury in rats with severe ethylene glycol toxicity, apparently by inhibiting calcium oxalate’s interaction with, and retention by, the kidney epithelium. PMID:23138489

  13. Interaction Studies Between Crofer-22APU Alloy And P2O5 Containing Barium Calcium Alumino-borosilicate (BCABS) Sealant Glass-Ceramics

    NASA Astrophysics Data System (ADS)

    Ananthanarayanan, A.; Montagne, L.; Revel, B.; Kothiyal, G. P.

    2010-12-01

    We present the effect of P2O5 addition on barium calcium aluminum borosilicate BCABS glasses of composition (mol %) 35BaO-15CaO-5Al2O3-(37-x)SiO2-8B2O3-xP2O5 (0≤x≤5). The incorporation of P2O5 increased network polymerization and crystallization tendency. However, addition of P2O5 leads to the formation of Cr2O3 at the interface, saturating it in the ions of the metal. This improves glass-to-metal bonding.

  14. Superconductivity of strontium aluminum germanide and barium aluminum germanide Structure and Dynamics of strontium aluminum germanium hydride and barium aluminum germanium hydride

    NASA Astrophysics Data System (ADS)

    Kranak, Verina Franika

    The discovery of the superconductor MgB2 led to the increase of research activity for more compounds adopting the AlB 2 structure type and containing superconductive properties. The prominent successor compounds were the silicide systems, AeAlSi (Ae=Sr, Ba, Ca). Presented here is an extension of this investigation to the germanides, SrAlGe and BaAlGe. The ternary structures were synthesized through arc-melting elemental stoichiometric mixtures and structurally characterized by x-ray powder diffraction. Both crystallize as the hexagonal SrPtSb space group (P m2), a variant of the AlB2 structure type (P 6/mmm). The low temperature region was measured on a Vibrating Sample Magnetometer (VSM) and both present the onset of superconductivity below 7K. These compounds are susceptible to hydrogen absorption and the new polyanionic hydrides, SrAlGeH and BaAlGeH, structural and dynamic properties are presented. The hydrides were synthesized via two distinct methods. One method is the reaction of SrH2 (BaH2) with elemental mixture of the Al and Ge under pressurized hydrogen and the other is a hydrogenation of the SrAlGe and BaAlGe. Both crystallize in the trigonal SrAlSiH structure type (P3m1), as determined from Rietveld analysis on powder neutron diffraction measurements. The hydrogen is coordinated by both the active metal and aluminum atoms, providing a unique environment for studying metal-hydrogen interactions. When exposed to air, both the hydrides and alloys transform from a crystalline grey to an amorphous yellow powder accompanied by a dramatic volume increase. Infrared spectroscopy shows the disappearance of the bands associated with the Al-H bond and the appearance of Ge-H and O-H bands. This indicates the material reacts with atmospheric water.

  15. Assessment of the solubility and bioaccessibility of barium and aluminum in soils affected by mine dust deposition.

    PubMed

    Shock, S S; Bessinger, B A; Lowney, Y W; Clark, J L

    2007-07-01

    Barium is a heavy metal to which human and animal receptors may be exposed in various settings--for example, in mineral extraction industries where the mining and milling of ores occurs. Aluminum is also an element abundant in soil and dust to which human and animal receptors may be exposed in association with such industries. This study investigated the solubility and bioaccessibility of barium and aluminum in simulated gastric fluids using an in vitro test method previously validated for lead. Soil samples were collected from the vicinity of a mine and transport road that generated fugitive dust containing barium as barite (BaSO4). It was found that barium bioaccessibility in different tundra soil and fugitive dust source materials varied greatly, between 0.07 and 66.0%, depending on sample location, grain size, solid-to-fluid ratio used in the in vitro experiments, and the analytical method selected for determining total barium concentrations in the sample substrates. For X-ray fluorescence spectrometry (XRF) analytical methods and a solid-to-fluid ratio of 1:100, barium bioaccessibility from the barite-rich mine waste rock and gyro crusher ore dust source materials was very low (0.07-0.36%). By contrast, the bioaccessibility of barium in tundra soil samples affected by fugitive dust deposition ranged from 3.8 to 19.5%. The relative solubility of barium measured in the simulated gastric fluids of this study is consistent with time-dependent dissolution of barite in mine waste rock and ore dust, and the presence of more soluble chemical forms in tundra soil. Laboratory XRF analysis was the only analytical method used in this study that accurately characterized total barium concentrations for all sample substrates. Aluminum bioaccessibility was distinguished from barium bioaccessibility by its generally lower values and smaller dependence on grain size and solid-to-fluid ratios. The range of aluminum bioaccessibility values (0.31-4.0%) is consistent with the

  16. Optical planar waveguide in sodium-doped calcium barium niobate crystals by carbon ion implantation

    NASA Astrophysics Data System (ADS)

    Zhao, Jin-Hua; Qin, Xi-Feng; Wang, Feng-Xiang; Fu, Gang; Wang, Hui-Lin; Wang, Xue-Lin

    2013-07-01

    There is great interest in niobate crystals which belong to the tetragonal tungsten bronze (TTB) families owing to their intriguing properties. As one representative of such crystals, CBN (calcium barium niobate) has attracted rapidly growing attention. Because it has a higher Curie temperature than SBN (strontium barium niobate), possesses outstanding ferroelectric and it possesses optical properties. In addition, doped with sodium, CBN will show a higher Curie temperature than pure CBN. We report on the fabrication and characterization of optical planar waveguide in x-cut sodium-doped calcium barium niobate crystal by using C ion implantation. The guided-mode properties at the wavelength of 633 and 1539 nm are investigated through prism-coupling measurements, respectively. By applying direct end-face coupling arrangement, the near-field optical intensity distribution of waveguide modes is measured at 633 nm. For comparison, the modal profile of the same guided mode is also numerically calculated by the finite difference beam-propagation method via computer software BeamPROP. The transmission spectra of the waveguide before and after ion implantation treatments were investigated also. Our experiment results reveal that the waveguide could propagate light with transverse magnetic polarized direction only and it is assumed that the polarization selectivity of CBN crystal may responsible for this phenomenon.

  17. Calcium citrate without aluminum antacids does not cause aluminum retention in patients with functioning kidneys

    NASA Technical Reports Server (NTRS)

    Sakhaee, K.; Wabner, C. L.; Zerwekh, J. E.; Copley, J. B.; Pak, L.; Poindexter, J. R.; Pak, C. Y.

    1993-01-01

    It has been suggested that calcium citrate might enhance aluminum absorption from food, posing a threat of aluminum toxicity even in patients with normal renal function. We therefore measured serum and urinary aluminum before and following calcium citrate therapy in patients with moderate renal failure and in normal subjects maintained on constant metabolic diets with known aluminum content (967-1034 mumol/day, or 26.1-27.9 mg/day, in patients and either 834 or 1579 mumol/day, or 22.5 and 42.6 mg/day, in normal subjects). Seven patients with moderate renal failure (endogenous creatinine clearance of 43 ml/min) took 50 mmol (2 g) calcium/day as effervescent calcium citrate with meals for 17 days. Eight normal women received 25 mmol (1 g) calcium/day as tricalcium dicitrate tablets with meals for 7 days. In patients with moderate renal failure, serum and urinary aluminum were normal before treatment at 489 +/- 293 SD nmol/l (13.2 +/- 7.9 micrograms/l) and 767 +/- 497 nmol/day (20.7 +/- 13.4 micrograms/day), respectively. They remained within normal limits and did not change significantly during calcium citrate treatment (400 +/- 148 nmol/l and 600 +/- 441 nmol/day, respectively). Similarly, no significant change in serum and urinary aluminum was detected in normal women during calcium citrate administration (271 +/- 59 vs 293 +/- 85 nmol/l and 515 +/- 138 vs 615 +/- 170 nmol/day, respectively). In addition, skeletal bone aluminum content did not change significantly in 14 osteoporotic patients (endogenous creatinine clearance of 68.5 ml/min) treated for 24 months with calcium citrate, 10 mmol calcium twice/day separately from meals (29.3 +/- 13.9 ng/mg ash bone to 27.9 +/0- 10.4, P = 0.727). In them, histomorphometric examination did not show any evidence of mineralization defect. Thus, calcium citrate given alone without aluminum-containing drugs does not pose a risk of aluminum toxicity in subjects with normal or functioning kidneys, when it is administered on an

  18. Efficient ionisation of calcium, strontium and barium by resonant laser pumping

    NASA Technical Reports Server (NTRS)

    Skinner, C. H.

    1980-01-01

    Efficient ionization has been observed when an atomic vapor of strontium, barium or calcium was illuminated with a long pulse tunable laser at the frequency of the atomic resonance line. The variation in the degree of ionization with neutral density and laser intensity has been measured using the 'hook' method. The maximum ionization observed was 94%. Excited state populations were measured yielding an excitation temperature (depending on exact experimental conditions) in the region of 0.4 eV. The decay of ion density after the laser pulse was monitored and the recombination coefficients determined. The results are interpreted in terms of an electron heating model.

  19. Curie temperature and magnetic properties of aluminum doped barium ferrite particles prepared by ball mill method

    NASA Astrophysics Data System (ADS)

    Chen, Daming; Harward, Ian; Baptist, Joshua; Goldman, Sara; Celinski, Zbigniew

    2015-12-01

    Barium ferrite has attracted considerable interest in the fields of permanent magnets and perpendicular magnetic recording due to its strong uniaxial anisotropy and high Curie temperature (Tc). We prepared aluminum doped barium ferrite ceramics (BaAlxFe12-xO19, 0≤x≤6) by the ball mill method. The powder was milled for 96 h, and after forming pellets, annealed for 48 h in air at 1000 °C. The X-ray diffraction (XRD) data show that there are only single hexagonal phases in the samples without any impurity phase. The crystal lattice constants, a and c, were calculated by Cohen's method. Both a and c decrease with increasing x, ranging from 0.588 nm and 2.318 nm to 0.573 nm and 2.294 nm, respectively. A Vibrating Sample Magnetometer (VSM) and Superconducting Quantum Interference Device (SQUID) were used to investigate Tc and magnetic properties of BaFe12-xAlxO19. It is found that Tc decreases with increasing x, from 425 °C to 298 °C. It is also found that the saturated magnetization (4πMs) decreases with increasing x, while the coercivity (Hc) increases with the increase in x. The anisotropy field was also determined from the SQUID measurement.

  20. Calcium metal as a scavenger for antimony from aluminum alloys

    SciTech Connect

    Bonsignore, P.V.; Daniels, E.J.; Wu, C.T.

    1994-10-04

    Previous work has shown that trace amounts of antimony (Sb) can affect the mechanical properties of strontium (Sr) modified aluminum castings. ANL has been investigating technology to remove or neutralize Sb to reduce its negative effect on the physical properties of those alloys. Review of past work on processing and recovery of scrap aluminum inferred that calcium (Ca) is an effective scavenger of Sb, bismuth, lead and cadmium. Following up on that lead, we have found that Ca is, indeed, effective for removing Sb from molten aluminum alloys although its effectiveness can be compromised by a wide range of processing conditions. A minimum ratio of about four to one, by weight, of Ca to Sb appears necessary to insure an effective scavenging of contained Sb.in 356 aluminum alloys.

  1. Copper, aluminum, iron and calcium inhibit human acetylcholinesterase in vitro.

    PubMed

    Pohanka, Miroslav

    2014-01-01

    Acetylcholinesterase (AChE) is an important part of cholinergic nerves where it participates in termination of neurotransmission. AChE can be inhibited by e.g. some Alzheimer disease drugs, nerve agents, and secondary metabolites. In this work, metal salts aluminum chloride, calcium chloride, cupric chloride, ferric chloride, potassium chloride, magnesium chloride and sodium chloride were tested for their ability to inhibit AChE. Standard Ellman assay based on human recombinant AChE was done and inhibition was measured using Dixon plot. No inhibition was proved for sodium, potassium and magnesium ions. However, aluminum, cupric, ferric and calcium ions were able to inhibit AChE via noncompetitive mechanism of inhibition. Though the inhibition is much weaker when compared to e.g. drugs with noncompetitive mechanism of action, biological relevance of the findings can be anticipated. PMID:24473150

  2. The retention of calcium, barium, and strontium ions by a mollisol humic acid: Spectroscopic investigation

    NASA Astrophysics Data System (ADS)

    Oufqir, Sofia; Bloom, Paul R.; Torner, Brandy M.

    2014-05-01

    Humic substances have a major role in controlling the mobility and bioavailability of metallic ions in soils and natural waters. The alkaline earth metals, calcium, barium, and strontium, are broadly abundant in the crust of the earth, and Ca2+ ions are known to be important in the formation of structural aggregates in soils. Yet, direct spectroscopic evidence of how Ca, Ba, and Sr ions interact with soil organic matter, is minimal. To develop a deeper understanding of the interaction of the alkaline earth cations in soil, we studied the complexation behavior of strontium, barium and calcium by humic acid (HA) using solid-state 13C CP-MAS NMR, FTIR and extended x-ray absorption fine structure (EXAFS) spectroscopy. A HA sample was extracted from an agricultural mollisol (pH 6, 32.5% clay content, 3.7% organic carbon) located in southwestern Minnesota, USA, by the standard NaOH method. The HA sample was treated with chloride salts of Ca, Sr or Ba, then freeze-dried prior to spectroscopic measurements. The FTIR spectra, obtained using pressed KBr disks, and the 13C NMR spectra revealed spectral differences, stemming mainly from deprotonation reactions of the carboxylic and phenolic groups of the HA. The association of Ca, Ba, and Sr ions with the HA caused a marked FTIR shift of the carboxylate band, with the Ba shift being the most pronounced (HA 1604.7; HA-Ca 1595.1; HA-Sr 1597; HA-Ba 1579.6), which seems to imply that Ba is the strongest bound element. An NMR shift of the carbonyl peak at 171.8 ppm was also observed to 174.5 for Ca, 173.7 for Sr, and 174.4 for Ba confirming that these cations are behaving differently towards soil HA. The EXAFS spectra indicated back-scattering from oxygen atoms, in the first shell, for Ca, Sr, and Ba with varied coordination number. Our data prove that (1) the carboxylates and phenolates are the prevailing functional groups involved in the interactions between the extracted HA and alkali metal cations, (2) barium forms the

  3. Preparation, characterization, biological activity, and transport study of polystyrene based calcium-barium phosphate composite membrane.

    PubMed

    Khan, Mohammad Mujahid Ali; Rafiuddin

    2013-10-01

    Calcium-barium phosphate (CBP) composite membrane with 25% polystyrene was prepared by co-precipitation method. Scanning electron microscopy (SEM), X-ray diffraction (XRD), Fourier transformed infrared (FTIR), and Thermogravimetric analysis (TGA) were used to characterize the membrane. The membrane was found to be crystalline in nature with consistent arrangement of particles and no indication of visible cracks. The electrical potentials measured across the composite membrane in contact with univalent electrolytes (KCl, NaCl and LiCl), have been found to increase with decrease in concentrations. Thus the membrane was found to be cation-selective. Transport properties of developed membranes may be utilized for the efficient desalination of saline water and more importantly demineralization process. The antibacterial study of this composite membrane shows good results for killing the disease causing bacteria along with waste water treatment. PMID:23910337

  4. Reactions of calcium orthosilicate and barium zirconate with oxides and sulfates of various elements

    NASA Technical Reports Server (NTRS)

    Zaplatynsky, I.

    1979-01-01

    Calcium orthosilicate and barium zirconate were evaluated as the insulation layer of thermal barrier coatings for air cooled gas turbine components. Their reactions with various oxides and sulfates were studied at 1100 C and 1300 C for times ranging up to 400 and 200 hours, respectively. These oxides and sulfates represent potential impurities or additives in gas turbine fuels and in turbine combustion air, as well as elements of potential bond coat alloys. The phase compositions of the reaction products were determined by X-ray diffraction analysis. BaZrO3 and 2CaO-SiO2 both reacted with P2O5, V2O5, Cr2O3, Al2O3, and SiO2. In addition, 2CaO-SiO2 reacted with Na2O, BaO, MgO, and CoO and BaZrO3 reacted with Fe2O3.

  5. Interaction Studies Between Crofer-22APU Alloy And P{sub 2}O{sub 5} Containing Barium Calcium Alumino-borosilicate (BCABS) Sealant Glass-Ceramics

    SciTech Connect

    Ananthanarayanan, A.; Montagne, L.; Revel, B.; Kothiyal, G. P.

    2010-12-01

    We present the effect of P{sub 2}O{sub 5} addition on barium calcium aluminum borosilicate BCABS glasses of composition (mol %)35BaO-15CaO-5Al{sub 2}O{sub 3}-(37-x)SiO{sub 2}-8B{sub 2}O{sub 3}-xP{sub 2}O{sub 5}(0{<=}x{<=}5). The incorporation of P{sub 2}O{sub 5} increased network polymerization and crystallization tendency. However, addition of P{sub 2}O{sub 5} leads to the formation of Cr{sub 2}O{sub 3} at the interface, saturating it in the ions of the metal. This improves glass-to-metal bonding.

  6. Chemical looping coal gasification with calcium ferrite and barium ferrite via solid--solid reactions

    SciTech Connect

    Siriwardane, Ranjani; Tian, Hanjing; Richards, George

    2016-01-01

    Coal gasification to produce synthesis gas by chemical looping was investigated with two oxygen carriers, barium ferrite (BaFe2O4) and calcium ferrite (CaFe2O4). Thermo-gravimetric analysis (TGA) and fixed-bed flow reactor data indicated that a solid–solid interaction occurred between oxygen carriers and coal to produce synthesis gas. Both thermodynamic analysis and experimental data indicated that BaFe2O4 and CaFe2O4 have high reactivity with coal but have a low reactivity with synthesis gas, which makes them very attractive for the coal gasification process. Adding steam increased the production of hydrogen (H2) and carbon monoxide (CO), but carbon dioxide (CO2) remained low because these oxygen carriers have minimal reactivity with H2 and CO. Therefore, the combined steam–oxygen carrier produced the highest quantity of synthesis gas. It appeared that neither the water–gas shift reaction nor the water splitting reaction promoted additional H2 formation with the oxygen carriers when steam was present. Wyodak coal, which is a sub-bituminous coal, had the best gasification yield with oxygen carrier–steam while Illinois #6 coal had the lowest. The rate of gasification and selectivity for synthesis gas production was significantly higher when these oxygen carriers were present during steam gasification of coal. The rates and synthesis gas yields during the temperature ramps of coal–steam with oxygen carriers were better than with gaseous oxygen.

  7. Determination of barium and calcium evaporation rates from impregnated tungsten dispenser cathodes

    NASA Astrophysics Data System (ADS)

    Jones, G. L.; Grant, J. T.

    The evaporation rates of barium and calcium from impregnated tungsten dispenser cathodes have been determined by both a vapor-collect method and line-of-sight mass spectrometry. Cathodes having molar ratios of BaO, CaO, and Al 2O 3 of 4:1:1, 5:3:2, and 1:1:1 have been studied. All measurements were conducted in ultrahigh vacuum. For the vapor-collect method, a W(110) collector was found to be suitable for monolayer growth. The procedure involved plotting the ratio of the adsorbate Auger peak-to-peak height to that from the collector as a function of collection time. Break-points in these plots characterized the collection of one monolayer of adsorbate. A geometrical correction then allowed the evaporation rates to be determined. Evaporation rates were determined at cathode temperatures of 1050, 1100, and 1150°C. For the line-of-sight mass spectrometry an Extranuclear quadrupole was used. The quadrupole was capable of measuring species up to 300 amu. Measurements with the quadrupole were made on a 5:3:2 and a 4:1:1 cathode. Results obtained using these two methods are compared.

  8. Study of the Influence Between Barium Ions and Calcium Ions on Morphology and Size of Coprecipitation in Microemulsion

    NASA Astrophysics Data System (ADS)

    Wang, Nong; Meng, Qing Luo

    2015-03-01

    In this paper, we systematically drew a series of inverse-microemulsion quasi-ternary system phase diagrams of OP-10+C8H17OH+C6H12+brine (CaCl2/BaCl2) by adjusting the ratio of CaCl2 and BaCl2. On this basis, microemulsions have been prepared with seven different molar ratios of Ca2+/Ba2+, and calcium carbonate and barium carbonate coprecipitation products were obtained by reaction with an equimolar amount of sodium carbonate. The influence of barium ion to morphology and composition of nanometer calcium carbonate were studied. These samples were characterized by scanning electron microscopy (SEM), Fourier transform infrared spectroscopy (FTIR) and X-ray diffraction (XRD). The SEM photographs indicated that when the content of Ca2+ was higher, some incomplete large cube of coprecipitation particles were formed in solution, but with the content of Ba2+ increased gradually, they formed a large number of small spherical particles, with the further increase of Ba2+ concentration, the particles mainly had structures of irregular polyhedron eventually. The measurement results of FTIR and XRD indicated that CaCO3 coprecipitation products gradually changed from calcite to the vaterite, eventually turned into being aragonite with the further increase of Ba2+ concentration.

  9. ALUMINUM ALTERS CALCIUM TRANSPORT IN PLASMA MEMBRANE AND ENDOPLASMIC RETICULUM FROM RAT BRAIN

    EPA Science Inventory

    Calcium is actively transported into intracellular organelles and out of the cytoplasm by Ca2+/Mg2+-ATPases located in the endoplasmic reticulum and plasma membranes. he effects of aluminum on calcium transport were examined in the adult rat brain. 5Ca-uptake was examined in micr...

  10. Potassium barium hexacyanoferrate - A potential cathode material for rechargeable calcium ion batteries

    NASA Astrophysics Data System (ADS)

    Padigi, Prasanna; Goncher, Gary; Evans, David; Solanki, Raj

    2015-01-01

    Potassium barium hexacyanoferrate (K2BaFe(CN)6) was investigated as a cathode material for reversible Ca2+ ion insertion/extraction type rechargeable battery using non-aqueous electrolytes. The electrochemical performance of K2BaFe(CN)6was evaluated using cyclic voltammetry and galvanic cycling at ambient temperature. It is shown that addition of water led to significant enhancement in intercalation and de-intercalation of Ca2+ ions, leading to improved charge/discharge capacity. The enhancement in performance is attributed to formation of solvation spheres around the intercalating Ca2+ ions which provide screening from the electrostatic charges of the BaFe(CN)6 lattice. A reversible capacity of 55.8 mA hr g-1 and a coulombic efficiency of 93.8% was demonstrated at the end of 30 charge/discharge cycles.

  11. Experimental and theoretical study of molecular structure of beryllium, magnesium, calcium, strontium and barium 4-nitrobenzoates

    NASA Astrophysics Data System (ADS)

    Samsonowicz, M.; Regulska, E.; Świsłocka, R.; Lewandowski, W.

    2013-02-01

    The influence of alkaline earth metal ions on the electronic system of 4-nitrobenzoic acid was studied in this paper. The vibrational (FT-IR) and NMR (1H and 13C) spectra were recorded for 4-nitrobenzoic acid (4-nba) and its salts (4-nb). The assignment of vibrational spectra was done. Some shifts of band wavenumbers in alkaline earth metal 4-nitrobenzoates spectra were observed in the series from magnesium to barium salts. Good correlations between wavenumbers of the vibrational bands in the IR spectra of studied salts and ionic potential, electronegativity, inverse of atomic mass, ionic radius and ionization energy of studied metals were found. The regular changes in the chemical shifts of protons (1H NMR) and carbons (13C NMR) in the series of studied salts were also observed. Optimized geometrical structures of studied compounds were calculated by B3LYP method using 6-311++G** as well as LANL2DZ basis sets. Theoretical wavenumbers and intensities in IR and chemical shifts in NMR spectra were also obtained. The calculated parameters were compared with experimental data of studied compounds.

  12. Histamine release by exocytosis from rat mast cells on reduction of extracellular sodium: a secretory response inhibited by calcium, strontium, barium or magnesium.

    PubMed Central

    Cochrane, D E; Douglas, W W

    1976-01-01

    1. Histamine release from peritoneal mast cells of the rat was stimulated when the cells were exposed for 10 min to sodium-deficient media where all NaCl had been replaced by KC1, RbC1, glucose, sucrose, mannitol, or Tris, provided calcium was less than about 0-5 mM. 2. Light and electron microscopy showed the response to be exocytosis. 3. The chelating agents, EDTA and EGTA, abolished the response to sodium lack and their inhibitory effects were reversed by re-incubating cells with calcium but not magnesium. 4. The response was inhibited by dinitrophenol combined with glucose-deprivation. 5. The response was inversely related to the concentrations of sodium and calcium below 137-5 and 0-5 mM respectively. 6. The related alkaline earth metals, barium, strontium, and magnesium, resembled calcium in inhibiting the response to sodium lack. 7. No secretory response was seen when the cells were exposed for 10 min to calcium-free medium in which lithium replaced sodium. Exposure to this medium for 60 min, however, elicited secretion. 8. It is concluded that when extracellular calcium is low, a reduction in extracellular sodium induces a conventional exocytotic secretory response dependent on energy and cellular calcium. It is suggested that sodium lack may mobilize calcium from a cellular site possibly the inner aspect of the plasma membrane. Images A B C D E F G H PMID:59804

  13. Influence of calcium substitution on defect disorder in barium titanate by atomistic simulation

    NASA Astrophysics Data System (ADS)

    Sampaio, D. V.; Santos, J. C. A.; Rezende, M. V. dos S.; Valerio, M. E. G.; Silva, R. S.

    2016-01-01

    In this work, classical atomistic simulation was employed to study the intrinsic disorder influenced by calcium substitution in BaTiO3 structure. The defects were modeled using the Mott-Littleton approximation, in which: a spherical region of the lattice surrounding the defect is treated explicitly, all interactions are considered, and more distant parts of the lattice are treated using a continuum approach. Frenkel, Schottky, pseudo-Schottky and anti-Schottky defects in Ba1-x Ca x TiO3 (x  =  0-1) were investigated. It was found that the most probable defects to occur in this system are CaO pseudo-Schottky defect and the incorporation of \\text{Ca}\\text{Ti}\\prime \\prime with compensation by oxygen vacancy.

  14. Thermoelectric performance enhancement of calcium cobaltite through barium grain boundary segregation.

    PubMed

    Carvillo, Paulo; Chen, Yun; Boyle, Cullen; Barnes, Paul N; Song, Xueyan

    2015-09-21

    We report the dramatic increase of the Seebeck coefficient S and thermoelectric performance of calcium cobaltite Ca3Co4O9+δ ceramics through non-stoichiometric addition of minute amount of Ba. The nominal chemistry of polycrystal pellets are Ca3BaxCo4O9+δ (x = 0, 0.01, 0.05, and 0.1). At 323 K, S of Ca3Co4O9+δ is 135 μV K(-1), whereas S of Ba incorporated Ca3Ba0.05Co4O9+δ is 162.5 μV·K(-1), which is the highest S value near room temperature regime reported for calcium cobaltite. The increase of S for Ca3Ba0.05Co4O9+δ sample is accompanied by the decrease of the electrical resistivity ρ, resulting in high power factor S(2)/ρ of 843 μW·m(-1) K(-2) at 1007 K. Moreover, the thermal conductivities κ of Ca3BaxCo4O9+δ decrease with the increase of the Ba addition. The figure-of-merit ZT for Ca3Ba0.05Co4O9+δ reaches 0.52 at 1073 K and a factor of 2.5 increment in comparison with undoped Ca3Co4O9+δ. Nanostructure examinations show that the added Ba segregated at the Ca3Co4O9+δ grain boundaries, while the Ca3Co4O9+δ grain interior is free of Ba. Performance enhancement is attributed to the carrier filtering effect caused by the Ba segregation. In addition, Ba segregation promotes the better crystal alignment and the development of crystal texture. PMID:26357956

  15. Near-infrared waveguide formation and RBS/channeling spectrometry analysis for damage in calcium barium niobate crystals via ion implantation

    NASA Astrophysics Data System (ADS)

    Zhang, Lian; Zhao, Jin-Hua; Gao, Wen-Lan; Liu, Peng; Zhou, Yu-Fan; Yu, Xiao-Fei; Wang, Tie-Jun; Song, Hong-Lian; Qiao, Mei; Wang, Xue-Lin

    2015-11-01

    We report on the fabrication of planar waveguide structures in calcium barium niobate crystals via C ion implantation at room temperature. The SRIM code was applied to calculate damage profiles of the C ions implanted into Ca0.32Ba0.68Nb2O6 crystals. The low-damage profiles in the near-surface of the implanted regions were verified by Rutherford backscattering/channeling spectrometry. The waveguide characteristics were investigated in the near-infrared bands. The propagation loss of the waveguide was estimated to be 0.88 dB/cm.

  16. Barium enema

    MedlinePlus

    ... series; Colorectal cancer - lower GI series; Colorectal cancer - barium enema; Crohn disease - lower GI series; Crohn disease - barium enema; Intestinal blockage - lower GI series; Intestinal blockage - ...

  17. Calcium-aluminum-rich inclusions from enstatite chondrites: indigenous or foreign?

    PubMed

    Guan; Huss; MacPherson; Wasserburg

    2000-08-25

    The primary mineral assemblages and initial (26)Al/(27)Al ratios of rare calcium-aluminum-rich inclusions (CAIs) from enstatite (E) chondrites are similar to those of CAIs from other chondrite classes. CAIs from all chondrite classes formed under oxidizing conditions that are much different from the reducing conditions under which the E chondrites formed. Either CAIs formed at an earlier, more oxidizing epoch in the region where E chondrites ultimately formed, or they formed at a different place in the solar nebula and were transported into the E chondrite formation region. PMID:10958775

  18. Near infrared emission for erbium-doped calcium aluminum silicate glass

    NASA Astrophysics Data System (ADS)

    Lihui, Huang; Xingren, Liu; Baojiu, Chen; Jiuling, Lin

    2001-09-01

    In this work, erbium-doped calcium aluminum silicate (CAS) glass has been synthesized by solid-state reaction. Intense emission at 1534 nm, corresponding to the 4I13/2→ 4I15/2 transition of the Er 3+ ion, was observed upon both 488 nm Ar + laser and 978 nm diode laser excitations at room temperature. The luminescence mechanisms in the glass are discussed. These results indicate this glass is a promising laser material with its high chemical durability and thermal stability.

  19. Structures and phase relations of aluminum-substituted calcium silicate hydrate

    SciTech Connect

    Kwan, S.; LaRosa-Thompson, J.; Grutzeck, M.W.

    1996-04-01

    The structures of aluminum-substituted calcium silicate hydrate (C-S-H) forming in a series of aqueous suspensions formulated with colloidal silica, reactive alumina, and lime and aged for 1 year have been studied using {sup 29}Si and {sup 27}Al magic angle spinning nuclear magnetic resonance spectroscopy (with and without cross polarization (CP)), solution pH, electron microscopy, and X-ray diffraction. As in earlier work dealing with the nature of C-S-H in the system CaO-SiO{sub 2}-H{sub 2}O, two aluminum-substituted C-S-H phases, having distinctly different anionic structures on the atomic level (Q{sub 2} versus Q{sub 1}Q{sub 2}), were found to extend into the system CaO-Al{sub 2}O{sub 3}-SiO{sub 2}-H{sub 2}O. X-ray diffraction patterns of the two aluminum-containing C-S-H phases are nearly identical, suggesting that their intermediate-range order is very similar, but MASNMR spectra show that these two phases have markedly different silicate structures on the atomic-level scale. Both C-S-H structures can accommodate approximately 5 mol% of Al{sub 2}O{sub 3} in tetrahedral and possibly octahedral coordination as well.

  20. Barium Sulfate

    MedlinePlus

    Barium sulfate is used to help doctors examine the esophagus (tube that connects the mouth and stomach), ... dimensional pictures of the inside of the body). Barium sulfate is in a class of medications called ...

  1. Lead isotopic ages of chondrules and calcium-aluminum-rich inclusions.

    PubMed

    Amelin, Yuri; Krot, Alexander N; Hutcheon, Ian D; Ulyanov, Alexander A

    2002-09-01

    The lead-lead isochron age of chondrules in the CR chondrite Acfer 059 is 4564.7 +/- 0.6 million years ago (Ma), whereas the lead isotopic age of calcium-aluminum-rich inclusions (CAIs) in the CV chondrite Efremovka is 4567.2 +/- 0.6 Ma. This gives an interval of 2.5 +/- 1.2 million years (My) between formation of the CV CAIs and the CR chondrules and indicates that CAI- and chondrule-forming events lasted for at least 1.3 My. This time interval is consistent with a 2- to 3-My age difference between CR CAIs and chondrules inferred from the differences in their initial 26Al/27Al ratios and supports the chronological significance of the 26Al-26Mg systematics. PMID:12215641

  2. Microstructure of amorphous aluminum hydroxide in belite-calcium sulfoaluminate cement

    SciTech Connect

    Song, Fei; Yu, Zhenglei; Yang, Fengling; Lu, Yinong Liu, Yunfei

    2015-05-15

    Belite-calcium sulfoaluminate (BCSA) cement is a promising low-CO{sub 2} alternative to ordinary Portland cement. Herein, aluminum hydroxide (AH{sub 3}), the main amorphous hydration product of BCSA cement, was investigated in detail. The microstructure of AH{sub 3} with various quantities of gypsum was investigated via scanning electron microscopy (SEM) and energy dispersive X-ray spectroscopy (EDS). The AH{sub 3} with various morphologies were observed and confirmed in the resulting pastes. Particular attention was paid to the fact that AH{sub 3} always contained a small amount of Ca according to the results of EDS analysis. The AH{sub 3} was then characterized via high resolution transmission electron microscopy (HRTEM). The results of HRTEM indicated that Ca arose from nanosized tricalcium aluminate hexahydrate which existed in the AH{sub 3}.

  3. Searching for calcium-aluminum-rich inclusions in cometary particles with Rosetta/COSIMA

    NASA Astrophysics Data System (ADS)

    Paquette, John A.; Engrand, Cecile; Stenzel, Oliver; Hilchenbach, Martin; Kissel, Jochen

    2016-07-01

    The calcium-aluminum-rich inclusions (CAIs) found in chondritic meteorites are probably the oldest solar system solids, dating back to 4567.30 ± 0.16 million years ago. They are thought to have formed in the protosolar nebula within a few astronomical units of the Sun, and at a temperature of around 1300 K. The Stardust mission found evidence of CAI-like material in samples recovered from comet Wild 2. The appearance of CAIs in comets, which are thought to be formed at lower temperatures and larger distances from the Sun, is only explicable if some mechanism allows the efficient transfer of such objects from the inner solar nebula to the outer solar nebula. Such mechanisms have been proposed such as an X-wind or turbulence. In this work, particles collected from within the coma of comet 67P/Churyumov-Gerasimenko are examined for compositional evidence of the presence of CAIs. COSIMA (the Cometary Secondary Ion Mass Analyzer) uses secondary ion mass spectrometry to analyze the composition of cometary dust captured on metal targets. While CAIs can have a radius of centimeters, they are more typically a few hundred microns in size, and can be smaller than 1 μm, so it is conceivable that particles visible on COSIMA targets (ranging in size from about 10 μm to hundreds of microns) could contain CAIs. Using a peak fitting technique, the composition of a set of 13 particles was studied, looking for material rich in both calcium and aluminum. One such particle was found.

  4. Searching for calcium-aluminum-rich inclusions in cometary particles with Rosetta/COSIMA

    NASA Astrophysics Data System (ADS)

    Paquette, John A.; Engrand, Cecile; Stenzel, Oliver; Hilchenbach, Martin; Kissel, Jochen

    2016-05-01

    The calcium-aluminum-rich inclusions (CAIs) found in chondritic meteorites are probably the oldest solar system solids, dating back to 4567.30 ± 0.16 million years ago. They are thought to have formed in the protosolar nebula within a few astronomical units of the Sun, and at a temperature of around 1300 K. The Stardust mission found evidence of CAI-like material in samples recovered from comet Wild 2. The appearance of CAIs in comets, which are thought to be formed at lower temperatures and larger distances from the Sun, is only explicable if some mechanism allows the efficient transfer of such objects from the inner solar nebula to the outer solar nebula. Such mechanisms have been proposed such as an X-wind or turbulence. In this work, particles collected from within the coma of comet 67P/Churyumov-Gerasimenko are examined for compositional evidence of the presence of CAIs. COSIMA (the Cometary Secondary Ion Mass Analyzer) uses secondary ion mass spectrometry to analyze the composition of cometary dust captured on metal targets. While CAIs can have a radius of centimeters, they are more typically a few hundred microns in size, and can be smaller than 1 μm, so it is conceivable that particles visible on COSIMA targets (ranging in size from about 10 μm to hundreds of microns) could contain CAIs. Using a peak fitting technique, the composition of a set of 13 particles was studied, looking for material rich in both calcium and aluminum. One such particle was found.

  5. Aluminum effects upon calbindin D9k-linked duodenal calcium transport in diabetic male rats.

    PubMed

    Orihuela, D; Favre, C; Monti, J A; Carnovale, C E; Carrillo, M C

    1999-02-22

    In order to elucidate if the inhibition mechanisms of Aluminum (Al) on intestinal calcium flux involve some possible action on calbindin-D9k, a series of in vivo and in vitro experiments were carried out in normal and in streptozotocin-induced diabetic male rats. The dose-response curves obtained from the in vitro studies indicate that, in the diabetic group (which has a lower content of calbindin-D9k), the effect of Al on JCa(ms) has a small dependence on rising Al concentration (0-10 microM). The parameters obtained from those curves: Emax (maximum reduction percentage of JCa(ms)) and ED50 (Al concentration that produces half of the highest inhibition) were significantly diminished in this group compared to control. Both s.c. injections of calcitriol (D3) at doses of 0.08 and 0.40 microg/kg body wt. per day and insulin (10 IU/kg body wt. per day), increase the inhibitory effect of Al to levels that did not differ from controls. In vivo gavage of 60 mg/kg body wt. per day of aluminum chloride for 1 week reveals that the degree of reduction of intestinal CaBP9k by Al is directly correlated to duodenal content of this protein (r2 = 0.683, P = 0.022). PMID:10079056

  6. Datasets depicting mobility retardation of NCS proteins observed upon incubation with calcium, but not with magnesium, barium or strontium

    PubMed Central

    Viviano, Jeffrey; Krishnan, Anuradha; Scully, Jenna; Wu, Hao; Venkataraman, Venkat

    2016-01-01

    In this data article we show the specificity of the Ca2+-induced mobility shift in three proteins that belong to the neuronal calcium sensor (NCS) protein family: Hippocalcin, GCAP1 and GCAP2. These proteins did not display a shift in mobility in native gels when incubated with divalent cations other than Ca2+ – such as Mg2+, Ba2+, and Sr2+, even at 10× concentrations. The data is similar to that obtained with another NCS protein, neurocalcin delta (Viviano et al., 2016, “Electrophoretic Mobility Shift in Native Gels Indicates Calcium-dependent Structural Changes of Neuronal Calcium Sensor Proteins”, [1]). PMID:27222862

  7. Datasets depicting mobility retardation of NCS proteins observed upon incubation with calcium, but not with magnesium, barium or strontium.

    PubMed

    Viviano, Jeffrey; Krishnan, Anuradha; Scully, Jenna; Wu, Hao; Venkataraman, Venkat

    2016-06-01

    In this data article we show the specificity of the Ca(2+)-induced mobility shift in three proteins that belong to the neuronal calcium sensor (NCS) protein family: Hippocalcin, GCAP1 and GCAP2. These proteins did not display a shift in mobility in native gels when incubated with divalent cations other than Ca(2+) - such as Mg(2+), Ba(2+), and Sr(2+), even at 10× concentrations. The data is similar to that obtained with another NCS protein, neurocalcin delta (Viviano et al., 2016, "Electrophoretic Mobility Shift in Native Gels Indicates Calcium-dependent Structural Changes of Neuronal Calcium Sensor Proteins", [1]). PMID:27222862

  8. Use of calcium/aluminum ratios as indicators of stress in forest ecosystems

    SciTech Connect

    Cronan, C.S.; Grigal, D.F.

    1995-03-01

    The calcium/aluminum (Ca/Al) molar ratio of the soil solution provides a valuable measurement endpoint or ecological indicator for identification of approximate thresholds beyond which the risk of forest damage from Al stress and nutrient imbalances increases. The Ca/Al ratio can also be used as an indicator to assess forest ecosystem changes over time in response to acidic deposition, forest harvesting, or other processes contributing to acid soil infertility. Based on a critical review of literature on Al stress, we estimate that there is a 50:50 risk of adverse impacts on tree growth or nutrition when the soil solution Ca/Al ratio is as low as 1.0, a 75% risk when the soil solution ratio is as low as 0.5, and nearly a 100% risk when the soil solution Ca/Al molar ratio is as low as 0.2. The Ca/Al ratio of the soil solution can be corroborated with other complementary indices.

  9. Calcium-aluminum-rich inclusions in the Allende meteorite - Evidence for a liquid origin

    NASA Technical Reports Server (NTRS)

    Blander, M.; Fuchs, L. H.

    1975-01-01

    We have made a detailed examination of the mineralogy, textures, and assemblages of six calcium-aluminum-rich inclusions (CAI) in the Allende meteorite. They can be classified into four types - hibonite-bearing, fassaite- and olivine-bearing, feldspathoid-bearing and fassaite-bearing CAI that are hibonite and olivine free. Examples of each type appear to have crystallized from a liquid rather than by agglomeration of solid nebular condensates. Some lines of evidence for a liquid origin are the presence of spherical and ovoid shapes and rims containing minerals that are more refractory than minerals inside the inclusion. Thermodynamic calculations and comparisons with liquidus phase diagrams indicate that the CAI could have been produced by direct condensation to metastable subcooled liquids that subsequently crystallized or by remelting of an equilibrium high-temperature condensate by impact. The diopside rims in some hibonite-bearing CAI and the paucity of metal in fassaite-olivine-bearing CAI are more consistent with direct condensation of a liquid.

  10. Optical behavior of Pr3+-doped barium titanate-calcium titanate material prepared by sol-gel method

    NASA Astrophysics Data System (ADS)

    Wang, Xiaoyan; Tang, Yanxue; He, Xiyun; Qiu, Pingsun; He, Qizhuang; Peng, Zifei; Sun, Dazhi

    2009-07-01

    Photoluminescence performances of Pr-doped alkaline-earth titanates (Ba,Ca)TiO3 (with rich barium) prepared by a solgel technique are investigated at room temperature. A relatively strong red luminescence is observed in (Ba0.80Ca0.20)TiO3 material when Pr-BaTiO3 material does not exhibit obvious red luminescence. The phenomenon is discussed with respect to the substitute of Ca and the two-photon luminescence effect. The red luminescence is enhanced by a fast thermal treatment. The wavelength range of luminescence near red and infrared light is broadened by the same process as well. These behaviors are ascribed to the randomization of distribution of Ca and Ba at A site in ABO3 perovskite structure. The experimental results provide not only a possible way to develop new materials with pastel visual impression, but also a potential technique to modify photoluminescence properties that can be controlled by external fields because the microscopic structure of BaTiO3, such as electric domains, can be changed by electric field, temperature, and so on.

  11. The formation of rims on calcium-aluminum-rich inclusions: Step I-Flash heating

    NASA Astrophysics Data System (ADS)

    Wark, David; Boynton, William V.

    2001-08-01

    Wark-Lovering rims of six calcium-aluminum-rich inclusions (CAIs) representing the main CAI types and groups in Allende, Efremovka and Vigarano were microsurgically separated and analysed by neutron activation analysis (NAA). All the rims have similar ~4x enrichments, relative to the interiors, of highly refractory lithophile and siderophile elements. The NAA results are confirmed by ion microprobe and scanning electron microscope (SEM) analyses of rim perovskites and rim metal grains. Less refractory Eu, Yb, V, Sr, Ca and Ni are less enriched in the rims. The refractory element patterns in the rims parallel the patterns in the outer parts of the CAIs. In particular, the rims on type B1 CAIs have the igneously fractionated rare earth element (REE) pattern of the melilite mantle below the rim and not the REE pattern of the bulk CAI, proving that the refractory elements in the rims were derived from the outer mantle and were not condensates onto the CAIs. The refractory elements were enriched in an Al2O3-rich residue <50 um thick after the most volatile ~80% of the outermost 200 um of each CAI had been volatilized, including much Mg, Si and Ca. Some volatilization occurred below the rim, and created refractory partial melts that crystallized hibonite and gehlenitic melilite. The required "flash heating" probably exceeded 2000 degrees C, but for only a few seconds, in order to melt only the outer CAI and to unselectively volatilize slow-diffusing O isotopes which show no mass fractionation in the rim. The volatilization did, however, produce "heavy" mass-fractionated Mg in rims. In some CAIs this was later obscured when "normal" Mg diffused in from accreted olivine grains at relatively high temperature (not the lower temperature meteorite metamorphism) and created the ~50 um set of monomineralic rim layers of pyroxene, melilite and spinel.

  12. Geochemical reactions and dynamics during titration of a contaminated groundwater with high uranium, aluminum, and calcium

    NASA Astrophysics Data System (ADS)

    Gu, Baohua; Brooks, Scott C.; Roh, Yul; Jardine, Philip M.

    2003-08-01

    This study investigated possible geochemical reactions during titration of a contaminated groundwater with a low pH but high concentrations of aluminum, calcium, magnesium, manganese, and trace contaminant metals/radionuclides such as uranium, technetium, nickel, and cobalt. Both Na-carbonate and hydroxide were used as titrants, and a geochemical equilibrium reaction path model was employed to predict aqueous species and mineral precipitation during titration. Although the model appeared to be adequate to describe the concentration profiles of some metal cations, solution pH, and mineral precipitates, it failed to describe the concentrations of U during titration and its precipitation. Most U (as uranyl, UO 22+) as well as Tc (as pertechnetate, TcO 4-) were found to be sorbed and coprecipitated with amorphous Al and Fe oxyhydroxides at pH below ˜5.5, but slow desorption or dissolution of U and Tc occurred at higher pH values when Na 2CO 3 was used as the titrant. In general, the precipitation of major cationic species followed the order of Fe(OH) 3 and/or FeCo 0.1(OH) 3.2, Al 4(OH) 10SO 4, MnCO 3, CaCO 3, conversion of Al 4(OH) 10SO 4 to Al(OH) 3,am, Mn(OH) 2, Mg(OH) 2, MgCO 3, and Ca(OH) 2. The formation of mixed or double hydroxide phases of Ni and Co with Al and Fe oxyhydroxides was thought to be responsible for the removal of Ni and Co in solution. Results of this study indicate that, although the hydrolysis and precipitation of a single cation are known, complex reactions such as sorption/desorption, coprecipitation of mixed mineral phases, and their dissolution could occur simultaneously. These processes as well as the kinetic constraints must be considered in the design of the remediation strategies and modeling to better predict the activities of various metal species and solid precipitates during pre- and post-groundwater treatment practices.

  13. Comparison of the adjuvant activity of aluminum hydroxide and calcium phosphate on the antibody response towards Bothrops asper snake venom.

    PubMed

    Olmedo, Hidekel; Herrera, María; Rojas, Leonardo; Villalta, Mauren; Vargas, Mariángela; Leiguez, Elbio; Teixeira, Catarina; Estrada, Ricardo; Gutiérrez, José María; León, Guillermo; Montero, Mavis L

    2014-01-01

    The adjuvanticity of aluminum hydroxide and calcium phosphate on the antibody response in mice towards the venom of the snake Bothrops asper was studied. It was found that, in vitro, most of the venom proteins are similarly adsorbed by both mineral salts, with the exception of some basic phospholipases A2, which are better adsorbed by calcium phosphate. After injection, the adjuvants promoted a slow release of the venom, as judged by the lack of acute toxicity when lethal doses of venom were administered to mice. Leukocyte recruitment induced by the venom was enhanced when it was adsorbed on both mineral salts; however, venom adsorbed on calcium phosphate induced a higher antibody response towards all tested HPLC fractions of the venom. On the other hand, co-precipitation of venom with calcium phosphate was the best strategy for increasing: (1) the capacity of the salt to couple venom proteins in vitro; (2) the venom ability to induce leukocyte recruitment; (3) phagocytosis by macrophages; and (4) a host antibody response. These findings suggest that the chemical nature is not the only one determining factor of the adjuvant activity of mineral salts. PMID:23506358

  14. Barium cyanide

    Integrated Risk Information System (IRIS)

    Barium cyanide ; CASRN 542 - 62 - 1 Human health assessment information on a chemical substance is included in the IRIS database only after a comprehensive review of toxicity data , as outlined in the IRIS assessment development process . Sections I ( Health Hazard Assessments for Noncarcinogenic Ef

  15. Calcium

    MedlinePlus

    ... of calcium dietary supplements are carbonate and citrate. Calcium carbonate is inexpensive, but is absorbed best when taken ... antacid products, such as Tums® and Rolaids®, contain calcium carbonate. Each pill or chew provides 200–400 mg ...

  16. Alleviating aluminum toxicity in an acid sulfate soil from Peninsular Malaysia by calcium silicate application

    NASA Astrophysics Data System (ADS)

    Elisa, A. A.; Ninomiya, S.; Shamshuddin, J.; Roslan, I.

    2016-03-01

    In response to human population increase, the utilization of acid sulfate soils for rice cultivation is one option for increasing production. The main problems associated with such soils are their low pH values and their associated high content of exchangeable Al, which could be detrimental to crop growth. The application of soil amendments is one approach for mitigating this problem, and calcium silicate is an alternative soil amendment that could be used. Therefore, the main objective of this study was to ameliorate soil acidity in rice-cropped soil. The secondary objective was to study the effects of calcium silicate amendment on soil acidity, exchangeable Al, exchangeable Ca, and Si content. The soil was treated with 0, 1, 2, and 3 Mg ha-1 of calcium silicate under submerged conditions and the soil treatments were sampled every 30 days throughout an incubation period of 120 days. Application of calcium silicate induced a positive effect on soil pH and exchangeable Al; soil pH increased from 2.9 (initial) to 3.5, while exchangeable Al was reduced from 4.26 (initial) to 0.82 cmolc kg-1. Furthermore, the exchangeable Ca and Si contents increased from 1.68 (initial) to 4.94 cmolc kg-1 and from 21.21 (initial) to 81.71 mg kg-1, respectively. Therefore, it was noted that calcium silicate was effective at alleviating Al toxicity in acid sulfate, rice-cropped soil, yielding values below the critical level of 2 cmolc kg-1. In addition, application of calcium silicate showed an ameliorative effect as it increased soil pH and supplied substantial amounts of Ca and Si.

  17. Calcium

    MedlinePlus

    ... body stores more than 99 percent of its calcium in the bones and teeth to help make and keep them ... in the foods you eat. Foods rich in calcium include Dairy products such as milk, cheese, and yogurt Leafy, green vegetables Fish with soft bones that you eat, such as canned sardines and ...

  18. Barium Depletion in Hollow Cathode Emitters

    NASA Technical Reports Server (NTRS)

    Polk, James E.; Capece, Angela M.; Mikellides, Ioannis G.; Katz, Ira

    2009-01-01

    The effect of tungsten erosion, transport and redeposition on the operation of dispenser hollow cathodes was investigated in detailed examinations of the discharge cathode inserts from an 8200 hour and a 30,352 hour ion engine wear test. Erosion and subsequent re-deposition of tungsten in the electron emission zone at the downstream end of the insert reduces the porosity of the tungsten matrix, preventing the ow of barium from the interior. This inhibits the interfacial reactions of the barium-calcium-aluminate impregnant with the tungsten in the pores. A numerical model of barium transport in the internal xenon discharge plasma shows that the barium required to reduce the work function in the emission zone can be supplied from upstream through the gas phase. Barium that flows out of the pores of the tungsten insert is rapidly ionized in the xenon discharge and pushed back to the emitter surface by the electric field and drag from the xenon ion flow. This barium ion flux is sufficient to maintain a barium surface coverage at the downstream end greater than 0.6, even if local barium production at that point is inhibited by tungsten deposits. The model also shows that the neutral barium pressure exceeds the equilibrium vapor pressure of the impregnant decomposition reaction over much of the insert length, so the reactions are suppressed. Only a small region upstream of the zone blocked by tungsten deposits is active and supplies the required barium. These results indicate that hollow cathode failure models based on barium depletion rates in vacuum dispenser cathodes are very conservative.

  19. Mechanism of action of barium ion on rat aortic smooth muscle.

    PubMed

    Hansen, T R; Dineen, D X; Petrak, R

    1984-03-01

    The mechanism of action of barium ion on the aortic smooth muscle of the normal rat was investigated using in vitro calcium-depleted aortic strips. Aortic strips were depleted of calcium by repeated exposure to norepinephrine in a calcium-free bathing solution. Although calcium depletion abrogated the response of strips to catecholamines and depolarizing agents, the response to barium chloride remained quantitatively intact. The calcium influx blocker D 600 prevented the contractile response to barium but not to catecholamines, whereas phentolamine prevented the response to catecholamines but not barium. The strip response to barium was depressed by a twofold increase in extracellular magnesium concentration whether the strip was intact or calcium depleted. Although increased concentrations of calcium in the extracellular medium inhibited the contractile response to potassium ion, increases in barium merely potentiated the potassium contracture. These findings indicate that barium produces its contractile effect on vascular smooth muscle by a direct intracellular interaction with the contractile or regulatory proteins. Barium enters these cells via calcium influx channels and is probably not sequestered in a physiologically releasable pool. Unlike calcium, barium does not stabilize the smooth muscle sarcolemma when present in high concentration. PMID:6703038

  20. Calcium

    MedlinePlus

    ... milligrams) of calcium each day. Get it from: Dairy products. Low-fat milk, yogurt, cheese, and cottage ... lactase that helps digest the sugar (lactose) in dairy products, and may have gas, bloating, cramps, or ...

  1. Development of calcium zirconate-based hydrogen sensors with oxide reference electrodes for molten aluminum

    NASA Astrophysics Data System (ADS)

    Krishnan, Vivek

    Hydrogen is a major cause of gas porosity in aluminum and is frequently removed from the melt prior to casting. The degassing process can be better controlled if the hydrogen content in the melt is known. Thus, gas sensors which can make continuous in situ measurements in molten aluminum are needed. Current online hydrogen sensing systems are complex designs which are prohibitively expensive. Solid electrolyte based potentiometric sensors have been developed as an attractive alternate. These sensors have traditionally used a gas phase as the reference electrode. The present design has a condensed-phase reference electrode to avoid the need for transport of the reference gas into and out of the melt. The use of an oxide rather than a hydride phase reference is expected to considerably lower device cost and improve shelf life and reliability. The sensor element consists of a solid electrolyte tube based on 10 mol% Indoped CaZrO3, which was synthesized using both solid oxide and oxalate co-precipitation techniques. Precursor oxalate powders prepared using polymeric surfactants (PEG) were characterized using SEM, XRD, FTIR and particle size analysis. PEG was found to reduce particle size and also influence the process of perovskite formation. The oxalate co-precipitation technique enabled powder synthesis at reduced processing time and temperature. Closed-one-end tubes were slip cast and densified for use as solid electrolytes. Impedance spectroscopy and D.C. resistance measurements were made at temperatures between 650 and 900°C. Undoped CaZrO3 was found to be a p-type conductor in air. Indoped CaZrO3 acted as a proton conductor in air and argon+H2O, whereas the material was found to be a p-type conductor in pure argon. While bulk conduction was found to be homogenous with activation energies matching those from D.C. measurements, conduction across the grain boundary was found to be heterogeneous. Potentiometric sensors using In-doped CaZrO3 as the electrolyte, and

  2. DEGRADATION OF SM2ZR2O7 THERMAL BARRIER COATING CAUSED BY CALCIUM-MAGNESIUM-ALUMINUM-SILICON OXIDE (CMAS) DEPOSITION

    SciTech Connect

    Wang, Honglong; Sheng, Zhizhi; Tarwater, Emily; Zhang, Xingxing; Dasgupta, Sudip; Fergus, Jeffrey

    2015-03-16

    Rare earth zirconates are promising materials for use as thermal barrier coatings in gas turbine engines. Among the lanthanide zirconate materials, Sm2Zr2O7 with the pyrochlore structure has lower thermal conductivity and better corrosion resistance against calcium-magnesium-aluminum-silicon oxide (CMAS). In this work, after reaction with CMAS, the pyrochlore structure transforms to the cubic fluorite structure and Ca2Sm8(SiO4)6O2 forms in elongated grain.

  3. Programmed Cell Death-Involved Aluminum Toxicity in Yeast Alleviated by Antiapoptotic Members with Decreased Calcium Signals1

    PubMed Central

    Zheng, Ke; Pan, Jian-Wei; Ye, Lan; Fu, Yu; Peng, Hua-Zheng; Wan, Bai-Yu; Gu, Qing; Bian, Hong-Wu; Han, Ning; Wang, Jun-Hui; Kang, Bo; Pan, Jun-Hang; Shao, Hong-Hong; Wang, Wen-Zhe; Zhu, Mu-Yuan

    2007-01-01

    The molecular mechanisms of aluminum (Al) toxicity and tolerance in plants have been the focus of ongoing research in the area of stress phytophysiology. Recent studies have described Al-induced apoptosis-like cell death in plant and animal cells. In this study, we show that yeast (Saccharomyces cerevisiae) exposed to low effective concentrations of Al for short times undergoes enhanced cell division in a manner that is dose and cell density dependent. At higher concentrations of Al or longer exposure times, Al induces cell death and growth inhibition. Several apoptotic features appear during Al treatment, including cell shrinkage, vacuolation, chromatin marginalization, nuclear fragmentation, DNA degradation, and DNA strand breaks, as well as concomitant cell aggregation. Yeast strains expressing Ced-9, Bcl-2, and PpBI-1 (a plant Bax inhibitor-1 isolated from Phyllostachys praecox), respectively, display more resistance to Al toxicity compared with control cells. Data from flow cytometric studies show these three antiapoptotic members do not affect reactive oxygen species levels, but decrease calcium ion (Ca2+) signals in response to Al stress, although both intracellular reactive oxygen species and Ca2+ levels were increased. The data presented suggest that manipulation of the negative regulation process of programmed cell death may provide a novel mechanism for conferring Al tolerance. PMID:16861572

  4. Calcium and aluminum cycling in a temperate broadleaved deciduous forest of the eastern USA: relative impacts of tree species, canopy state, and flux type.

    PubMed

    Levia, Delphis F; Shiklomanov, Alexey N; Van Stan, John T; Scheick, Carrie E; Inamdar, Shreeram P; Mitchell, Myron J; McHale, Patrick J

    2015-07-01

    Ca/Al molar ratios are commonly used to assess the extent of aluminum stress in forests. This is among the first studies to quantify Ca/Al molar ratios for stemflow. Ca/Al molar ratios in bulk precipitation, throughfall, stemflow, litter leachate, near-trunk soil solution, and soil water were quantified for a deciduous forest in northeastern MD, USA. Data were collected over a 3-year period. The Ca/Al molar ratios in this study were above the threshold for aluminum stress (<1). Fagus grandifolia Ehrh. (American beech) had a median annual stemflow Ca/Al molar ratio of 15.7, with the leafed and leafless values of 12.4 and 19.2, respectively. The corresponding Ca/Al molar ratios for Liriodendron tulipifera L. (yellow poplar) were 11.9 at the annual time scale and 11.9 and 13.6 for leafed and leafless periods, respectively. Bayesian statistical analysis showed no significant effect of canopy state (leafed, leafless) on Ca/Al molar ratios. DOC was consistently an important predictor of calcium, aluminum, and Ca/Al ratios. pH was occasionally an important predictor of calcium and aluminum concentrations, but was not a good predictor of Ca/Al ratio in any of the best-fit models (of >500 examined). This study supplies new data on Ca/Al molar ratios for stemflow from two common deciduous tree species. Future work should examine Ca/Al molar ratios in stemflow of other species and examine both inorganic and organic aluminum species to better gauge the potential for, and understand the dynamics of, aluminum toxicity in the proximal area around tree boles. PMID:26100445

  5. Calcium phosphate sol-gel-derived coatings on titanium-aluminum-vanadium substrate for biomedical applications

    NASA Astrophysics Data System (ADS)

    Gan, Lu

    Osseointegration of implants to host bone is a necessary requirement for dental and orthopaedic implants. The rate and quality of osseointegration were enhanced through the use of calcium phosphate (Ca-P) films on metallic substrates. The present study investigates the characteristics of Ca-P films applied using sol-gel dip coating methods to sintered porous-surfaced implants. Ca-P films have been formed using Inorganic Route and Organic Route processes. It has been shown that both approaches resulted in the formation of carbonated hydroxyapatite but with different Ca/P ratios as well as different surface textures and film structures, the Inorganic Route-formed film being more porous at its outermost surface, and having a more irregular topography. An interfacial reaction product (calcium titanium oxide) was detected for the Inorganic Route-formed coatings while this interfacial phase was not detectable in the Organic Route-formed coatings. The interface tensile and shear adhesion strength properties of Ca-P films have been evaluated using an improved direct pull-off testing (ASTM C633) and a substrate straining method, respectively. For both Ca-P films, the adhesive tensile strength was higher than the failure stress of ˜38 MPa occurring between the Ca-P films and the glue or in the glue. A shear lag approach revealed a shear strength of 347 +/- 64MPa and 280 +/- 28MPa for the Inorganic Route and the Organic Route Ca-P films, respectively. In vivo animal model studies have been performed to compare the effect on early bone formation of sintered porous-surfaced implants that had been modified through the addition of Ca-P film. In Group I study (i.e. Inorganic Route-formed Ca-P-coated implants vs. non-coated implants), it has been found that the Inorganic Route-formed Ca-P film significantly enhances the early rate of bone ingrowth for sintered porous-surfaced implants. However, in Group II study (i.e. Organic Route-formed Ca-P-coated implants vs. non

  6. BARIUM RECOVERY PROCESS

    DOEpatents

    Blanco, R.E.

    1959-07-21

    A method of separating barium from nuclear fission products is described. In accordance with the invention, barium may be recovered from an acidic solution of neutron-irradiated fissionable material by carrying ihe barium cut of solution as a sulfate with lead as a carrier and then dissolving the barium-containing precipitate in an aqueous solution of an aliphatic diamine chelating reagent. The barium values together with certain other metallic values present in the diamine solution are then absorbed onto a cation exchange resin and the barium is selectively eluted from the resin bed with concentrated nitric acid.

  7. Emission spectrographic determination of barium in sea water using a cation exchange concentration procedure

    USGS Publications Warehouse

    Szabo, B. J.; Joensuu, O.

    1967-01-01

    A concentration technique employing Dowex 50W cation exchange resin is described for the determination of barium in sea water. The separated barium is precipitated as fluoride together with calcium and strontium and measured by emission spectrographic analysis. The vertical distribution of barium in sea water has been measured in the Caribbean Sea and the Atlantic Ocean. The barium content varied between 7 and 23 ??g. per liter; in two profiles, the lowest concentrations were at a depth of about 1000 meters.

  8. Nanoparticles of barium induce apoptosis in human phagocytes

    PubMed Central

    Mores, Luana; França, Eduardo Luzia; Silva, Núbia Andrade; Suchara, Eliane Aparecida; Honorio-França, Adenilda Cristina

    2015-01-01

    Purpose Nutrients and immunological factors of breast milk are essential for newborn growth and the development of their immune system, but this secretion can contain organic and inorganic toxins such as barium. Colostrum contamination with barium is an important issue to investigate because this naturally occurring element is also associated with human activity and industrial pollution. The study evaluated the administration of barium nanoparticles to colostrum, assessing the viability and functional activity of colostral mononuclear phagocytes. Methods Colostrum was collected from 24 clinically healthy women (aged 18–35 years). Cell viability, superoxide release, intracellular Ca2+ release, and phagocyte apoptosis were analyzed in the samples. Results Treatment with barium lowered mononuclear phagocyte viability, increased superoxide release, and reduced intracellular calcium release. In addition, barium increased cell death by apoptosis. Conclusion These data suggest that nanoparticles of barium in colostrum are toxic to cells, showing the importance of avoiding exposure to this element. PMID:26451108

  9. Barium enema (image)

    MedlinePlus

    A barium enema is performed to examine the walls of the colon. During the procedure, a well lubricated enema tube is inserted gently into the rectum. The barium, a radiopaque (shows up on X-ray) contrast ...

  10. Oxygen isotope heterogeneities in the earliest protosolar gas recorded in a meteoritic calcium aluminum-rich inclusion

    NASA Astrophysics Data System (ADS)

    Aléon, Jérôme; El Goresy, Ahmed; Zinner, Ernst

    2007-11-01

    Combined petrologic, oxygen and magnesium isotopic and trace element analyses of a compound calcium-aluminum-rich inclusion (CAI) from the Efremovka reduced CV3 carbonaceous chondrite reveal that it consists of a Mg-rich, 16O-rich xenolithic CAI, previously altered in the nebula, that impacted an extensively molten, 16O-depleted, type A host CAI shortly before the end of the host's crystallization. Convoluted regions in the xenolith were probably formed by rapid crystallization of the partial melt produced during impact. Oxygen isotopic ratios in the host CAI are correlated both with melilite chemistry and location in the inclusion. The region immediately inside the Wark-Lovering rim of the CAI consists of 16O-rich gehlenite with Δ 17O ranging down to - 20‰ but melilite becomes progressively 16O-poor (Δ 17O ˜ 0‰) and Mg-rich towards the interior. In the absence of Mg isotopic fractionation, this variation is best attributed to O isotopic exchange between the nebular gas and the partially molten inclusion during its crystallization. This event lasted less than 200 h, which implies that the host CAI was transported between two nebular reservoirs with distinct O isotopic compositions during this time. Examination of possible transport mechanisms suggests that the transport occurred over a distance of less than 1 astronomical unit. The close-to-canonical 26Al/ 27Al ratio of 4.1 × 10 - 5 determined from both inclusions implies that at most 670,000 yr after the birth of the Solar System, the 16O-rich reservoir was spatially limited and an 16O-poor reservoir with typical planetary isotopic composition was available for planet formation.

  11. Growth of calcium-aluminum-rich inclusions by coagulation and fragmentation in a turbulent protoplanetary disk: Observations and simulations

    NASA Astrophysics Data System (ADS)

    Charnoz, Sébastien; Aléon, Jérôme; Chaumard, Noël; Baillié, Kévin; Taillifet, Esther

    2015-05-01

    Whereas it is generally accepted that calcium-aluminum-rich inclusions (CAIs) from chondritic meteorites formed in a hot environment in the solar protoplanetary disk, the conditions of their formation remain debated. Recent laboratory studies of CAIs have provided new kind of data: their size distributions. We report that size distributions of CAIs measured in laboratory from sections of carbonaceous chondrites have a power law size distribution with cumulative size exponent between -1.7 and -1.9, which translates into cumulative size exponent between -2.5 and -2.8 after correction for sectioning. To explain these observations, numerical simulations were run to explore the growth of CAIs from micrometer to centimeter sizes, in a hot and turbulent protoplanetary disk through the competition of coagulation and fragmentation. We show that the size distributions obtained in growth simulations are in agreement with CAIs size distributions in meteorites. We explain the CAI sharp cut-off of their size distribution at centimeter sizes as the direct result from the famous fragmentation barrier, provided that CAI fragment for impact velocities larger than 10 m/s. The growth/destruction timescales of millimeter- and centimeter-sized CAIs is inversely proportional to the local dust/gas ratio and is about 10 years at 1300 K and up to 104 years at 1670 K. This implies that the most refractory CAIs are expected to be smaller in size owing to their long growth timescale compared to less refractory CAIs. Conversely, the least refractory CAIs could have been recycled many times during the CAI production era which may have profound consequences for their radiometric age.

  12. Constraints on formation processes of two coarse-grained calcium- aluminum-rich inclusions: a study of mantles, islands and cores

    USGS Publications Warehouse

    Meeker, G.P.

    1995-01-01

    Many coarse-grained calcium- aluminum-rich inclusions (CAIs) contain features that are inconsistent with equilibrium liquid crystallization models of origin. Spinel-free islands (SFIs) in spinel-rich cores of Type B CAIs are examples of such features. One model previously proposed for the origin of Allende 5241, a Type B1 CAI containing SFIs, involves the capture and assimilation of xenoliths by a liquid droplet in the solar nebula (El Goresy et al, 1985; MacPherson et al 1989). This study reports new textural and chemical zoning data from 5241 and identifies previously unrecognized chemical zoning patterns in the melilite mantle and in a SFI. -from Author

  13. Barium release system

    NASA Technical Reports Server (NTRS)

    Lewis, B. W.; Stokes, C. S.; Smith, E. W.; Murphy, W. J. (Inventor)

    1973-01-01

    A chemical system is described for releasing a good yield of free barium neutral atoms and barium ions in the upper atmosphere and interplanetary space for the study of the geophysical properties of the medium. The barium is released in the vapor phase so that it can be ionized by solar radiation and also be excited to emit resonance radiation in the visible range. The ionized luminous cloud of barium becomes a visible indication of magnetic and electrical characteristics in space and allows determination of these properties over relatively large areas at a given time.

  14. Acid precipitation and food quality: Inhibition of growth and survival in black ducks and mallards by dietary aluminum, calcium and phosphorus

    USGS Publications Warehouse

    Robbins, C.S.

    1990-01-01

    In areas impacted by acid precipitation, water chemistry of acidic ponds and streams often changes, resulting in increased mobilization of aluminum and decreased concentration of calcium carbonate. Aluminum binds with phosphorus and inhibits its uptake by organisms. Thus, invertebrate food organisms used by waterfowl may have inadequate Ca and P or elevated Al for normal growth and development. Acid rain and its effects may be one of the factors negatively impacting American black ducks (Anas rubripes) in eastern North America. One-day old mallards (A. platyrhynchos) and black ducks were placed on one of three Ca:P regimens: low:low (LL), normal:normal (NN), and low:high (LH) with each regimen divided further into three or four Al levels for 10 weeks. Forty-five % of the black ducks died on nine different diets whereas only 28% of the mallards died on three different diets. Mortality was significantly related to diet in both species. Growth rates for body weight, culmens, wings, and tarsi of both species on control diets exceeded those on many treatment diets but the differences were less apparent for mallards than for black ducks. Differences among treatments were due to both Ca:P and Al levels.

  15. Final report on the safety assessment of aluminum silicate, calcium silicate, magnesium aluminum silicate, magnesium silicate, magnesium trisilicate, sodium magnesium silicate, zirconium silicate, attapulgite, bentonite, Fuller's earth, hectorite, kaolin, lithium magnesium silicate, lithium magnesium sodium silicate, montmorillonite, pyrophyllite, and zeolite.

    PubMed

    Elmore, Amy R

    2003-01-01

    This report reviews the safety of Aluminum, Calcium, Lithium Magnesium, Lithium Magnesium Sodium, Magnesium Aluminum, Magnesium, Sodium Magnesium, and Zirconium Silicates, Magnesium Trisilicate, Attapulgite, Bentonite, Fuller's Earth, Hectorite, Kaolin, Montmorillonite, Pyrophyllite, and Zeolite as used in cosmetic formulations. The common aspect of all these claylike ingredients is that they contain silicon, oxygen, and one or more metals. Many silicates occur naturally and are mined; yet others are produced synthetically. Typical cosmetic uses of silicates include abrasive, opacifying agent, viscosity-increasing agent, anticaking agent, emulsion stabilizer, binder, and suspending agent. Clay silicates (silicates containing water in their structure) primarily function as adsorbents, opacifiers, and viscosity-increasing agents. Pyrophyllite is also used as a colorant. The International Agency for Research on Cancer has ruled Attapulgite fibers >5 microm as possibly carcinogenic to humans, but fibers <5 microm were not classified as to their carcinogenicity to humans. Likewise, Clinoptilolite, Phillipsite, Mordenite, Nonfibrous Japanese Zeolite, and synthetic Zeolites were not classified as to their carcinogenicity to humans. These ingredients are not significantly toxic in oral acute or short-term oral or parenteral toxicity studies in animals. Inhalation toxicity, however, is readily demonstrated in animals. Particle size, fibrogenicity, concentration, and mineral composition had the greatest effect on toxicity. Larger particle size and longer and wider fibers cause more adverse effects. Magnesium Aluminum Silicate was a weak primary skin irritant in rabbits and had no cumulative skin irritation in guinea pigs. No gross effects were reported in any of these studies. Sodium Magnesium Silicate had no primary skin irritation in rabbits and had no cumulative skin irritation in guinea pigs. Hectorite was nonirritating to the skin of rabbits in a Draize primary skin

  16. Observed Barium Emission Rates

    NASA Technical Reports Server (NTRS)

    Stenbaek-Nielsen, H. C.; Wescott, E. M.; Hallinan, T. J.

    1993-01-01

    The barium releases from the CRRES satellite have provided an opportunity for verifying theoretically calculated barium ion and neutral emission rates. Spectra of the five Caribbean releases in the summer of 1991 were taken with a spectrograph on board a U.S. Air Force jet aircraft. Because the line of sight release densities are not known, only relative rates could be obtained. The observed relative rates agree well with the theoretically calculated rates and, together with other observations, confirm the earlier detailed theoretical emission rates. The calculated emission rates can thus with good accuracy be used with photometric observations. It has been postulated that charge exchange between neutral barium and oxygen ions represents a significant source for ionization. If so. it should be associated with emissions at 4957.15 A and 5013.00 A, but these emissions were not detected.

  17. Aspiration of Barium Contrast

    PubMed Central

    Fuentes Santos, Cristina; Steen, Bárbara

    2014-01-01

    The aspiration of barium contrast is a rare complication that may occur during studies of the digestive tract. Barium is an inert material that can cause anywhere from an asymptomatic mechanical obstruction to serious symptoms of respiratory distress that can result in patient death. We present the case of a 79-year-old male patient in whom we observed the presence of contrast medium residue in the lung parenchyma as an incidental finding during hospitalization. When the patient's medical file was reviewed, images were found of a barium swallow study that the patient had undergone months earlier, and we were able to observe the exact moment of the aspiration of the contrast material. The patient had been asymptomatic since the test. PMID:25309769

  18. Refinement of the crystal structure of calcium-lithium-aluminum tourmaline from the pegmatite vein in the Sangilen Upland (Tuva Republic)

    SciTech Connect

    Rozhdestvenskaya, I. V. Bronzova, Yu. M.; Frank-Kamenetskaya, O. V.; Zolotarev, A. A.; Kuznetsova, L. G.; Bannova, I. I.

    2008-03-15

    The crystal structure of a natural calcium-lithium-aluminum tourmaline, which has the unique composition (Ca{sub 0.62}Na{sub 0.32}{open_square}{sub 0.06})(Al{sub 1.08}Li{sub 0.99}Fe{sub 0.66}{sup 2+} Mg{sub 0.24}Ti{sub 0.03})Al{sub 6}[Si{sub 6}O{sub 18}](BO{sub 3}){sub 3}(OH{sub 2.28}O{sub 0.72}) {center_dot} (F{sub 0.84}O{sub 0.16}), is refined (R = 0.019, R{sub w} = 0.022, S = 1.47). It is found that the O(1)(W) site is split into two sites, O(1) and O(11), which are incompletely occupied by fluorine and oxygen anions, respectively, and that the O(3)(V) site contains bivalent oxygen anions. The solid solution studied is close in composition to the liddicoatite mineral species and differs from the latter one by the Li: Al ratio in the Y octahedra and the presence of bivalent oxygen anions in the O(3) site. The tourmaline studied differs from the hypothetical oxyliddicoatite by the population of the O(1)(W) site by fluorine and accommodation of additional oxygen anions in the O(3)(V) site.

  19. Refinement of the crystal structure of calcium-lithium-aluminum tourmaline from the pegmatite vein in the Sangilen Upland (Tuva Republic)

    SciTech Connect

    Rozhdestvenskaya, I. V. Bronzova, Yu. M.; Frank-Kamenetskaya, O. V.; Zolotarev, A. A.; Kuznetsova, L. G.; Bannova, I. I.

    2008-03-15

    The crystal structure of a natural calcium-lithium-aluminum tourmaline, which has the unique composition (Ca{sub 0.62}Na{sub 0.32}{open_square}{sub 0.06})(Al{sub 1.08}Li{sub 0.99}Fe{sub 0.66}{sup 2+} Mg{sub 0.24}Ti{sub 0.03})Al{sub 6}[Si{sub 6}O{sub 18}](BO{sub 3}){sub 3}(OH{sub 2.28}O{sub 0.72}) . (F{sub 0.84}O{sub 0.16}), is refined (R = 0.019, R{sub w} = 0.022, S = 1.47). It is found that the O(1)(W) site is split into two sites, O(1) and O(11), which are incompletely occupied by fluorine and oxygen anions, respectively, and that the O(3)(V) site contains bivalent oxygen anions. The solid solution studied is close in composition to the liddicoatite mineral species and differs from the latter one by the Li: Al ratio in the Y octahedra and the presence of bivalent oxygen anions in the O(3) site. The tourmaline studied differs from the hypothetical oxyliddicoatite by the population of the O(1)(W) site by fluorine and accommodation of additional oxygen anions in the O(3)(V) site.

  20. AN ALUMINUM/CALCIUM-RICH, IRON-POOR, WHITE DWARF STAR: EVIDENCE FOR AN EXTRASOLAR PLANETARY LITHOSPHERE?

    SciTech Connect

    Zuckerman, B.; Klein, B.; Jura, M.; Koester, D.; Dufour, P.; Melis, Carl

    2011-10-01

    The presence of elements heavier than helium in white dwarf atmospheres is often a signpost for the existence of rocky objects that currently or previously orbited these stars. We have measured the abundances of various elements in the hydrogen-atmosphere white dwarfs G149-28 and NLTT 43806. In comparison with other white dwarfs with atmospheres polluted by heavy elements, NLTT 43806 is substantially enriched in aluminum but relatively poor in iron. We compare the relative abundances of Al and eight other heavy elements seen in NLTT 43806 with the elemental composition of bulk Earth, with simulated extrasolar rocky planets, with solar system meteorites, with the atmospheric compositions of other polluted white dwarfs, and with the outer layers of the Moon and Earth. The best agreement is found with a model that involves accretion of a mixture of terrestrial crust and upper mantle material onto NLTT 43806. The implication is that NLTT 43806 is orbited by a differentiated rocky planet, perhaps quite similar to Earth, that has suffered a collision that stripped away some of its outer layers.

  1. Barium and Compounds

    Integrated Risk Information System (IRIS)

    Barium and Compounds ; CASRN 7440 - 39 - 3 Human health assessment information on a chemical substance is included in the IRIS database only after a comprehensive review of toxicity data , as outlined in the IRIS assessment development process . Sections I ( Health Hazard Assessments for Noncarcinog

  2. Ultra-low temperature processing of barium tellurate dielectrics

    NASA Astrophysics Data System (ADS)

    Kwon, Do-Kyun

    Ceramics, metals and polymers have unique electrical properties that are combined for electronic devices and systems. It necessitates lower processing temperatures for ceramics to be compatible with metal and polymer systems. In this thesis, the synthesis, crystal structure, and dielectric properties of barium tellurate are studied for temperatures between 500 and 900°C. Barium tellurate dielectric ceramics (BaTe4O9, BaTe 2O5, BaTe2O6, BaTeO3, BaTeO 4, and Ba2TeO5) are extensively investigated as new LTCC (Low-Temperature Cofired Ceramics) dielectric systems integrated with low resistivity metal electrodes such as silver and aluminum for microwave application. Studies on the phase formation and crystal structure through thermal analyses (Differential Scanning Calorimetry and Thermogravimetric Analysis, DSC-TGA) and X-ray diffraction phase analysis attest that barium tellurates are formed in the temperature range of 500 ˜ 900°C, through the sequential phase formations from Te-rich to Ba-rich phases. The oxygen coordination of the tellurium ion progresses from TeO4 to TeO6 via TeO 3+1 and TeO3 with increasing barium content as confirmed by structural analysis using infrared spectroscopy. High density barium tellurate ceramics are achieved at temperatures as low as 550°C, which provides the potential to be co-fired with low-melting aluminum metal electrodes in LTCC processing. Dielectric permittivity, loss, and temperature stability of barium tellurate dielectric ceramics were measured from 100 Hz to 13 GHz. Barium tellurate ceramics exhibit excellent microwave dielectric properties with intermediate dielectric permittivities and high quality factors (Q). The dielectric properties at microwave frequencies are epsilonr = 17.5, Qxf = 54700 GHz, TCf = -90 ppm/°C for BaTe4O9, epsilonr = 21, Qxf = 50300 GHz, TCf = -51 ppm/°C for BaTe2O6, epsilonr = 10, Qxf = 34000 GHz, TCf = -54 ppm/°C for BaTeO3, and epsilonr = 17, Qx f = 49600 GHz, TCf = -124 ppm/°C for Ba 2TeO5

  3. Factors controlling soil water and stream water aluminum concentrations after a clearcut in a forested watershed with calcium-poor soils

    USGS Publications Warehouse

    McHale, M.R.; Burns, Douglas A.; Lawrence, G.B.; Murdoch, Peter S.

    2007-01-01

    The 24 ha Dry Creek watershed in the Catskill Mountains of southeastern New York State USA was clearcut during the winter of 1996-1997. The interactions among acidity, nitrate (NO3- ), aluminum (Al), and calcium (Ca2+) in streamwater, soil water, and groundwater were evaluated to determine how they affected the speciation, solubility, and concentrations of Al after the harvest. Watershed soils were characterized by low base saturation, high exchangeable Al concentrations, and low exchangeable base cation concentrations prior to the harvest. Mean streamwater NO3- concentration was about 20 ??mol l-1 for the 3 years before the harvest, increased sharply after the harvest, and peaked at 1,309 ??mol l -1 about 5 months after the harvest. Nitrate and inorganic monomeric aluminum (Alim) export increased by 4-fold during the first year after the harvest. Alim mobilization is of concern because it is toxic to some fish species and can inhibit the uptake of Ca2+ by tree roots. Organic complexation appeared to control Al solubility in the O horizon while ion exchange and possibly equilibrium with imogolite appeared to control Al solubility in the B horizon. Alim and NO3- concentrations were strongly correlated in B-horizon soil water after the clearcut (r2 = 0.96), especially at NO3- concentrations greater than 100 ??mol l-1. Groundwater entering the stream from perennial springs contained high concentrations of base cations and low concentrations of NO3- which mixed with acidic, high Alim soil water and decreased the concentration of Alim in streamwater after the harvest. Five years after the harvest soil water NO 3- concentrations had dropped below preharvest levels as the demand for nitrogen by regenerating vegetation increased, but groundwater NO3- concentrations remained elevated because groundwater has a longer residence time. As a result streamwater NO3- concentrations had not fallen below preharvest levels, even during the growing season, 5 years after the harvest

  4. A CRITICAL EXAMINATION OF THE X-WIND MODEL FOR CHONDRULE AND CALCIUM-RICH, ALUMINUM-RICH INCLUSION FORMATION AND RADIONUCLIDE PRODUCTION

    SciTech Connect

    Desch, S. J.; Morris, M. A.; Connolly, H. C.; Boss, Alan P.

    2010-12-10

    Meteoritic data, especially regarding chondrules and calcium-rich, aluminum-rich inclusions (CAIs), and isotopic evidence for short-lived radionuclides (SLRs) in the solar nebula, potentially can constrain how planetary systems form. Interpretation of these data demands an astrophysical model, and the 'X-wind' model of Shu et al. and collaborators has been advanced to explain the origin of chondrules, CAIs, and SLRs. It posits that chondrules and CAIs were thermally processed <0.1 AU from the protostar, then flung by a magnetocentrifugal outflow to the 2-3 AU region to be incorporated into chondrites. Here we critically examine key assumptions and predictions of the X-wind model. We find a number of internal inconsistencies: theory and observation show no solid material exists at 0.1 AU; particles at 0.1 AU cannot escape being accreted into the star; particles at 0.1 AU will collide at speeds high enough to destroy them; thermal sputtering will prevent growth of particles; and launching of particles in magnetocentrifugal outflows is not modeled, and may not be possible. We also identify a number of incorrect predictions of the X-wind model: the oxygen fugacity where CAIs form is orders of magnitude too oxidizing, chondrule cooling rates are orders of magnitude lower than those experienced by barred olivine chondrules, chondrule-matrix complementarity is not predicted, and the SLRs are not produced in their observed proportions. We conclude that the X-wind model is not relevant to chondrule and CAI formation and SLR production. We discuss more plausible models for chondrule and CAI formation and SLR production.

  5. Setting process of lime-based conservation mortars with barium hydroxide

    SciTech Connect

    Karatasios, Ioannis . E-mail: ikarat@ims.demokritos.gr; Kilikoglou, Vassilis; Colston, Belinda; Theoulakis, Panagiotis; Watt, David

    2007-06-15

    This paper presents the effect of barium hydroxide on the setting mechanism of lime-based conservation mortars, when used as an additive material. The study focuses on the monitoring of the setting process and the identification of the mineral phases formed, which are essential for furthering the study of the durability of barium mixtures against chemical degradation. X-ray diffraction analysis (XRD), scanning electron microscopy (SEM) and thermal analysis (DTA-TG) were used to monitor the setting processes of these mixtures and identify new phases formed. The results suggest that barium hydroxide is evenly distributed within the lime and produces a homogeneous binding material, consisting of calcite (CaCO{sub 3}), witherite (BaCO{sub 3}) and barium-calcium carbonate [BaCa(CO{sub 3}){sub 2}]. Finally, it was found that barium carbonate can be directly bonded to calcitic aggregates and therefore increases its chemical compatibility with the binding material.

  6. Barium Peritonitis in Small Animals

    PubMed Central

    KO, Jae Jin; MANN, F. A. (Tony)

    2014-01-01

    ABSTRACT Barium peritonitis is extremely rare, but is difficult to treat and may be life-threatening. Barium suspension leakage from the gastrointestinal tract into the abdominal cavity has a time-dependent and synergistically deleterious effect in patients who have generalized bacterial peritonitis. The severity of barium peritonitis is dependent on the quantity of barium in the abdominal cavity. Barium sulfate leakage results in hypovolemia and hypoproteinemia by worsening the exudation of extracellular fluid and albumin. Abdominal fluid analysis is a useful and efficient method to diagnose barium peritonitis. Serial radiographs may not be a reliable or timely diagnostic technique. Initial aggressive fluid resuscitation and empirical broad-spectrum antibiotic treatment should be instituted promptly, followed quickly by celiotomy. During exploratory surgical intervention, copious irrigation and direct wiping with gauze are employed to remove as much barium as possible. Omentectomy should be considered when needed to expedite barium removal. Despite aggressive medical and surgical treatments, postoperative prognosis is guarded to poor due to complications, such as acute vascular shock, sepsis, diffuse peritonitis, hypoproteninemia, electrolyte imbalance, cardiac arrest, small bowel obstruction related to progression of granulomas and adhesions in the abdominal cavity. Therefore, intensive postoperative monitoring and prompt intervention are necessary to maximize chances for a positive outcome. For those that do survive, small bowel obstruction is a potential consequence due to progression of abdominal adhesions. PMID:24430662

  7. Barium uranyl diphosphonates

    SciTech Connect

    Nelson, Anna-Gay D.; Alekseev, Evgeny V.; Ewing, Rodney C.; Albrecht-Schmitt, Thomas E.

    2012-08-15

    Three Ba{sup 2+}/UO{sub 2}{sup 2+} methylenediphosphonates have been prepared from mild hydrothermal treatment of uranium trioxide, methylendiphosphonic acid (C1P2) with barium hydroxide octahydrate, barium iodate monohydrate, and small aliquots of HF at 200 Degree-Sign C. These compounds, Ba[UO{sub 2}[CH{sub 2}(PO{sub 3}){sub 2}]{center_dot}1.4H{sub 2}O (Ba-1), Ba{sub 3}[(UO{sub 2}){sub 4}(CH{sub 2}(PO{sub 3}){sub 2}){sub 2}F{sub 6}]{center_dot}6H{sub 2}O (Ba-2), and Ba{sub 2}[(UO{sub 2}){sub 2}(CH{sub 2}(PO{sub 3}){sub 2})F{sub 4}]{center_dot}5.75H{sub 2}O (Ba-3) all adopt layered structures based upon linear uranyl groups and disphosphonate molecules. Ba-2 and Ba-3 are similar in that they both have UO{sub 5}F{sub 2} pentagonal bipyramids that are bridged and chelated by the diphosphonate moiety into a two-dimensional zigzag anionic sheet (Ba-2) and a one-dimensional ribbon anionic chain (Ba-3). Ba-1, has a single crystallographically unique uranium metal center where the C1P2 ligand solely bridges to form [UO{sub 2}[CH{sub 2}(PO{sub 3}){sub 2}]{sup 2-} sheets. The interlayer space of the structures is occupied by Ba{sup 2+}, which, along with the fluoride ion, mediates the structure formed and maintains overall charge balance. - Graphical abstract: Illustration of the stacking of the layers in Ba{sub 3}[(UO{sub 2}){sub 4}(CH{sub 2}(PO{sub 3}){sub 2}){sub 2})F{sub 6}]{center_dot}6H{sub 2}O viewed along the c-axis. The structure is constructed from UO{sub 7} pentagonal bipyramidal units, U(1)O{sub 7}=gray, U(2)O{sub 7}=yellow, barium=blue, phosphorus=magenta, fluorine=green, oxygen=red, carbon=black, and hydrogen=light peach. Highlights: Black-Right-Pointing-Pointer The polymerization of the UO{sub 2}{sup 2+} sites to form uranyl dimers leads to structural variations in compounds. Black-Right-Pointing-Pointer Barium cations stitch uranyl diphosphonate anionic layers together, and help mediate structure formation. Black-Right-Pointing-Pointer HF acts as both a

  8. Tungsten and barium transport in the internal plasma of hollow cathodes

    NASA Astrophysics Data System (ADS)

    Polk, James E.; Mikellides, Ioannis G.; Katz, Ira; Capece, Angela M.

    2009-06-01

    The effect of tungsten erosion, transport, and redeposition on the operation of dispenser hollow cathodes was investigated in detailed examinations of the discharge cathode inserts from 8200 h and 30 352 h ion engine wear tests. Erosion and subsequent redeposition of tungsten in the electron emission zone at the downstream end of the insert reduce the porosity of the tungsten matrix, preventing the flow of barium from the interior. This inhibits the interfacial reactions of the barium-calcium-aluminate impregnant with the tungsten in the pores. A numerical model of barium transport in the internal xenon discharge plasma shows that the barium required to reduce the work function in the emission zone can be supplied from upstream through the gas phase. Barium that flows out of the pores of the tungsten insert is rapidly ionized in the xenon discharge and pushed back to the emitter surface by the electric field and drag from the xenon ion flow. This barium ion flux is sufficient to maintain a barium surface coverage at the downstream end greater than 0.6, even if local barium production at that point is inhibited by tungsten deposits. The model also shows that the neutral barium pressure exceeds the equilibrium vapor pressure of the impregnant decomposition reaction over much of the insert length, so the reactions are suppressed. Only a small region upstream of the zone blocked by tungsten deposits is active and supplies the required barium. These results indicate that hollow cathode failure models based on barium depletion rates in vacuum dispenser cathodes are very conservative.

  9. Silico-ferrite of Calcium and Aluminum (SFCA) Iron Ore Sinter Bonding Phases: New Insights into Their Formation During Heating and Cooling

    NASA Astrophysics Data System (ADS)

    Webster, Nathan A. S.; Pownceby, Mark I.; Madsen, Ian C.; Kimpton, Justin A.

    2012-12-01

    The formation of silico-ferrite of calcium and aluminum (SFCA) and SFCA-I iron ore sinter phases during heating and cooling of synthetic iron ore sinter mixtures in the range 298 K to 1623 K (25 °C to 1350 °C) and at oxygen partial pressure of 5 × 10-3 atm has been characterized using in situ synchrotron X-ray diffraction. SFCA and SFCA-I are the key bonding phases in iron ore sinter, and an improved understanding of their formation mechanisms may lead to improved efficiency of industrial sintering processes. During heating, SFCA-I formation at 1327 K to 1392 K (1054 °C to 1119 °C) (depending on composition) was associated with the reaction of Fe2O3, 2CaO·Fe2O3, and SiO2. SFCA formation (1380 K to 1437 K [1107 °C to 1164 °C]) was associated with the reaction of CaO·Fe2O3, SiO2, and a phase with average composition 49.60, 9.09, 0.14, 7.93, and 32.15 wt pct Fe, Ca, Si, Al, and O, respectively. Increasing Al2O3 concentration in the starting sinter mixture increased the temperature range over which SFCA-I was stable before the formation of SFCA, and it stabilized SFCA to a higher temperature before it melted to form a Fe3O4 + melt phase assemblage (1486 K to 1581 K [1213 °C to 1308 °C]). During cooling, the first phase to crystallize from the melt (1452 K to 1561 K [1179 °C to 1288 °C]) was an Fe-rich phase, similar in composition to SFCA-I, and it had an average composition 58.88, 6.89, 0.82, 3.00, and 31.68 wt pct Fe, Ca, Si, Al, and O, respectively. At lower temperatures (1418 K to 1543 K [1145 °C to 1270 °C]), this phase reacted with melt to form SFCA. Increasing Al2O3 increased the temperature at which crystallization of the Fe-rich phase occurred, increased the temperature at which crystallization of SFCA occurred, and suppressed the formation of Fe2O3 (1358 K to 1418 K [1085 °C to 1145 °C]) to lower temperatures.

  10. Barium uranyl diphosphonates

    NASA Astrophysics Data System (ADS)

    Nelson, Anna-Gay D.; Alekseev, Evgeny V.; Ewing, Rodney C.; Albrecht-Schmitt, Thomas E.

    2012-08-01

    Three Ba2+/UO22+ methylenediphosphonates have been prepared from mild hydrothermal treatment of uranium trioxide, methylendiphosphonic acid (C1P2) with barium hydroxide octahydrate, barium iodate monohydrate, and small aliquots of HF at 200 °C. These compounds, Ba[UO2[CH2(PO3)2]·1.4H2O (Ba-1), Ba3[(UO2)4(CH2(PO3)2)2F6]·6H2O (Ba-2), and Ba2[(UO2)2(CH2(PO3)2)F4]·5.75H2O (Ba-3) all adopt layered structures based upon linear uranyl groups and disphosphonate molecules. Ba-2 and Ba-3 are similar in that they both have UO5F2 pentagonal bipyramids that are bridged and chelated by the diphosphonate moiety into a two-dimensional zigzag anionic sheet (Ba-2) and a one-dimensional ribbon anionic chain (Ba-3). Ba-1, has a single crystallographically unique uranium metal center where the C1P2 ligand solely bridges to form [UO2[CH2(PO3)2]2- sheets. The interlayer space of the structures is occupied by Ba2+, which, along with the fluoride ion, mediates the structure formed and maintains overall charge balance.

  11. An Improved Qualitative Analysis Procedure for Aluminum Subgroup Cations.

    ERIC Educational Resources Information Center

    Kistner, C. R.; Robinson, Patricia J.

    1983-01-01

    Describes a procedure for the qualitative analysis of aluminum subgroup cations designed to avoid failure to obtain lead or barium chromate precipitates or failure to report aluminum hydroxide when present (due to staining). Provides a flow chart and step-by-step explanation for the new procedure, indicating significantly improved student results.…

  12. On Barium Oxide Solubility in Barium-Containing Chloride Melts

    NASA Astrophysics Data System (ADS)

    Nikolaeva, Elena V.; Zakiryanova, Irina D.; Bovet, Andrey L.; Korzun, Iraida V.

    2016-08-01

    Oxide solubility in chloride melts depends on temperature and composition of molten solvent. The solubility of barium oxide in the solvents with barium chloride content is essentially higher than that in molten alkali chlorides. Spectral data demonstrate the existence of oxychloride ionic groupings in such melts. This work presents the results of the BaO solubility in two molten BaCl2-NaCl systems with different barium chloride content. The received data together with earlier published results revealed the main regularities of BaO solubility in molten BaO-BaCl2-MCl systems.

  13. Calcium and olfactory transduction.

    PubMed

    Winegar, B D; Rosick, E R; Schafer, R

    1988-01-01

    1. Inorganic cations, organic calcium antagonists, and calmodulin antagonists were applied to olfactory epithelia of frogs (Rana pipiens) while recording electroolfactogram (EOG) responses. 2. Inorganic cations inhibited EOGs in a rank order, reflecting their calcium channel blocking potency: La3+ greater than Zn2+ greater than Cd2+ greater than Al3+ greater than Ca2+ greater than Sr2+ greater than Co2+ greater than Ba2+ greater than Mg2+. Barium ion significantly enhanced EOGs immediately following application. 3. Diltiazem and verapamil produced dose-dependent EOG inhibition. 4. Calmodulin antagonists inhibited EOGs without correlation to their anti-calmodulin potency. PMID:2904344

  14. Fluorescent lighting with aluminum nitride phosphors

    DOEpatents

    Cherepy, Nerine J.; Payne, Stephen A.; Seeley, Zachary M.; Srivastava, Alok M.

    2016-05-10

    A fluorescent lamp includes a glass envelope; at least two electrodes connected to the glass envelope; mercury vapor and an inert gas within the glass envelope; and a phosphor within the glass envelope, wherein the phosphor blend includes aluminum nitride. The phosphor may be a wurtzite (hexagonal) crystalline structure Al.sub.(1-x)M.sub.xN phosphor, where M may be drawn from beryllium, magnesium, calcium, strontium, barium, zinc, scandium, yttrium, lanthanum, cerium, praseodymium, europium, gadolinium, terbium, ytterbium, bismuth, manganese, silicon, germanium, tin, boron, or gallium is synthesized to include dopants to control its luminescence under ultraviolet excitation. The disclosed Al.sub.(1-x)M.sub.xN:Mn phosphor provides bright orange-red emission, comparable in efficiency and spectrum to that of the standard orange-red phosphor used in fluorescent lighting, Y.sub.2O.sub.3:Eu. Furthermore, it offers excellent lumen maintenance in a fluorescent lamp, and does not utilize "critical rare earths," minimizing sensitivity to fluctuating market prices for the rare earth elements.

  15. In situ cross-linking of sodium alginate with calcium and aluminum ions to sustain the release of theophylline from polymeric matrices.

    PubMed

    Nokhodchi, Ali; Tailor, Anish

    2004-12-01

    Small matrices of calcium alginate or aluminium alginate have been investigated as possible controlled release systems for drugs. The objective of the present study was to sustain the release of theophylline from alginate matrices using different concentrations of aluminium chloride and calcium chloride in presence and absence of HPMC. Tablets containing differing concentrations of aluminium and calcium chloride were produced and the release rate of theophylline was tested using the basket dissolution apparatus over 8 h. Increasing amounts of aluminium chloride from 0.0001 to 0.00068 moles decreased the release of theophylline from 95.1 +/- 0.27 to 29.5 +/- 1.5, indicating a significant effect of aluminium ions on a reduction in the release rate of theophylline from sodium alginate matrices. In the case of matrices containing different concentrations of calcium ions, as the concentration of calcium chloride increased, the release rate increased to an optimum then declined after this. This was due to insufficient calcium ions being available to cross-link with the sodium alginate to form an insoluble gel. The effect of aluminium ions, as this is a trivalent ion compared to calcium, which is a divalent ion, aluminium ions are able to decrease the release rate with a smaller concentration compared to calcium ions. The results also showed that the presence of HPMC caused a reduction in release rate of theophylline from alginate matrices containing calcium chloride. Whereas, in the case of alginate matrices containing aluminium chloride the release rate of theophylline increased in presence of HPMC. For comparing the dissolution data, dissolution efficiency (DE) was used. The values of DE are consistent with the dissolution data. The results show that within a formulation series, DE values generally decrease when the cation concentration increases and this criterion can be used to describe the effect of calcium and aluminium ions on the release behaviour of theophylline

  16. Tungsten and Barium Transport in the Internal Plasma of Hollow Cathodes

    NASA Technical Reports Server (NTRS)

    Polk, James E.; Mikellides, Ioannis G.; Katz, Ira; Capece, Angela M.

    2008-01-01

    The effect of tungsten erosion, transport and redeposition on the operation of dispenser hollow cathodes was investigated in detailed examinations of the discharge cathode inserts from an 8200 hour and a 30,352 hour ion engine wear test. Erosion and subsequent re-deposition of tungsten in the electron emission zone at the downstream end of the insert reduces the porosity of the tungsten matrix, preventing the flow of barium from the interior. This inhibits the interfacial reactions of the barium-calcium-aluminate impregnant with the tungsten in the pores. A numerical model of barium transport in the internal xenon discharge plasma shows that the barium required to reduce the work function in the emission zone can be supplied from upstream through the gas phase. Barium that flows out of the pores of the tungsten insert is rapidly ionized in the xenon discharge and pushedback to the emitter surface by the electric field and drag from the xenon ion flow. Thisbarium ion flux is sufficient to maintain a barium surface coverage at the downstream endgreater than 0.6, even if local barium production at that point is inhibited by tungsten deposits. The model also shows that the neutral barium pressure exceeds the equilibrium vapor pressure of the impregnant decomposition reaction over much of the insert length,so the reactions are suppressed. Only a small region upstream of the zone blocked by tungsten deposits is active and supplies the required barium. These results indicate that hollowcathode failure models based on barium depletion rates in vacuum dispenser cathodes are very conservative.

  17. CH Stars and Barium Stars

    NASA Astrophysics Data System (ADS)

    Bond, H.; Sion, E.; Murdin, P.

    2000-11-01

    The classical barium (or `Ba II') stars are RED GIANT STARS whose spectra show strong absorption lines of barium, strontium and certain other heavy elements, as well as strong features due to carbon molecules. Together with the related class of CH stars, the Ba II stars were crucial in establishing the existence of neutron-capture reactions in stellar interiors that are responsible for the synt...

  18. Barium light source method and apparatus

    NASA Technical Reports Server (NTRS)

    Curry, John J. (Inventor); MacDonagh-Dumler, Jeffrey (Inventor); Anderson, Heidi M. (Inventor); Lawler, James E. (Inventor)

    2002-01-01

    Visible light emission is obtained from a plasma containing elemental barium including neutral barium atoms and barium ion species. Neutral barium provides a strong green light emission in the center of the visible spectrum with a highly efficient conversion of electrical energy into visible light. By the selective excitation of barium ionic species, emission of visible light at longer and shorter wavelengths can be obtained simultaneously with the green emission from neutral barium, effectively providing light that is visually perceived as white. A discharge vessel contains the elemental barium and a buffer gas fill therein, and a discharge inducer is utilized to induce a desired discharge temperature and barium vapor pressure therein to produce from the barium vapor a visible light emission. The discharge can be induced utilizing a glow discharge between electrodes in the discharge vessel as well as by inductively or capacitively coupling RF energy into the plasma within the discharge vessel.

  19. Microwave absorption properties of Al- and Cr-substituted M-type barium hexaferrite

    NASA Astrophysics Data System (ADS)

    Qiu, Jianxun; Gu, Mingyuan; Shen, Haigen

    2005-09-01

    Aluminum- and chromium-substituted barium ferrite particles with single magnetic domain were prepared using self-propagating combustion method. The crystalline structure, size, coercivity and microwave absorption property of the particles were investigated by means of X-ray diffraction, transmission electron microscopy, vibrating sample magnetometry and vector network analyzer. The results show that the crystalline structure of BaFe 12-xAl xO 19 is still hexagonal. But when the chromium substitution amount y exceeds 0.6, the extra chromium ions cannot enter the lattice of BaFe 12-yCr yO 19. After Fe 3+ is partly substituted with Al 3+ and Cr 3+, the microwave absorption properties of barium ferrite are improved. The maximum absorption reaches 34.76 dB. The ferromagnetic resonance is an important channel of barium ferrite to absorb microwaves with high frequency. Aluminum and chromium substitutions change the ferromagnetic resonant frequency of barium ferrite. The multipeak phenomenon of the ferromagnetic resonance increases the microwave absorption capability of barium ferrite.

  20. Interaction between Barium Oxide and Barium Containing Chloride Melt

    NASA Astrophysics Data System (ADS)

    Nikolaeva, Elena V.; Zakiryanova, Irina D.; Korzun, Iraida V.; Bovet, Andrey L.; Antonov, Boris D.

    2015-05-01

    Thermal analysis was applied to determine the liquidus temperatures in the NaCl-KCl-BaCl2-BaO system, with BaO concentration varied from 0 to 6 mole%. The temperature dependence of the BaO solubility in the NaCl-KCl-BaCl2 eutectic melt was investigated; the thermodynamic parameters of BaO dissolution were calculated. The caloric effects of melting of the NaCl-KCl-BaCl2 eutectic with barium oxide and barium oxychloride additions were studied. The type, morphology, and composition of oxychloride ionic groupings in the melt were determined in situ using Raman spectroscopy.

  1. Efficient polymer light-emitting diode with air-stable aluminum cathode

    NASA Astrophysics Data System (ADS)

    Abbaszadeh, D.; Wetzelaer, G. A. H.; Doumon, N. Y.; Blom, P. W. M.

    2016-03-01

    The fast degradation of polymer light-emitting diodes (PLEDs) in ambient conditions is primarily due to the oxidation of highly reactive metals, such as barium or calcium, which are used as cathode materials. Here, we report the fabrication of PLEDs using an air-stable partially oxidized aluminum (AlOx) cathode. Usually, the high work function of aluminum (4.2 eV) imposes a high barrier for injecting electrons into the lowest unoccupied molecular orbital (LUMO) of the emissive polymer (2.9 eV below the vacuum level). By partially oxidizing aluminum, its work function is decreased, but not sufficiently low for efficient electron injection. Efficient injection is obtained by inserting an electron transport layer of poly[(9,9-di-n-octylfluorenyl-2,7-diyl)-alt-(benzo[2,1,3]thiadiazol-4,8-diyl)] (F8BT), which has its LUMO at 3.3 eV below vacuum, between the AlOx cathode and the emissive polymer. The intermediate F8BT layer not only serves as a hole-blocking layer but also provides an energetic staircase for electron injection from AlOx into the emissive layer. PLEDs with an AlOx cathode and F8BT interlayer exhibit a doubling of the efficiency as compared to conventional Ba/Al PLEDs, and still operate even after being kept in ambient atmosphere for one month without encapsulation.

  2. Calcium channels in Paramecium aurelia.

    PubMed

    Schein, S J

    1977-01-01

    Reversal of swimming direction in paramecium is dependent on the calcium influx through the excitable-membrane calcium channels. Several mutants of Paramecium aurelia have been selected on the basis of their resistance to the paralyzing effect of barium. The mutants have reduced reversal behavior and are in the same three pawn genes as discovered by Kung (16, 17). Also, in barium solutions, the pawns live longer than the wild-type; however, pwB mutants are more resistant to barium toxicity than pwA mutants. These results suggest that the selection picked up mutants in the calcium channel. Electrophysiological studies demonstrate this point directly, showing defective calcium activation in all pawns, but also defective anomalous rectification in pwB mutants. A model is presented which accounts for the differences between pwA and pwB mutants. It ascribes the depolarization-sensitive "gate" function to the pwA gene product and the "pore" function to the pwB gene product. Additionally, the stability of the channel structure is demonstrated, channel half-life being from five to eight days. PMID:928443

  3. Selective Adsorption of Sodium Aluminum Fluoride Salts from Molten Aluminum

    SciTech Connect

    Leonard S. Aubrey; Christine A. Boyle; Eddie M. Williams; David H. DeYoung; Dawid D. Smith; Feng Chi

    2007-08-16

    Aluminum is produced in electrolytic reduction cells where alumina feedstock is dissolved in molten cryolite (sodium aluminum fluoride) along with aluminum and calcium fluorides. The dissolved alumina is then reduced by electrolysis and the molten aluminum separates to the bottom of the cell. The reduction cell is periodically tapped to remove the molten aluminum. During the tapping process, some of the molten electrolyte (commonly referred as “bath” in the aluminum industry) is carried over with the molten aluminum and into the transfer crucible. The carryover of molten bath into the holding furnace can create significant operational problems in aluminum cast houses. Bath carryover can result in several problems. The most troublesome problem is sodium and calcium pickup in magnesium-bearing alloys. Magnesium alloying additions can result in Mg-Na and Mg-Ca exchange reactions with the molten bath, which results in the undesirable pickup of elemental sodium and calcium. This final report presents the findings of a project to evaluate removal of molten bath using a new and novel micro-porous filter media. The theory of selective adsorption or removal is based on interfacial surface energy differences of molten aluminum and bath on the micro-porous filter structure. This report describes the theory of the selective adsorption-filtration process, the development of suitable micro-porous filter media, and the operational results obtained with a micro-porous bed filtration system. The micro-porous filter media was found to very effectively remove molten sodium aluminum fluoride bath by the selective adsorption-filtration mechanism.

  4. Calcium supplements

    MedlinePlus

    ... TYPES OF CALCIUM SUPPLEMENTS Forms of calcium include: Calcium carbonate: Over-the-counter (OTC) antacid products, such as Tums and Rolaids, contain calcium carbonate. These sources of calcium do not cost much. ...

  5. Barium responsiveness of the rat aorta and femoral artery during pregnancy.

    PubMed

    Hart, J L

    1982-01-11

    The barium responses of isolated aortic strips and femoral arteries from non-pregnant and pregnant rats were investigated. Barium caused concentration-related increases in tension of vessels from both pregnant and non-pregnant rats. The concentration-response curves of femoral arteries from non-pregnant and 3 week pregnant rats were not different; however contractility and slopes of concentration-response lines for thoracic aortas from 1, 2 and 3 week pregnant rats were significantly less than those of aortas from non-pregnant rats. In addition, barium caused rhythmic contractions to develop in both femoral arteries and aortas of 3 week pregnant rats more frequently than vessels from non-pregnant rats. Rhythmic contractions did not develop in aortas from 3 week pregnant rats in calcium-free Krebs. Since the effects of barium on the electrical and mechanical activity of various muscles have been postulated to be similar to and/or dependent on calcium, these results may indicate that changes in calcium sensitivity of vascular smooth muscle occur during pregnancy. Such changes may contribute to the blood flow redistribution and other cardiovascular adaptations of pregnancy. PMID:7054642

  6. Reverse microemulsion-mediated synthesis and structural evolution of barium hexaaluminate nanoparticles

    SciTech Connect

    Zarur, A.J.; Hwu, H.H.; Ying, J.Y.

    2000-04-04

    Nanocrystalline barium hexaaluminate has been successfully synthesized through the use of a reverse microemulsion as a medium for controlled hydrolysis and polycondensation of barium and aluminum alkoxides. The nanoparticles derived were characterized with electron microscopy, X-ray diffraction, and nitrogen adsorption analysis. This novel material possessed a well-defined particle morphology and an ultrahigh surface area, and exhibited excellent catalytic performance in methane combustion. Its structural evolution was found to be strongly dependent on synthesis parameters, such as water/alkoxide ratio and aging period. Powder recovery and drying techniques also had an important impact on particle agglomeration and structural development. Through the unique synthesis approach described, barium hexaaluminate with superb thermal stability was achieved, with surface areas in excess of 100 m{sup 2}/g retained even after calcination at 1,300 C.

  7. Aluminum Hydroxide

    MedlinePlus

    Aluminum hydroxide is used for the relief of heartburn, sour stomach, and peptic ulcer pain and to ... Aluminum hydroxide comes as a capsule, a tablet, and an oral liquid and suspension. The dose and ...

  8. Calcium alloy as active material in secondary electrochemical cell

    DOEpatents

    Roche, Michael F.; Preto, Sandra K.; Martin, Allan E.

    1976-01-01

    Calcium alloys such as calcium-aluminum and calcium-silicon, are employed as active material within a rechargeable negative electrode of an electrochemical cell. Such cells can use a molten salt electrolyte including calcium ions and a positive electrode having sulfur, sulfides, or oxides as active material. The calcium alloy is selected to prevent formation of molten calcium alloys resulting from reaction with the selected molten electrolytic salt at the cell operating temperatures.

  9. Calcium - ionized

    MedlinePlus

    ... at both ionized calcium and calcium attached to proteins. You may need to have a separate ionized calcium test if you have factors that increase or decrease total calcium levels. These may include abnormal blood levels ...

  10. The problem of the barium stars

    NASA Technical Reports Server (NTRS)

    Bohm-Vitense, E.; Nemec, J.; Proffitt, C.

    1984-01-01

    Ultraviolet observations of barium stars and other cool stars with peculiar element abundances are reported. Those observations attempted to find hot white dwarf companions. Among six real barium stars studied, only Zeta Cap was found to have a white dwarf companion. Among seven mild, or marginal, barium stars studied, at least three were found to have hot subluminous companions. It is likely that all of them have white dwarf companions.

  11. Calcium Oscillations

    PubMed Central

    Dupont, Geneviève; Combettes, Laurent; Bird, Gary S.; Putney, James W.

    2011-01-01

    Calcium signaling results from a complex interplay between activation and inactivation of intracellular and extracellular calcium permeable channels. This complexity is obvious from the pattern of calcium signals observed with modest, physiological concentrations of calcium-mobilizing agonists, which typically present as sequential regenerative discharges of stored calcium, a process referred to as calcium oscillations. In this review, we discuss recent advances in understanding the underlying mechanism of calcium oscillations through the power of mathematical modeling. We also summarize recent findings on the role of calcium entry through store-operated channels in sustaining calcium oscillations and in the mechanism by which calcium oscillations couple to downstream effectors. PMID:21421924

  12. 21 CFR 82.1051 - Lakes (D&C).

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... radical sodium, potassium, aluminum, barium, calcium, strontium, or zirconium; or (ii) a salt prepared... subpart, by combining such color with the basic radical sodium, potassium, aluminum, barium, calcium... substratum is “D&C Red No. 9—Barium Lake”, and a lake prepared by extending the aluminum salt prepared...

  13. 21 CFR 82.1051 - Lakes (D&C).

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... radical sodium, potassium, aluminum, barium, calcium, strontium, or zirconium; or (ii) a salt prepared... subpart, by combining such color with the basic radical sodium, potassium, aluminum, barium, calcium... substratum is “D&C Red No. 9—Barium Lake”, and a lake prepared by extending the aluminum salt prepared...

  14. 21 CFR 82.1051 - Lakes (D&C).

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... radical sodium, potassium, aluminum, barium, calcium, strontium, or zirconium; or (ii) a salt prepared... subpart, by combining such color with the basic radical sodium, potassium, aluminum, barium, calcium... substratum is “D&C Red No. 9—Barium Lake”, and a lake prepared by extending the aluminum salt prepared...

  15. 21 CFR 82.1051 - Lakes (D&C).

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... radical sodium, potassium, aluminum, barium, calcium, strontium, or zirconium; or (ii) a salt prepared... subpart, by combining such color with the basic radical sodium, potassium, aluminum, barium, calcium... substratum is “D&C Red No. 9—Barium Lake”, and a lake prepared by extending the aluminum salt prepared...

  16. 21 CFR 82.1051 - Lakes (D&C).

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... radical sodium, potassium, aluminum, barium, calcium, strontium, or zirconium; or (ii) a salt prepared... subpart, by combining such color with the basic radical sodium, potassium, aluminum, barium, calcium... substratum is “D&C Red No. 9—Barium Lake”, and a lake prepared by extending the aluminum salt prepared...

  17. Processing science of barium titanate

    NASA Astrophysics Data System (ADS)

    Aygun, Seymen Murat

    Barium titanate and barium strontium titanate thin films were deposited on base metal foils via chemical solution deposition and radio frequency magnetron sputtering. The films were processed at elevated temperatures for densification and crystallization. Two unifying research goals underpin all experiments: (1) To improve our fundamental understanding of complex oxide processing science, and (2) to translate those improvements into materials with superior structural and electrical properties. The relationships linking dielectric response, grain size, and thermal budget for sputtered barium strontium titanate were illustrated. (Ba 0.6Sr0.4)TiO3 films were sputtered on nickel foils at temperatures ranging between 100-400°C. After the top electrode deposition, the films were co-fired at 900°C for densification and crystallization. The dielectric properties were observed to improve with increasing sputter temperature reaching a permittivity of 1800, a tunability of 10:1, and a loss tangent of less than 0.015 for the sample sputtered at 400°C. The data can be understood using a brick wall model incorporating a high permittivity grain interior with low permittivity grain boundary. However, this high permittivity value was achieved at a grain size of 80 nm, which is typically associated with strong suppression of the dielectric response. These results clearly show that conventional models that parameterize permittivity with crystal diameter or film thickness alone are insufficiently sophisticated. Better models are needed that incorporate the influence of microstructure and crystal structure. This thesis next explores the ability to tune microstructure and properties of chemically solution deposited BaTiO3 thin films by modulation of heat treatment thermal profiles and firing atmosphere composition. Barium titanate films were deposited on copper foils using hybrid-chelate chemistries. An in-situ gas analysis process was developed to probe the organic removal and the

  18. Barium granuloma of the transverse colon.

    PubMed Central

    McKee, P. H.; Cameron, C. H.

    1978-01-01

    A case of barium sulphate granuloma of the transverse colon following gunshot wounds to the abdomen has been described. Scanning electron microscopy with electron probe microanalysis was used to confirm the presence of barium sulphate and the absence of lead or other elements related to the gunshot wounds. Images Fig. 1 Fig. 2 Fig. 3 Fig. 4 PMID:740599

  19. Calcium Carbonate

    MedlinePlus

    Calcium carbonate is a dietary supplement used when the amount of calcium taken in the diet is not ... for healthy bones, muscles, nervous system, and heart. Calcium carbonate also is used as an antacid to relieve ...

  20. Calcium - urine

    MedlinePlus

    ... best treatment for the most common type of kidney stone , which is made of calcium. This type of ... the kidneys into the urine, which causes calcium kidney stones Sarcoidosis Taking too much calcium Too much production ...

  1. Anti wetting additives for aluminosilicate refractories in molten aluminum contact applications

    NASA Astrophysics Data System (ADS)

    Shukla, Devdutt Pramod

    Aluminosilicate based refractories are widely used in furnace installations for melting aluminum because they are inexpensive, readily available and generally exhibit the properties desired from a refractory material. However, they face severe corrosion and degradation issues due to the extremely reducing nature of molten aluminum alloys. Isothermal static cup testing is widely used as a tool to evaluate the performance of refractories against penetration by molten aluminum alloys. Various testing methods were reviewed and an upgraded static cup test was recommended. Commercially available aluminosilicate refractories were tested using this method and their results were studied in order to understand the corrosion process. Barium sulfate, which is widely used as an anti-wetting additive to improve refractory performance by limiting physical contact between molten metal and the refractory, has proved ineffective at temperatures above 1000°C. A literature review suggested that barium sulfate formed barium celsian at high temperatures and that the celsian was responsible for the non-wetting effect. Wetting angle measurements of molten AL 5083 on synthetic celsian discs revealed that barium celsian and strontium celsian were both not wetted by molten aluminum. Static cup tests were performed on aluminosilicate refractories containing barium carbonate and strontium carbonate. These additives led to the in-situ formation of celsian phases within the refractory matrix that led to improved corrosion resistance at 1300°C. Phase analysis revealed that celsian formation suppressed the formation of mullite within refractories, thereby reducing penetration.

  2. Radium/Barium Waste Project

    SciTech Connect

    McDowell, Allen K.; Ellefson, Mark D.; McDonald, Kent M.

    2015-06-25

    The treatment, shipping, and disposal of a highly radioactive radium/barium waste stream have presented a complex set of challenges requiring several years of effort. The project illustrates the difficulty and high cost of managing even small quantities of highly radioactive Resource Conservation and Recovery Act (RCRA)-regulated waste. Pacific Northwest National Laboratory (PNNL) research activities produced a Type B quantity of radium chloride low-level mixed waste (LLMW) in a number of small vials in a facility hot cell. The resulting waste management project involved a mock-up RCRA stabilization treatment, a failed in-cell treatment, a second, alternative RCRA treatment approach, coordinated regulatory variances and authorizations, alternative transportation authorizations, additional disposal facility approvals, and a final radiological stabilization process.

  3. Influence of Barium Hexaferrite on Magnetic Properties of Hydroxyapatite Ceramics.

    PubMed

    Jarupoom, P; Jaita, P

    2015-11-01

    Hydroxyapatite (HA) powders was derived from natural bovine bone by sequence of thermal processes. The barium hexaferrite (BF) find magnetic powders were added into HA powders in ratio of 1-3 vol.%. The HA-BF ceramics were prepared by a solid state reaction method and sintered at 1250 degrees C for 2 h. Effects of BF additive on structural, physical and magnetic properties of HA ceramics were investigated. X-ray diffraction revealed that all HA-BF samples showed a main phase of high purity hydroxyapatite [Ca10(PO4)6(OH)2] with calcium and phosphate molar ratio of 1.67. The addition of BF into HA inhibited grain growth and caused an improvement of mechanical properties. The M-H hysteresis loops also showed an improvement in magnetic behavior for higher content of BF. Moreover, in vitro bioactivity test indicated that the 2-3 vol.% sample may be suitable for biological applications. PMID:26726671

  4. Characterization of Medicago truncatula reduced calcium oxalate crystal mutant alleles

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Calcium oxalate crystal formation is common in plants. Formation of these crystals has been shown to function in plant defense, calcium regulation, and aluminum tolerance. Although calcium oxalate is common and plays important roles in plant development, our understanding of how these crystals form ...

  5. Barium Isotopes in Single Presolar Grains

    NASA Technical Reports Server (NTRS)

    Pellin, M. J.; Davis, A. M.; Savina, M. R.; Kashiv, Y.; Clayton, R. N.; Lewis, R. S.; Amari, S.

    2001-01-01

    Barium isotopic compositions of single presolar grains were measured by laser ablation laser resonant ionization mass spectrometry and the implications of the data for stellar processes are discussed. Additional information is contained in the original extended abstract.

  6. Aluminum Analysis.

    ERIC Educational Resources Information Center

    Sumrall, William J.

    1998-01-01

    Presents three problems based on the price of aluminum designed to encourage students to be cooperative and to use an investigative approach to learning. Students collect and synthesize information, analyze results, and draw conclusions. (AIM)

  7. Aluminum Hydroxide

    MedlinePlus

    ... penicillamine (Cuprimine, Depen), prednisone (Deltasone, Orasone), products containing iron, tetracycline (Sumycin, Tetracap, and others), ticlopidine (Ticlid), and vitamins.be aware that aluminum hydroxide may interfere with other medicines, making them less effective. Take your other medications 1 ...

  8. Distribution and source of barium in ground water at Cattaraugus Indian Reservation, southwestern New York

    USGS Publications Warehouse

    Moore, R.B.; Staubitz, W.W.

    1984-01-01

    High concentrations of dissolved barium have been found in ground water from bedrock wells on the Seneca Nation of Indians Reservation on Cattaraugus Creek in southwestern New York. Concentrations in 1982 were as high as 23.0 milligrams per liter , the highest found reported from any natural ground-water system in the world. The highest concentrations are in a bedrock aquifer and in small lenses of saturated gravel between bedrock and the overlying till. The bedrock aquifer is partly confined by silt, clay, and till. The high barium concentrations are attributed to dissolution of the mineral barite (BaSO4), which is present in the bedrock and possibly in overlying silt, clay, or till. The dissolution of barite seems to be controlled by action of sulfate-reducing bacteria, which alter the BaSO4 equilibrium by removing sulfate ions and permitting additional barite to dissolve. Ground water from the surficial, unconsolidated deposits and surface water in streams contain little or no barium. Because barium is chemically similar to calcium, it probably could be removed by cation exchange or treatments similar to those used for water softening. (USGS)

  9. Thermochemical hydrogen production via a cycle using barium and sulfur - Reaction between barium sulfide and water

    NASA Technical Reports Server (NTRS)

    Ota, K.; Conger, W. L.

    1977-01-01

    The reaction between barium sulfide and water, a reaction found in several sulfur based thermochemical cycles, was investigated kinetically at 653-866 C. Gaseous products were hydrogen and hydrogen sulfide. The rate determining step for hydrogen formation was a surface reaction between barium sulfide and water. An expression was derived for the rate of hydrogen formation.

  10. Sulphate removal from sodium sulphate-rich brine and recovery of barium as a barium salt mixture.

    PubMed

    Vadapalli, Viswanath R K; Zvimba, John N; Mulopo, Jean; Motaung, Solly

    2013-01-01

    Sulphate removal from sodium sulphate-rich brine using barium hydroxide and recovery of the barium salts has been investigated. The sodium sulphate-rich brine treated with different dosages of barium hydroxide to precipitate barium sulphate showed sulphate removal from 13.5 g/L to less than 400 mg/L over 60 min using a barium to sulphate molar ratio of 1.1. The thermal conversion of precipitated barium sulphate to barium sulphide achieved a conversion yield of 85% using coal as both a reducing agent and an energy source. The recovery of a pure mixture of barium salts from barium sulphide, which involved dissolution of barium sulphide and reaction with ammonium hydroxide resulted in recovery of a mixture of barium carbonate (62%) and barium hydroxide (38%), which is a critical input raw material for barium salts based acid mine drainage (AMD) desalination technologies. Under alkaline conditions of this barium salt mixture recovery process, ammonia gas is given off, while hydrogen sulfide is retained in solution as bisulfide species, and this provides basis for ammonium hydroxide separation and recovery for reuse, with hydrogen sulfide also recoverable for further industrial applications such as sulfur production by subsequent stripping. PMID:23485244

  11. Recovery of aluminum and other metal values from fly ash

    DOEpatents

    McDowell, W.J.; Seeley, F.G.

    1979-11-01

    The invention relates to a method for improving the acid leachability of aluminum and other metal values found in fly ash which comprises sintering the fly ash, prior to acid leaching, with a calcium sulfate-containing composition at a temperature at which the calcium sulfate is retained in said composition during sintering and for a time sufficient to quantitatively convert the aluminum in said fly ash into an acid-leachable form.

  12. Recovery of aluminum and other metal values from fly ash

    DOEpatents

    McDowell, William J.; Seeley, Forest G.

    1981-01-01

    The invention described herein relates to a method for improving the acid leachability of aluminum and other metal values found in fly ash which comprises sintering the fly ash, prior to acid leaching, with a calcium sulfate-containing composition at a temperature at which the calcium sulfate is retained in said composition during sintering and for a time sufficient to quantitatively convert the aluminum in said fly ash into an acid-leachable form.

  13. Chemical abundances and kinematics of barium stars

    NASA Astrophysics Data System (ADS)

    de Castro, D. B.; Pereira, C. B.; Roig, F.; Jilinski, E.; Drake, N. A.; Chavero, C.; Silva, J. V. Sales

    2016-04-01

    In this paper we present an homogeneous analysis of photospheric abundances based on high-resolution spectroscopy of a sample of 182 barium stars and candidates. We determined atmospheric parameters, spectroscopic distances, stellar masses, ages, luminosities and scale height, radial velocities, abundances of the Na, Al, alpha-elements, iron-peak elements, and s-process elements Y, Zr, La, Ce, and Nd. We employed the local-thermodynamic-equilibrium model atmospheres of Kurucz and the spectral analysis code MOOG. We found that the metallicities, the temperatures and the surface gravities for barium stars can not be represented by a single gaussian distribution. The abundances of alpha-elements and iron peak elements are similar to those of field giants with the same metallicity. Sodium presents some degree of enrichment in more evolved stars that could be attributed to the NeNa cycle. As expected, the barium stars show overabundance of the elements created by the s-process. By measuring the mean heavy-element abundance pattern as given by the ratio [s/Fe], we found that the barium stars present several degrees of enrichment. We also obtained the [hs/ls] ratio by measuring the photospheric abundances of the Ba-peak and the Zr-peak elements. Our results indicated that the [s/Fe] and the [hs/ls] ratios are strongly anti-correlated with the metallicity. Our kinematical analysis showed that 90% of the barium stars belong to the thin disk population. Based on their luminosities, none of the barium stars are luminous enough to be an AGB star, nor to become self-enriched in the s-process elements. Finally, we determined that the barium stars also follow an age-metallicity relation.

  14. Chemical abundances and kinematics of barium stars

    NASA Astrophysics Data System (ADS)

    de Castro, D. B.; Pereira, C. B.; Roig, F.; Jilinski, E.; Drake, N. A.; Chavero, C.; Sales Silva, J. V.

    2016-07-01

    In this paper, we present an homogeneous analysis of photospheric abundances based on high-resolution spectroscopy of a sample of 182 barium stars and candidates. We determined atmospheric parameters, spectroscopic distances, stellar masses, ages, luminosities and scaleheight, radial velocities, abundances of the Na, Al, α-elements, iron-peak elements, and s-process elements Y, Zr, La, Ce, and Nd. We employed the local thermodynamic equilibrium model atmospheres of Kurucz and the spectral analysis code MOOG. We found that the metallicities, the temperatures and the surface gravities for barium stars cannot be represented by a single Gaussian distribution. The abundances of α-elements and iron peak elements are similar to those of field giants with the same metallicity. Sodium presents some degree of enrichment in more evolved stars that could be attributed to the NeNa cycle. As expected, the barium stars show overabundance of the elements created by the s-process. By measuring the mean heavy-element abundance pattern as given by the ratio [s/Fe], we found that the barium stars present several degrees of enrichment. We also obtained the [hs/ls] ratio by measuring the photospheric abundances of the Ba-peak and the Zr-peak elements. Our results indicated that the [s/Fe] and the [hs/ls] ratios are strongly anticorrelated with the metallicity. Our kinematical analysis showed that 90 per cent of the barium stars belong to the thin disc population. Based on their luminosities, none of the barium stars are luminous enough to be an asymptotic giant branch star, nor to become self-enriched in the s-process elements. Finally, we determined that the barium stars also follow an age-metallicity relation.

  15. Constraining the oceanic barium cycle with stable barium isotopes

    NASA Astrophysics Data System (ADS)

    Cao, Zhimian; Siebert, Christopher; Hathorne, Ed C.; Dai, Minhan; Frank, Martin

    2016-01-01

    The distribution of barium (Ba) concentrations in seawater resembles that of nutrients and Ba has been widely used as a proxy of paleoproductivity. However, the exact mechanisms controlling the nutrient-like behavior, and thus the fundamentals of Ba chemistry in the ocean, have not been fully resolved. Here we present a set of full water column dissolved Ba (DBa) isotope (δ137BaDBa) profiles from the South China Sea and the East China Sea that receives large freshwater inputs from the Changjiang (Yangtze River). We find pronounced and systematic horizontal and depth dependent δ137BaDBa gradients. Beyond the river influence characterized by generally light signatures (0.0 to + 0.3 ‰), the δ137BaDBa values in the upper water column are significantly higher (+ 0.9 ‰) than those in the deep waters (+ 0.5 ‰). Moreover, δ137BaDBa signatures are essentially constant in the entire upper 100 m, in which dissolved silicon isotopes are fractionated during diatom growth resulting in the heaviest isotopic compositions in the very surface waters. Combined with the decoupling of DBa concentrations and δ137BaDBa from the concentrations of nitrate and phosphate this implies that the apparent nutrient-like fractionation of Ba isotopes in seawater is primarily induced by preferential adsorption of the lighter isotopes onto biogenic particles rather than by biological utilization. The subsurface δ137BaDBa distribution is dominated by water mass mixing. The application of stable Ba isotopes as a proxy for nutrient cycling should therefore be considered with caution and both biological and physical processes need to be considered. Clearly, however, Ba isotopes show great potential as a new tracer for land-sea interactions and ocean mixing processes.

  16. Inhibition of barium sulfate deposition by polycarboxylates of various molecular structures

    SciTech Connect

    van der Leeden, M.C.; van Rosmalen, G.M. )

    1990-02-01

    To establish a relationship between the molecular structure of polycarboxylates and their growth-retarding influence on barium sulfate, seeded-suspension-growth experiments were performed at various inhibitor concentrations and pH values. Two types of polycarboxylates with a molecular structure based on their polyacrylic or maleic acid were studied. The molecular structure of these compounds were varied by particle substitution with monomers containing hydroxyl, amide, and sulfonic acid, as well as hydrophobic groups. Hydrophobic groups are detrimental to good inhibitor performance, whereas the introduction of OH, NH {sub 2}, or SO {sub 3} H groups presents opportunities to enhance the inhibitor effectiveness. The sequence in performance of the compounds on barium sulfate was compared with the sequence formerly obtained for calcium sulfate dihydrate.

  17. Calcium - urine

    MedlinePlus

    ... into the urine, which causes calcium kidney stones Sarcoidosis Taking too much calcium Too much production of ... Milk-alkali syndrome Proximal renal tubular acidosis Rickets Sarcoidosis Vitamin D Update Date 5/3/2015 Updated ...

  18. Regeneration of barium carbonate from barium sulphide in a pilot-scale bubbling column reactor and utilization for acid mine drainage.

    PubMed

    Mulopo, J; Zvimba, J N; Swanepoel, H; Bologo, L T; Maree, J

    2012-01-01

    Batch regeneration of barium carbonate (BaCO(3)) from barium sulphide (BaS) slurries by passing CO(2) gas into a pilot-scale bubbling column reactor under ambient conditions was used to assess the technical feasibility of BaCO(3) recovery in the Alkali Barium Calcium (ABC) desalination process and its use for sulphate removal from high sulphate Acid Mine Drainage (AMD). The effect of key process parameters, such as BaS slurry concentration and CO(2) flow rate on the carbonation, as well as the extent of sulphate removal from AMD using the recovered BaCO(3) were investigated. It was observed that the carbonation reaction rate for BaCO(3) regeneration in a bubbling column reactor significantly increased with increase in carbon dioxide (CO(2)) flow rate whereas the BaS slurry content within the range 5-10% slurry content did not significantly affect the carbonation rate. The CO(2) flow rate also had an impact on the BaCO(3) morphology. The BaCO(3) recovered from the pilot-scale bubbling column reactor demonstrated effective sulphate removal ability during AMD treatment compared with commercial BaCO(3). PMID:22233912

  19. Aluminum alloy

    NASA Technical Reports Server (NTRS)

    Blackburn, Linda B. (Inventor); Starke, Edgar A., Jr. (Inventor)

    1989-01-01

    This invention relates to aluminum alloys, particularly to aluminum-copper-lithium alloys containing at least about 0.1 percent by weight of indium as an essential component, which are suitable for applications in aircraft and aerospace vehicles. At least about 0.1 percent by weight of indium is added as an essential component to an alloy which precipitates a T1 phase (Al2CuLi). This addition enhances the nucleation of the precipitate T1 phase, producing a microstructure which provides excellent strength as indicated by Rockwell hardness values and confirmed by standard tensile tests.

  20. Calcium supplements

    MedlinePlus

    ... SHOULD TAKE CALCIUM SUPPLEMENTS? Calcium is an important mineral for the human body. It helps build and protect your teeth ... absorb calcium. You can get vitamin D from sunlight exposure to your skin and from your diet. Ask your provider whether ...

  1. The effects of fumed silica and barite on the aluminum resistance of alumina castables

    NASA Astrophysics Data System (ADS)

    Afshar, Saied; Gaubert, Christophe; Allaire, Claude

    2003-11-01

    A study of the effects of microsilica and barium sulfate as additives in high-tabular alumina castables on cold and hot modulus of rupture, porosity, thermal shock, and corrosion resistance to aluminum attack is reported in this article. This investigation underlined the importance of the quality of fumed silica on the physical and mechanical properties of refractory castables, and also confirmed the importance of celsian formation during firing in the protection of refractory against aluminum attack.

  2. Aluminum phosphide

    Integrated Risk Information System (IRIS)

    Aluminum phosphide ; CASRN 20859 - 73 - 8 Human health assessment information on a chemical substance is included in the IRIS database only after a comprehensive review of toxicity data , as outlined in the IRIS assessment development process . Sections I ( Health Hazard Assessments for Noncarcinoge

  3. Bone healing response to an injectable calcium phosphate cement with enhanced radiopacity.

    PubMed

    Acarturk, Oguz; Lehmicke, Michael; Aberman, Harold; Toms, Derek; Hollinger, Jeffrey O; Fulmer, Mark

    2008-07-01

    The aim of this study was to determine the impact of barium sulfate on remodeling and regeneration in standard tibial defects in rabbits treated with the Norian skeletal repair system (SRS). Two formulations of SRS (with and without barium sulfate) were injected into the medullary canal of the tibia of New Zealand white rabbits. Animals were sacrificed at 6 weeks, 6 months, 1 year, and 2 years. Over the 2-year duration of the study, standard SRS and SRS with barium sulfate appeared to be biocompatible and osteoconductive with no evidence of either inflammation or fibrous tissue around the implant materials or at the bone-material interfaces. This outcome underscores the osteophilic property of the SRS. A difference we observed between the standard SRS and the SRS with barium sulfate was the appearance of acellular material contiguous to the SRS with barium sulfate. Energy dispersive X-ray spectroscopy (EDX) analysis was conducted and confirmed that the acellular material was barium sulfate. Pathological examination of additional tissues including regional lymph nodes revealed neither dissemination of calcium phosphate nor barium sulfate. We concluded that the residual barium sulfate detected by EDX was localized to the intramedullary canal of the tibia. PMID:18098201

  4. Kinetic analysis of barium currents in chick cochlear hair cells.

    PubMed Central

    Zidanic, M; Fuchs, P A

    1995-01-01

    Inward barium current (IBa) through voltage-gated calcium channels was recorded from chick cochlear hair cells using the whole-cell clamp technique. IBa was sensitive to dihydropyridines and insensitive to the peptide toxins omega-agatoxin IVa, omega-conotoxin GVIa, and omega-conotoxin MVIIC. Changing the holding potential over a -40 to -80 mV range had no effect on the time course or magnitude of IBa nor did it reveal any inactivating inward currents. The activation of IBa was modeled with Hodgkin-Huxley m2 kinetics. The time constant of activation, tau m, was 550 microseconds at -30 mV and gradually decreased to 100 microseconds at +50 mV. A Boltzmann fit to the activation curve, m infinity, yielded a half activation voltage of -15 mV and a steepness factor of 7.8 mV. Opening and closing rate constants, alpha m and beta m, were calculated from tau m and m infinity, then fit with modified exponential functions. The H-H model derived by evaluating the exponential functions for alpha m and beta m not only provided an excellent fit to the time course of IBa activation, but was predictive of the time course and magnitude of the IBa tail current. No differences in kinetics or voltage dependence of activation of IBa were found between tall and short hair cells. We conclude that both tall and short hair cells of the chick cochlea predominantly, if not exclusively, express noninactivating L-type calcium channels. These channels are therefore responsible for processes requiring voltage-dependent calcium entry through the basolateral cell membrane, such as transmitter release and activation of Ca(2+)-dependent K+ channels. PMID:7787021

  5. 21 CFR 82.2051 - Lakes (Ext. D&C).

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... is a salt in which is combined the basic radical sodium, potassium, barium, or calcium; or (ii) a... color with the basic radical sodium, potassium, aluminum, barium, calcium, strontium, or zirconium. (2... No. 2—Calcium Lake,” and a lake prepared by extending the barium salt prepared from Ext. D&C Red...

  6. 21 CFR 82.2051 - Lakes (Ext. D&C).

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... is a salt in which is combined the basic radical sodium, potassium, barium, or calcium; or (ii) a... color with the basic radical sodium, potassium, aluminum, barium, calcium, strontium, or zirconium. (2... No. 2—Calcium Lake,” and a lake prepared by extending the barium salt prepared from Ext. D&C Red...

  7. 21 CFR 82.2051 - Lakes (Ext. D&C).

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... is a salt in which is combined the basic radical sodium, potassium, barium, or calcium; or (ii) a... color with the basic radical sodium, potassium, aluminum, barium, calcium, strontium, or zirconium. (2... No. 2—Calcium Lake,” and a lake prepared by extending the barium salt prepared from Ext. D&C Red...

  8. 21 CFR 82.2051 - Lakes (Ext. D&C).

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... is a salt in which is combined the basic radical sodium, potassium, barium, or calcium; or (ii) a... color with the basic radical sodium, potassium, aluminum, barium, calcium, strontium, or zirconium. (2... No. 2—Calcium Lake,” and a lake prepared by extending the barium salt prepared from Ext. D&C Red...

  9. 21 CFR 82.2051 - Lakes (Ext. D&C).

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... is a salt in which is combined the basic radical sodium, potassium, barium, or calcium; or (ii) a... color with the basic radical sodium, potassium, aluminum, barium, calcium, strontium, or zirconium. (2... No. 2—Calcium Lake,” and a lake prepared by extending the barium salt prepared from Ext. D&C Red...

  10. Selectivity of calcium channels in rat uterine smooth muscle: interactions between sodium, calcium and barium ions.

    PubMed

    Jmari, K; Mironneau, C; Mironneau, J

    1987-03-01

    1. Action potentials and membrane currents were recorded by means of a double sucrose-gap technique from Cs-loaded strips from pregnant rats superfused in Ca-free EGTA-containing solutions. 2. When external Ca was reduced below 1 microM in the presence of 1 mM-EGTA, step depolarizations from a holding potential close to the normal resting potential produced tetrodotoxin-resistant inward currents. These currents were suppressed after removal of external Na and blocked by a variety of Ca-channel blockers such as Mn, Co, Ni and nifedipine. 3. Inactivation of the inward Na current was studied using a double-pulse protocol. The degree of inactivation of the Na current was almost maximal for depolarizations of +50 mV. Application of stronger depolarizations did not significantly increase it and had no effect on recovery from inactivation. Similarly, increasing the duration of the conditioning pulse from 30 to 250 ms had no further effect on both amplitude and kinetics of the Na current. These results suggest that the Na current inactivation reflects a pure voltage-dependent mechanism. 4. The effects of external Ca were studied over a 10(9)-fold range in concentration. When external Ca was gradually increased from 1 nM to 1 microM, the inward Na current was reduced and finally abolished. As the external Ca was increased over 0.5 mM, inward current reappeared and increased as Ca became the charge carrier. 5. When Na was the charge carrier, external Ca was the most effective divalent cation in blocking the Ca channel with a half-blockage concentration of 0.1 microM. Addition of millimolar concentrations of Ca and Sr also reduced the Ba current while adding Ba to Ca-containing solution produced no increase in current. 6. Membrane currents in solutions containing both Ba and Ca ions were less than in solutions containing either Ca or Ba at the same concentration, suggesting that Ca channels are single-file multi-ion pores. 7. We conclude that the selectivity of uterine Ca channels depends on the presence of external Ca. In the absence of Ca, these channels become permeable to other divalent (Ba and Sr) and monovalent (Na) cations. PMID:2443660

  11. 75 FR 19657 - Barium Chloride From China

    Federal Register 2010, 2011, 2012, 2013, 2014

    2010-04-15

    ... Commission found that the domestic interested party group response to its notice of institution (74 FR 31757... COMMISSION Barium Chloride From China AGENCY: United States International Trade Commission. ACTION: Notice of Commission determination to conduct a full five-year review concerning the antidumping duty order on...

  12. 75 FR 20625 - Barium Chloride From China

    Federal Register 2010, 2011, 2012, 2013, 2014

    2010-04-20

    ... established a schedule for the conduct of this review (74 FR 62587, November 30, 2010). Subsequently, counsel... From the Federal Register Online via the Government Publishing Office INTERNATIONAL TRADE COMMISSION Barium Chloride From China AGENCY: United States International Trade Commission. ACTION:...

  13. ARE THERE ANY STARS LACKING NEUTRON-CAPTURE ELEMENTS? EVIDENCE FROM STRONTIUM AND BARIUM

    SciTech Connect

    Roederer, Ian U.

    2013-01-01

    The cosmic dispersion in the abundances of the heavy elements strontium and barium in halo stars is well known. Strontium and barium are detected in most cool, metal-poor giants, but are these elements always detectable? To identify stars that could be considered probable candidates for lacking these elements, I examine the stellar abundance data available in the literature for 1148 field stars and 226 stars in dwarf galaxies, 776 of which have metallicities lower than [Fe/H] <-2.0. Strontium or barium have been detected in all field, globular cluster, and dwarf galaxy environments studied. All upper limits are consistent with the lowest detected ratios of [Sr/H] and [Ba/H]. The frequent appearance of these elements raises the intriguing prospect that at least one kind of neutron-capture reaction operates as often as the nucleosynthesis mechanisms that produce lighter elements, such as magnesium, calcium, or iron, although the yields of heavy elements may be more variable.

  14. Oilfield scales: controls on precipitation and crystal morphology of barite (barium sulphate)

    NASA Astrophysics Data System (ADS)

    Stark, A. I. R.; Wogelius, R. A.; Vaughan, D. J.

    2003-04-01

    The precipitation and subsequent build up of barite (barium sulphate) inside extraction tubing presents a costly problem for off shore oil wells which use seawater to mobilize oil during hydrocarbon recovery. Mixing of reservoir formation water containing Ba2+ ions and seawater containing SO_42- ions results in barite precipitation within the reservoir well-bore region and piping. Great effort has been expended in designing strategies to minimize scale formation but details of the reaction mechanism and sensitivity to thermodynamic variables are poorly constrained. Furthermore, few detailed studies have been carried out under simulated field conditions. Hence an experimental programme was designed to study barite formation under environmentally relevant conditions with control of several system variables during the precipitation reaction. Synthetic sea-water and formation-water brines containing sodium sulphate and barium chloride, respectively, were mixed to induce BaSO_4 precipitation. Experiments were carried out at high temperature (100^oC) and high pressure (500 bars) in double rocking autoclave bombs. Barite formation as a function of the addition of calcium, magnesium, and a generic phosphonate based scale inhibitor was investigated whilst maintaining constant pH, temperature and ionic strength (0.5159). Additional experiments were performed at ambient conditions for comparison. Data concerning nucleation, growth rates, and crystal morphology were obtained. ICP-AES data from the supernatant product solutions showed considerable variation in quantity of barium sulphate precipitated as a function of the listed experimental variables. For example, ESEM analysis of barium sulphate crystals showed a dramatic shift in crystal habit from the typical tabular habit produced in control experiments; experiments performed in the presence of foreign cations produced more equant crystals, while those experiments completed in the presence of the phosphonate scale inhibitor

  15. Aluminum citrate inhibits cytotoxicity and aggregation of oxalate crystals.

    PubMed

    Guo, Chungang; McMartin, Kenneth E

    2007-02-12

    Calcium oxalate monohydrate (COM), which represents a major component of kidney stones, is an end metabolite of ethylene glycol. COM accumulation has been linked with acute renal toxicity in ethylene glycol poisoning. COM injures the kidney either by directly producing cytotoxicity to the kidney cells or by aggregating in the kidney lumen leading to the blockage of urine flow. The present studies were designed to examine whether aluminum citrate could reduce the toxicity of COM. Toxicity was determined in human proximal tubule cells by leakage of lactate dehydrogenase or uptake of ethidium homodimer and in erythrocytes by degree of hemolysis. Aluminum citrate significantly inhibited the leakage of lactate dehydrogenase from human proximal tubule cells and protected against cell death from COM. The inhibitory effect of aluminum citrate was greater than that of other citrate or aluminum salts such as sodium citrate, aluminum chloride, calcium citrate, ammonium citrate or potassium citrate. Aluminum citrate significantly inhibited the aggregation of COM crystals in vitro and decreased red cell membrane damage from COM. Aluminum citrate appeared to directly interact with COM, but not with the cell membrane. As such, aluminum citrate reduced the cytotoxicity by a physico-chemical interaction with the COM surface, and not by dissolving the COM crystals. These studies suggest that aluminum citrate may protect against tissue damage that occurs with high levels of oxalate accumulation, especially in ethylene glycol poisoning and possibly in hyperoxaluric states. PMID:17161516

  16. Microcapsules with Intrinsic Barium Radiopacity for Immunoprotection and X-ray/CT imaging of Pancreatic Islet Cells

    PubMed Central

    Arifin, D.R.; Manek, S.; Call, E.; Arepally, A.; Bulte, J.W.M.

    2012-01-01

    Microencapsulation is a commonly used technique for immunoprotection of engrafted therapeutic cells. We investigated a library of capsule formulations to determine the most optimal formulation for pancreatic beta islet cell transplantation, using barium as the gelating ion and clinical-grade protamine sulfate (PS) as a new cationic capsule cross-linker. Barium-gelated alginate/PS/alginate microcapsules (APSA, diameter = 444±21 μm) proved to be mechanically stronger and supported a higher cell viability as compared to conventional alginate/poly-L-lysine/alginate (APLLA) capsules. Human pancreatic islets encapsulated inside APSA capsules, gelated with 20 mM barium as optimal concentration, exhibited a sustained morphological integrity, viability, and functionality for at least 3–4 weeks in vitro, with secreted human C-peptide levels of 0.2–160 pg/ml/islet. Unlike APLLA capsules that are gelled with calcium, barium-APSA capsules are intrinsically radiopaque and, when engrafted into mice, could be readily imaged in vivo with micro-computed tomography (CT). Without the need of adding contrast agents, these capsules offer a clinically applicable alternative for simultaneous immunoprotection and real-time, non-invasive X-ray/CT monitoring of engrafted cells during and after in vivo administration. PMID:22444642

  17. Calcium antagonists.

    PubMed

    Grossman, Ehud; Messerli, Franz H

    2004-01-01

    Calcium antagonists were introduced for the treatment of hypertension in the 1980s. Their use was subsequently expanded to additional disorders, such as angina pectoris, paroxysmal supraventricular tachycardias, hypertrophic cardiomyopathy, Raynaud phenomenon, pulmonary hypertension, diffuse esophageal spasms, and migraine. Calcium antagonists as a group are heterogeneous and include 3 main classes--phenylalkylamines, benzothiazepines, and dihydropyridines--that differ in their molecular structure, sites and modes of action, and effects on various other cardiovascular functions. Calcium antagonists lower blood pressure mainly through vasodilation and reduction of peripheral resistance. They maintain blood flow to vital organs, and are safe in patients with renal impairment. Unlike diuretics and beta-blockers, calcium antagonists do not impair glucose metabolism or lipid profile and may even attenuate the development of arteriosclerotic lesions. In long-term follow-up, patients treated with calcium antagonists had development of less overt diabetes mellitus than those who were treated with diuretics and beta-blockers. Moreover, calcium antagonists are able to reduce left ventricular mass and are effective in improving anginal pain. Recent prospective randomized studies attested to the beneficial effects of calcium antagonists in hypertensive patients. In comparison with placebo, calcium antagonist-based therapy reduced major cardiovascular events and cardiovascular death significantly in elderly hypertensive patients and in diabetic patients. In several comparative studies in hypertensive patients, treatment with calcium antagonists was equally effective as treatment with diuretics, beta-blockers, or angiotensin-converting enzyme inhibitors. From these studies, it seems that a calcium antagonist-based regimen is superior to other regimens in preventing stroke, equivalent in preventing ischemic heart disease, and inferior in preventing congestive heart failure

  18. Hydrothermal Transformation of the Calcium Aluminum Oxide Hydrates CaAl2O4 . 10H2O and Ca2Al2O. 8H2O to Ca3Al2(OH)12 Investigated by In Situ Synchrotron X-ray Powder Diffraction

    SciTech Connect

    Jensen,T.; Christensen, A.; Hanson, J.

    2005-01-01

    The hydrothermal transformation of calcium aluminate hydrates were investigated by in situ synchrotron X-ray powder diffraction in the temperature range 25 to 170 C. This technique allowed the study of the detailed reaction mechanism and identification of intermediate phases. The material CaAl{sub 2}O{sub 4}{center_dot}10H{sub 2}O converted to Ca{sub 3}Al{sub 2}(OH){sub 12} and amorphous aluminum hydroxide. Ca{sub 2}Al{sub 2}O{sub 5}{center_dot}8H{sub 2}O transformed via the intermediate phase Ca{sub 4}Al{sub 2}O{sub 7}{center_dot}13H{sub 2}O to Ca{sub 3}Al{sub 2}(OH){sub 12} and gibbsite, Al(OH){sub 3}. The phase Ca{sub 4}Al{sub 2}O{sub 7}{center_dot}19H{sub 2}O reacted via the same intermediate phase to Ca{sub 3}Al{sub 2}(OH){sub 12} and mainly amorphous aluminum hydroxide. The powder pattern of the intermediate phase is reported.

  19. Radioactive Barium Ion Trap Based on Metal-Organic Framework for Efficient and Irreversible Removal of Barium from Nuclear Wastewater.

    PubMed

    Peng, Yaguang; Huang, Hongliang; Liu, Dahuan; Zhong, Chongli

    2016-04-01

    Highly efficient and irreversible capture of radioactive barium from aqueous media remains a serious task for nuclear waste disposal and environmental protection. To address this task, here we propose a concept of barium ion trap based on metal-organic framework (MOF) with a strong barium-chelating group (sulfate and sulfonic acid group) in the pore structures of MOFs. The functionalized MOF-based ion traps can remove >90% of the barium within the first 5 min, and the removal efficiency reaches 99% after equilibrium. Remarkably, the sulfate-group-functionalized ion trap demonstrates a high barium uptake capacity of 131.1 mg g(-1), which surpasses most of the reported sorbents and can selectively capture barium from nuclear wastewater, whereas the sulfonic-acid-group-functionalized ion trap exhibits ultrafast kinetics with a kinetic rate constant k2 of 27.77 g mg(-1) min(-1), which is 1-3 orders of magnitude higher than existing sorbents. Both of the two MOF-based ion traps can capture barium irreversibly. Our work proposes a new strategy to design barium adsorbent materials and provides a new perspective for removing radioactive barium and other radionuclides from nuclear wastewater for environment remediation. Besides, the concrete mechanisms of barium-sorbent interactions are also demonstrated in this contribution. PMID:26999358

  20. AES analysis of barium fluoride thin films

    NASA Astrophysics Data System (ADS)

    Kashin, G. N.; Makhnjuk, V. I.; Rumjantseva, S. M.; Shchekochihin, Ju. M.

    1993-06-01

    AES analysis of thin films of metal fluorides is a difficult problem due to charging and decomposition of such films under electron bombardment. We have developed a simple algorithm for a reliable quantitative AES analysis of metal fluoride thin films (BaF 2 in our work). The relative AES sensitivity factors for barium and fluorine were determined from BaF 2 single-crystal samples. We have investigated the dependence of composition and stability of barium fluoride films on the substrate temperature during film growth. We found that the instability of BaF 2 films grown on GaAs substrates at high temperatures (> 525°C) is due to a loss of fluorine. Our results show that, under the optimal electron exposure conditions, AES can be used for a quantitative analysis of metal fluoride thin films.

  1. Calcium in diet

    MedlinePlus

    ... of calcium dietary supplements include calcium citrate and calcium carbonate. Calcium citrate is the more expensive form of ... the body on a full or empty stomach. Calcium carbonate is less expensive. It is absorbed better by ...

  2. Resonance-fluorescence in barium ion clouds

    NASA Astrophysics Data System (ADS)

    Horak, H. G.; Whitaker, R. W.

    1982-09-01

    The problem of resonant-fluorescent scattering of sunlight by a high altitude, plane-parallel, barium ion cloud is solved numerically. Line strengths and profiles are computed using a modified version of the computer program LINEAR (Auer, Heasley and Milkey, 1972). Hyperfine structure of the spectral lines becomes important for very thick layers and is taken into account. Comparisons are made between coherent and completely noncoherent scattering results, and finally the influence of collisions on the radiation field is estimated.

  3. Barium Titanate Nanoparticles for Biomarker Applications

    NASA Astrophysics Data System (ADS)

    Matar, O.; Posada, O. M.; Hondow, N. S.; Wälti, C.; Saunders, M.; Murray, C. A.; Brydson, R. M. D.; Milne, S. J.; Brown, A. P.

    2015-10-01

    A tetragonal crystal structure is required for barium titanate nanoparticles to exhibit the nonlinear optical effect of second harmonic light generation (SHG) for use as a biomarker when illuminated by a near-infrared source. Here we use synchrotron XRD to elucidate the tetragonal phase of commercially purchased tetragonal, cubic and hydrothermally prepared barium titanate (BaTiO3) nanoparticles by peak fitting with reference patterns. The local phase of individual nanoparticles is determined by STEM electron energy loss spectroscopy (EELS), measuring the core-loss O K-edge and the Ti L3-edge energy separation of the t2g, eg peaks. The results show a change in energy separation between the t2g and eg peak from the surface and core of the particles, suggesting an intraparticle phase mixture of the barium titanate nanoparticles. HAADF-STEM and bright field TEM-EDX show cellular uptake of the hydrothermally prepared BaTiO3 nanoparticles, highlighting the potential for application as biomarkers.

  4. Suicidal ingestion of barium-sulfide-containing shaving powder.

    PubMed

    Downs, J C; Milling, D; Nichols, C A

    1995-03-01

    Physicians, familiar with the common usage of barium medicinally as the contrast agent barium sulfate, may consider it an innocuous or at most a minimally harmful compound. The barium cation is extremely toxic and produces characteristic gastrointestinal symptoms, periorbital and extremity paresthesia, hypertension, and progressive flaccid muscular paralysis. Profound hypokalemia also may be induced. Overdose may be rapidly fatal unless the ingestion is recognized and appropriate treatment is instituted expediently. PMID:7771386

  5. Calcium Test

    MedlinePlus

    ... as thyroid disease , parathyroid disorder , malabsorption , cancer, or malnutrition An ionized calcium test may be ordered when ... albumin , which can result from liver disease or malnutrition , both of which may result from alcoholism or ...

  6. Calcium Calculator

    MedlinePlus

    ... with Sarcopenia Skeletal Rare Disorders Data & Publications Facts and Statistics Vitamin D map Fracture Risk Map Hip Fracture ... Training Courses Working Groups Regional Audits Reports Facts and Statistics Popular content Calcium content of common foods What ...

  7. Calcium - ionized

    MedlinePlus

    ... levels. These may include abnormal blood levels of albumin or immunoglobulins. Normal Results Children: 4.8 to ... 2016:chap 245. Read More Acute kidney failure Albumin - blood (serum) test Bone tumor Calcium blood test ...

  8. Magnetoelastic coupling in epitaxial cobalt ferrite/barium titanate heterostructures

    NASA Astrophysics Data System (ADS)

    Gräfe, Joachim; Welke, Martin; Bern, Francis; Ziese, Michael; Denecke, Reinhard

    2013-08-01

    Ultra-thin cobalt ferrite films have been synthesised on ferroelectric barium titanate crystals. The cobalt ferrite films exhibit a magnetic response to strain induced by structural changes in the barium titanate substrate, suggesting a pathway to multiferroic coupling. These structural changes are achieved by heating through the phase transition temperatures of barium titanate. In addition the ferromagnetic signal of the substrate itself is taken into account, addressing the influence of impurities or defects in the substrate. The cobalt ferrite/barium titanate heterostructure is a suitable oxidic platform for future magnetoelectric applications with an established ferroelectric substrate and widely tuneable magnetic properties by changing the transition metal in the ferrite film.

  9. Lanthanide doped strontium-barium cesium halide scintillators

    SciTech Connect

    Bizarri, Gregory; Bourret-Courchesne, Edith; Derenzo, Stephen E.; Borade, Ramesh B.; Gundiah, Gautam; Yan, Zewu; Hanrahan, Stephen M.; Chaudhry, Anurag; Canning, Andrew

    2015-06-09

    The present invention provides for a composition comprising an inorganic scintillator comprising an optionally lanthanide-doped strontium-barium, optionally cesium, halide, useful for detecting nuclear material.

  10. Creating unstable velocity-space distributions with barium injections

    NASA Technical Reports Server (NTRS)

    Pongratz, M. B.

    1983-01-01

    Ion velocity-space distributions resulting from barium injections from orbiting spacecraft and shaped charges are discussed. Active experiments confirm that anomalous ionization processes may operate, but photoionization accounts for the production of the bulk of the barium ions. Pitch-angle diffusion and/or velocity-space diffusion may occur, but observations of barium ions moving upwards against gravity suggests that the ions retain a significant enough fraction of their initial perpendicular velocity to provide a mirror force. The barium ion plasmas should have a range of Alfven Mach numbers and plasma betas. Because the initial conditions can be predicted these active experiments should permit testing plasma instability hypotheses.

  11. Calcium Carbonate.

    PubMed

    Al Omari, M M H; Rashid, I S; Qinna, N A; Jaber, A M; Badwan, A A

    2016-01-01

    Calcium carbonate is a chemical compound with the formula CaCO3 formed by three main elements: carbon, oxygen, and calcium. It is a common substance found in rocks in all parts of the world (most notably as limestone), and is the main component of shells of marine organisms, snails, coal balls, pearls, and eggshells. CaCO3 exists in different polymorphs, each with specific stability that depends on a diversity of variables. PMID:26940168

  12. Calcium orthophosphates

    PubMed Central

    Dorozhkin, Sergey V.

    2011-01-01

    The present overview is intended to point the readers’ attention to the important subject of calcium orthophosphates. This type of materials is of special significance for human beings, because they represent the inorganic part of major normal (bones, teeth and antlers) and pathological (i.e., those appearing due to various diseases) calcified tissues of mammals. For example, atherosclerosis results in blood vessel blockage caused by a solid composite of cholesterol with calcium orthophosphates, while dental caries and osteoporosis mean a partial decalcification of teeth and bones, respectively, that results in replacement of a less soluble and harder biological apatite by more soluble and softer calcium hydrogenphosphates. Therefore, the processes of both normal and pathological calcifications are just an in vivo crystallization of calcium orthophosphates. Similarly, dental caries and osteoporosis might be considered an in vivo dissolution of calcium orthophosphates. Thus, calcium orthophosphates hold a great significance for humankind, and in this paper, an overview on the current knowledge on this subject is provided. PMID:23507744

  13. Calcium Hydroxylapatite

    PubMed Central

    Yutskovskaya, Yana Alexandrovna; Philip Werschler, WM.

    2015-01-01

    Background: Calcium hydroxylapatite is one of the most well-studied dermal fillers worldwide and has been extensively used for the correction of moderate-to-severe facial lines and folds and to replenish lost volume. Objectives: To mark the milestone of 10 years of use in the aesthetic field, this review will consider the evolution of calcium hydroxylapatite in aesthetic medicine, provide a detailed injection protocol for a global facial approach, and examine how the unique properties of calcium hydroxylapatite provide it with an important place in today’s market. Methods: This article is an up-to-date review of calcium hydroxylapatite in aesthetic medicine along with procedures for its use, including a detailed injection protocol for a global facial approach by three expert injectors. Conclusion: Calcium hydroxylapatite is a very effective agent for many areas of facial soft tissue augmentation and is associated with a high and well-established safety profile. Calcium hydroxylapatite combines high elasticity and viscosity with an ability to induce long-term collagen formation making it an ideal agent for a global facial approach. PMID:25610523

  14. Design for aluminum recycling

    SciTech Connect

    Not Available

    1993-10-01

    This article describes the increasing use of aluminum in automobiles and the need to recycle to benefit further growth of aluminum applications by assuring an economical, high-quality source of metal. The article emphasizes that coordination of material specifications among designers can raise aluminum scrap value and facilitate recycling. Applications of aluminum in automobile construction are discussed.

  15. Effect of temperature on isoprenaline- and barium-induced slow action potentials in guinea-pig ventricular strips.

    PubMed

    Manzini, S; Parlani, M; Martucci, E; Maggi, C A; Meli, A

    1986-01-01

    The effect of variation in temperature (37-32 and 27 degrees C) on electrical and mechanical activity of depolarized and isoprenaline- or barium-reactivated guinea pig ventricular strips was studied. Lowering the temperature brings a marked prolongation of isoprenaline-induced slow action potentials. In addition the maximal rate of depolarization was strongly reduced at lower temperatures. These effects were observed at an extracellular Ca2+ concentration of either 0.9 or 2.5 mM. The accompanying mechanical activities was significantly increased by reduction in temperature. Barium-induced slow action potentials were similarly affected by temperature variations. These observations suggest that hypothermia exert a sort of calcium antagonistic action probably coupled to a reduction of repolarizing outward potassium currents. PMID:2430855

  16. Hydrolysis of aluminum dross material to achieve zero hazardous waste.

    PubMed

    David, E; Kopac, J

    2012-03-30

    A simple method with high efficiency for generating high pure hydrogen by hydrolysis in tap water of highly activated aluminum dross is established. Aluminum dross is activated by mechanically milling to particles of about 45 μm. This leads to removal of surface layer of the aluminum particles and creation of a fresh chemically active metal surface. In contact with water the hydrolysis reaction takes place and hydrogen is released. In this process a Zero Waste concept is achieved because the other product of reaction is aluminum oxide hydroxide (AlOOH), which is nature-friendly and can be used to make high quality refractory or calcium aluminate cement. For comparison we also used pure aluminum powder and alkaline tap water solution (NaOH, KOH) at a ratio similar to that of aluminum dross content. The rates of hydrogen generated in hydrolysis reaction of pure aluminum and aluminum dross have been found to be similar. As a result of the experimental setup, a hydrogen generator was designed and assembled. Hydrogen volume generated by hydrolysis reaction was measured. The experimental results obtained reveal that aluminum dross could be economically recycled by hydrolysis process with achieving zero hazardous aluminum dross waste and hydrogen generation. PMID:22326245

  17. Studies of aluminum in rat brain

    SciTech Connect

    Lipman, J.J.; Brill, A.B.; Som, P.; Jones, K.W.; Colowick, S.; Cholewa, M.

    1985-01-01

    The effects of high aluminum concentrations in rat brains were studied using /sup 14/C autoradiography to measure the uptake of /sup 14/C 2-deoxy-D-glucose (/sup 14/C-2DG) and microbeam proton-induced x-ray emission (microPIXE) with a 20-..mu..m resolution to measure concentrations of magnesium, aluminum, potassium, and calcium. The aluminum was introduced intracisternally in the form of aluminum tartrate (Al-T) while control animals were given sodium tartrate (Na-T). The /sup 14/C was administered intravenously. The animals receiving Al-T developed seizure disorders and had pathological changes that included cerebral cortical atrophy. The results showed that there was a decreased uptake of /sup 14/C-2DG in cortical regions in which increased aluminum levels were measured, i.e., there is a correlation between the aluminum in the rat brain and decreased brain glucose metabolism. A minimum detection limit of about 16 ppM (mass fraction) or 3 x 10/sup 9/ Al atoms was obtained for Al under the conditions employed. 14 refs., 4 figs., 1 tab.

  18. Depolarization-induced contractile activity of smooth muscle in calcium-free solution.

    PubMed

    Mangel, A W; Nelson, D O; Rabovsky, J L; Prosser, C L; Connor, J A

    1982-01-01

    In calcium-free solution, strips of cat intestinal muscle developed slow, rhythmic electrical potential changes that triggered contractions. Some strips failed to develop spontaneous electrical activity in calcium-free solution but responded with contractions to depolarization by direct electrical stimulation or by treatment with barium chloride, potassium chloride, or acetylcholine. Similar results were obtained with segments of cat stomach, colon, esophagus, bladder, uterus, and vena cava, as well as with rabbit vena cava. In calcium-free saline, rat small intestinal muscle showed fast electrical activity with accompanying development of a tetanuslike contraction. After 60 min in calcium-free solution, cat small intestinal muscle retained 17.7% of its original concentration of calcium. It is concluded that in some smooth muscles, depolarization-triggered release of intracellular calcium does not require an associated influx of calcium. PMID:7058877

  19. Barium Enhancement in NGC 6819 Blue Stragglers

    NASA Astrophysics Data System (ADS)

    Milliman, Katelyn; Mathieu, Robert D.; Schuler, Simon C.

    2015-01-01

    Possible formation pathways for blue straggler stars include mergers in hierarchical triple systems, stellar collisions during dynamical encounters, and mass transfer from a giant companion. Extensive work on the blue stragglers in the old open cluster NGC 188 (7 Gyr) has led to exciting discoveries including a binary secondary mass distribution peaked at 0.5 MSolar and the detection of three young white dwarf binary companions. These indicate that mass transfer from an asymptotic giant branch star is the dominant mechanism for blue straggler formation in open clusters. Such mass transfer events should pollute the surface abundance of the blue straggler with nucleosynthesis products from the evolved donor. The other formation pathways, mergers and collisions, are predicted to produce no such enhancements. In an effort to move beyond NGC 188 and into other open clusters we present the first results of a surface abundance study of the blue stragglers in the intermediate-aged open cluster NGC 6819 (2.5 Gyr) using the Hydra multi-object spectrograph on the WIYN 3.5 m telescope. This part of our study centers on the s-process element barium as a tracer of formation via mass transfer. We compare the blue straggler surface abundance of barium to that of a sample of main-sequence stars in NGC 6819 and find multiple blue stragglers with anomalous abundances. Surprising, most of the blue stragglers with barium anomalies show no radial-velocity evidence for a companion. We gratefully acknowledge funding from the National Science Foundation under grant AST- 0908082 and the Wisconsin Space Grant Consortium.

  20. BARIUM IN TEETH AS INDICATOR OF BODY BURDEN

    EPA Science Inventory

    A study was conducted to determine the biological availability of naturally occurring barium in a municipal drinking water by the analysis of barium in deciduous teeth of children. The grade school children of two Illinois towns were chosen for the study. The towns were chosen ba...

  1. Barium dithionate as an EPR dosemeter.

    PubMed

    Baran, M P; Bugay, O A; Kolesnik, S P; Maksimenko, V M; Teslenko, V V; Petrenko, T L; Desrosiers, M F

    2006-01-01

    Electron paramagnetic resonance (EPR) dosimetry is growing in popularity and this success has encouraged the search for other dosimetric materials. Previous studies of gamma-irradiated barium dithionate (BaS(2)O(6) x 2H(2)O) have shown promise for its use as a radiation dosemeter. This work studies in greater detail several essential attributes of the system. Special attention has been directed to the study of EPR response dependences on microwave power, irradiation temperature, minimum detectable dose and post-irradiation stability. PMID:16565205

  2. Europium-doped barium bromide iodide

    SciTech Connect

    Gundiah, Gautam; Hanrahan, Stephen M.; Hollander, Fredrick J.; Bourret-Courchesne, Edith D.

    2009-10-21

    Single crystals of Ba0.96Eu0.04BrI (barium europium bromide iodide) were grown by the Bridgman technique. The title compound adopts the ordered PbCl2 structure [Braekken (1932). Z. Kristallogr. 83, 222-282]. All atoms occupy the fourfold special positions (4c, site symmetry m) of the space group Pnma with a statistical distribution of Ba and Eu. They lie on the mirror planes, perpendicular to the b axis at y = +-0.25. Each cation is coordinated by nine anions in a tricapped trigonal prismatic arrangement.

  3. Short-cavity squeezing in barium

    NASA Technical Reports Server (NTRS)

    Hope, D. M.; Bachor, H-A.; Manson, P. J.; Mcclelland, D. E.

    1992-01-01

    Broadband phase sensitive noise and squeezing were experimentally observed in a system of barium atoms interacting with a single mode of a short optical cavity. Squeezing of 13 +/- 3 percent was observed. A maximum possible squeezing of 45 +/- 8 percent could be inferred for out experimental conditions, after correction for measured loss factors. Noise reductions below the quantum limit were found over a range of detection frequencies 60-170 MHz and were best for high cavity transmission and large optical depths. The amount of squeezing observed is consistent with theoretical predictions from a full quantum statistical model of the system.

  4. Vacancy ordering in reduced barium titanate

    NASA Astrophysics Data System (ADS)

    Woodward, David I.; Reaney, Ian M.; Yang, Gaiying Y.; Dickey, Elizabeth C.; Randall, Clive A.

    2004-06-01

    A crystal structure is proposed for reduced barium titanate, BaTiO3-δ, δ≈0.33, formed during the degradation of Ni-BaTiO3 X7R multilayer ceramic capacitors. High-resolution transmission electron microscopy and selected-area electron diffraction have been used in combination with computer simulations to show that oxygen vacancies accrete on every third pseudocubic {111} plane, resulting in a cell with space group P3m1. Additionally, from electron energy loss spectroscopy, it is proposed that Ti4+ is reduced to Ti3+ as a mechanism of charge compensation within oxygen-deficient octahedra.

  5. Biocompatibility of Intracanal Medications Based on Calcium Hydroxide

    PubMed Central

    Andolfatto, Carolina; da Silva, Guilherme Ferreira; Cornélio, Ana Livia Gomes; Guerreiro-Tanomaru, Juliane Maria; Tanomaru-Filho, Mario; Faria, Gisele; Bonetti-Filho, Idomeo; Cerri, Paulo Sérgio

    2012-01-01

    Objective. The aim of this study was to evaluate the rat subcutaneous tissue reaction to calcium hydroxide-based intracanal medicaments, UltraCal XS (calcium hydroxide, barium sulphate, aqueous matrix), Hydropast (calcium hydroxide, barium sulphate, and propyleneglycol), and Calen (Calcium hydroxide, zinc oxide, colophony, and polyethyleneglycol), used as a control. Methods. Forty-eight rats (Rattus Norvegicus Holtzman) were distributed in three groups: Calen, UltraCal XS, and Hydropast. Polyethylene tubes filled with one of the medicaments were implanted in the dorsal subcutaneous. After 7 and 30 days, the implants were removed and the specimens were fixed and embedded in paraffin. Morphological and quantitative analyses were carried out in the HE-stained sections. The numerical density of inflammatory cells in the capsule was evaluated and statistical analyses were performed (P ≤ 0.05). Results. At 7 days, all materials induced an inflammatory reaction in the subcutaneous tissue adjacent to the implants. In all groups, a significant reduction in the number of inflammatory cells and giant cells was verified in the period of 30 days. Conclusion. These results indicate that the calcium hydroxide-based medicaments evaluated present biocompatibility similar to Calen. PMID:23320187

  6. Barium cardiotoxicity: Relationship between ultrastructural damage and mechanical effects.

    PubMed

    Delfino, G; Amerini, S; Mugelli, A

    1988-01-01

    The ultrastructural damage in guinea-pig ventricular strips caused by barium was analysed. At a concentration of 1 mmol/litre, barium chloride caused a dramatic increase in the developed tension associated with the onset of automaticity. The ultrastructural analysis demonstrated that barium caused notable and consistent alterations which affected most myocyte components. Various degenerative aspects were observed in mitochondria and in the contractile apparatus. Glycogen deposits were completely depleted. Preparations driven at 4 Hz (i.e. the rate of spontaneous firing of barium-treated preparations) showed moderate ultrastructural alterations, thus demonstrating that the increase in the rate of beating is not the only determinant of the observed damage. These results suggest that the myocardial toxicity of barium is due not only to the well-known modifications in membrane permeability, but possibly also to alterations in cell function. PMID:20702358

  7. Emission analysis of a laser-produced barium plasma plume.

    PubMed

    Singh, R K; Joshi, H C; Kumar, Ajai

    2015-09-01

    In the present work we report the characteristic emission features of a laser-produced barium plasma plume. The time-resolved analysis for the different spectral lines of neutral and singly charged ionic barium has been carried out. It has been observed that the temporal evolution of electron temperature and density shows a peculiar behavior which is significantly different from the reported results of laser ablation of materials. The electron density increases with increase in delay time but the temperature does not change to any significant extent. Strong self-reversal in the emission of a resonant singly charged barium ionic line (455.4 nm) with time delay indicates the increase of population of singly charged barium ion with time. The results are explained on the basis of the increased population of barium metastables and subsequent ionization (Penning type). PMID:26368891

  8. Characterization of ionomycin as a calcium ionophore.

    PubMed

    Liu, C; Hermann, T E

    1978-09-10

    The ionophorous properties of a new antibiotic, ionomycin, have been studied. It was found that the antibiotic is capable of extracting calcium ion from the bulk of an aqueous phase into an organic phase. The antibiotic also acts as a mobile ion carrier to transport the cation across a solvent barrier. The divalent cation selectivity order for ionomycin as determined by ion competition experiments was found to be: Ca greater than Mg greater than Sr = Ba, where the binding of strontium and barium by the antibiotic is insignificant. The antibiotic also binds La3+ to some extent, but its complexation with monovalent alkali metal ions is negligible. Measurement of the binding of ionomycin with Ca2+ indicates that ionomycin complexes and transports calcium ion in a one to one stoichiometry. PMID:28319

  9. Calcium and bones

    MedlinePlus

    Bone strength and calcium ... calcium (as well as phosphorus) to make healthy bones. Bones are the main storage site of calcium in ... your body does not absorb enough calcium, your bones can get weak or will not grow properly. ...

  10. Get Enough Calcium

    MedlinePlus

    ... Calcium Print This Topic En español Get Enough Calcium Browse Sections The Basics Overview Foods and Vitamins ... 2 of 4 sections Take Action! Take Action: Calcium Sources Protect your bones – get plenty of calcium ...

  11. Calcium carbonate overdose

    MedlinePlus

    Tums overdose; Calcium overdose ... Calcium carbonate can be dangerous in large amounts. ... Some products that contain calcium carbonate are certain: ... and mineral supplements Other products may also contain calcium ...

  12. Proton conductivity of potassium doped barium zirconates

    NASA Astrophysics Data System (ADS)

    Xu, Xiaoxiang; Tao, Shanwen; Irvine, John T. S.

    2010-01-01

    Potassium doped barium zirconates have been synthesized by solid state reactions. It was found that the solubility limit of potassium on A-sites is between 5% and 10%. Introducing extra potassium leads to the formation of second phase or YSZ impurities. The water uptake of barium zirconates was increased even with 5% doping of potassium at the A-site. The sintering conditions and conductivity can be improved significantly by adding 1 wt% ZnO during material synthesis. The maximum solubility for yttrium at B-sites is around 15 at% after introducing 1 wt% zinc. The conductivity of Ba 0.95K 0.05Zr 0.85Y 0.11Zn 0.04O 3-δ at 600 °C is 2.2×10 -3 S/cm in wet 5% H 2. The activation energies for bulk and grain boundary are 0.29(2), 0.79(2) eV in wet 5% H 2 and 0.31(1), 0.74(3) eV in dry 5% H 2. A power density of 7.7 mW/cm 2 at 718 °C was observed when a 1 mm thick Ba 0.95K 0.05Zr 0.85Y 0.11Zn 0.04O 3-δ pellet was used as electrolyte and platinum electrodes.

  13. Calcium cyanide

    Integrated Risk Information System (IRIS)

    Jump to main content . Integrated Risk Information System Recent Additions | Contact Us Search : All EPA IRIS • You are here : EPA Home • Research • Environmental Assessment • IRIS • IRIS Summaries Redirect Page As of September 28 , 2010 , the assessment summary for calcium cyanide is included in th

  14. External cadmium and internal calcium block of single calcium channels in smooth muscle cells from rabbit mesenteric artery.

    PubMed

    Huang, Y; Quayle, J M; Worley, J F; Standen, N B; Nelson, M T

    1989-11-01

    The patch clamp technique was used to record unitary currents through single calcium channels from smooth muscle cells of rabbit mesenteric arteries. The effects of external cadmium and cobalt and internal calcium, barium, cadmium, and magnesium on single channel currents were investigated with 80 mM barium as the charge carrier and Bay K 8644 to prolong openings. External cadmium shortened the mean open time of single Ca channels. Cadmium blocking and unblocking rate constants of 16.5 mM-1 ms-1 and 0.6 ms-1, respectively, were determined, corresponding to dissociation constant Kd of 36 microM at -20 mV. These results are very similar to those reported for cardiac muscle Ca channels (Lansman, J. B., P. Hess, and R. W. Tsien. 1986. J. Gen. Physiol. 88:321-347). In contrast, Cd2+ (01-10 mM), when applied to the internal surface of Ca channels in inside-out patches, did not affect the mean open time, mean unitary current, or the variance of the open channel current. Internal calcium induced a flickery block, with a Kd of 5.8 mM. Mean blocking and unblocking rate constants for calcium of 0.56 mM-1 ms-1 and 3.22 ms-1, respectively, were determined. Internal barium (8 mM) reduced the mean unitary current by 36%. We conclude that under our experimental conditions, the Ca channel is not symmetrical with respect to inorganic ion block and that intracellular calcium can modulate Ca channel currents via a low-affinity binding site. PMID:2481511

  15. Do all barium stars have a white dwarf companion?

    NASA Technical Reports Server (NTRS)

    Dominy, J. F.; Lambert, D. L.

    1983-01-01

    International Ultraviolet Explorer short-wavelength, low-dispersion spectra were analyzed for four barium, two mild barium, and one R-type carbon star in order to test the hypothesis that the barium and related giants are produced by mass transfer from a companion now present as a white dwarf. An earlier tentative identification of a white dwarf companion to the mild barium star Zeta Cyg is confirmed. For the other stars, no ultraviolet excess attributable to a white dwarf is seen. Limits are set on the bolometric magnitude and age of a possible white dwarf companion. Since the barium stars do not have obvious progenitors among main-sequence and subgiant stars, mass transfer must be presumed to occur when the mass-gaining star is already on the giant branch. This restriction, and the white dwarf's minimum age, which is greater than 8 x 10 to the 8th yr, determined for several stars, effectively eliminates the hypothesis that mass transfer from an asymptotic giant branch star creates a barium star. Speculations are presented on alternative methods of producing a barium star in a binary system.

  16. Hygienic importance of increased barium content in some fresh waters.

    PubMed

    Havlík, B; Hanusová, J; Rálková, J

    1980-01-01

    In surface waters of the mining and processing areas of uranium ore there is an increased content of free and bound barium ions due to the use of barium salts for the treatment of waste and mine waters containing radium. In model experiments with the algae Ankistrodesmus falcatus, Chlorella kessleri and Scenedesmus obliquus, we studied the effect of Ba2+ on the accumulation of 226Ra. It was found that the accumulation of radium by algae is negatively influenced with barium concentrations higher than 1 mg.l-1. The accumulation of barium of organisms of primary production was studied using 133BaCl2. At a barium content in the medium of 4.0, 0.46 and 0.04 mu. l-1, the algae accumulated 30-60% of the added amount of barium during an exposure of 15 days. Biochemical analyses showed that barium is bound to the cellular membrane and to other components of the algal cell that cannot be extracted with water or alcohol. PMID:7462608

  17. Aluminum and Young Artists.

    ERIC Educational Resources Information Center

    Anderson, Thomas

    1980-01-01

    The author suggests a variety of ways in which aluminum and aluminum foil can be used in elementary and junior high art classes: relief drawing and rubbing; printing; repousse; sculpture; mobiles; foil sculpture; and three dimensional design. Sources of aluminum supplies are suggested. (SJL)

  18. Photoluminescence of barium titanate and barium zirconate in multilayer disordered thin films at room temperature.

    PubMed

    Moreira, M L; Gurgel, M F C; Mambrini, G P; Leite, E R; Pizani, P S; Varela, J A; Longo, E

    2008-09-25

    The emission of wide band photoluminescence showed a synergic effect on barium zirconate and barium titanate thin films in alternate multilayer system at room temperature by 488 nm exiting wavelength. The thin films obtained by spin-coating were annealed at 350, 450, and 550 degrees C for 2 h. The X-ray patterns revealed the complete separation among the BaTiO3 and BaZrO3 phases in the adjacent films. Visible and intense photoluminescence was governed by BaZrO3 thin films in the multilayer system. Quantum mechanics calculations were used in order to simulate ordered and disordered thin films structures. The disordered models, which were built by using the displacement of formers and modifier networks, showed a different symmetry in each system, which is in accordance with experimental photoluminescence emission, thus allowing to establish a correlation among the structural and optical properties of these multilayered systems. PMID:18593105

  19. Proton conductivity of potassium doped barium zirconates

    SciTech Connect

    Xu Xiaoxiang; Tao Shanwen; Irvine, John T.S.

    2010-01-15

    Potassium doped barium zirconates have been synthesized by solid state reactions. It was found that the solubility limit of potassium on A-sites is between 5% and 10%. Introducing extra potassium leads to the formation of second phase or YSZ impurities. The water uptake of barium zirconates was increased even with 5% doping of potassium at the A-site. The sintering conditions and conductivity can be improved significantly by adding 1 wt% ZnO during material synthesis. The maximum solubility for yttrium at B-sites is around 15 at% after introducing 1 wt% zinc. The conductivity of Ba{sub 0.95}K{sub 0.05}Zr{sub 0.85}Y{sub 0.11}Zn{sub 0.04}O{sub 3-{delta}} at 600 deg. C is 2.2x10{sup -3} S/cm in wet 5% H{sub 2}. The activation energies for bulk and grain boundary are 0.29(2), 0.79(2) eV in wet 5% H{sub 2} and 0.31(1), 0.74(3) eV in dry 5% H{sub 2}. A power density of 7.7 mW/cm{sup 2} at 718 deg. C was observed when a 1 mm thick Ba{sub 0.95}K{sub 0.05}Zr{sub 0.85}Y{sub 0.11}Zn{sub 0.04}O{sub 3-{delta}} pellet was used as electrolyte and platinum electrodes. - Graphical abstract: Potassium doped barium zirconates have been synthesized by solid state reactions. It was found that the solubility limit of potassium on A-sites is between 5% and 10 %. The sintering conditions and conductivity can be improved significantly by adding 1 wt% ZnO during material synthesis. Five percent doping of potassium at A-site can double the total conductivity.

  20. Designed microstructures in textured barium hexaferrite

    NASA Astrophysics Data System (ADS)

    Hovis, David Brian

    It is a fundamental principle of materials science that the microstructure of a material defines its properties and ultimately its performance for a given application. A prime example of this can be found in the large conch shell Strombus gigas, which has an intricate microstructure extending across five distinct length scales. This microstructure gives extraordinary damage tolerance to the shell. The structure of Strombus gigas cannot be replicated in a modern engineering ceramic with any existing processing technique, so new processing techniques must be developed to apply this structure to a model material. Barium hexaferrite was chosen as a model material to create microstructures reminiscent of Strombus gigas and evaluate its structure-property relations. This work describes novel processing methods to produce textured barium hexaferrite with no coupling between the sample geometry and the texture direction. This technique, combining magnetic field-assisted gelcasting with templated grain growth, also allows multilayer samples to be fabricated with different texture directions in adjacent layers. The effects of adding either B2O3 or excess BaCO 3 on the densification and grain growth of barium hexaferrite was studied. The texture produced using this technique was assessed using orientation imaging microscopy (OIM) at Oak Ridge National Laboratory. These measurements showed peak textures as high as 60 MRD and sharp interfaces between layers cast with different texture directions. The effect of oxygen on the quality of gelcasting is also discussed, and it is shown that with proper mold design, it is possible to gelcast multiple layers with differing texture directions without delamination. Monolithic and multilayer samples were produced and tested in four point bending to measure the strength and work of fracture. Modulus measurements, made with the ultrasonic pulse-echo technique, show clear signs of microcracking in both the isotropic and textured samples

  1. Effect of B-site europium doping on the hydrogen transport properties of barium cerate

    NASA Astrophysics Data System (ADS)

    Rhodes, James Michael

    Barium cerate doped with europium on the Ce-site (B-site of the ABO3 perovskite structure) has been investigated as a potential material for hydrogen separation. Barium cerate doped with 15 mol% europium (BaCe0.85Eu0.15O3-delta) demonstrated higher electrical conductivity in a hydrogen-containing gas stream than gadolinium-doped barium cerate (BaCe0.85Gd0.15O3-delta), which was known to have one of the highest conductivities (0.027 S/cm 2 compared to 0.021 S/cm2 at 800°C). For europium dopant levels between 5 to 25 mol%, the sample doped with 15 mol% demonstrated higher electrical conductivities in dry forming gas (4% H2/96% N2) dry air, and wet nitrogen. The activation energies in dry air (˜0.60 eV) were indicative of p-type electronic conduction, and the activation energies in hydrogen-containing gases (˜0.35--0.45 eV) were indicative of protonic conduction. With BaCe0.85Eu0.15O3-delta , the onset of n-type electronic conductivity necessary for hydrogen separation was shown to occur at ˜600°C. A gas-tight glass seal was developed to study the hydrogen permeation properties of BaCe0.85Eu0.15O3-delta. The glass seal was a composite of a glass containing strontium oxide, boron oxide, silicon oxide, aluminum oxide, and lanthanum oxide mixed with doped barium cerate powder. The seal would form at temperatures >875°C, allowing for testing down to 650°C. The effect of temperature, feed-side hydrogen partial pressure, and membrane thickness on hydrogen permeation flux of BaCe0.85Eu0.15O 3-delta was investigated. For the range of thicknesses studied (0.75 to 2.00 mm), the performance of BaCe0.85Eu0.15O 3-delta membranes is under mixed control of bulk diffusion and surface kinetics. This mixed control indicates that investigating BaCe 0.85Eu0.15O3-delta membranes thinner than 0.75 mm would result in a limited increase in hydrogen permeation flux unless measures were taken to improve surface kinetics. The need for improved surface kinetics was confirmed when surface

  2. Energetic Insight into the Formation of Solids from Aluminum Polyoxocations.

    PubMed

    Reusser, Dana; Casey, William H; Navrotsky, Alexandra

    2015-08-01

    The ε-Keggin [AlO4Al12(OH)24(H2O)12](7+) ion (AlAl12(7+)) is a metastable precursor in the formation of aluminum oxyhydroxide solids. It also serves as a useful model for the chemistry of aluminous mineral surfaces. Herein we calculate the enthalpies of formation for this aqueous ion and its heterometal-substituted forms, GaAl12(7+) and GeAl12(8+), using solution calorimetry. Rather than measuring the enthalpies of the MAl12(7/8+) ions directly from solution hydrolysis, we measured the metathesis reaction of the crystallized forms with barium chloride creating an aqueous aluminum solution monospecific in MAl12(7/8+). Then, the contributions to the heat of formation from the crystallized forms were subtracted using referenced states. When comparing the aqueous AlAl12(7+) ion to solid aluminum (oxy)-hydroxide phases, we found that this ion lies closer in energy to solid phases than to aqueous aluminum monomers, thus explaining its role as a precursor to amorphous aluminum hydroxide phases. PMID:26129924

  3. Metallurgical Properties and Phase Transformations of Barium-Strontium Modifier

    NASA Astrophysics Data System (ADS)

    Platonov, M. A.; Sulimova, I. S.; Rozhikhina, I. D.; Dmitrienko, V. I.; Horoshun, G. V.

    2016-04-01

    Metallurgical properties and phase transformations of barium-strontium modifier were tested in laboratory conditions resembling steel processing in furnace and ladle. When heating barium-strontium modifier start of melting, kinetics of decomposition, phase and structure transformation were studied. The concentrate under consideration has been revealed to be a complex mineral compound containing barytocalcite, calcite, calciostrontianite, dolomite and siderite. The reaction kinetics of decomposing mineral components of barium-strontium modifier to oxides does not considerably affect slag formation in conditions of out-of-furnace steel processing.

  4. A high-altitude barium radial injection experiment

    NASA Technical Reports Server (NTRS)

    Wescott, E. M.; Stenbaek-Nielsen, H. C.; Hallinan, T. J.; Deehr, C. S.; Romick, G. J.; Olson, J. V.; Roederer, J. G.; Sydora, R.

    1980-01-01

    A rocket launched from Poker Flat, Alaska, carried a new type of high-explosive barium shaped charge to 571 km, where detonation injected a thin disk of barium vapor with high velocity nearly perpendicular to the magnetic field. The TV images of the injection are spectacular, revealing three major regimes of expanding plasma which showed early instabilities in the neutral gas. The most unusual effect of the injection is a peculiar rayed barium-ion structure lying in the injection plane and centered on a 5 km 'black hole' surrounding the injection point. Preliminary electrostatic computer simulations show a similar rayed development.

  5. Barium hexaferrite ferrofluids - preparation and physical properties

    NASA Astrophysics Data System (ADS)

    Müller, R.; Hiergeist, R.; Steinmetz, H.; Ayoub, N.; Fujisaki, M.; Schüppel, W.

    1999-07-01

    Barium hexaferrite BaFe 12-2 xTi xCo xO 19 ferrofluids have been prepared for the first time using oleic acid as surfactant and Isopar M ® as carrier liquid. The initial susceptibility versus temperature for zero-field cooling of the ferrofluid was obtained by a vibrating sample magnetometer. TEM pictures of the fluid show isolated particles and only small agglomerates and a mean particle diameter of approx. 8 nm. Numerical calculations of the magneto-viscous effect, based on the local-equilibrium magnetic state model, clearly show the benefit for Ba-ferrite ferrofluids resulting from the high uniaxial anisotropy compared to magnetite ferrofluids. Rheological measurements were performed with a rotational-type viscometer with magnetic field perpendicular to the hydrodynamic vortex axis.

  6. Aluminum reference electrode

    DOEpatents

    Sadoway, Donald R.

    1988-01-01

    A stable reference electrode for use in monitoring and controlling the process of electrolytic reduction of a metal. In the case of Hall cell reduction of aluminum, the reference electrode comprises a pool of molten aluminum and a solution of molten cryolite, Na.sub.3 AlF.sub.6, wherein the electrical connection to the molten aluminum does not contact the highly corrosive molten salt solution. This is accomplished by altering the density of either the aluminum (decreasing the density) or the electrolyte (increasing the density) so that the aluminum floats on top of the molten salt solution.

  7. Aluminum reference electrode

    DOEpatents

    Sadoway, D.R.

    1988-08-16

    A stable reference electrode is described for use in monitoring and controlling the process of electrolytic reduction of a metal. In the case of Hall cell reduction of aluminum, the reference electrode comprises a pool of molten aluminum and a solution of molten cryolite, Na[sub 3]AlF[sub 6], wherein the electrical connection to the molten aluminum does not contact the highly corrosive molten salt solution. This is accomplished by altering the density of either the aluminum (decreasing the density) or the electrolyte (increasing the density) so that the aluminum floats on top of the molten salt solution. 1 fig.

  8. Stimulation of sugar uptake and thymidine incorporation in mouse 3T3 cells by calcium phosphate and other extracellular particles.

    PubMed Central

    Barnes, D W; Colowick, S P

    1977-01-01

    Evidence is presented that the marked stimulation of sugar uptake and thymidine incorporation by addition of extra Ca2+ to stationary phase mouse 3T3 cells in culture is phosphate dependent and due to the action of the calcium phosphate precipitate formed in the medium. The cells are similarly stimulated by a variety of particulate materials, including calcium pyrophosphate, barium sulfate, kaolin, and polystrene beads. The precipitate effects on sugar uptake are of the same magnitude as those seen with certain hormones (insulin, epidermal growth factor) or with fresh 10% calf serum. The effect of barium sulfate on thymidine incorporation is also of the same magnitude as seen with these hormones, but much less than half that found with fresh calf serum. The stimulation by barium sulfate or hormones of thymidine incorporation is not phosphate dependent. PMID:202958

  9. Stimulation of sugar uptake and thymidine incorporation in mouse 3T3 cells by calcium phosphate and other extracellular particles.

    PubMed

    Barnes, D W; Colowick, S P

    1977-12-01

    Evidence is presented that the marked stimulation of sugar uptake and thymidine incorporation by addition of extra Ca2+ to stationary phase mouse 3T3 cells in culture is phosphate dependent and due to the action of the calcium phosphate precipitate formed in the medium. The cells are similarly stimulated by a variety of particulate materials, including calcium pyrophosphate, barium sulfate, kaolin, and polystrene beads. The precipitate effects on sugar uptake are of the same magnitude as those seen with certain hormones (insulin, epidermal growth factor) or with fresh 10% calf serum. The effect of barium sulfate on thymidine incorporation is also of the same magnitude as seen with these hormones, but much less than half that found with fresh calf serum. The stimulation by barium sulfate or hormones of thymidine incorporation is not phosphate dependent. PMID:202958

  10. Phased surgical treatment of barium enema-induced rectal injury and retention of barium in the pelvic floor space

    PubMed Central

    Yang, Xuefei; Xia, Ligang; Huang, Jun; Wang, Jianping

    2014-01-01

    Iatrogenic injuries caused by barium enema are rarely reported. Following a phased surgical protocol for up to one year, we have successfully treated a patient with rectal injury and severe infection of the pelvic floor space complicated with retention of large amounts of barium and vaginal fistula. In this article, the phased surgery planning for the treatment of rectal injury complicated with vaginal fistula is discussed in terms of the pros and cons, and the observed effect and evolution of barium retained in the pelvic floor space are described. PMID:25405155

  11. Adsorption of radium and barium on goethite and ferrihydrite: A kinetic and surface complexation modelling study

    NASA Astrophysics Data System (ADS)

    Sajih, M.; Bryan, N. D.; Livens, F. R.; Vaughan, D. J.; Descostes, M.; Phrommavanh, V.; Nos, J.; Morris, K.

    2014-12-01

    Radium and barium uptake onto ferrihydrite and goethite have been studied in the concentration range 1 nM to 5 mM and from pH 4 to 10, to develop a model to predict radium behaviour in legacy uranium mining wastes. For ferrihydrite, uptake of Ra2+ at nM concentrations was strong at pH >7. At higher concentrations, Ba2+ sorption to ferrihydrite was slightly weaker than that of Ra2+. Experiments with goethite showed weaker binding for both metal ions in all systems. The interactions of radium with both ferrihydrite and goethite are fully reversible. The behaviour of radium during transformation of ferrihydrite to goethite has been studied, and no evidence for irreversible incorporation within the goethite lattice was found; radium uptake to goethite was the same, whether or not it was present during its formation. Calcium competed with radium for ferrihydrite sorption only at high calcium concentrations (>10 mM). Barium is a more effective competitor, and a concentration of 1 mM reduced radium sorption. Sediment samples from a legacy uranium mining site have been analysed, and the in situ Rd values are consistent with radium uptake by surface coatings of ferrihydrite or goethite like phases. Surface complexation models have been developed for radium sorption to ferrihydrite and goethite which simulate the experimental data successfully. In both cases, approaches based on a single surface functional group and tetradentate binding sites simulated the data successfully. These data could be used in underpinning the safety case for legacy mining sites.

  12. Upper gastrointestinal barium evaluation of duodenal pathology: A pictorial review

    PubMed Central

    Gupta, Pankaj; Debi, Uma; Sinha, Saroj Kant; Prasad, Kaushal Kishor

    2014-01-01

    Like other parts of the gastrointestinal tract (GIT), duodenum is subject to a variety of lesions both congenital and acquired. However, unlike other parts of the GIT viz. esophagus, rest of the small intestine and large intestine, barium evaluation of duodenal lesions is technically more challenging and hence not frequently reported. With significant advances in computed tomography technology, a thorough evaluation including intraluminal, mural and extramural is feasible in a single non-invasive examination. Notwithstanding, barium evaluation still remains the initial and sometimes the only imaging study in several parts of the world. Hence, a thorough acquaintance with the morphology of various duodenal lesions on upper gastrointestinal barium examination is essential in guiding further evaluation. We reviewed our experience with various common and uncommon barium findings in duodenal abnormalities. PMID:25170399

  13. Calculated emission rates for barium releases in space

    NASA Technical Reports Server (NTRS)

    Stenbaek-Nielsen, H. C.

    1989-01-01

    The optical emissions from barium releases in space are caused by resonance and fluorescent scattering of sunlight. Emission rates for the dominant ion and neutral lines are calculated assuming the release to be optically thin and the barium to be in radiative equilibrium with the solar radiation. The solar spectrum has deep Fraunhofer absorption lines at the primary barium ion resonances. A velocity component toward or away from the sun will Doppler shift the emission lines relative to the absorption lines and the emission rates will increase many-fold over the rest value. The Doppler brightening is important in shaped charge or satellite releases where the barium is injected at high velocities. Emission rates as a function of velocity are calculated for the 4554, 4934, 5854, 6142 and 6497 A ion emission lines and the dominant neutral line at 5535 A. Results are presented for injection parallel to the ambient magnetic field, B, and for injection at an angle to B.

  14. Study of the photovoltaic effect in thin film barium titanate

    NASA Technical Reports Server (NTRS)

    Grannemann, W. W.; Dharmadhikari, V. S.

    1983-01-01

    The feasibility of making non-volatile digital memory devices of barium titanate, BaTiO3, that are integrated onto a silicon substrate with the required ferroelectric film produced by processing, compatible with silicon technology was examined.

  15. Synthesis, photoluminescence and magnetic properties of barium vanadate nanoflowers

    SciTech Connect

    Xu, Jing; Hu, Chenguo; Xi, Yi; Peng, Chen; Wan, Buyong; He, Xiaoshan

    2011-06-15

    Graphical abstract: The flower-shaped barium vanadate was obtained for the first time. The photoluminescence and magnetic properties of the barium vanadate nanoflowers were investigated at room temperature. Research highlights: {yields} In the paper, the flower-shaped barium vanadate were obtained for the first time. The CHM method used here is new and simple for preparation of barium vanadate. {yields} The photoluminescence and magnetic properties of the barium vanadate nanoflowers were investigated at room temperature. The strong bluish-green emission was observed. {yields} The ferromagnetic behavior of the barium vanadate nanoflowers was found with saturation magnetization of about 83.50 x 10{sup -3} emu/g, coercivity of 18.89 Oe and remnant magnetization of 4.63 x 10{sup -3} emu/g. {yields} The mechanisms of PL and magnetic property of barium vanadate nanoflowers have been discussed. -- Abstract: The flower-shaped barium vanadate has been obtained by the composite hydroxide mediated (CHM) method from V{sub 2}O{sub 5} and BaCl{sub 2} at 200 {sup o}C for 13 h. XRD and XPS spectrum of the as-synthesized sample indicate it is hexagonal Ba{sub 3}V{sub 2}O{sub 8} with small amount of Ba{sub 3}VO{sub 4.8} coexistence. Scan electron microscope and transmission electron microscope display that the flower-shaped crystals are composed of nanosheets with thickness of {approx}20 nm. The UV-visible spectrum shows that the barium vanadate sample has two optical gaps (3.85 eV and 3.12 eV). Photoluminescence spectrum of the barium vanadate flowers exhibits a visible light emission centered at 492 and 525 nm which might be attributed to VO{sub 4} tetrahedron with T{sub d} symmetry in Ba{sub 3}V{sub 2}O{sub 8}. The ferromagnetic behavior of the barium vanadate nanoflowers has been found with saturation magnetization of about 83.50 x 10{sup -3} emu/g, coercivity of 18.89 Oe and remnant magnetization of 4.63 x 10{sup -3} emu/g, which is mainly due to the presence of a non

  16. A search for technetium (Tc II) in barium stars

    NASA Technical Reports Server (NTRS)

    Little-Marenin, Irene R.; Little, Stephen J.

    1987-01-01

    The authors searched without success for the lines of Tc II at 2647.02, 2610.00 and 2543.24 A in IUE spectra of the barium stars HR 5058, Omicron Vir, and Zeta Cap. The lack of Tc II implies that the observed s-process enhancements were produced more than half a million years ago and supports the suggestion that the spectral peculiarities of barium stars are probably related to the binary nature of the stars.

  17. 'Skidding' of the CRRES G-9 barium release

    NASA Technical Reports Server (NTRS)

    Huba, J. D.; Mitchell, H. G.; Fedder, J. A.; Bernhardt, P. A.

    1992-01-01

    A simulation study and experimental data of the CRRES G-9 ionospheric barium release are presented. The simulation study is based on a 2D electrostatic code that incorporates time-dependent coupling to the background plasma. It is shown that the densest portion of the barium ion cloud 'skids' about 15 km within the first three seconds following the release, consistent with the optical data analyses.

  18. Solar eclipse sign of intussusception on barium enema.

    PubMed

    Raveenthiran, V

    2002-01-01

    The colographic appearance of intussusception is variously described as a claw sign, pincer defect, shouldering effect, and coiled-spring pattern. This report adds a new radiographic sign to the list. An end-on view of an intussusception on barium enema shows a ring of contrast resembling a solar eclipse. Familiarity with this bizarre appearance is desirable, lest it may be mistaken for spillage of barium due to a colonic perforation. PMID:11793074

  19. Aluminum: Recycling of Aluminum Dross/Saltcake

    SciTech Connect

    Blazek, S.

    1999-01-29

    As this NICE3 publication details, the objective of this project is to commercialize the process technology to eliminate all landfill waste associated with black dross and saltcake generated from aluminum recycling in the United States.

  20. Aluminum powder metallurgy processing

    NASA Astrophysics Data System (ADS)

    Flumerfelt, Joel Fredrick

    In recent years, the aluminum powder industry has expanded into non-aerospace applications. However, the alumina and aluminum hydroxide in the surface oxide film on aluminum powder require high cost powder processing routes. A driving force for this research is to broaden the knowledge base about aluminum powder metallurgy to provide ideas for fabricating low cost aluminum powder components. The objective of this dissertation is to explore the hypothesis that there is a strong linkage between gas atomization processing conditions, as-atomized aluminum powder characteristics, and the consolidation methodology required to make components from aluminum powder. The hypothesis was tested with pure aluminum powders produced by commercial air atomization commercial inert gas atomization and gas atomization reaction synthesis (GARS). The commercial atomization methods are bench marks of current aluminum powder technology. The GARS process is a laboratory scale inert gas atomization facility. A benefit of using pure aluminum powders is an unambiguous interpretation of the results without considering the effects of alloy elements. A comparison of the GARS aluminum powders with the commercial aluminum powders showed the former to exhibit superior powder characteristics. The powders were compared in terms of size and shape, bulk chemistry, surface oxide chemistry and structure, and oxide film thickness. Minimum explosive concentration measurements assessed the dependence of explosibility hazard on surface area, oxide film thickness, and gas atomization processing conditions. The GARS aluminum powders were exposed to different relative humidity levels, demonstrating the effect of atmospheric conditions on post-atomization oxidation of aluminum powder. An Al-Ti-Y GARS alloy exposed in ambient air at different temperatures revealed the effect of reactive alloy elements on post-atomization powder oxidation. The pure aluminum powders were consolidated by two different routes, a

  1. Calcium and Vitamin D

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Calcium is required for the bone formation phase of bone remodeling. Typically about 5 nmol (200 mg) of calcium is removed from the adult skeleton and replaced each day. To supply this amount, one would need to consume about 600 mg of calcium, since calcium is not very efficiently absorbed. Calcium ...

  2. Randomized crossover study comparing the phosphate-binding efficacy of calcium ketoglutarate versus calcium carbonate in patients on chronic hemodialysis.

    PubMed

    Bro, S; Rasmussen, R A; Handberg, J; Olgaard, K; Feldt-Rasmussen, B

    1998-02-01

    The objective of the study was to evaluate the phosphate-binding efficacy, side effects, and cost of therapy of calcium ketoglutarate granulate as compared with calcium carbonate tablets in patients on chronic hemodialysis. The study design used was a randomized, crossover open trial, and the main outcome measurements were plasma ionized calcium levels, plasma phosphate levels, plasma intact parathyroid hormone (PTH) levels, requirements for supplemental aluminum-aminoacetate therapy, patient tolerance, and cost of therapy. Nineteen patients on chronic hemodialysis were treated with a dialysate calcium concentration of 1.25 mmol/L and a fixed alfacalcidol dose for at least 2 months. All had previously tolerated therapy with calcium carbonate. Of the 19 patients included, 10 completed both treatment arms. After 12 weeks of therapy, the mean (+/-SEM) plasma ionized calcium level was significantly lower in the ketoglutarate arm compared with the calcium carbonate arm (4.8+/-0.1 mg/dL v 5.2+/-0.1 mg/dL; P = 0.004), whereas the mean plasma phosphate (4.5+/-0.3 mg/dL v 5.1+/-0.1 mg/dL) and PTH levels (266+/-125 pg/mL v 301+/-148 pg/mL) did not differ significantly between the two treatment arms. Supplemental aluminum-aminoacetate was not required during calcium ketoglutarate treatment, while two patients needed this supplement when treated with calcium carbonate. Five of 17 (29%) patients were withdrawn from calcium ketoglutarate therapy within 1 to 2 weeks due to intolerance (anorexia, vomiting, diarrhea, general uneasiness), whereas the remaining 12 patients did not experience any side effects at all. The five patients with calcium ketoglutarate intolerance all had pre-existing gastrointestinal symptoms; four of them had received treatment with cimetidine or omeprazol before inclusion into the study. Calculations based on median doses after 12 weeks showed that the cost of the therapy in Denmark was 10 times higher for calcium ketoglutarate compared with calcium

  3. Releasing effects in flame photometry: Determination of calcium

    USGS Publications Warehouse

    Dinnin, J.I.

    1960-01-01

    Strontium, lanthanum, neodymium, samarium, and yttrium completely release the flame emission of calcium from the depressive effects of sulfate, phosphate, and aluminate. Magnesium, beryllium, barium, and scandium release most of the calcium emission. These cations, when present in high concentration, preferentially form compounds with the depressing anions when the solution is evaporated rapidly in the flame. The mechanism of the interference and releasing effects is explained on the basis of the chemical equilibria in the evaporating droplets of solution and is shown to depend upon the nature of the compounds present in the aqueous phase of the solution. The need for background correction techniques is stressed. The releasing effect is used in the determination of calcium in silicate rocks without the need for separations.

  4. Fabrication of Lotus-Type Porous Aluminum through Thermal Decomposition Method

    NASA Astrophysics Data System (ADS)

    Kim, S. Y.; Park, J. S.; Nakajima, H.

    2009-04-01

    Lotus-type porous aluminum with cylindrical pores was fabricated by unidirectional solidification through thermal decomposition of calcium hydroxide, sodium bicarbonate, or titanium hydride. The pore-forming gas decomposed from calcium hydroxide, sodium bicarbonate, and titanium hydride is identified as hydrogen. The elongated pores are evolved due to the solubility gap between liquid and solid when the melt dissolving hydrogen is solidified unidirectionally. The porosity of lotus aluminum is as high as 20 pct despite the type of the compounds. The pore size decreases and the pore density increases with increasing amount of calcium hydroxide, which is explained by an increase in the number of pore nucleation sites. The porosity and pore size in lotus aluminum fabricated using calcium hydroxide decrease with increasing argon pressure, which is explained by Boyle’s law. It is suggested that this fabrication method is simple and safe, which makes it superior to the conventional technique using high-pressure hydrogen gas.

  5. Aspects of aluminum toxicity

    SciTech Connect

    Hewitt, C.D.; Savory, J.; Wills, M.R. )

    1990-06-01

    Aluminum is the most abundant metal in the earth's crust. The widespread occurrence of aluminum, both in the environment and in foodstuffs, makes it virtually impossible for man to avoid exposure to this metal ion. Attention was first drawn to the potential role of aluminum as a toxic metal over 50 years ago, but was dismissed as a toxic agent as recently as 15 years ago. The accumulation of aluminum, in some patients with chronic renal failure, is associated with the development of toxic phenomena; dialysis encephalopathy, osteomalacic dialysis osteodystrophy, and an anemia. Aluminum accumulation also occurs in patients who are not on dialysis, predominantly infants and children with immature or impaired renal function. Aluminum has also been implicated as a toxic agent in the etiology of Alzheimer's disease, Guamiam amyotrophic lateral sclerosis, and parkinsonism-dementia. 119 references.

  6. Calcium and bones (image)

    MedlinePlus

    Calcium is one of the most important minerals for the growth, maintenance, and reproduction of the human ... body, are continually being re-formed and incorporate calcium into their structure. Calcium is essential for the ...

  7. Calcium source (image)

    MedlinePlus

    Getting enough calcium to keep bones from thinning throughout a person's life may be made more difficult if that person has ... as a tendency toward kidney stones, for avoiding calcium-rich food sources. Calcium deficiency also effects the ...

  8. Coronary Calcium Scan

    MedlinePlus

    ... the NHLBI on Twitter. What Is a Coronary Calcium Scan? A coronary calcium scan is a test ... you have calcifications in your coronary arteries. Coronary Calcium Scan Figure A shows the position of the ...

  9. Calcium hydroxide poisoning

    MedlinePlus

    Hydrate - calcium; Lime milk; Slaked lime ... Calcium hydroxide ... These products contain calcium hydroxide: Cement Limewater Many industrial solvents and cleaners (hundreds to thousands of construction products, flooring strippers, brick cleaners, cement ...

  10. BONDING ALUMINUM METALS

    DOEpatents

    Noland, R.A.; Walker, D.E.

    1961-06-13

    A process is given for bonding aluminum to aluminum. Silicon powder is applied to at least one of the two surfaces of the two elements to be bonded, the two elements are assembled and rubbed against each other at room temperature whereby any oxide film is ruptured by the silicon crystals in the interface; thereafter heat and pressure are applied whereby an aluminum-silicon alloy is formed, squeezed out from the interface together with any oxide film, and the elements are bonded.

  11. Aluminum powder metallurgy processing

    SciTech Connect

    Flumerfelt, J.F.

    1999-02-12

    The objective of this dissertation is to explore the hypothesis that there is a strong linkage between gas atomization processing conditions, as-atomized aluminum powder characteristics, and the consolidation methodology required to make components from aluminum powder. The hypothesis was tested with pure aluminum powders produced by commercial air atomization, commercial inert gas atomization, and gas atomization reaction synthesis (GARS). A comparison of the GARS aluminum powders with the commercial aluminum powders showed the former to exhibit superior powder characteristics. The powders were compared in terms of size and shape, bulk chemistry, surface oxide chemistry and structure, and oxide film thickness. Minimum explosive concentration measurements assessed the dependence of explosibility hazard on surface area, oxide film thickness, and gas atomization processing conditions. The GARS aluminum powders were exposed to different relative humidity levels, demonstrating the effect of atmospheric conditions on post-atomization processing conditions. The GARS aluminum powders were exposed to different relative humidity levels, demonstrating the effect of atmospheric conditions on post-atomization oxidation of aluminum powder. An Al-Ti-Y GARS alloy exposed in ambient air at different temperatures revealed the effect of reactive alloy elements on post-atomization powder oxidation. The pure aluminum powders were consolidated by two different routes, a conventional consolidation process for fabricating aerospace components with aluminum powder and a proposed alternative. The consolidation procedures were compared by evaluating the consolidated microstructures and the corresponding mechanical properties. A low temperature solid state sintering experiment demonstrated that tap densified GARS aluminum powders can form sintering necks between contacting powder particles, unlike the total resistance to sintering of commercial air atomization aluminum powder.

  12. Coherent control of photoionization of atomic barium

    NASA Astrophysics Data System (ADS)

    Yamazaki, Rekishu

    We present the results of our study on coherent control of photoionization of atomic barium. Our study focused on the understanding of the controllability, especially due to the effect of the coherent interaction between the atomic system and the laser field. The first half of the study investigates the mechanisms of the control behind the previously observed laser phase-insensitive product state control. The controllability of this excitation scheme, two-color two-photon resonantly enhanced excitation, was analyzed from two aspects, the role of ac Stark shift introduced by the strong laser field and the multi-pathway quantum mechanical interferences. We have analyzed the excitation scheme from the analysis of the photoelectron angular distribution measured using the excitation scheme and the monitoring of the intermediate state population. Analysis of the data as well as the numerical simulation showed clear understanding of the role of two mechanisms in the product state control reported. We also investigated the control of the phase lag during the product state control. We conducted the control of the phase lag in the study of asymmetric photoelectron angular distribution, which arises from the concurrent even-odd parity outgoing electron wave excitation. The phase lag was controlled in full range, 2pi, and the results were analyzed in terms of the role of autoionizing resonance structures as well as the nature of outgoing electron waves at different locations of the autoionizing resonances.

  13. Barium Tagging for nEXO

    NASA Astrophysics Data System (ADS)

    Fudenberg, Daniel; Brunner, Thomas; Varentsov, Victor; Devoe, Ralph; Dilling, Jens; Gratta, Giorgio; nEXO Collaboration

    2015-10-01

    nEXO is a next-generation experiment designed to search for 0 νββ -decay of Xe-136 in a liquid xenon time projection chamber. Positive observation of this decay would determine the neutrino to be a Majorana particle In order to greatly reduce background contributions to this search, the collaboration is developing several ``barium tagging'' techniques to recover and identify the decay daughter, Ba-136. ``Tagging'' may be available for a 2nd phase of nEXO and will push the sensitivity beyond the inverted neutrino-mass hierarchy. Tagging methods in testing for this phase include Ba-ion capture on a probe with identification by resonance ionization laser spectroscopy, and Ba capture in solid xenon on a cold probe with identification by fluorescence. In addition, Ba tagging for a gas-phase detector, appropriate for a later stage, is being tested. Here efficient ion extraction from heavy carrier gases is key. Detailed gas-dynamic and ion transport calculations have been performed to optimize for ion extraction. An apparatus to extract Ba ions from up to 10 bar xenon gas into vacuum using an RF-only funnel has been constructed and demonstrates extraction of ions from noble gases. We will present this system's status along with results of this R&D program.

  14. High H- ionic conductivity in barium hydride

    NASA Astrophysics Data System (ADS)

    Verbraeken, Maarten C.; Cheung, Chaksum; Suard, Emmanuelle; Irvine, John T. S.

    2015-01-01

    With hydrogen being seen as a key renewable energy vector, the search for materials exhibiting fast hydrogen transport becomes ever more important. Not only do hydrogen storage materials require high mobility of hydrogen in the solid state, but the efficiency of electrochemical devices is also largely determined by fast ionic transport. Although the heavy alkaline-earth hydrides are of limited interest for their hydrogen storage potential, owing to low gravimetric densities, their ionic nature may prove useful in new electrochemical applications, especially as an ionically conducting electrolyte material. Here we show that barium hydride shows fast pure ionic transport of hydride ions (H-) in the high-temperature, high-symmetry phase. Although some conductivity studies have been reported on related materials previously, the nature of the charge carriers has not been determined. BaH2 gives rise to hydride ion conductivity of 0.2 S cm-1 at 630 °C. This is an order of magnitude larger than that of state-of-the-art proton-conducting perovskites or oxide ion conductors at this temperature. These results suggest that the alkaline-earth hydrides form an important new family of materials, with potential use in a number of applications, such as separation membranes, electrochemical reactors and so on.

  15. Development of advanced barium ferrite tape media

    NASA Astrophysics Data System (ADS)

    Shimizu, Osamu; Oyanagi, Masahito; Morooka, Atsushi; Mori, Masahiko; Kurihashi, Yuich; Tada, Toshio; Suzuki, Hiroyuki; Harasawa, Takeshi

    2016-02-01

    We developed an advanced particulate magnetic tape using fine barium ferrite (BaFe) particles for magnetic-tape storage systems. The new tape showed a signal-to-noise ratio (SNR) that was 3.5 dB higher than that of the commercially available BaFe tape used for the Linear Tape Open generation 6 tape-storage system, at a linear density of 300 kfci measured with a giant magnetoresistive head with a reader width of 0.45 μm. Such significant increase in SNR was achieved by reducing the magnetic particle volume from 1950 to 1350 nm3, while maintaining a sufficiently high thermal stability, improving the perpendicular squareness ratio from 0.66 to 0.83, and improving the surface roughness from 2.5 to 2.0 nm when measured by atomic force microscopy and from 2.4 to 0.9 nm when measured by optical interferometry. This paper describes the characteristics of the new BaFe particles and media, which are expected to be employed for future high-capacity linear-tape systems.

  16. The flame photometric determination of calcium in phosphate, carbonate, and silicate rocks

    USGS Publications Warehouse

    Kramer, H.

    1957-01-01

    A flame photometric method of determining calcium in phosphate, carbonate, and silicate locks has been developed Aluminum and phosphate interference was overcome by the addition of a large excess of magnesium. The method is rapid and suitable for routine analysis Results obtained are within ?? 2% of the calcium oxide content. ?? 1957.

  17. Characterization of calcium oxalate defective (cod) 3 mutant from Medicago truncatula

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Many plants invest a considerable amount of resources and energy into the formation of calcium oxalate crystals. Assigned roles for plant crystal formation include functions in defense, calcium regulation, and aluminum tolerance. From a human health standpoint, oxalate present in edible plant tiss...

  18. Carbothermic Aluminum Production Using Scrap Aluminum As A Coolant

    DOEpatents

    LaCamera, Alfred F.

    2002-11-05

    A process for producing aluminum metal by carbothermic reduction of alumina ore. Alumina ore is heated in the presence of carbon at an elevated temperature to produce an aluminum metal body contaminated with about 10-30% by wt. aluminum carbide. Aluminum metal or aluminum alloy scrap then is added to bring the temperature to about 900-1000.degree. C. and precipitate out aluminum carbide. The precipitated aluminum carbide is filtered, decanted, or fluxed with salt to form a molten body having reduced aluminum carbide content.

  19. MTBE OXIDATION BY BIFUNCTIONAL ALUMINUM

    EPA Science Inventory

    Bifunctional aluminum, prepared by sulfating zero-valent aluminum with sulfuric acid, has a dual functionality of simultaneously decomposing both reductively- and oxidatively-degradable contaminants. In this work, the use of bifunctional aluminum for the degradation of methyl te...

  20. Studies on aluminum neurotoxicity

    SciTech Connect

    Cho, S.

    1988-01-01

    This work reports the inhibitory effects of aluminum on glucose-6-phosphate dehydrogenase (G6PD) from yeast and brains. The aluminum contents and several enzyme activities in aluminum-fed rat brain homogenates were compared with those in age-matched control groups. The concentration of aluminum in the homogenates of the aluminum-fed groups were twice of that of the controls. Acetylcholinesterase activities were the same as in both groups but hexokinase and G6PD activities in the aluminum-fed group were about 73% and 70% of the control, respectively. Further studies on the inhibitory effects of aluminum on G6PD were performed with the enzymes purified from human and pig brains. Two forms of G6PD isozymes were purified from human and pig brain by ammonium sulfate fractionation, hydroxylapatite chromatography, affinity chromatography with NADP-agarose and Blue-Sepharose CL-6B, and gel filtration with Sephadex S-300. The two forms of isozymes (isozyme I and II), purified to be homogeneous, had a molecular weight of 220,000, and composed of 4 subunits of molecular weight of 57,000. HPLC peptide maps of tryptic digests and amino acid analyses of the isozymes showed extensive homologies between the isozymes. Interestingly, only the isozyme II in human and pig brain were active with 6-phosphogluconate as a substrate. No such an activity was found in isozyme I. Aluminum inactivated G6PD activity of the human and pig brain isozyme I and isozyme II without affecting the 6-phosphogluconate dehydrogenase activity of the isozyme II. Circular dichroism studies showed that the binding of aluminum to G6PD induced a decrease in {alpha}-helix and {beta}-sheet and a increase in random coil. Therefore it is suggested that inactivation of G6PD by aluminum is due to the conformational change induced by aluminum binding.

  1. Aluminum: Reducing chloride emissions from aluminum production

    SciTech Connect

    Simon, P.

    1999-09-29

    Reynolds Metals Company (RMC), with assistance from a NICE{sup 3} grant, is developing for commercialization a closed-loop control process that greatly reduces chlorine emissions and increases plant efficiency while maintaining metal quality. The process still utilizes chlorine to remove impurities during aluminum processing, but is more effective than current methods. With the new technology chlorine in the stack is monitored and input chlorine is adjusted continuously. This optimization of chlorine use results in substantially less waste because less chlorine has to be bought or produced by aluminum manufacturers. This innovation is a significant improvement over conventional aluminum treatments, in which chlorine is injected in a more costly and wasteful manner. By the year 2010, the new technology has the potential to reduce the energy it takes to create chlorine by 8.4 billion Btu per year and to cut greenhouse gas emissions by 1,377 tons per year.

  2. Acceleration of osteogenesis by using barium titanate piezoelectric ceramic as an implant material

    NASA Astrophysics Data System (ADS)

    Furuya, K.; Morita, Y.; Tanaka, K.; Katayama, T.; Nakamachi, E.

    2011-04-01

    As bone has piezoelectric properties, it is expected that activity of bone cells and bone formation can be accelerated by applying piezoelectric ceramics to implants. Since lead ions, included in ordinary piezoelectric ceramics, are harmful, a barium titanate (BTO) ceramic, which is a lead-free piezoelectric ceramic, was used in this study. The purpose of this study was to investigate piezoelectric effects of surface charge of BTO on cell differentiation under dynamic loading in vitro. Rat bone marrow cells seeded on surfaces of BTO ceramics were cultured in culture medium supplemented with dexamethasone, β-glycerophosphate and ascorbic acid while a dynamic load was applied to the BTO ceramics. After 10 days of cultivation, the cell layer and synthesized matrix on the BTO surfaces were scraped off, and then DNA content, alkaline phosphtase (ALP) activity and calcium content were measured, to evaluate osteogenic differentiation. ALP activity on the charged BTO surface was slightly higher than that on the non-charged BTO surface. The amount of calcium on the charged BTO surface was also higher than that on the non-charged BTO surface. These results showed that the electric charged BTO surface accelerated osteogenesis.

  3. Aluminum space frame technology

    SciTech Connect

    Birch, S.

    1994-01-01

    This article examines the increased application of aluminum to the construction of automobile frames. The topics of the article include a joint venture between Audi and Alcoa, forms in which aluminum is used, new alloys and construction methods, meeting rigidity and safety levels, manufacturing techniques, the use of extrusions, die casting, joining techniques, and pollution control during manufacturing.

  4. Anodizing Aluminum with Frills.

    ERIC Educational Resources Information Center

    Doeltz, Anne E.; And Others

    1983-01-01

    "Anodizing Aluminum" (previously reported in this journal) describes a vivid/relevant laboratory experience for general chemistry students explaining the anodizing of aluminum in sulfuric acid and constrasting it to electroplating. Additions to this procedure and the experiment in which they are used are discussed. Reactions involved are also…

  5. Cast aluminum denture base.

    PubMed

    Barco, M T; Dembert, M L

    1987-08-01

    The laboratory procedures for a cast aluminum base denture have been presented. If an induction casting machine is not available, the "two-oven technique" works well, provided the casting arm is kept spinning manually for 4 minutes after casting. If laboratory procedures are executed precisely and with care, the aluminum base denture can be cast with good results. PMID:3305884

  6. Is the Aluminum Hypothesis Dead?

    PubMed Central

    2014-01-01

    The Aluminum Hypothesis, the idea that aluminum exposure is involved in the etiology of Alzheimer disease, dates back to a 1965 demonstration that aluminum causes neurofibrillary tangles in the brains of rabbits. Initially the focus of intensive research, the Aluminum Hypothesis has gradually been abandoned by most researchers. Yet, despite this current indifference, the Aluminum Hypothesis continues to attract the attention of a small group of scientists and aluminum continues to be viewed with concern by some of the public. This review article discusses reasons that mainstream science has largely abandoned the Aluminum Hypothesis and explores a possible reason for some in the general public continuing to view aluminum with mistrust. PMID:24806729

  7. Preparation of barium hexaferrite powders using oxidized steel scales waste

    NASA Astrophysics Data System (ADS)

    Septiani, Ardita; Idayanti, Novrita; Kristiantoro, Tony

    2016-02-01

    Research on preparation of barium hexaferrite powders has been done using Hot Strip Mill scales as raw materials. Hot Strip Mill scales are oxidized steel scales waste from steel industrial process. The method used for preparing the barium hexaferrite powders was solid state reaction method. Oxidized steel scales were milled using ball mill for 10 hours, then screened through a 250 mesh sieve to obtain powders with maximum size of 63 µm. Powders were roasted at 600°C temperature for 4 hours to obtain hematite (Fe2O3) phase. Roasted powders were then mixed with barium carbonate, and were subsequently milled for 16 hours. After mixing, powders were calcined with an increasing rate of 10°C/min and maintained at 1100°C for 3 hours. Calcination process was performed to acquire barium hexaferrite phase. X-ray Diffraction (XRD) characterization in conjunction with RIR analysis showed that 85 wt. % of barium hexaferrite is formed. The magnetic properties of powders were characterized using Permagraph. It is found the value of remanent induction is 1.09 kG, coercivity of 2.043 kOe, and the maximum energy product of 0.25 MGOe.

  8. Acceleration of barium ions near 8000 km above an aurora

    NASA Technical Reports Server (NTRS)

    Stenbaek-Nielsen, H. C.; Hallinan, T. J.; Wescott, E. M.; Foeppl, H.

    1984-01-01

    A barium shaped charge, named Limerick, was released from a rocket launched from Poker Flat Research Range, Alaska, on March 30, 1982, at 1033 UT. The release took place in a small auroral breakup. The jet of ionized barium reached an altitude of 8100 km 14.5 min after release, indicating that there were no parallel electric fields below this altitude. At 8100 km the jet appeared to stop. Analysis shows that the barium at this altitude was effectively removed from the tip. It is concluded that the barium was actually accelerated upward, resulting in a large decrease in the line-of-sight density and hence the optical intensity. The parallel electric potential in the acceleration region must have been greater than 1 kV over an altitude interval of less than 200 km. The acceleration region, although presumably auroral in origin, did not seem to be related to individual auroral structures, but appeared to be a large-scale horizontal structure. The perpendicular electric field below, as deduced from the drift of the barium, was temporally and spatially very uniform and showed no variation related to individual auroral structures passing through.

  9. The aluminum smelting process.

    PubMed

    Kvande, Halvor

    2014-05-01

    This introduction to the industrial primary aluminum production process presents a short description of the electrolytic reduction technology, the history of aluminum, and the importance of this metal and its production process to modern society. Aluminum's special qualities have enabled advances in technologies coupled with energy and cost savings. Aircraft capabilities have been greatly enhanced, and increases in size and capacity are made possible by advances in aluminum technology. The metal's flexibility for shaping and extruding has led to architectural advances in energy-saving building construction. The high strength-to-weight ratio has meant a substantial reduction in energy consumption for trucks and other vehicles. The aluminum industry is therefore a pivotal one for ecological sustainability and strategic for technological development. PMID:24806722

  10. Aluminum structural applications

    SciTech Connect

    Lucas, G.

    1996-05-01

    Extensive research by aluminum producers and automakers in the 1980s resulted in the development of technologies that enable building of aluminum cars that meet and exceed all the expectations of today`s drivers and passengers, yet weigh several hundred pounds less than their steel counterparts. The Acura NSX sports car, the Audi A8, and the Jaguar XJ220 have all been introduced. Ford has built 40 aluminum-intensive automobiles based on the Taurus/Sable for test purposes, and General Motors recently announced an aluminum-structured electric vehicle. The design flexibility that aluminum allows is shown by these examples. Each uses a somewhat different technology that is particularly suited to the vehicle and its market.

  11. The Aluminum Smelting Process

    PubMed Central

    2014-01-01

    This introduction to the industrial primary aluminum production process presents a short description of the electrolytic reduction technology, the history of aluminum, and the importance of this metal and its production process to modern society. Aluminum's special qualities have enabled advances in technologies coupled with energy and cost savings. Aircraft capabilities have been greatly enhanced, and increases in size and capacity are made possible by advances in aluminum technology. The metal's flexibility for shaping and extruding has led to architectural advances in energy-saving building construction. The high strength-to-weight ratio has meant a substantial reduction in energy consumption for trucks and other vehicles. The aluminum industry is therefore a pivotal one for ecological sustainability and strategic for technological development. PMID:24806722

  12. Barium Depletion in the NSTAR Discharge Cathode After 30,000 Hours of Operation

    NASA Technical Reports Server (NTRS)

    Polk, James E.; Capece, Angela M.; Mikellides, Ioannis G.; Katz, Ira

    2010-01-01

    Dispenser hollow cathodes rely on a consumable supply of barium released by impregnant materials in the pores of a tungsten matrix to maintain a low work function surface. Examinations of cathode inserts from long duration ion engine tests show deposits of tungsten at the downstream end that appear to block the flow of barium from the interior. In addition, a numerical model of barium transport in the insert plasma indicates that the barium partial pressure in the insert may exceed the equilibrium vapor pressure of the dominant barium-producing reaction, and it was postulated previously that this would suppress barium loss in the upstream part of the insert. New measurements of the depth of barium depletion from a cathode insert operated for 30,352 hours reveal that barium loss is confined to a narrow region near the downstream end, confirming this hypothesis.

  13. Rocket having barium release system to create ion clouds in the upper atmosphere

    NASA Technical Reports Server (NTRS)

    Lewis, B. W.; Stokes, C. S.; Smith, E. W.; Murphy, W. J. (Inventor)

    1974-01-01

    A chemical system for releasing a good yield of free barium atoms and barium ions to create ion clouds in the upper atmosphere and interplanetary space for the study of the geophysical properties of the medium is presented.

  14. Studies of hexacelsian and celsian barium aluminosilicates

    NASA Astrophysics Data System (ADS)

    Lee, Kuo-Tong

    1998-09-01

    The first part of this work (chapter 3) describes the reaction paths leading to the formation of BaAlsb2Sisb2Osb8 (BAS) from a mixture of gamma-BaCOsb3,\\ alpha-Alsb2Osb3, and amorphous SiOsb2 powders. Heat treatments conducted from 600 to 1200sp°C in air were used to transform the powder mixtures into hexacelsian BAS. The phase evolution to BAS was examined by x-ray diffraction. Several experiments were designed to microscopically reproduce the solid-solid interfaces expected during the synthesis of BAS and enabled the author to describe the different stages of the reaction. There exist two reaction paths in formation of BAS in this study: (1) formation of a series of barium silicates leading to BaO*2SiOsb2 (BSsb2) which then reacts with Alsb2Osb3 to form BAS and (2) formation of BaO*Alsb2Osb3 (BA) which then reacts with SiOsb2 to form BAS. The kinetics of the latter is slower than that of the former because the reaction between BaO*Alsb2Osb3 and SiOsb2 to form BAS includes a bond breaking process. The second part (chapter 4) of this research was undertaken to study the role of additives on the kinetics of the transformation of hexacelsian to celsian. Pre-synthesized hexacelsian powders doped with various additives were heated at temperatures ranging from 850 to 1400sp°C for 4 hrs. Semi-quantitative analysis of XRD was used to determine the extent of the hexacelsian-to-celsian transformation. This work was extended further to investigate the mechanisms involved in the transformation. Defect structures developed in the additive-containing celsian provide insights about the sites occupied by the cations added. Experimental results indicate that the doping of ˜0.99A cations in promoting the conversion of hexacelsian to celsian is by forming an interstitial solid solution in hexacelsian and ˜0.66A cations form a substitutional solid solution. In a kinetic study on the CaO- or MgO-enhanced transformation, values of rate constant, k, and Avlami constant, n, at

  15. Barium Levels in Soils and Centella asiatica

    PubMed Central

    Ong, Ghim Hock; Yap, Chee Kong; Mahmood, Maziah; Tan, Soon Guan; Hamzah, Suhaimi

    2013-01-01

    In this study, Centella asiatica and surface soils were collected from 12 sampling sites in Peninsular Malaysia, and the barium (Ba) concentrations were determined. The Ba concentration [μg/g dry weight (dw)] was 63.72 to 382.01 μg/g in soils while in C. asiatica, Ba concentrations ranged from 5.05 to 21.88 μg/g for roots, 3.31 to 11.22 μg/g for leaves and 2.37 to 6.14 μg/g for stems. In C. asiatica, Ba accumulation was found to be the highest in roots followed by leaves and stems. The correlation coefficients (r) of Ba between plants and soils were found to be significantly positively correlated, with the highest correlation being between roots-soils (r=0.922, p<005), followed by leaves-soils (r=0.890, p<005) and stems-soils (r=0.848, p<005). This indicates that these three parts of C. asiatica are good biomonitors of Ba pollution. For the transplantation study, four sites were selected as unpolluted [(Universiti Putra Malaysia (UPM)], semi-polluted (Seri Kembangan and Balakong) and polluted sites (Juru). Based on the transplantation study under experimental field and laboratory conditions, Ba concentrations in C. asiatica were significantly (p<0.05) higher after three weeks of exposure at Seri Kembangan, Balakong and Juru. Thus, these experimental findings confirm that the leaves, stems and roots of C. asiatica can reflect the Ba levels in the soils where this plant is found. Three weeks after back transplantation to clean soils, the Ba levels in C. asiatica were still higher than the initial Ba level even though Ba elimination occurred. In conclusion, the leaves, stems and roots of C. asiatica are good biomonitors of Ba pollution. PMID:24575242

  16. Barium Aspiration in an Infant: A Case Report and Review of Management

    PubMed Central

    Jackson, M.; Kapur, N.; Goyal, V.; Choo, K.; Sarikwal, A.; Masters, I. B.; Isles, Alan F.

    2014-01-01

    We describe a case of bilateral inhalation of barium in an infant following a barium swallow for investigation of dusky spells associated with feeds. A bronchoscopy subsequently revealed the presence of a mid-tracheal tracheo-esophageal cleft. To date, little has been reported on barium aspiration in children and there is no consensus for management. We review the literature on barium aspiration, its consequences, and make recommendations for management. PMID:24818122

  17. Prompt ionization in the CRIT II barium releases

    NASA Astrophysics Data System (ADS)

    Torbert, R. B.; Kletzing, C. A.; Liou, K.; Rau, D.

    1992-05-01

    Observations of electron and ion distributions inside a fast neutral barium jet in the ionosphere show significant fluxes within 4 km of release, presumably related to beam plasma instability processes involved in the Critical Ionization Velocity (CIV) effect. Electron fluxes exceeding 5 x 10 exp 12/sq cm-str-sec-keV were responsible for ionizing both the streaming barium and ambient oxygen. Resulting ion fluxes seem to be consistent with 1-2 percent ionization of the fast barium, as reported by optical observations, although the extended spatial distribution of the optically observed ions is difficult to reconcile with the in situ observations. When the perpendicular velocity of the neutrals falls below critical values, these processes shut off. Although these observations resemble the earlier Porcupine experimental results (Haerendel, 1982), theoretical understanding of the differences between these data and that of earlier negative experiments is still lacking.

  18. White dwarf kicks and implications for barium stars

    NASA Astrophysics Data System (ADS)

    Izzard, R. G.; Church, R. P.; Dermine, T.

    The barium stars have caused much grief in the field of binary stellar evolution. They are often eccentric when they should be circular and are not found to have periods longer than 104 days even though wind accretion should still be efficient at such separations. We address both these problems by introducing a kick to white dwarfs when they are born, thus solving the eccentricity problem, and imposing strong orbital angular momentum loss to shrink barium-star binaries down to the observed periods. Whilst our angular momentum prescription is hard to justify for the barium stars it shows that strong angular momentum loss is necessary to reproduce the observed period-eccentricity distribution. We are investigating whether this can be obtained from a circumbinary disc.

  19. Barium-borate-flyash glasses: As radiation shielding materials

    NASA Astrophysics Data System (ADS)

    Singh, Sukhpal; Kumar, Ashok; Singh, Devinder; Thind, Kulwant Singh; Mudahar, Gurmel S.

    2008-01-01

    The attenuation coefficients of barium-borate-flyash glasses have been measured for γ-ray photon energies of 356, 662, 1173 and 1332 keV using narrow beam transmission geometry. The photon beam was highly collimated and overall scatter acceptance angle was less than 3°. Our results have an uncertainty of less than 3%. These coefficients were then used to obtain the values of mean free path (mfp), effective atomic number and electron density. Good agreements have been observed between experimental and theoretical values of these parameters. From the studies of the obtained results it is reported here that from the shielding point of view the barium-borate-flyash glasses are better shields to γ-radiations in comparison to the standard radiation shielding concretes and also to the ordinary barium-borate glasses.

  20. Comparision of Uptake Models for Strontium (Sr) and Barium (Ba) in Vine (Vitis vinifera L.) in Castilla-La Mancha (spain).

    NASA Astrophysics Data System (ADS)

    Amorós, José Angel; Pérez-de-los-Reyes, Caridad; García-Navarro, Francisco J.; Bravo, Sandra; Higueras, Pablo; Moreno, Marta

    2015-04-01

    Castilla-La Mancha is the biggest vine-growing region in the world (about 500,000 ha) and one of the most important in terms of production of wine. The soils diversity should induce differences in the uptake of mineral elements by the vineyard. Of over the regional vine extension, 101 plots were selected and analyzed soil samples from each of them, following the description by FAO procedures. Samples of leaves were also taken from each soil plot. We analyzed the contents of mineral elements in both soil and leaf, using the FRX technique. This paper is focused on the elements strontium and barium because they are the trace elements having a higher concentration in the soils of the region, with values in soil range from 22.3 mg•kg-1-3602.7 mg•kg-1 in strontium and from 65.4 mg•kg-1 to 469.3 mg•kg-1 in barium. The contents of both elements in leaves have ranged from 23.3 mg•kg-1 y 1084.5 mg•kg-1 for strontium, and between 3.86 mg•kg-1 and 235.0 mg•kg-1 for barium. The aim of this work is state the behaviour in the soil-plant system for both elements. For this study, different statistical adjustment models have been tested (linear, multiplicative, exponential and logarithmic). The results show that the values of "R" for strontium are higher than barium in all models. Samples have also been studied by soil order (classified according to the FAO criteria). In this case, significant correlation from strontium have been found in all soil orders, except in calcisols. Significant correlations for barium appear only in entisols and luvisols. In conclusion it can be seen how these two elements differ in their behaviour in the soil-plant system. In general, the concentration of strontium in the soil is better correlated with leaf content than barium in the same soil. We can suggest a greater facility for the absorption of strontium by the grapevine. In calcisols, bearing in mind the interference of calcium, this uptake does not present such a high correlation

  1. Compact pulse forming line using barium titanate ceramic material.

    PubMed

    Kumar Sharma, Surender; Deb, P; Shukla, R; Prabaharan, T; Shyam, A

    2011-11-01

    Ceramic material has very high relative permittivity, so compact pulse forming line can be made using these materials. Barium titanate (BaTiO(3)) has a relative permittivity of 1200 so it is used for making compact pulse forming line (PFL). Barium titanate also has piezoelectric effects so it cracks during high voltages discharges due to stresses developed in it. Barium titanate is mixed with rubber which absorbs the piezoelectric stresses when the PFL is charged and regain its original shape after the discharge. A composite mixture of barium titanate with the neoprene rubber is prepared. The relative permittivity of the composite mixture is measured to be 85. A coaxial pulse forming line of inner diameter 120 mm, outer diameter 240 mm, and length 350 mm is made and the composite mixture of barium titanate and neoprene rubber is filled between the inner and outer cylinders. The PFL is charged up to 120 kV and discharged into 5 Ω load. The voltage pulse of 70 kV, 21 ns is measured across the load. The conventional PFL is made up of oil or plastics dielectrics with the relative permittivity of 2-10 [D. R. Linde, CRC Handbook of Chemistry and Physics, 90th ed. (CRC, 2009); Xia et al., Rev. Sci. Instrum. 79, 086113 (2008); Yang et al., Rev. Sci. Instrum. 81, 43303 (2010)], which increases the length of PFL. We have reported the compactness in length achieved due to increase in relative permittivity of composite mixture by adding barium titanate in neoprene rubber. PMID:22129008

  2. Compact pulse forming line using barium titanate ceramic material

    NASA Astrophysics Data System (ADS)

    Kumar Sharma, Surender; Deb, P.; Shukla, R.; Prabaharan, T.; Shyam, A.

    2011-11-01

    Ceramic material has very high relative permittivity, so compact pulse forming line can be made using these materials. Barium titanate (BaTiO3) has a relative permittivity of 1200 so it is used for making compact pulse forming line (PFL). Barium titanate also has piezoelectric effects so it cracks during high voltages discharges due to stresses developed in it. Barium titanate is mixed with rubber which absorbs the piezoelectric stresses when the PFL is charged and regain its original shape after the discharge. A composite mixture of barium titanate with the neoprene rubber is prepared. The relative permittivity of the composite mixture is measured to be 85. A coaxial pulse forming line of inner diameter 120 mm, outer diameter 240 mm, and length 350 mm is made and the composite mixture of barium titanate and neoprene rubber is filled between the inner and outer cylinders. The PFL is charged up to 120 kV and discharged into 5 Ω load. The voltage pulse of 70 kV, 21 ns is measured across the load. The conventional PFL is made up of oil or plastics dielectrics with the relative permittivity of 2-10 [D. R. Linde, CRC Handbook of Chemistry and Physics, 90th ed. (CRC, 2009); Xia et al., Rev. Sci. Instrum. 79, 086113 (2008); Yang et al., Rev. Sci. Instrum. 81, 43303 (2010)], which increases the length of PFL. We have reported the compactness in length achieved due to increase in relative permittivity of composite mixture by adding barium titanate in neoprene rubber.

  3. The adhesiometer: a simple device to measure adherence of barium sulfate to intestinal mucosa.

    PubMed

    Salomonowitz, E; Frick, M P; Cragg, A H; Lund, G

    1984-04-01

    A simple, inexpensive device assessing barium sulfate adherence to alimentary tract mucosa was tested in an animal study using pigs and dogs. Interaction of gastric, intestinal, and colonic mucosal lining with three different barium preparations was studied. In both pigs and dogs, barium adherence to gastric mucosa was significantly stronger when compared with colonic mucosa. PMID:6608230

  4. 49 CFR 173.182 - Barium azide-50 percent or more water wet.

    Code of Federal Regulations, 2013 CFR

    2013-10-01

    ... 49 Transportation 2 2013-10-01 2013-10-01 false Barium azide-50 percent or more water wet. 173.182 Section 173.182 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS... Class 1 and Class 7 § 173.182 Barium azide—50 percent or more water wet. Barium azide—50 percent or...

  5. 40 CFR 721.10010 - Barium manganese oxide (BaMnO3).

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... 40 Protection of Environment 32 2013-07-01 2013-07-01 false Barium manganese oxide (BaMnO3). 721... Substances § 721.10010 Barium manganese oxide (BaMnO3). (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as barium manganese oxide (BaMnO3) (PMN...

  6. 21 CFR 201.304 - Tannic acid and barium enema preparations.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 21 Food and Drugs 4 2011-04-01 2011-04-01 false Tannic acid and barium enema preparations. 201.304... Tannic acid and barium enema preparations. (a) It has become a widespread practice for tannic acid to be added to barium enemas to improve X-ray pictures. Tannic acid is capable of causing diminished...

  7. 40 CFR 721.10010 - Barium manganese oxide (BaMnO3).

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... 40 Protection of Environment 31 2011-07-01 2011-07-01 false Barium manganese oxide (BaMnO3). 721... Substances § 721.10010 Barium manganese oxide (BaMnO3). (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as barium manganese oxide (BaMnO3) (PMN...

  8. 40 CFR 721.10010 - Barium manganese oxide (BaMnO3).

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... 40 Protection of Environment 31 2014-07-01 2014-07-01 false Barium manganese oxide (BaMnO3). 721... Substances § 721.10010 Barium manganese oxide (BaMnO3). (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as barium manganese oxide (BaMnO3) (PMN...

  9. 49 CFR 173.182 - Barium azide-50 percent or more water wet.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ... 49 Transportation 2 2011-10-01 2011-10-01 false Barium azide-50 percent or more water wet. 173.182 Section 173.182 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS... Class 1 and Class 7 § 173.182 Barium azide—50 percent or more water wet. Barium azide—50 percent or...

  10. 40 CFR 721.10010 - Barium manganese oxide (BaMnO3).

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Barium manganese oxide (BaMnO3). 721... Substances § 721.10010 Barium manganese oxide (BaMnO3). (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as barium manganese oxide (BaMnO3) (PMN...

  11. 49 CFR 173.182 - Barium azide-50 percent or more water wet.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ... 49 Transportation 2 2010-10-01 2010-10-01 false Barium azide-50 percent or more water wet. 173.182 Section 173.182 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS... Class 1 and Class 7 § 173.182 Barium azide—50 percent or more water wet. Barium azide—50 percent or...

  12. 49 CFR 173.182 - Barium azide-50 percent or more water wet.

    Code of Federal Regulations, 2012 CFR

    2012-10-01

    ... 49 Transportation 2 2012-10-01 2012-10-01 false Barium azide-50 percent or more water wet. 173.182 Section 173.182 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS... Class 1 and Class 7 § 173.182 Barium azide—50 percent or more water wet. Barium azide—50 percent or...

  13. 21 CFR 201.304 - Tannic acid and barium enema preparations.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 21 Food and Drugs 4 2012-04-01 2012-04-01 false Tannic acid and barium enema preparations. 201.304... Tannic acid and barium enema preparations. (a) It has become a widespread practice for tannic acid to be added to barium enemas to improve X-ray pictures. Tannic acid is capable of causing diminished...

  14. 21 CFR 201.304 - Tannic acid and barium enema preparations.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 21 Food and Drugs 4 2014-04-01 2014-04-01 false Tannic acid and barium enema preparations. 201.304... Tannic acid and barium enema preparations. (a) It has become a widespread practice for tannic acid to be added to barium enemas to improve X-ray pictures. Tannic acid is capable of causing diminished...

  15. 40 CFR 721.10010 - Barium manganese oxide (BaMnO3).

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... 40 Protection of Environment 32 2012-07-01 2012-07-01 false Barium manganese oxide (BaMnO3). 721... Substances § 721.10010 Barium manganese oxide (BaMnO3). (a) Chemical substance and significant new uses subject to reporting. (1) The chemical substance identified as barium manganese oxide (BaMnO3) (PMN...

  16. 21 CFR 201.304 - Tannic acid and barium enema preparations.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 21 Food and Drugs 4 2013-04-01 2013-04-01 false Tannic acid and barium enema preparations. 201.304... Tannic acid and barium enema preparations. (a) It has become a widespread practice for tannic acid to be added to barium enemas to improve X-ray pictures. Tannic acid is capable of causing diminished...

  17. 49 CFR 173.182 - Barium azide-50 percent or more water wet.

    Code of Federal Regulations, 2014 CFR

    2014-10-01

    ... 49 Transportation 2 2014-10-01 2014-10-01 false Barium azide-50 percent or more water wet. 173.182 Section 173.182 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS... Class 1 and Class 7 § 173.182 Barium azide—50 percent or more water wet. Barium azide—50 percent or...

  18. 21 CFR 201.304 - Tannic acid and barium enema preparations.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Tannic acid and barium enema preparations. 201.304... Tannic acid and barium enema preparations. (a) It has become a widespread practice for tannic acid to be added to barium enemas to improve X-ray pictures. Tannic acid is capable of causing diminished...

  19. Clinical biochemistry of aluminum

    SciTech Connect

    King, S.W.; Savory, J.; Wills, M.R.

    1981-05-01

    Aluminum toxicity has been implicated in the pathogenesis of a number of clinical disorders in patients with chronic renal failure on long-term intermittent hemodialysis treatment. The predominant disorders have been those involving either bone (osteomalacic dialysis osteodystrophy) or brain (dialysis encephalopathy). In nonuremic patients, an increased brain aluminum concentration has been implicated as a neurotoxic agent in the pathogenesis of Alzheimer's disease and was associated with experimental neurofibrillary degeneration in animals. The brain aluminum concentrations of patients dying with the syndrome of dialysis encephalopathy (dialysis dementia) are significantly higher than in dialyzed patients without the syndrome and in nondialyzed patients. Two potential sources for the increased tissue content of aluminum in patients on hemodialysis have been proposed: (1) intestinal absorption from aluminum containing phosphate-binding gels, and (2) transfer across the dialysis membrane from aluminum in the water used to prepare the dialysate. These findings, coupled with our everyday exposure to the ubiquitous occurrence of aluminum in nature, have created concerns over the potential toxicity of this metal.

  20. Barium and antimony distributions on the hands of nonshooters.

    PubMed

    Havakost, D G; Peters, C A; Koons, R D

    1990-09-01

    Barium and antimony levels from selected areas of the left and right hands of 269 nonshooters provide a database for interpretation of gunshot residue swab analysis results. The database represents a variety of activities of individuals sampled by collectors throughout the United States. Nonshooting exposure to barium and antimony can generally be distinguished from firearms-associated exposure by considering the relative levels of the elements, location on the hands, and condition of the swabs. Consistent definition of sampling procedures and accurate analytical results make this database applicable for interpretation of data generated by most gunshot residue swab examiners. PMID:2230685

  1. Study of the photovoltaic effect in thin film barium titanate

    NASA Technical Reports Server (NTRS)

    Grannemann, W. W.; Dharmadhikari, V. S.

    1981-01-01

    The photoelectric effect in structures consisting of metal deposited barium titanate film silicon is described. A radio frequency sputtering technique is used to deposit ferroelectric barium titantate films on silicon and quartz. Film properties are measured and correlated with the photoelectric effect characteristics of the films. It was found that to obtain good quality pin hole free films, it is necessary to reduce the substrate temperature during the last part of the deposition. The switching ability of the device with internal applied voltage is improved when applied with a ferroelectric memory device.

  2. Methods for producing monodispersed particles of barium titanate

    DOEpatents

    Hu, Zhong-Cheng

    2001-01-01

    The present invention is a low-temperature controlled method for producing high-quality, ultrafine monodispersed nanocrystalline microsphere powders of barium titanate and other pure or composite oxide materials having particles ranging from nanosized to micronsized particles. The method of the subject invention comprises a two-stage process. The first stage produces high quality monodispersed hydrous titania microsphere particles prepared by homogeneous precipitation via dielectric tuning in alcohol-water mixed solutions of inorganic salts. Titanium tetrachloride is used as an inorganic salt precursor material. The second stage converts the pure hydrous titania microsphere particles into crystalline barium titanate microsphere powders via low-temperature, hydrothermal reactions.

  3. Ionization and expansion of barium clouds in the ionosphere

    NASA Technical Reports Server (NTRS)

    Ma, T.-Z.; Schunk, R. W.

    1993-01-01

    A recently envelope 3D model is used here to study the motion of the barium clouds released in the ionosphere, including the ionization stage. The ionization and the expansion of the barium clouds and the interaction between the clouds and the background ions are investigated using three simulations: a cloud without a directional velocity, a cloud with an initial velocity of 5 km/s across the B field, and a cloud with initial velocity components of 2 km/s both along and across the B field.

  4. Purifying Aluminum by Vacuum Distillation

    NASA Technical Reports Server (NTRS)

    Du Fresne, E. R.

    1985-01-01

    Proposed method for purifying aluminum employs one-step vacuum distillation. Raw material for process impure aluminum produced in electrolysis of aluminum ore. Impure metal melted in vacuum. Since aluminum has much higher vapor pressure than other constituents, boils off and condenses on nearby cold surfaces in proportions much greater than those of other constituents.

  5. Concentrations of lead, cadmium and barium in urban garden-grown vegetables: the impact of soil variables

    PubMed Central

    McBride, Murray B.; Shayler, Hannah A.; Spliethoff, Henry M.; Mitchell, Rebecca G.; Marquez-Bravo, Lydia G.; Ferenz, Gretchen S.; Russell-Anelli, Jonathan M.; Casey, Linda; Bachman, Sharon

    2014-01-01

    Paired vegetable/soil samples from New York City and Buffalo, NY, gardens were analyzed for lead (Pb), cadmium (Cd) and barium (Ba). Vegetable aluminum (Al) was measured to assess soil adherence. Soil and vegetable metal concentrations did not correlate; vegetable concentrations varied by crop type. Pb was below health-based guidance values (EU standards) in virtually all fruits. 47% of root crops and 9% of leafy greens exceeded guidance values; over half the vegetables exceeded the 95th percentile of market-basket concentrations for Pb. Vegetable Pb correlated with Al; soil particle adherence/incorporation was more important than Pb uptake via roots. Cd was similar to market-basket concentrations and below guidance values in nearly all samples. Vegetable Ba was much higher than Pb or Cd, although soil Ba was lower than soil Pb. The poor relationship between vegetable and soil metal concentrations is attributable to particulate contamination of vegetables and soil characteristics that influence phytoavailability. PMID:25163429

  6. Concentrations of lead, cadmium and barium in urban garden-grown vegetables: the impact of soil variables.

    PubMed

    McBride, Murray B; Shayler, Hannah A; Spliethoff, Henry M; Mitchell, Rebecca G; Marquez-Bravo, Lydia G; Ferenz, Gretchen S; Russell-Anelli, Jonathan M; Casey, Linda; Bachman, Sharon

    2014-11-01

    Paired vegetable/soil samples from New York City and Buffalo, NY, gardens were analyzed for lead (Pb), cadmium (Cd) and barium (Ba). Vegetable aluminum (Al) was measured to assess soil adherence. Soil and vegetable metal concentrations did not correlate; vegetable concentrations varied by crop type. Pb was below health-based guidance values (EU standards) in virtually all fruits. 47% of root crops and 9% of leafy greens exceeded guidance values; over half the vegetables exceeded the 95th percentile of market-basket concentrations for Pb. Vegetable Pb correlated with Al; soil particle adherence/incorporation was more important than Pb uptake via roots. Cd was similar to market-basket concentrations and below guidance values in nearly all samples. Vegetable Ba was much higher than Pb or Cd, although soil Ba was lower than soil Pb. The poor relationship between vegetable and soil metal concentrations is attributable to particulate contamination of vegetables and soil characteristics that influence phytoavailability. PMID:25163429

  7. Chemical abundance analysis of 19 barium stars

    NASA Astrophysics Data System (ADS)

    Yang, Guo-Chao; Liang, Yan-Chun; Spite, Monique; Chen, Yu-Qin; Zhao, Gang; Zhang, Bo; Liu, Guo-Qing; Liu, Yu-Juan; Liu, Nian; Deng, Li-Cai; Spite, Francois; Hill, Vanessa; Zhang, Cai-Xia

    2016-01-01

    We aim at deriving accurate atmospheric parameters and chemical abundances of 19 barium (Ba) stars, including both strong and mild Ba stars, based on the high signal-to-noise ratio and high resolution Echelle spectra obtained from the 2.16 m telescope at Xinglong station of National Astronomical Observatories, Chinese Academy of Sciences. The chemical abundances of the sample stars were obtained from an LTE, plane-parallel and line-blanketed atmospheric model by inputting the atmospheric parameters (effective temperatures Teff, surface gravities log g, metallicity [Fe/H] and microturbulence velocity ξt) and equivalent widths of stellar absorption lines. These samples of Ba stars are giants as indicated by atmospheric parameters, metallicities and kinematic analysis about UVW velocity. Chemical abundances of 17 elements were obtained for these Ba stars. Their Na, Al, α- and iron-peak elements (O, Na, Mg, Al, Si, Ca, Sc, Ti, V, Cr, Mn, Ni) are similar to the solar abundances. Our samples of Ba stars show obvious overabundances of neutron-capture (n-capture) process elements relative to the Sun. Their median abundances of [Ba/Fe], [La/Fe] and [Eu/Fe] are 0.54, 0.65 and 0.40, respectively. The Y I and Zr I abundances are lower than Ba, La and Eu, but higher than the α- and iron-peak elements for the strong Ba stars and similar to the iron-peak elements for the mild stars. There exists a positive correlation between Ba intensity and [Ba/Fe]. For the n-capture elements (Y, Zr, Ba, La), there is an anti-correlation between their [X/Fe] and [Fe/H]. We identify nine of our sample stars as strong Ba stars with [Ba/Fe] >0.6 where seven of them have Ba intensity Ba=2-5, one has Ba=1.5 and another one has Ba=1.0. The remaining ten stars are classified as mild Ba stars with 0.17<[Ba/Fe] <0.54.

  8. The effects of calcium channel inhibitors and other procedures affecting calcium translocation on drug-induced rhythmic contractions in the rat vas deferens.

    PubMed Central

    Hay, D. W.; Wadsworth, R. M.

    1983-01-01

    In the rat isolated vas deferens, methoxamine 8.1 microM produced an initial phasic response that declined towards baseline and was followed by rhythmic contractions that continued until wash-out. These responses were predominant in the epididymal half. BaCl2 1 mM produced a similar type of response which was not mediated by noradrenaline release or activation of alpha-adrenoceptors. The barium responses were similar in the epididymal and prostatic halves. Incubation in nominally Ca2+-free solution caused abolition or near abolition of rhythmic contractions produced by barium or methoxamine. The initial phasic response to methoxamine was abolished in Ca2+-free solution, whereas that produced by barium persisted. Rhythmic contractions produced by methoxamine or barium were inhibited by Mg2+ (2.4-20 mM) and by La3+ (1-5 mM). Mg2+ had selectivity for inhibition of the frequency of methoxamine- but not barium-induced rhythmic contractions. Despite their dependence on [Ca2+]o, barium- and methoxamine-induced rhythmic contractions were resistant to inhibition by calcium channel inhibitors. Verapamil, nifedipine and flunarazine inhibited the amplitude of rhythmic contractions more readily than the frequency (methoxamine IC50 for verapamil: amplitude = 29.8 +/- 5.40 microM, n = 6, frequency = 96.7 +/- 31.0 microM, n = 5, for nifedipine: amplitude = 2.42 +/- 0.34 microM, n = 7, frequency = 3.24 +/- 0.75 microM, n = 7, and for flunarizine: amplitude = 15.9 +/- 5.95 microM, n = 7, frequency = 153 +/- 28.6 microM, n = 7). There was no differentiation between inhibition of methoxamine and barium-induced responses. Like Mg2+, methoxyverapamil selectively inhibited the frequency of methoxamine-induced contractions (IC50: amplitude = 16.8 +/- 2.86 microM, n = 5, frequency = 2.07 +/- 0.81 microM, n = 5) but not barium-induced contractions (IC50: amplitude = 13.9 +/- 1.95 microM, n = 5, frequency = 48.5 +/- 8.98 microM, n = 5). Diazoxide (43.3-2167 microM) and nitroprusside (3

  9. Advances in aluminum anodizing

    NASA Technical Reports Server (NTRS)

    Dale, K. H.

    1969-01-01

    White anodize is applied to aluminum alloy surfaces by specific surface preparation, anodizing, pigmentation, and sealing techniques. The development techniques resulted in alloys, which are used in space vehicles, with good reflectance values and excellent corrosive resistance.

  10. Walnut Hulls Clean Aluminum

    NASA Technical Reports Server (NTRS)

    Colberg, W. R.; Gordon, G. H.; Jackson, C. H.

    1984-01-01

    Hulls inflict minimal substrate damage. Walnut hulls found to be best abrasive for cleaning aluminum surfaces prior to painting. Samples blasted with walnut hulls showed no compressive stress of surface.

  11. Corrosion Inhibitors for Aluminum.

    ERIC Educational Resources Information Center

    Muller, Bodo

    1995-01-01

    Describes a simple and reliable test method used to investigate the corrosion-inhibiting effects of various chelating agents on aluminum pigments in aqueous alkaline media. The experiments that are presented require no complicated or expensive electronic equipment. (DDR)

  12. CORROSION PROTECTION OF ALUMINUM

    DOEpatents

    Dalrymple, R.S.; Nelson, W.B.

    1963-07-01

    Treatment of aluminum-base metal surfaces in an autoclave with an aqueous chromic acid solution of 0.5 to 3% by weight and of pH below 2 for 20 to 50 hrs at 160 to 180 deg C produces an extremely corrosion-resistant aluminum oxidechromium film on the surface. A chromic acid concentration of 1 to 2% and a pH of about 1 are preferred. (D.C.W.)

  13. Corrosion Protection of Aluminum

    DOEpatents

    Dalrymple, R. S.; Nelson, W. B.

    1963-07-01

    Treatment of aluminum-base metal surfaces in an autoclave with an aqueous chromic acid solution of 0.5 to 3% by weight and of pH below 2 for 20 to 50 hrs at 160 to 180 deg C produces an extremely corrosion-resistant aluminum oxidechromium film on the surface. A chromic acid concentration of 1 to 2% and a pH of about 1 are preferred.

  14. Light weight aluminum optics

    NASA Astrophysics Data System (ADS)

    Catura, R. C.; Vieira, J. R.

    1985-09-01

    Light weight mirror blanks were fabricated by dip-brazing a core of low mass aluminum foam material to thin face sheets of solid aluminum. The blanks weigh 40% of an equivalent size solid mirror and were diamond turned to provide reflective surfaces. Optical interferometry was used to assess their dimensional stability over 7 months. No changes in flatness are observed (to the sensitivity of the measurements of a half wavelength of red light).

  15. Synthesis of phase pure praseodymium barium copper iron oxide.

    PubMed

    Konne, Joshua L; Davis, Sean A; Glatzel, Stefan; Hall, Simon R

    2013-06-18

    The control of crystallization of praseodymium barium copper iron oxide, an intermediate temperature solid oxide fuel cell cathode material, has been demonstrated for the first time using a biotemplated sol-gel synthesis technique. The results obtained showed significant improvement in purity, synthesis time, surface area and simplicity over that previously reported. PMID:23660963

  16. Stabilization of arsenic- and barium-rich glass manufacturing waste

    SciTech Connect

    Fuessle, R.W.; Taylor, M.A.

    2000-03-01

    Effective solidification/stabilization (S/S) of arsenic- and barium-containing D004/D005 waste was accomplished by using a binder of cement with 40% class C fly ash and either ferrous sulfate or ferric sulfate as an additive. Addition of iron salts improves arsenic solidification/stabilization (S/S). Barium may be encapsulated within the stabilized matrix as barium sulfate. Recommended mole ratios for iron/arsenic and barium/sulfate are at least 6 and 1.2, respectively. A binder/waste ratio of 0.15 is volume efficient, but the mix design must be carefully controlled to achieve adequate S/S. In practice, the heterogeneity of waste and large-scale mix operations may preclude close control of reagent dosages, so a binder/waste ratio of 0.40 is preferable. Ferrous sulfate additive is preferable for arsenic S/S because it is effective over a wider range of mix designs and over a long-term curing period. Toxicity characteristic leaching procedure results degraded with long curing time for some mix designs with ferric sulfate additive.

  17. Laser selective excitation of a three-level atom - Barium

    NASA Technical Reports Server (NTRS)

    Carlsten, J. L.

    1974-01-01

    Development of a theory describing the selective excitation of a three-level atom with a tunable laser. The effects of number density, line widths, and laser parameters on the final populations of the levels are discussed. An experiment is described in which a tunable dye laser is used to pump large numbers of barium atoms into a definite excited state.

  18. Effects of light exposure on irradiated barium fluoride crystals

    SciTech Connect

    Wuest, C.R.; Mauger, G.J.

    1993-04-20

    Small barium fluoride crystals have been irradiated using cobalt-60 gamma rays under various illumination conditions to establish the effect of photo-bleaching of the radiation-induced color centers. This paper describes results of a few different experiments conducted at LLNL over the past few weeks.

  19. SEPARATION OF BARIUM VALUES FROM URANYL NITRATE SOLUTIONS

    DOEpatents

    Tompkins, E.R.

    1959-02-24

    The separation of radioactive barium values from a uranyl nitrate solution of neutron-irradiated uranium is described. The 10 to 20% uranyl nitrate solution is passed through a flrst column of a cation exchange resin under conditions favoring the adsorption of barium and certain other cations. The loaded resin is first washed with dilute sulfuric acid to remove a portion of the other cations, and then wash with a citric acid solution at pH of 5 to 7 to recover the barium along with a lesser amount of the other cations. The PH of the resulting eluate is adjusted to about 2.3 to 3.5 and diluted prior to passing through a smaller second column of exchange resin. The loaded resin is first washed with a citric acid solution at a pH of 3 to elute undesired cations and then with citric acid solution at a pH of 6 to eluts the barium, which is substantially free of undesired cations.

  20. Dynamics of a barium release in the magnetospheric tail

    NASA Technical Reports Server (NTRS)

    Mende, S. B.; Swenson, G. R.; Geller, S. P.; Doolittle, J. H.; Haerendel, G.

    1989-01-01

    The late time behavior of the May 13, 1985 magnetotail barium cloud is examined. The bulk dynamics of the cloud are studied based on triangulated data and data from Fabry-Perot Doppler velocity measurements. The changes in cloud morphology in relation to the in situ measurements made by the Ion Release Module satellite are discussed.

  1. PROPOSED ORAL REFERENCE DOSE (RFD) FOR BARIUM AND COMPOUNDS

    EPA Science Inventory

    The Integrated Risk Information System (IRIS) is a database of EPA's consensus opinion of the human health effects that may result from exposure to various substances found in the environment. A Toxicological Review and IRIS Summary were prepared for barium and compounds in 1998 ...

  2. BARIUM AND RADIUM REMOVAL FROM GROUNDWATER BY ION EXCHANGE

    EPA Science Inventory

    The primary objective of this study was to determine the applicability of weak acid exchange resin in the hydrogen form for removal of hardness, barium and radium from groundwater. Weak acid resin in the hydrogen form eliminates the addition of sodium to drinking water. The capac...

  3. Elemental Content of Calcium Oxalate Stones from a Canine Model of Urinary Stone Disease

    PubMed Central

    Killilea, David W.; Westropp, Jodi L.; Shiraki, Ryoji; Mellema, Matthew; Larsen, Jennifer; Kahn, Arnold J.; Kapahi, Pankaj; Chi, Thomas; Stoller, Marshall L.

    2015-01-01

    One of the most common types of urinary stones formed in humans and some other mammals is composed of calcium oxalate in ordered hydrated crystals. Many studies have reported a range of metals other than calcium in human stones, but few have looked at stones from animal models such as the dog. Therefore, we determined the elemental profile of canine calcium oxalate urinary stones and compared it to reported values from human stones. The content of 19 elements spanning 7-orders of magnitude was quantified in calcium oxalate stones from 53 dogs. The elemental profile of the canine stones was highly overlapping with human stones, indicating similar inorganic composition. Correlation and cluster analysis was then performed on the elemental profile from canine stones to evaluate associations between the elements and test for potential subgrouping based on elemental content. No correlations were observed with the most abundant metal calcium. However, magnesium and sulfur content correlated with the mineral hydration form, while phosphorous and zinc content correlated with the neuter status of the dog. Inter-elemental correlation analysis indicated strong associations between barium, phosphorous, and zinc content. Additionally, cluster analysis revealed subgroups within the stones that were also based primarily on barium, phosphorous, and zinc. These data support the use of the dog as a model to study the effects of trace metal homeostasis in urinary stone disease. PMID:26066810

  4. [Do cows drink calcium?].

    PubMed

    Geishauser, T; Lechner, S; Plate, I; Heidemann, B

    2008-03-01

    The objective of this study was to investigate how well cows drink the Propeller calcium drink, and it's effect on blood calcium concentration. Drinking was tested in 120 cows right after calving, before cows drank anything else. 60 cows each were offered 20 liters of Propeller calcium drink or 20 liters of water. Cows drank the Propeller as good as water. 72% of all cows drank all 20 liters, 18% drank on average 8.2 liters and 10% drank less than 1 liter. Blood calcium concentration was studied in 16 cows right after calving. Eight cows each were offered 20 liters of Propeller calcium drink or no calcium drink. Blood calcium significantly increased ten minutes after Propeller intake and stayed significantly elevated for 24 hours. Without calcium drink blood calcium levels decreased significantly. Advantages of the new Propeller calcium drink over calcium gels or boli could be that cows now drink calcium themselves and that the Propeller increases blood calcium concentration rapidly and long lasting. PMID:18429501

  5. Barium and strontium as calcium substitutes for contractile responses in the rat tail artery.

    PubMed

    Ebeigbe, A B; Aloamaka, C P

    1985-01-01

    The ability of Ba2+ and Sr2+ to substitute for Ca2+ in contractile responses of the rat tail artery has been examined. Both Ba2+ and Sr2+ caused comparable contractions in Ca-depleted NA-stimulated, or K+-depolarized strips. Ba2+ and Sr2+ substitute poorly for Ca2+ at noradrenaline-sensitive membrane sites. At high concentrations, the three divalent cations stabilize the membrane in the order: Ca2+ greater than Sr2+ greater than Ba2+. The relaxation rates following high-K+ contractions were similar for all three divalent cations, suggesting a common mechanism for sequestration/extrusion. PMID:2414057

  6. Correlation between 19F environment and isotropic chemical shift in barium and calcium fluoroaluminates.

    PubMed

    Body, M; Silly, G; Legein, C; Buzaré, J-Y

    2004-04-19

    High-speed MAS (19)F NMR spectra are recorded and reconstructed for 10 compounds from BaF(2)-AlF(3) and CaF(2)-AlF(3) binary systems which leads to the determination of 77 isotropic (19)F chemical shifts in various environments. A first attribution of NMR lines is performed for 8 compounds using a superposition model as initially proposed by B. Bureau et al. The phenomenological parameters of this model are then refined to improve the NMR line assignment. A satisfactory reliability is reached with a root-mean-square (RMS) deviation between calculated and measured values equal to 6 ppm. The refined parameters are then successfully tested on alpha-BaCaAlF(7) whose structure was recently determined. Finally, the isotropic chemical shift ranges are defined for shared, unshared, and "free" fluorine atoms encountered in the investigated binary systems. So, the fluorine surroundings can be deduced from the NMR line positions in compounds whose structure is unknown. Such an approach can also be applied to fluoride glasses. PMID:15074964

  7. Straczekite, a new calcium barium potassium vanadate mineral from Wilson Springs, Arkansas.

    USGS Publications Warehouse

    Evans, H.T., Jr.; Nord, G.; Marinenko, J.; Milton, C.

    1984-01-01

    Straczekite occurs as a rare secondary mineral in fibrous seams, along with other V minerals (A.M. 64-713), in ore from the vanadium mine in Wilson Springs (formerly Potash Sulfur Springs), Garland County, Arkansas. It forms soft, thin laths of dark greenish black crystals up to 0.5 mm in length. Indexed XRD data are tabulated; strongest lines 3.486(100), 10.449(50), 1.8306(50), 1.9437(15) A; a 11.679, b 3.6608, c 10.636 A, beta 100.53o; space group C2/m, C2 or Cm. Chemical analysis gave V2O5 66.4, V2O4 15.3, Fe2O3 0.9, Na2O 0.4, K2O 1.8, CaO 2.5, BaO 5.5, H2O 7.2, = 100.0, leading to the formula (Ca0.39Ba0.31K0.33Na0.11)- 196(V4+1.59V5+6.31Fe3+0.10)O20.02(H2O)2.9; Dcalc. 3.21 g/cm3. A possible layer structure is discussed. The name is for J. A. Straczek, Chief Geologist at Union Carbide Corp.-R.A.H.

  8. Results of critical velocity experiments with barium, strontium, and calcium releases from CRRES satellite

    NASA Technical Reports Server (NTRS)

    Wescott, E. M.; Stenbaek-Nielsen, H. C.; Hampton, D. L.; Delamere, P. A.

    1994-01-01

    As part of the NASA Combined Release and Radiation Effects Satellite (CRRES) chemical release program in September 1990, two Ba and also one each Sr and Ca canisters of a boron-titanium thermite mixture, which vaporizes the element on ignition, were released near perigee after dusk in the South Pacific to study the critical velocity effect proposed by Alfven. The critical velocities of these three elements are 2.7, 3.5, and 5.4 km/s respectively, all well below the orbital velocity of 9.4 km/s. On September 10, 1990, a Sr and Ba pair (G-13, or critical ionization velocity (CIV) I) was released near Rarotonga at approximately 515 km altitude in a background electron density of 3.4 x 10(exp 6)/cu cm. On September 14, 1990, G-14 or CIV II released a Ca and Ba pair west of New Caledonia near 595 km at an electron density of 1.5 x 10(exp 6)/cu cm. Ions of all three elements were observed with low-light level imagers from two aircraft after they had transited up the magnetic field lines into the sunlight. Emissions from the spherically expanding neutral gas shells below the solar terminator, observed with cameras filtered for the Ba(+) ion line at 4554 A and also in unfiltered imagers for approximately 15 s after release, are probably due to excitation by hot electrons created in the CIV process. The ions created clearly lost much of their energy, which we now show can be explained by elastic collisions: Ba(+) + O. Inventories of the observed ions indicate yields of 0.15% and 1.84% for Ba in the first and second experiments, 0.02% for Sr and 0.27% for Ca. Ionization from all the releases continued along the satellite trajectory much longer (greater than 45 s) than expected for a CIV process. The ion production along the satellite track versus time typically shows a rapid rise to a peak in a few seconds followed by an exponential decrease to a level essentially constant rate. The characteristic distances for CIV I and II are 47 and 62 km, respectively. We interpret the early time rise and exponential fall to be due to CIV ionization, of 0.014% (CIV I) and 0.40% (CIV II) for the Ba releases. The later ions produced at a constant rate probably have origins from other such processes as stripping and associative ionization collisions with atmospheric constituents primarily O, and charge exchange with O(+), He(+), and H(+). We suggest that the much larger Ba ionization rate in CIV II than CIV I is due to the fact that the release occurred in the peak Ca density where hot electrons were already present.

  9. Determination of micro amounts of iron, aluminum, and alkaline earth metals in silicon carbide

    NASA Technical Reports Server (NTRS)

    Hirata, H.; Arai, M.

    1978-01-01

    A colorimetric method for analysis of micro components in silicon carbide used as the raw material for varistors is described. The microcomponents analyzed included iron soluble in hydrochloric acid, iron, aluminum, calcium and magnesium. Samples were analyzed by the method, and the results for iron and aluminum agreed well with the N.B.S. standard values and the values obtained by the other company. The method can therefore be applied to the analysis of actual samples.

  10. Preliminary study of the CRRES magnetospheric barium releases

    NASA Technical Reports Server (NTRS)

    Huba, J. D.; Bernhardt, P. A.; Lyon, J. G.

    1992-01-01

    Preliminary theoretical and computational analyses of the Combined Release and Radiation Effects Satellite (CRRES) magnetospheric barium releases are presented. The focus of the studies is on the evolution of the diamagnetic cavity which is formed by the barium ions as they expand outward, and on the structuring of the density and magnetic field during the expansion phase of the releases. Two sets of simulation studies are discussed. The first set is based upon a 2D ideal MHD code and provides estimates of the time and length scales associated with the formation and collapse of the diamagnetic cavity. The second set uses a nonideal MHD code; specifically, the Hall term is included. This additional term is critical to the dynamics of sub-Alfvenic plasma expansions, such as the CRRES barium releases, because it leads to instability of the expanding plasma. Detailed simulations of the G4 and G10 releases were performed. In both cases the expanding plasma rapidly structured: the G4 release structured at time t less than about 3 s and developed scale sizes of about 1-2 km, while the G10 release structured at time t less than about 22 s and developed scale sizes of about 10-15 km. It is also found that the diamagnetic cavity size is reduced from those obtained from the ideal MHD results because of the structure. On the other hand, the structuring allows the formation of plasma blobs which appear to free stream across the magnetic field; thus, the barium plasma can propagate to larger distances traverse to the magnetic field than the case where no structuring occurs. Finally, a new normal mode of the system was discovered which may be excited at the leading edge of the expanding barium plasma.

  11. BLENDED CALCIUM ALUMINATE-CALCIUM SULFATE CEMENT-BASED GROUT FOR P-REACTOR VESSEL IN-SITU DECOMMISSIONING

    SciTech Connect

    Langton, C.; Stefanko, D.

    2011-03-10

    The objective of this report is to document laboratory testing of blended calcium aluminate - calcium hemihydrate grouts for P-Reactor vessel in-situ decommissioning. Blended calcium aluminate - calcium hemihydrate cement-based grout was identified as candidate material for filling (physically stabilizing) the 105-P Reactor vessel (RV) because it is less alkaline than portland cement-based grout which has a pH greater than 12.4. In addition, blended calcium aluminate - calcium hemihydrate cement compositions can be formulated such that the primary cementitious phase is a stable crystalline material. A less alkaline material (pH {<=} 10.5) was desired to address a potential materials compatibility issue caused by corrosion of aluminum metal in highly alkaline environments such as that encountered in portland cement grouts [Wiersma, 2009a and b, Wiersma, 2010, and Serrato and Langton, 2010]. Information concerning access points into the P-Reactor vessel and amount of aluminum metal in the vessel is provided elsewhere [Griffin, 2010, Stefanko, 2009 and Wiersma, 2009 and 2010, Bobbitt, 2010, respectively]. Radiolysis calculations are also provided in a separate document [Reyes-Jimenez, 2010].

  12. Calcium and Vitamin D

    MedlinePlus

    ... to your weekly shopping list. Produce Serving Size Estimated Calcium* Collard greens, frozen 8 oz 360 mg ... Oranges 1 whole 55 mg Seafood Serving Size Estimated Calcium* Sardines, canned with bones 3 oz 325 ...

  13. Fenoprofen calcium overdose

    MedlinePlus

    ... page: //medlineplus.gov/ency/article/002649.htm Fenoprofen calcium overdose To use the sharing features on this page, please enable JavaScript. Fenoprofen calcium is a type of medicine called a nonsteroidal ...

  14. Calcium channel blocker overdose

    MedlinePlus

    ... this page: //medlineplus.gov/ency/article/002580.htm Calcium channel blocker overdose To use the sharing features on this page, please enable JavaScript. Calcium channel blockers are a type of medicine used ...

  15. Fenoprofen calcium overdose

    MedlinePlus

    Fenoprofen calcium is a type of medicine called a nonsteroidal anti-inflammatory drug. It is a prescription pain medicine used to relieve symptoms of arthritis . Fenoprofen calcium overdose occurs when someone takes more than the ...

  16. Calcium and bones (image)

    MedlinePlus

    Calcium is one of the most important minerals for the growth, maintenance, and reproduction of the human body. Bones, like other tissues in the body, are continually being re-formed and incorporate calcium into their ...

  17. Crystal structure of complex natural aluminum magnesium calcium iron oxide

    SciTech Connect

    Rastsvetaeva, R. K. Aksenov, S. M.; Verin, I. A.

    2010-07-15

    The structure of a new natural oxide found near the Tashelga River (Eastern Siberia) was studied by X-ray diffraction. The pseudo-orthorhombic unit cell parameters are a = 5.6973(1) A, b = 17.1823(4) A, c = 23.5718(5) A, {beta} = 90{sup o}, sp. gr. Pc. The structure was refined to R = 0.0516 based on 4773 reflections with vertical bar F vertical bar > 7{sigma}(F) taking into account the twin plane perpendicular to the z axis (the twin components are 0.47 and 0.53). The crystal-chemical formula (Z = 4) is Ca{sub 2}Mg{sub 2}{sup IV}Fe{sub 2}{sup (2+)IV}[Al{sub 14}{sup VI}O{sub 31}(OH)][Al{sub 2}{sup IV}O][Al{sup IV}]AL{sup IV}(OH)], where the Roman numerals designate the coordination of the atoms. The structure of the mineral is based on wide ribbons of edge-sharing Al octahedra (an integral part of the spinel layer). The ribbons run along the shortest x axis and are inclined to the y and z axes. The adjacent ribbons are shifted with respect to each other along the y axis, resulting in the formation of step-like layers in which the two-ribbon thickness alternates with the three-ribbon thickness. Additional Al octahedra and Mg and Fe{sup 2+} tetrahedra are located between the ribbons. The layers are linked together to form a three-dimensional framework by Al tetrahedra, Ca polyhedra, and hydrogen bonds with the participation of OH groups.

  18. Contribution of calcium oxalate to soil-exchangeable calcium

    USGS Publications Warehouse

    Dauer, Jenny M.; Perakis, Steven S.

    2013-01-01

    Acid deposition and repeated biomass harvest have decreased soil calcium (Ca) availability in many temperate forests worldwide, yet existing methods for assessing available soil Ca do not fully characterize soil Ca forms. To account for discrepancies in ecosystem Ca budgets, it has been hypothesized that the highly insoluble biomineral Ca oxalate might represent an additional soil Ca pool that is not detected in standard measures of soil-exchangeable Ca. We asked whether several standard method extractants for soil-exchangeable Ca could also access Ca held in Ca oxalate crystals using spike recovery tests in both pure solutions and soil extractions. In solutions of the extractants ammonium chloride, ammonium acetate, and barium chloride, we observed 2% to 104% dissolution of Ca oxalate crystals, with dissolution increasing with both solution molarity and ionic potential of cation extractant. In spike recovery tests using a low-Ca soil, we estimate that 1 M ammonium acetate extraction dissolved sufficient Ca oxalate to contribute an additional 52% to standard measurements of soil-exchangeable Ca. However, in a high-Ca soil, the amount of Ca oxalate spike that would dissolve in 1 M ammonium acetate extraction was difficult to detect against the large pool of exchangeable Ca. We conclude that Ca oxalate can contribute substantially to standard estimates of soil-exchangeable Ca in acid forest soils with low soil-exchangeable Ca. Consequently, measures of exchangeable Ca are unlikely to fully resolve discrepancies in ecosystem Ca mass balance unless the contribution of Ca oxalate to exchangeable Ca is also assessed.

  19. Calcium and magnesium disorders.

    PubMed

    Goff, Jesse P

    2014-07-01

    Hypocalcemia is a clinical disorder that can be life threatening to the cow (milk fever) and predisposes the animal to various other metabolic and infectious disorders. Calcium homeostasis is mediated primarily by parathyroid hormone, which stimulates bone calcium resorption and renal calcium reabsorption. Parathyroid hormone stimulates the production of 1,25-dihydroxyvitamin D to enhance diet calcium absorption. High dietary cation-anion difference interferes with tissue sensitivity to parathyroid hormone. Hypomagnesemia reduces tissue response to parathyroid hormone. PMID:24980727

  20. Calcium and Mitosis

    NASA Technical Reports Server (NTRS)

    Hepler, P.

    1983-01-01

    Although the mechanism of calcium regulation is not understood, there is evidence that calcium plays a role in mitosis. Experiments conducted show that: (1) the spindle apparatus contains a highly developed membrane system that has many characteristics of sarcoplasmic reticulum of muscle; (2) this membrane system contains calcium; and (3) there are ionic fluxes occurring during mitosis which can be seen by a variety of fluorescence probes. Whether the process of mitosis can be modulated by experimentally modulating calcium is discussed.

  1. Note: Inhibiting bottleneck corrosion in electrical calcium tests for ultra-barrier measurements

    NASA Astrophysics Data System (ADS)

    Nehm, F.; Müller-Meskamp, L.; Klumbies, H.; Leo, K.

    2015-12-01

    A major failure mechanism is identified in electrical calcium corrosion tests for quality assessment of high-end application moisture barriers. Accelerated calcium corrosion is found at the calcium/electrode junction, leading to an electrical bottleneck. This causes test failure not related to overall calcium loss. The likely cause is a difference in electrochemical potential between the aluminum electrodes and the calcium sensor, resulting in a corrosion element. As a solution, a thin, full-area copper layer is introduced below the calcium, shifting the corrosion element to the calcium/copper junction and inhibiting bottleneck degradation. Using the copper layer improves the level of sensitivity for the water vapor transmission rate (WVTR) by over one order of magnitude. Thin-film encapsulated samples with 20 nm of atomic layer deposited alumina barriers this way exhibit WVTRs of 6 × 10-5 g(H2O)/m2/d at 38 °C, 90% relative humidity.

  2. A case of recurrent renal aluminum hydroxide stone.

    PubMed

    Cakıroglu, Basri; Dogan, Akif Nuri; Tas, Tuncay; Gozukucuk, Ramazan; Uyanik, Bekir Sami

    2014-01-01

    Renal stone disease is characterized by the differences depending on the age, gender, and the geographic location of the patients. Seventy-five percent of the renal stone components is the calcium (Ca). The most common type of the stones is the Ca oxalate stones, while Ca phosphate, uric acid, struvite, and sistine stones are more rarely reported. Other than these types, triamterene, adenosine, silica, indinavir, and ephedrine stones are also reported in the literature as case reports. However, to the best of our knowledge, aluminum hydroxide stones was not reported reported before. Herein we will report a 38-years-old woman with the history of recurrent renal colic disease whose renal stone was determined as aluminum hydroxide stone in type. Aluminum mineral may be considered in the formation of kidney stones as it is widely used in the field of healthcare and cosmetics. PMID:25013740

  3. Aluminum, parathyroid hormone, and osteomalacia

    SciTech Connect

    Burnatowska-Hledin, M.A.; Kaiser, L.; Mayor, G.H.

    1983-01-01

    Aluminum exposure in man is unavoidable. The occurrence of dialysis dementia, vitamin D-resistant osteomalacia, and hypochromic microcytic anemia in dialysis patients underscores the potential for aluminum toxicity. Although exposure via dialysate and hyperalimentation leads to significant tissue aluminum accumulation, the ubiquitous occurrence of aluminum and the severe pathology associated with large aluminum burdens suggest that smaller exposures via the gastrointestinal tract and lungs could represent an important, though largely unrecognized, public health problem. It is clear that some aluminum absorption occurs with the ingestion of small amounts of aluminum in the diet and medicines, and even greater aluminum absorption is seen in individuals consuming large amounts of aluminum present in antacids. Aluminum absorption is enhanced in the presence of elevated circulating parathyroid hormone. In addition, elevated PTH leads to the preferential deposition of aluminum in brain and bone. Consequently, PTH is likely to be involved in the pathogenesis of toxicities in those organs. PTH excess also seems to lead to the deposition of aluminum in the parathyroid gland. The in vitro demonstration that aluminum inhibits parathyroid hormone release is consistent with the findings of a euparathyroid state in dialysis patients with aluminum related vitamin D-resistant osteomalacia. Nevertheless, it seems likely that hyperparathyroidism is at least initially involved in the pathogenesis of aluminum neurotoxicity and osteomalacia; the increases in tissue aluminum stores are followed by suppression of parathyroid hormone release, which is required for the evolution of osteomalacia. Impaired renal function is not a prerequisite for increased tissue aluminum burdens, nor for aluminum-related organ toxicity. Consequently, it is likely that these diseases will be observed in populations other than those with chronic renal disease.

  4. Calcium and Vitamin D

    Technology Transfer Automated Retrieval System (TEKTRAN)

    This chapter describes the roles of calcium and vitamin D in bone health. Calcium is required for the bone formation phase of bone remodeling and it also affects bone mass through its impact on the remodeling rate. Typically, about 5 nmol (200 mg) of calcium is removed from the adult skeleton and ...

  5. Calcium and bones

    MedlinePlus

    Bone strength and calcium ... or if your body does not absorb enough calcium, your bones can get weak or will not grow properly. ... injury. As you age, your body still needs calcium to keep your bones dense and strong. Most experts recommend at least ...

  6. Occurrence of aluminum in chloride cells of Perla marginata (Plecoptera) after exposure to low pH and elevated aluminum concentration

    SciTech Connect

    Guerold, F.; Giamberini, L.; Pihan, J.C.; Tourmann, J.L.; Kaufmann, R.

    1995-04-01

    As a consequence of acid depositions on poorly buffered catchments underlain by hard rocks, aluminum is mobilized and transported from terrestrial systems to the aquatic environment. Loss of fishes has been related to low pH and elevated aluminum concentrations in surface waters which present a low ionic content especially during acid stress such as snowmelt and heavy rainfalls. Among the causes of fish population decline in acid waters, aluminum is considered a toxic cofactor. Different studies have clearly shown that aluminum is accumulated in different organs such as kidneys, liver and gills. Research on fish has demonstrated that aluminum may be toxic, but the toxicity is markedly influenced by the pH, organic compounds and calcium content of the water. Field surveys have shown clearly that macroinvertebrates are also affected by surface-water acidification. However, little is know about the possible effects of aluminum on aquatic invertebrates and, particularly, on aquatic insects exposed to acidic conditions. Hall et al. have shown that the whole-body concentration of aluminum decreases in blackflies and mayflies transplated from neutral water to acid water. Similar results have been reported for Daphnia and chironomid. On the contrary, Ormerod et al. demonstrated the absence of relationship between water pH and insect aluminum concentrations. When aluminum occurs in aquatic insects, it has been shown that it is primarily adsorbed on the external surface and/or accumulates in gut contents. To our knowledge, the subcellular location as well as the toxicity of aluminum to acid-sensitive aquatic insects remains unclear and existing hypotheses are often based on research on fish. In this content the purpose of this study was to investigate the presence of aluminum at a subcellular level in the acid-sensitive species of stonefly, Perla marginata, after exposure to low pH and elevated aluminum concentrations. 18 refs., 1 fig., 1 tab.

  7. ALUMINUM RECLAMATION BY ACIDIC EXTRACTION OF ALUMINUM-ANODIZING SLUDGES

    EPA Science Inventory

    Extraction of aluminum-anodizing sludges with sulfuric acid was examined to determine the potential for production of commercial-strength solutions of aluminum sulfate, that is liquid alum. The research established kinetic and stoichiometric relationships and evaluates product qu...

  8. Calcium bioavailability from calcium fortified food products.

    PubMed

    Kohls, K

    1991-08-01

    The calcium balance of 12 presumed healthy human young adult subjects was assessed. Subjects consumed a constant laboratory-controlled diet supplemented with one of four calcium-fortified food products: orange juice (OJ), milk (M), experimental pasteurized processed cheese (T), soda (S), or a calcium carbonate plus vitamin D tablet (CC). Study length was 6 weeks with seven-day experimental periods (2-days allowed for adjustment with 5-days combined for purposes of analysis). All urine and fecal samples were collected by the subjects for the duration of the study. Blood samples were drawn at the end of each experimental period. Urine and fecal calcium contents were determined. Blood samples were analyzed for alkaline phosphatase. Results of this study indicate a higher fecal calcium content (mg/day) when subjects consumed CC and T, and when subjects consumed self-selected diets, than when given S, M, or OJ. Urinary calcium excretion was significantly lower when subjects consumed OJ than when they consumed M, T, or their self-selected diets. A significantly larger positive calcium balance was demonstrated when subjects consumed OJ as compared to T. Fecal transmit time did not vary significantly. Serum alkaline phosphatase was significantly lower when subjects consumed T than when they consumed self-selected diets. PMID:1765836

  9. Aluminum for plasmonics.

    PubMed

    Knight, Mark W; King, Nicholas S; Liu, Lifei; Everitt, Henry O; Nordlander, Peter; Halas, Naomi J

    2014-01-28

    Unlike silver and gold, aluminum has material properties that enable strong plasmon resonances spanning much of the visible region of the spectrum and into the ultraviolet. This extended response, combined with its natural abundance, low cost, and amenability to manufacturing processes, makes aluminum a highly promising material for commercial applications. Fabricating Al-based nanostructures whose optical properties correspond with theoretical predictions, however, can be a challenge. In this work, the Al plasmon resonance is observed to be remarkably sensitive to the presence of oxide within the metal. For Al nanodisks, we observe that the energy of the plasmon resonance is determined by, and serves as an optical reporter of, the percentage of oxide present within the Al. This understanding paves the way toward the use of aluminum as a low-cost plasmonic material with properties and potential applications similar to those of the coinage metals. PMID:24274662

  10. Validation of an in situ solidification/stabilization technique for hazardous barium and cyanide waste for safe disposal into a secured landfill.

    PubMed

    Vaidya, Rucha; Kodam, Kisan; Ghole, Vikram; Surya Mohan Rao, K

    2010-09-01

    The aim of the present study was to devise and validate an appropriate treatment process for disposal of hazardous barium and cyanide waste into a landfill at a Common Hazardous Waste Treatment Storage Disposal Facility (CHWTSDF). The waste was generated during the process of hardening of steel components and contains cyanide (reactive) and barium (toxic) as major contaminants. In the present study chemical fixation of the contaminants was carried out. The cyanide was treated by alkali chlorination with calcium hypochlorite and barium by precipitation with sodium sulfate as barium sulfate. The pretreated mixture was then solidified and stabilized by binding with a combination of slag cement, ordinary Portland cement and fly ash, molded into blocks (5 x 5 x 5 cm) and cured for a period of 3, 7 and 28 days. The final experiments were conducted with 18 recipe mixtures of waste + additive:binder (W:B) ratios. The W:B ratios were taken as 80:20, 70:30 and 50:50. The optimum proportions of additives and binders were finalized on the basis of the criteria of unconfined compressive strength and leachability. The leachability studies were conducted using the Toxicity Characteristic Leaching Procedure. The blocks were analyzed for various physical and leachable chemical parameters at the end of each curing period. Based on the results of the analysis, two recipe mixtures, with compositions - 50% of [waste + (120 g Ca(OCl)(2) + 290 g Na(2)SO(4)) kg(-1) of waste] + 50% of binders, were validated for in situ stabilization into a secured landfill of CHWTSDF. PMID:20430516

  11. Regeneration of aluminum hydride

    DOEpatents

    Graetz, Jason Allan; Reilly, James J; Wegrzyn, James E

    2012-09-18

    The present invention provides methods and materials for the formation of hydrogen storage alanes, AlH.sub.x, where x is greater than 0 and less than or equal to 6 at reduced H.sub.2 pressures and temperatures. The methods rely upon reduction of the change in free energy of the reaction between aluminum and molecular H.sub.2. The change in free energy is reduced by lowering the entropy change during the reaction by providing aluminum in a state of high entropy, and by increasing the magnitude of the change in enthalpy of the reaction or combinations thereof.

  12. Regeneration of aluminum hydride

    DOEpatents

    Graetz, Jason Allan; Reilly, James J.

    2009-04-21

    The present invention provides methods and materials for the formation of hydrogen storage alanes, AlH.sub.x, where x is greater than 0 and less than or equal to 6 at reduced H.sub.2 pressures and temperatures. The methods rely upon reduction of the change in free energy of the reaction between aluminum and molecular H.sub.2. The change in free energy is reduced by lowering the entropy change during the reaction by providing aluminum in a state of high entropy, by increasing the magnitude of the change in enthalpy of the reaction or combinations thereof.

  13. Elevated temperature aluminum alloys

    NASA Technical Reports Server (NTRS)

    Meschter, Peter (Inventor); Lederich, Richard J. (Inventor); O'Neal, James E. (Inventor)

    1989-01-01

    Three aluminum-lithium alloys are provided for high performance aircraft structures and engines. All three alloys contain 3 wt % copper, 2 wt % lithium, 1 wt % magnesium, and 0.2 wt % zirconium. Alloy 1 has no further alloying elements. Alloy 2 has the addition of 1 wt % iron and 1 wt % nickel. Alloy 3 has the addition of 1.6 wt % chromium to the shared alloy composition of the three alloys. The balance of the three alloys, except for incidentql impurities, is aluminum. These alloys have low densities and improved strengths at temperatures up to 260.degree. C. for long periods of time.

  14. Aluminum Hydroxide and Magnesium Hydroxide

    MedlinePlus

    Aluminum Hydroxide, Magnesium Hydroxide are antacids used together to relieve heartburn, acid indigestion, and upset stomach. They ... They combine with stomach acid and neutralize it. Aluminum Hydroxide, Magnesium Hydroxide are available without a prescription. ...

  15. Design, testing, fabrication and launch support of a liquid chemical barium release payload (utilizing the liquid fluorine-barium salt/hydrazine system)

    NASA Technical Reports Server (NTRS)

    Stokes, C. S.; Smith, E. W.; Murphy, W. J.

    1972-01-01

    A payload was designed which included a cryogenic oxidizer tank, a fuel tank, and burner section. Release of 30 lb of chemicals was planned to occur in 2 seconds at the optimum oxidizer to fuel ratio. The chemicals consisted of 17 lb of liquid fluorine oxidizer and 13 lb of hydrazine-barium salt fuel mixture. The fuel mixture was 17% barium chloride, 16% barium nitrate, and 67% hydrazine, and contained 2.6 lb of available barium. Two significant problem areas were resolved during the program: explosive valve development and burner operation. The release payload was flight tested, from Wallops Island, Virginia. The release took place at an altitude of approximately 260 km. The release produced a luminous cloud which expanded very rapidly, disappearing to the human eye in about 20 seconds. Barium ion concentration slowly increased over a wide area of sky until measurements were discontinued at sunrise (about 30 minutes).

  16. Surface studies of barium and barium oxide on tungsten and its application to understanding the mechanism of operation of an impregnated tungsten cathode

    NASA Technical Reports Server (NTRS)

    Forman, R.

    1976-01-01

    Surface studies have been made of multilayer and monolayer films of barium and barium oxide on a tungsten substrate. The purpose of the investigation was to synthesize the surface conditions that exist on an activated impregnated tungsten cathode and obtain a better understanding of the mechanism of operation of such cathodes. The techniques employed in these measurements were Auger spectroscopy and work-function measurements. The results of this study show that the surface of an impregnated cathode is identical to that observed for a synthesized monolayer or partial monolayer of barium on oxidized tungsten by evaluating Auger spectra and work-function measurements. Data obtained from desorption studies of barium monolayers on a tungsten substrate in conjunction with Auger and work-function results have been interpreted to show that throughout most of its life an impreganated cathode has a partial monolayer, rather than a monolayer, of barium on its surface.

  17. Synchronous barium peaks in high-resolution profiles of calcite and aragonite marine bivalve shells

    NASA Astrophysics Data System (ADS)

    Gillikin, David Paul; Lorrain, Anne; Paulet, Yves-Marie; André, Luc; Dehairs, Frank

    2008-10-01

    Barium/calcium profiles of bivalve shells are characterized by flat background signals periodically interrupted by sharp peaks, with the background signals correlated with water Ba/Ca. To test if the peaks are an environmental signal related to productivity, we analyzed high-resolution Ba/Ca profiles in bivalve shells that grew adjacent to one another. Two aragonitic Saxidomus giganteus show remarkable similarity over a decade of growth, clearly indicating an environmental forcing. Four calcitic Pecten maximus shells also record synchronous Ba/Ca peaks, again indicating an exogenous control. The Ba/Ca peaks, however, start ~40 days after the crash of a bloom, while sedimentation takes place immediately following the bloom. Barite formation in settling phytoplankton flocs, as has been previously proposed, is clearly not the cause of these peaks. Other possible causes, such as dissolved Ba in ambient water, spawning, shell organic matter content, and kinetic growth rate effects are also discussed, but none provide satisfactory explanations. Background shell Ba partition coefficients (Ba/Cacarbonate/Ba/Cawater) for both the calcitic shells (0.18) and aragonitic shells (0.16) are similar to that previously reported for the calcitic Mytilus edulis (~0.1). We suggest that Ba/Ca peaks in bivalve shells are caused by an as yet undetermined environmental forcing, while background Ba/Ca levels are a good indication of dissolved Ba/Ca in the water; both are independent of shell mineralogy.

  18. The effect of radiopacifiers agents on pH, calcium release, radiopacity, and antimicrobial properties of different calcium hydroxide dressings.

    PubMed

    Ordinola-Zapata, Ronald; Bramante, Clovis Monteiro; García-Godoy, Franklin; Moldauer, Bertram Ivan; Gagliardi Minotti, Paloma; Tercília Grizzo, Larissa; Duarte, Marco Antonio Hungaro

    2015-07-01

    The aim of this study was to evaluate the antimicrobial activity, pH level, calcium ion release, and radiopacity of calcium hydroxide pastes associated with three radiopacifying agents (iodoform, zinc oxide, and barium sulfate). For the pH and calcium release tests, 45 acrylic teeth were utilized and immersed in ultrapure water. After 24 h, 72 h, and 7 days the solution was analyzed by using a pH meter and an atomic absorption spectrophotometer. Polyethylene tubes filled with the pastes were used to perform the radiopacity test. For the antimicrobial test, 25 dentin specimens were infected intraorally in order to induce the biofilm colonization and treated with the pastes for 7 days. The Live/Dead technique and a confocal microscope were used to obtain the ratio of live cells. Parametric and nonparametric statistical tests were performed to show differences among the groups (P < 0.05). The pH analysis at 7 days showed significant differences (P < 0.05) among the groups. No differences among the pastes were found in the calcium release test on the 7th day (P > 0.05). The calcium hydroxide/iodoform samples had the highest radiopacity and antimicrobial activity against the biofilm-infected dentin in comparison to the other pastes (P < 0.05). Calcium hydroxide mixed with 17% iodoform and 35% propylene glycol into a paste had the highest pH, calcium ion release, radiopacity, and the greatest antimicrobial action versus similar samples mixed with BaSO4 or ZnO. PMID:25990864

  19. PROCESS FOR REMOVING ALUMINUM COATINGS

    DOEpatents

    Flox, J.

    1959-07-01

    A process is presented for removing aluminum jackets or cans from uranium slugs. This is accomplished by immersing the aluminum coated uranium slugs in an aqueous solution of 9 to 20% sodium hydroxide and 35 to 12% sodium nitrate to selectively dissolve the aluminum coating, the amount of solution being such as to obtain a molar ratio of sodium hydroxide to aluminum of at least

  20. Dielectric function for doped graphene layer with barium titanate

    NASA Astrophysics Data System (ADS)

    Martinez Ramos, Manuel; Garces Garcia, Eric; Magana, Fernado; Vazquez Fonseca, Gerardo Jorge

    2015-03-01

    The aim of our study is to calculate the dielectric function for a system formed with a graphene layer doped with barium titanate. Density functional theory, within the local density approximation, plane-waves and pseudopotentials scheme as implemented in Quantum Espresso suite of programs was used. We considered 128 carbon atoms with a barium titanate cluster of 11 molecules as unit cell with periodic conditions. The geometry optimization is achieved. Optimization of structural configuration is performed by relaxation of all atomic positions to minimize their total energies. Band structure, density of states and linear optical response (the imaginary part of dielectric tensor) were calculated. We thank Dirección General de Asuntos del Personal Académico de la Universidad Nacional Autónoma de México, partial financial support by Grant IN-106514 and we also thank Miztli Super-Computing center the technical assistance.

  1. Particularities of Radiation Defect Formation in Ceramic Barium Cerate

    NASA Astrophysics Data System (ADS)

    Khromushin, I. V.; Aksenova, T. I.; Tuseev, T.; Munasbaeva, K. K.; Ermolaev, Yu V.; Ermolaev, V. N.; Seitov, A. S.

    2015-04-01

    The effects of irradiation with electrons, ions of noble gases (Ne, Ar, Kr) and oxygen on the structure and properties of neodymium-doped barium cerate have been studied using the methods of X-ray diffraction analysis, scanning electron and atomic force microscopy, thermal desorption spectroscopy. It was shown that irradiation by low-energy ions of noble gases stimulates the blistering processes on the sample surface, while the high-energy ions contribute to formation of the structures on the irradiated surface that resemble the various stages of spherulitegrowth. The similar structures were not observed in the case of irradiation with high-energy oxygen ions. According to the data on thermal desorption of water and oxygen molecules from the irradiated barium cerate it was supposed that irradiation by the noble gas ions promotes neodymium oxidation state change. It was noticed that the electron irradiation leads to the formation of the nano-sized acicular structures on the cerate surface.

  2. Absolute Te_2 reference for barium ion at 4554 nm

    NASA Astrophysics Data System (ADS)

    Dutta, Tarun; De Munshi, Debashis; Mukherjee, Manas

    2016-06-01

    Precision atomic spectroscopy is presently the work horse in quantum information technology, metrology, trace analysis and even for fundamental tests in physics. Stable lasers are inherent part of precision spectroscopy which in turn requires absolute wavelength markers suitably placed corresponding to the atomic species being probed. Here we present, new lines of tellurium (Te$_2$) which allows locking of external cavity diode laser (ECDL) for precision spectroscopy of singly charged barium ions. In addition, we have developed an ECDL with over 100 GHz mod-hop-free tuning range using commercially available diode from $\\textit{Nichia}$. These two developments allow nearly drift-free operation of a barium ion trap set-up with one single reference cell thereby reducing the complexity of the experiment.

  3. Barium titanate nanoparticles: promising multitasking vectors in nanomedicine

    NASA Astrophysics Data System (ADS)

    Graziana Genchi, Giada; Marino, Attilio; Rocca, Antonella; Mattoli, Virgilio; Ciofani, Gianni

    2016-06-01

    Ceramic materials based on perovskite-like oxides have traditionally been the object of intense interest for their applicability in electrical and electronic devices. Due to its high dielectric constant and piezoelectric features, barium titanate (BaTiO3) is probably one of the most studied compounds of this family. Recently, an increasing number of studies have been focused on the exploitation of barium titanate nanoparticles (BTNPs) in the biomedical field, owing to the high biocompatibility of BTNPs and their peculiar non-linear optical properties that have encouraged their use as nanocarriers for drug delivery and as label-free imaging probes. In this review, we summarize all the recent findings about these ‘smart’ nanoparticles, including the latest, most promising potential as nanotransducers for cell stimulation.

  4. NASA/Max Planck Institute Barium Ion Cloud Project.

    NASA Technical Reports Server (NTRS)

    Brence, W. A.; Carr, R. E.; Gerlach, J. C.; Neuss, H.

    1973-01-01

    NASA and the Max Planck Institute for Extraterrestrial Physics (MPE), Munich, Germany, conducted a cooperative experiment involving the release and study of a barium cloud at 31,500 km altitude near the equatorial plane. The release was made near local magnetic midnight on Sept. 21, 1971. The MPE-built spacecraft contained a canister of 16 kg of Ba CuO mixture, a two-axis magnetometer, and other payload instrumentation. The objectives of the experiment were to investigate the interaction of the ionized barium cloud with the ambient medium and to deduce the properties of electric fields in the proximity of the release. An overview of the project is given to briefly summarize the organization, responsibilities, objectives, instrumentation, and operational aspects of the project.

  5. The Skylab barium plasma injection experiments. I - Convection observations

    NASA Technical Reports Server (NTRS)

    Wescott, E. M.; Stenbaek-Nielsen, H. C.; Davis, T. N.; Peek, H. M.

    1976-01-01

    Two barium-plasma injection experiments were carried out during magnetically active periods in conjunction with the Skylab 3 mission. The high-explosive shaped charges were launched near dawn on November 27 and December 4, 1973, UT. In both cases, the AE index was near 400 gammas, and extensive pulsating auroras covered the sky. The first experiment, Skylab Alpha, occurred in the waning phase of a 1000-gamma substorm, and the second, Skylab Beta, occurred in the expansive phase of an 800-gamma substorm. In both, the convection was generally magnetically eastward, with 100-km-level electric fields near 40 mV/m. However, in the Alpha experiment the observed orientation of the barium flux tube fit theoretical field lines having no parallel current, but the Beta flux-tube orientation indicated a substantial upward parallel sheet current.

  6. Observations and theory of the AMPTE magnetotail barium releases

    NASA Technical Reports Server (NTRS)

    Bernhardt, P. A.; Roussel-Dupre, R. A.; Pongratz, M. B.; Haerendel, G.; Valenzuela, A.

    1987-01-01

    The barium releases in the magnetotail during the Active Magnetospheric Particle Tracer Explorers (AMPTE) operation were monitored by ground-based imagers and by instruments on the Ion Release Module. After each release, the data show the formation of a structured diamagnetic cavity. The cavity grows until the dynamic pressure of the expanding ions balances the magnetic pressure on its surface. The magnetic field inside the cavity is zero. The barium ions collect on the surface of the cavity, producing a shell. Plasma irregularities form along magnetic field lines draped over the surface of the cavity. The scale size of the irregularities is nearly equal to the thickness of the shell. The evolution and structuring of the diamagnetic cavity are modeled using magnetohydrodynamics theory.

  7. Numerical simulation of a radially injected barium cloud

    NASA Technical Reports Server (NTRS)

    Swift, D. W.; Wescott, E. M.

    1981-01-01

    Electrostatic two-dimensional numerical simulations of a radially symmetric barium injection experiment demonstrate that ions created by solar UV irradiation are electrostatically bound to the electrons which remain tied to the field lines on which they are created. Two possible instabilities are identified, but neither of them causes the barium plasma cloud to polarize in a way that would permit the plasma to keep up with the neutrals. In a second model, the velocity of the neutrals is allowed to be a function of the azimuthal angle. Here, a portion of the cloud does polarize in a way that allows a portion of the plasma to detach and move outward at the approximate speed of the neutrals. No rapid detachment is found when only the density of the neutrals is given an azimuthal asymmetry.

  8. Study of the photovoltaic effect in thin film barium titanate

    NASA Technical Reports Server (NTRS)

    Grannemann, W. W.; Dharmadhikari, V. S.

    1982-01-01

    Ferroelectric films of barium titanate were synthesized on silicon and quartz substrates, and the photoelectric effect in the structure consisting of metal deposited ferroelectric barium titanate film silicon was studied. A photovoltage with polarity that depends on the direction of the remanent polarization was observed. The deposition of BaTiO3 on silicon and fused quartz substrates was accomplished by an rf sputtering technique. A series of experiments to study the growth of ferroelectric BaTiO3 films on single crystal silicon and fused quartz substrates were conducted. The ferroelectric character in these films was found on the basis of evidence from the polarization electric field hysteresis loops, capacitance voltage and capacitance temperature techniques and from X-ray diffraction studies.

  9. Barium titanate nanoparticles: promising multitasking vectors in nanomedicine.

    PubMed

    Genchi, Giada Graziana; Marino, Attilio; Rocca, Antonella; Mattoli, Virgilio; Ciofani, Gianni

    2016-06-10

    Ceramic materials based on perovskite-like oxides have traditionally been the object of intense interest for their applicability in electrical and electronic devices. Due to its high dielectric constant and piezoelectric features, barium titanate (BaTiO3) is probably one of the most studied compounds of this family. Recently, an increasing number of studies have been focused on the exploitation of barium titanate nanoparticles (BTNPs) in the biomedical field, owing to the high biocompatibility of BTNPs and their peculiar non-linear optical properties that have encouraged their use as nanocarriers for drug delivery and as label-free imaging probes. In this review, we summarize all the recent findings about these 'smart' nanoparticles, including the latest, most promising potential as nanotransducers for cell stimulation. PMID:27145888

  10. RECLAMATION OF ALUMINUM FINISHING SLUDGES

    EPA Science Inventory

    The research study of the reclamation of aluminum-anodizing sludges was conducted in two sequential phases focused on enhanced dewatering of aluminum-anodizing sludges to produce commercial-strength solutions of aluminum sulfate, i.e., liquid alum. The use of high-pressure (14 to...

  11. Electrically conductive anodized aluminum coatings

    NASA Technical Reports Server (NTRS)

    Alwitt, Robert S. (Inventor); Liu, Yanming (Inventor)

    2001-01-01

    A process for producing anodized aluminum with enhanced electrical conductivity, comprising anodic oxidation of aluminum alloy substrate, electrolytic deposition of a small amount of metal into the pores of the anodized aluminum, and electrolytic anodic deposition of an electrically conductive oxide, including manganese dioxide, into the pores containing the metal deposit; and the product produced by the process.

  12. Barium borohydride chlorides: synthesis, crystal structures and thermal properties.

    PubMed

    Grube, Elisabeth; Olesen, Cathrine H; Ravnsbæk, Dorthe B; Jensen, Torben R

    2016-05-10

    Here we report the synthesis, mechanism of formation, characterization and thermal decomposition of new barium borohydride chlorides prepared by mechanochemistry and thermal treatment of MBH4-BaCl2, M = Li, Na or K in ratios 1 : 1 and 1 : 2. Initially, orthorhombic barium chloride, o-BaCl2 transforms into o-Ba(BH4)xCl2-x, x ∼ 0.15. Excess LiBH4 leads to continued anion substitution and a phase transformation into hexagonal barium borohydride chloride h-Ba(BH4)xCl2-x, which accommodates higher amounts of borohydride, possibly x ∼ 0.85 and resembles h-BaCl2. Thus, two solid solutions are in equilibrium during mechano-chemical treatment of LiBH4-BaCl2 (1 : 1) whereas LiBH4-BaCl2 (2 : 1) converts to h-Ba(BH4)0.85Cl1.15. Upon thermal treatment at T > ∼200 °C, h-Ba(BH4)0.85Cl1.15 transforms into another orthorhombic barium borohydride chloride compound, o-Ba(BH4)0.85Cl1.15, which is structurally similar to o-BaBr2. The samples with M = Na and K have lower reactivity and form o-Ba(BH4)xCl2-x, x ∼ 0.1 and a solid solution of sodium chloride dissolved in solid sodium borohydride, Na(BH4)1-xClx, x = 0.07. The new compounds and reaction mechanisms are investigated by in situ synchrotron radiation powder X-ray diffraction (SR-PXD), Fourier transform infrared spectroscopy (FT-IR) and simultaneous thermogravimetric analysis (TGA), differential scanning calorimetry (DSC), mass spectroscopy (MS) and temperature programmed photographic analysis (TPPA). PMID:27109871

  13. Synthesis and characterization of barium ferrite–silica nanocomposites

    SciTech Connect

    Aguilar-González, M.A.; Mendoza-Suárez, G.; Padmasree, K.P.

    2013-10-15

    In this work, we prepared barium ferrite-silica (BaM-SiO{sub 2}) nanocomposites of different molar ratios by high-energy ball milling, followed by heat-treatment at different temperatures. The microstructure, morphology and magnetic properties were characterized for different synthesis conditions by using X-ray diffraction (XRD), scanning electron microscopy (SEM) and vibrating sample magnetometry (VSM). The results indicate that 15 h of milling was enough to avoid the generation of hematite phase and to get a good dispersion of barium ferrite particles in the ceramic matrix. For milling periods beyond 15 h and heat treatment above 900 °C, the XRD patterns showed the presence of hematite phase caused by the decomposition of BaM. The agglomerate size observed through SEM analysis was around 150 nm with a good BaM dispersion into the SiO{sub 2} matrix. The highest saturation magnetization (Ms) value obtained was 43 emu/g and the corresponding coercivity (Hc) value of 3.4 kOe for the composition 60BaM-40SiO{sub 2} milled for 15 h and heat treated at 900 °C. This coercivity value is acceptable for the application in magnetic recording media. Highlights: • Barium ferrite–silica nanocomposites were prepared by high energy ball milling. • Optimal processing time is 15 h milling and heat treatment at 900 °C. • This is enough to avoid the generation of hematite phase. • Obtain good dispersion of barium ferrite particles in the ceramic matrix • Above this processing time shows the presence of increased amount of hematite.

  14. Layer morphology and growth mechanisms in barium ferrites

    NASA Astrophysics Data System (ADS)

    Turner, G.; Stewart, B.; Baird, T.; Peacock, R. D.; Cairns-Smith, A. G.

    1996-01-01

    Crystals of hexagonal barium ferrites have been grown using a standard flux technique and, as a modification, on platinum tabs removed early from the hot flux. Products have been examined by SEM. Mature crystals often show highly laminated structures. Early crystals may consist of thin, somewhat flexible plates or slabs which overgrow themselves in ways which provide a possible explanation for the long c-axis repeats previously reported in these materials.

  15. Acute barium intoxication following ingestion of soap water solution

    PubMed Central

    Joshi, Nandita; Sharma, Chhavi Sarabpreert; Sai; Sharma, Jai Prakash

    2012-01-01

    We present a rare case in which a young girl ingested a solution of a hair-removing soap. The ingestion resulted in profound hypokalemia and severe acidosis leading to flaccid paralysis, respiratory arrest and ventricular arrhythmias. Ultimately the patient made complete recovery. The soapwas found to contain barium sulfide. The degree of paralysis and acidosis appeared to be directly related to serum potassium levels. PMID:23559738

  16. Calcium-bismuth electrodes for large-scale energy storage (liquid metal batteries)

    SciTech Connect

    Kim, H; Boysen, DA; Ouchi, T; Sadoway, DR

    2013-11-01

    Calcium is an attractive electrode material for use in grid-scale electrochemical energy storage due to its low electronegativity, earth abundance, and low cost. The feasibility of combining a liquid Ca-Bi positive electrode with a molten salt electrolyte for use in liquid metal batteries at 500-700 degrees C was investigated. Exhibiting excellent reversibility up to current densities of 200 mA cm(-2), the calcium bismuth liquid alloy system is a promising positive electrode candidate for liquid metal batteries. The measurement of low self-discharge current suggests that the solubility of calcium metal in molten salt electrolytes can be sufficiently suppressed to yield high coulombic efficiencies >98%. The mechanisms giving rise to Ca-Bi electrode overpotentials were investigated in terms of associated charge transfer and mass transport resistances. The formation of low density Ca11Bi10 intermetallics at the electrode electrolyte interface limited the calcium deposition rate capability of the electrodes; however, the co-deposition of barium into bismuth from barium-containing molten salts suppressed Ca-Bi intermetallic formation thereby improving the discharge capacity. (C) 2013 Elsevier B.V. All rights reserved.

  17. The Tordo 1 polar cusp barium plasma injection experiment

    NASA Technical Reports Server (NTRS)

    Wescott, E. M.; Stenbaek-Nielsen, H. C.; Davis, T. N.; Jeffries, R. A.; Roach, W. H.

    1978-01-01

    In January 1975, two barium plasma injection experiments were carried out with rockets launched into the upper atmosphere where field lines from the dayside cusp region intersect the ionosphere. The Tordo 1 experiment took place near the beginning of a worldwide magnetic storm. It became a polar cap experiment almost immediately as convection perpendicular to the magnetic field moved the fluorescent plasma jet away from the cusp across the polar cap in an antisunward direction. Convection across the polar cap with an average velocity of more than 1 km/s was observed for nearly 40 min until the barium flux tubes encountered large electron fields associated with a poleward bulge of the auroral oval near Greenland. Prior to the encounter with the aurora near Greenland there is evidence of upward acceleration of the barium ions while they were in the polar cap. The three-dimensional observations of the plasma orientation and motion give an insight into convection from the cusp region across the polar cap, the orientation of the polar cap magnetic field lines out to several earth radii, the causes of polar cap magnetic perturbations, and parallel acceleration processes.

  18. Barium aluminosilicate reinforced in situ with silicon nitride

    SciTech Connect

    Richardson, K.K.; Freitag, D.W.; Hunn, D.L.

    1995-10-01

    Advanced ceramic composite materials that exhibit high strength and toughness with good thermal shock resistance are needed for emerging high-temperature engineering applications. A recently developed in situ reinforced barium aluminosilicate glass-ceramic shows promise of meeting many of the requirements for these types of applications with the added benefit of low-cost fabrication through densification by pressureless sintering. The material is toughened through in situ growth of rodlike {beta}-Si{sub 3}N{sub 4} grains resulting from the {alpha}-{beta} silicon nitride phase transformation. Microstructural development and material properties for temperatures up to 1,400 C are discussed. When compared to monolithic barium aluminosilicate, barium aluminosilicate reinforced with 70% by volume of Si{sub 3}N{sub 4} shows a significant increase in flexural strength (from 80 to 565 MPa) and fracture toughness (from 1.8 to 5.74 MPa {center_dot} m{sup 1/2}) with a high resistance to thermal shock.

  19. Alkoxylation using modified calcium-containing bimetallic or polymetallic catalysts

    SciTech Connect

    King, S.W.

    1992-05-19

    This patent describes a method for providing an alkoxylation catalyst. It comprises reacting or solubilizing, at least partially, calcium metal or a calcium-containing compound, by mixing with an activator or solubilizing thereby forming a calcium-containing reacting a divalent or polyvalent metal or a divalent or polyvalent metal-containing compound wherein the divalent or polyvalent metal is selected from the group consisting of beryllium, magnesium, strontium, barium, lanthanum, titanium, zirconium, hafnium, niobium, tantalum, molybdenum, tungsten, iron, cobalt, nickel, copper, zinc, boron, gallium, silicon, germanium tin, phosphorus, antimony, sulfur, selenium, tellurium, cerium and thorium with an organic compound having at least one active hydrogen to produce a divalent or polyvalent metal-containing composition: reacting the calcium-containing composition with the divalent or polyvalent metal-containing composition under effective reaction conditions to produce a catalyst precursor composition; and reacting the catalyst precursor composition with a divalent or polyvalent oxyacid or a divalent or polyvalent metal salt of an oxyacid or mixtures thereof under effective reaction conditions to produce the alkoxylation catalyst.

  20. Aluminum battery alloys

    DOEpatents

    Thompson, David S.; Scott, Darwin H.

    1985-01-01

    Aluminum alloys suitable for use as anode structures in electrochemical cs are disclosed. These alloys include iron levels higher than previously felt possible, due to the presence of controlled amounts of manganese, with possible additions of magnesium and controlled amounts of gallium.

  1. Mechanisms of aluminum tolerance

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Aluminum (Al) toxicity limits agricultural productivity over much of the world’s arable land by inhibiting root growth and development. Affected plants have difficulty in acquiring adequate water and nutrition from their soil environments and thus have stunted shoot development and diminished yield....

  2. Maize aluminum tolerance

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Maize is one of the most economically important food crops grown on acid soils, where aluminum (Al) toxicity greatly limits crop yields. Considerable variation for Al tolerance exists in maize, and this variation has been exploited for many years by plant breeders to enhance maize Al tolerance. Curr...

  3. Aluminum-ferricyanide battery

    SciTech Connect

    Marsh, C.; Licht, S.L.

    1993-11-29

    A battery capable of producing high current densities with high charge capacity is described which includes an aluminum anode, a ferricyanide electrolyte and a second electrode capable of reducing ferricyanide electrolyte which is either dissolved in an alkaline solution or alkaline seawater solution. The performance of the battery is enhanced by high temperature and high electrolyte flow rates.

  4. Aluminum Sulfate 18 Hydrate

    ERIC Educational Resources Information Center

    Young, Jay A.

    2004-01-01

    A chemical laboratory information profile (CLIP) of the chemical, aluminum sulfate 18 hydrate, is presented. The profile lists physical and harmful properties, exposure limits, reactivity risks, and symptoms of major exposure for the benefit of teachers and students using the chemical in the laboratory.

  5. Fluxless aluminum brazing

    DOEpatents

    Werner, W.J.

    1974-01-01

    This invention relates to a fluxless brazing alloy for use in forming brazed composites made from members of aluminum and its alloys. The brazing alloy consists of 35-55% Al, 10--20% Si, 25-60% Ge; 65-88% Al, 2-20% Si, 2--18% In; 65--80% Al, 15-- 25% Si, 5- 15% Y. (0fficial Gazette)

  6. Aluminum battery alloys

    DOEpatents

    Thompson, D.S.; Scott, D.H.

    1984-09-28

    Aluminum alloys suitable for use as anode structures in electrochemical cells are disclosed. These alloys include iron levels higher than previously felt possible, due to the presence of controlled amounts of manganese, with possible additions of magnesium and controlled amounts of gallium.

  7. REMOVAL OF ALUMINUM COATINGS

    DOEpatents

    Peterson, J.H.

    1959-08-25

    A process is presented for dissolving aluminum jackets from uranium fuel elements without attack of the uranium in a boiling nitric acid-mercuric nitrate solution containing up to 50% by weight of nitrtc acid and mercuric nitrate in a concentration of between 0.05 and 1% by weight.

  8. Building an aluminum car

    SciTech Connect

    Ashley, S.

    1994-05-01

    This article examines the increasing use of aluminum in automobiles to decrease weight and consequently increase fuel economy. The topics of the article include federal fuel economy goals, the development of optimum body structure and manufacturing techniques, comparison with steel, cost of materials, weight reduction and recycling of materials.

  9. Mesoporous aluminum phosphite

    SciTech Connect

    El Haskouri, Jamal; Perez-Cabero, Monica; Guillem, Carmen; Latorre, Julio; Beltran, Aurelio; Beltran, Daniel; Amoros, Pedro

    2009-08-15

    High surface area pure mesoporous aluminum-phosphorus oxide-based derivatives have been synthesized through an S{sup +}I{sup -} surfactant-assisted cooperative mechanism by means of a one-pot preparative procedure from aqueous solution and starting from aluminum atrane complexes and phosphoric and/or phosphorous acids. A soft chemical extraction procedure allows opening the pore system of the parent as-prepared materials by exchanging the surfactant without mesostructure collapse. The nature of the pore wall can be modulated from mesoporous aluminum phosphate (ALPO) up to total incorporation of phosphite entities (mesoporous aluminum phosphite), which results in a gradual evolution of the acidic properties of the final materials. While phosphate groups in ALPO act as network building blocks (bridging Al atoms), the phosphite entities become basically attached to the pore surface, what gives practically empty channels. The mesoporous nature of the final materials is confirmed by X-ray diffraction (XRD), transmission electron microscopy (TEM) and N{sub 2} adsorption-desorption isotherms. The materials present regular unimodal pore systems whose order decreases as the phosphite content increases. NMR spectroscopic results confirm the incorporation of oxo-phosphorus entities to the framework of these materials and also provide us useful information concerning the mechanism through which they are formed. - Abstract: TEM image of the mesoporous aluminum phosphite showing the hexagonal disordered pore array that is generated by using surfactant micelles as template. Also a scheme emphasizing the presence of an alumina-rich core and an ALPO-like pore surface is presented.

  10. ALUMINUM SOLUBILITY, CALCIUM-ALUMINUM EXCHANGE, AND PH IN ACID FOREST SOILS

    EPA Science Inventory

    Important components in several models designed to describe the effects of acid deposition on soils and surface waters are the pH-A1 and Ca-A1 exchange relationships. f A1 solubility is controlled by A1 trihydroxide minerals, the theoretical pH-A1 relationship can be described by...

  11. SOLDERING OF ALUMINUM BASE METALS

    DOEpatents

    Erickson, G.F.

    1958-02-25

    This patent deals with the soldering of aluminum to metals of different types, such as copper, brass, and iron. This is accomplished by heating the aluminum metal to be soldered to slightly above 30 deg C, rubbing a small amount of metallic gallium into the part of the surface to be soldered, whereby an aluminum--gallium alloy forms on the surface, and then heating the aluminum piece to the melting point of lead--tin soft solder, applying lead--tin soft solder to this alloyed surface, and combining the aluminum with the other metal to which it is to be soldered.

  12. [Calcium antagonism by papaverine in isolated rat gastric fundus strips in a model system].

    PubMed

    Simon, L; Sallai, J; Szontagh, M; Simon-Talpas, G; Müller, A

    1984-04-01

    Examining isolated strips of gastric fundus tissue of rats the authors observed that papaverin up to 7.8 X 10(-8) to 6.25 X 10(-7) mol/l increased the intensity of convulsions induced by constant amounts of barium chloride (9.5 X 10(-4); with further increase of the concentration the intensity of convulsions gradually sank under the initial value. An increased proneness to cramping was also observed when the calcium content of the Tyrode solution was reduced. In this case the proneness to cramping was highest between 1 and 1.3 mmol/l calcium content. When the calcium content was 1 mmol/l, papaverin increased the proneness to cramping only to a smaller degree, in agreement with the effect measured when the calcium content of the organ bath was reduced below 1 mmol/l. In model experiments, calcium antagonized the potential difference-increasing effect of papaverin at the ether/NaCl (0.1 mol/l) phase boundary. From this the authors infer an interaction (complex formation) between papaverin and calcium at the phase boundary, which is independent of the biological medium. Their findings and the papaverin -calcium antagonism first observed by Benigni [2] can be interpreted in this way. PMID:6739529

  13. Relationship between modulation by estradiol, progesterone and calcium upon the pharmacological reactivity of uteri of dogs.

    PubMed

    Calixto, J B; Aucélio, J G; Jurkiewicz, A

    1979-09-01

    The influence of treatment with estradiol and progesterone, was studied on the contractions induced in immature dog uteri by histamine, acetylcholine, oxytocin and barium chloride, in vitro. Two parameters were measured from dose-response curves: rho and pD2. It was observed that although pD2 values were slightly affected by hormonal treatment, the values of rho for oxytocin and acetylcholine receptors were greatly reduced by estradiol treatment and further decreased by association of estradiol plus progesterone; the effects for histamine and barium chloride were less affected. Increasing Ca2+ concentration in the nutrient solution completely reverted the variations for rho values. The results indicate tat the effect of drugs on the dog uterus depends on the balance between the modulating actions of ovarian hormones and calcium. PMID:504784

  14. A review of the health impacts of barium from natural and anthropogenic exposure.

    PubMed

    Kravchenko, Julia; Darrah, Thomas H; Miller, Richard K; Lyerly, H Kim; Vengosh, Avner

    2014-08-01

    There is an increasing public awareness of the relatively new and expanded industrial barium uses which are potential sources of human exposure (e.g., a shale gas development that causes an increased awareness of environmental exposures to barium). However, absorption of barium in exposed humans and a full spectrum of its health effects, especially among chronically exposed to moderate and low doses of barium populations, remain unclear. We suggest a systematic literature review (from 1875 to 2014) on environmental distribution of barium, its bioaccumulation, and potential and proven health impacts (in animal models and humans) to provide the information that can be used for optimization of future experimental and epidemiological studies and developing of mitigative and preventive strategies to minimize negative health effects in exposed populations. The potential health effects of barium exposure are largely based on animal studies, while epidemiological data for humans, specifically for chronic low-level exposures, are sparse. The reported health effects include cardiovascular and kidney diseases, metabolic, neurological, and mental disorders. Age, race, dietary patterns, behavioral risks (e.g., smoking), use of medications (those that interfere with absorbed barium in human organism), and specific physiological status (e.g., pregnancy) can modify barium effects on human health. Identifying, evaluating, and predicting the health effects of chronic low-level and moderate-level barium exposures in humans is challenging: Future research is needed to develop an understanding of barium bioaccumulation in order to mitigate its potential health impacts in various exposured populations. Further, while occupationally exposed at-risk populations exist, it is also important to identify potentially vulnerable subgroups among non-occupationally exposed populations (e.g., elderly, pregnant women, children) who are at higher risk of barium exposure from drinking water and food

  15. Aluminum permanganate battery

    SciTech Connect

    Marsh, C.; Licht, S.L.

    1993-11-30

    A battery is provided comprising an aluminum anode, an aqueous solution of permanganate as the cathodic species and a second electrode capable of reducing permanganate. Such a battery system is characterized by its high energy density and low polarization losses when operating at high temperatures in a strong caustic electrolyte, i.e., high concentration of hydroxyl ions. A variety of anode and electrocatalyst materials are suitable for the efficient oxidation-reduction process and are elucidated.

  16. Aluminum microstructures on anodic alumina for aluminum wiring boards.

    PubMed

    Jha, Himendra; Kikuchi, Tatsuya; Sakairi, Masatoshi; Takahashi, Hideaki

    2010-03-01

    The paper demonstrates simple methods for the fabrication of aluminum microstructures on the anodic oxide film of aluminum. The aluminum sheets were first engraved (patterned) either by laser beam or by embossing to form deep grooves on the surface. One side of the sheet was then anodized, blocking the other side by using polymer mask to form the anodic alumina. Because of the lower thickness at the bottom part of the grooves, the part was completely anodized before the complete oxidation of the other parts. Such selectively complete anodizing resulted in the patterns of metallic aluminum on anodic alumina. Using the technique, we fabricated microstructures such as line patterns and a simple wiring circuit-board-like structure on the anodic alumina. The aluminum microstructures fabricated by the techniques were embedded in anodic alumina/aluminum sheet, and this technique is promising for applications in electronic packaging and devices. PMID:20356280

  17. Lead in calcium supplements.

    PubMed

    Scelfo, G M; Flegal, A R

    2000-04-01

    Intercalibrated measurements of lead in calcium supplements indicate the importance of rigorous analytical techniques to accurately quantify contaminant exposures in complex matrices. Without such techniques, measurements of lead concentrations in calcium supplements may be either erroneously low, by as much as 50%, or below the detection limit needed for new public health criteria. In this study, we determined the lead content of 136 brands of supplements that were purchased in 1996. The calcium in the products was derived from natural sources (bonemeal, dolomite, or oyster shell) or was synthesized and/or refined (chelated and nonchelated calcium). The dried products were acid digested and analyzed for lead by high resolution-inductively coupled plasma-mass spectrometry. The method's limit of quantitation averaged 0.06 microg/g, with a coefficient of variation of 1.7% and a 90-100% lead recovery of a bonemeal standard reference material. Two-thirds of those calcium supplements failed to meet the 1999 California criteria for acceptable lead levels (1.5 microg/daily dose of calcium) in consumer products. The nonchelated synthesized and/or refined calcium products, specifically antacids and infant formulas, had the lowest lead concentrations, ranging from nondetectable to 2.9 microg Pb/g calcium, and had the largest proportion of brands meeting the new criteria (85% of the antacids and 100% of the infant formulas). PMID:10753088

  18. Lead in calcium supplements.

    PubMed Central

    Scelfo, G M; Flegal, A R

    2000-01-01

    Intercalibrated measurements of lead in calcium supplements indicate the importance of rigorous analytical techniques to accurately quantify contaminant exposures in complex matrices. Without such techniques, measurements of lead concentrations in calcium supplements may be either erroneously low, by as much as 50%, or below the detection limit needed for new public health criteria. In this study, we determined the lead content of 136 brands of supplements that were purchased in 1996. The calcium in the products was derived from natural sources (bonemeal, dolomite, or oyster shell) or was synthesized and/or refined (chelated and nonchelated calcium). The dried products were acid digested and analyzed for lead by high resolution-inductively coupled plasma-mass spectrometry. The method's limit of quantitation averaged 0.06 microg/g, with a coefficient of variation of 1.7% and a 90-100% lead recovery of a bonemeal standard reference material. Two-thirds of those calcium supplements failed to meet the 1999 California criteria for acceptable lead levels (1.5 microg/daily dose of calcium) in consumer products. The nonchelated synthesized and/or refined calcium products, specifically antacids and infant formulas, had the lowest lead concentrations, ranging from nondetectable to 2.9 microg Pb/g calcium, and had the largest proportion of brands meeting the new criteria (85% of the antacids and 100% of the infant formulas). Images Figure 1 Figure 2 PMID:10753088

  19. [Growth and metabolism of calcium in rats chronically poisoned with aluminium hydroxide].

    PubMed

    Mahieu, S; Calvo, M L; Millen, N; Gonzalez, M; Contini, M C

    1998-01-01

    The effects of aluminum on growth have been studied in rats chronically poisoned with aluminum hydroxide (80 mg/kg b.w.-i.p.-three times a week, during 6 months) and in control rats, between 3 and 26 weeks of age. The growth data was evaluated according to Parks 'theory of feeding an growth. At the end of the poisoning period, the calcium metabolism was studied through a balance of calcium and the determination of bone Ca++ accretion and resorption rates with the aid of 45Ca++. The parathyroid glands function was studied using an indirect method. Treated rats showed a significant decrease in asymptotic weights and in the initial efficiency of food conversion into biomass regarding controls. No differences were observed in food intake between both group. Aluminum affected neither the peak growth rate nor the time necessary to attain maturity. The calcium balance in treated rats was significantly less than in the control group. This was accompanied by a significant increase in the calcium excreted by faces, caused perhaps by a less intestinal absorption. An important amount of aluminum on the surface of the trabecular bone and a reduction in the skeletal Ca++ mass, was observed in all treated rats. Nevertheless there are no differences in the latter when expressed for 100 g of body weight. The rate of skeletal Ca++ accretion was found to be significantly decreased in treated group with respect to controls, without any changes in the bone Ca resorption rate. The reduction in bone turnover revealed by the decrease of Vo+/Vo- was accompanied by less recovery velocity of calcemia in the aluminum treated group, being indirectly related to the parathyroid gland response to calcium depletion. In the model that we studied the decreased bone turnover could have been caused by deposits of aluminum in bone; however there could exist associated factors such as dysfunction in the secretion of PTH, or less affinity between its receptors at the bone level. PMID:9504191

  20. Aluminum Carbothermic Technology

    SciTech Connect

    Bruno, Marshall J.

    2005-03-31

    This report documents the non-proprietary research and development conducted on the Aluminum Carbothermic Technology (ACT) project from contract inception on July 01, 2000 to termination on December 31, 2004. The objectives of the program were to demonstrate the technical and economic feasibility of a new carbothermic process for producing commercial grade aluminum, designated as the ''Advanced Reactor Process'' (ARP). The scope of the program ranged from fundamental research through small scale laboratory experiments (65 kW power input) to larger scale test modules at up to 1600 kW power input. The tasks included work on four components of the process, Stages 1 and 2 of the reactor, vapor recovery and metal alloy decarbonization; development of computer models; and economic analyses of capital and operating costs. Justification for developing a new, carbothermic route to aluminum production is defined by the potential benefits in reduced energy, lower costs and more favorable environmental characteristics than the conventional Hall-Heroult process presently used by the industry. The estimated metrics for these advantages include energy rates at approximately 10 kWh/kg Al (versus over 13 kWh/kg Al for Hall-Heroult), capital costs as low as $1250 per MTY (versus 4,000 per MTY for Hall-Heroult), operating cost reductions of over 10%, and up to 37% reduction in CO2 emissions for fossil-fuel power plants. Realization of these benefits would be critical to sustaining the US aluminum industries position as a global leader in primary aluminum production. One very attractive incentive for ARP is its perceived ability to cost effectively produce metal over a range of smelter sizes, not feasible for Hall-Heroult plants which must be large, 240,000 TPY or more, to be economical. Lower capacity stand alone carbothermic smelters could be utilized to supply molten metal at fabrication facilities similar to the mini-mill concept employed by the steel industry. Major

  1. Target-Cell Contact Activates a Highly Selective Capacitative Calcium Entry Pathway in Cytotoxic T Lymphocytes

    PubMed Central

    Zweifach, Adam

    2000-01-01

    Calcium influx is critical for T cell activation. Evidence has been presented that T cell receptor–stimulated calcium influx in helper T lymphocytes occurs via channels activated as a consequence of depletion of intracellular calcium stores, a mechanism known as capacitative Ca2+ entry (CCE). However, two key questions have not been addressed. First, the mechanism of calcium influx in cytotoxic T cells has not been examined. While the T cell receptor–mediated early signals in helper and cytotoxic T cells are similar, the physiology of the cells is strikingly different, raising the possibility that the mechanism of calcium influx is also different. Second, contact of T cells with antigen-presenting cells or targets involves a host of intercellular interactions in addition to those between antigen–MHC and the T cell receptor. The possibility that calcium influx pathways in addition to those activated via the T cell receptor may be activated by contact with relevant cells has not been addressed. We have used imaging techniques to show that target-cell–stimulated calcium influx in CTLs occurs primarily through CCE. We investigated the permeability of the CTL influx pathway for divalent cations, and compared it to the permeability of CCE in Jurkat human leukemic T cells. CCE in CTLs shows a similar ability to discriminate between calcium, barium, and strontium as CCE in Jurkat human leukemic T lymphocytes, where CCE is likely to mediated by Ca2+ release–activated Ca2+ current (CRAC) channels, suggesting that CRAC channels also underlie CCE in CTLs. These results are the first determination of the mechanism of calcium influx in cytotoxic T cells and the first demonstration that cell contact–mediated calcium signals in T cells occur via depletion-activated channels. PMID:10662784

  2. The effect of barium on perceptions of taste intensity and palatability.

    PubMed

    Dietsch, Angela M; Solomon, Nancy Pearl; Steele, Catriona M; Pelletier, Cathy A

    2014-02-01

    Barium may affect the perception of taste intensity and palatability. Such differences are important considerations in the selection of dysphagia assessment strategies and interpretation of results. Eighty healthy women grouped by age (younger, older) and genetic taste status (supertaster, nontaster) rated intensity and palatability for seven tastants prepared in deionized water with and without 40 % w/v barium: noncarbonated and carbonated water, diluted ethanol, and high concentrations of citric acid (sour), sodium chloride (salty), caffeine (bitter), and sucrose (sweet). Mixed-model analyses explored the effects of barium, taster status, and age on perceived taste intensity and acceptability of stimuli. Barium was associated with lower taste intensity ratings for sweet, salty, and bitter tastants, higher taste intensity in carbonated water, and lower palatability in water, sweet, sour, and carbonated water. Older subjects reported lower palatability (all barium samples, sour) and higher taste intensity scores (ethanol, sweet, sour) compared to younger subjects. Supertasters reported higher taste intensity (ethanol, sweet, sour, salty, bitter) and lower palatability (ethanol, salty, bitter) than nontasters. Refusal rates were highest for younger subjects and supertasters, and for barium (regardless of tastant), bitter, and ethanol. Barium suppressed the perceived intensity of some tastes and reduced palatability. These effects are more pronounced in older subjects and supertasters, but younger supertasters are least likely to tolerate trials of barium and strong tastant solutions. PMID:24037100

  3. 75 FR 36629 - Barium Chloride From the People's Republic of China: Continuation of Antidumping Duty Order

    Federal Register 2010, 2011, 2012, 2013, 2014

    2010-06-28

    ... Barium Chloride From China, 75 FR 33824 (June 15, 2010), and Barium Chloride from China (Inv. No. 731-TA... Five-year (``Sunset'') Review, 74 FR 31412 (July 1, 2009). As a result of its review, the Department... China: Final Results of Expedited Third Sunset Review of Antidumping Duty Order, 74 FR 55814 (October...

  4. Description of the barium cloud vectoring systems developed for the PLACES test series

    SciTech Connect

    Finnell, R.T.

    1981-05-01

    The PLACES experiments were conducted to investigate the effects of ionospheric plasmas (created by barium vapor released from rockets) on satellite communications and navigation systems. Launcher setting angles for the rockets were provided by a minicomputer system made up of four subsystems. This report describes the subsystems which determined the barium cloud vectors from TV data alone and from combined radar/TV data.

  5. LACK OF EFFECT OF DRINKING WATER BARIUM ON CARDIOVASCULAR RISK FACTORS

    EPA Science Inventory

    Higher cardiovascular mortality has been associated in a single epidemiological study with higher levels of barium in drinking water. he purpose of this study was to determine whether drinking water barium at levels found in some U.S. communities alters the known risk factors for...

  6. Extracting aluminum from dross tailings

    NASA Astrophysics Data System (ADS)

    Amer, A. M.

    2002-11-01

    Aluminum dross tailings, an industrial waste, from the Egyptian Aluminium Company (Egyptalum) was used to produce two types of alums: aluminum-sulfate alum [itAl2(SO4)3.12H2O] and ammonium-aluminum alum [ (NH 4)2SO4AL2(SO4)3.24H2O]. This was carried out in two processes. The first process is leaching the impurities using diluted H2SO4 with different solid/liquid ratios at different temperatures to dissolve the impurities present in the starting material in the form of solute sulfates. The second process is the extraction of aluminum (as aluminum sulfate) from the purifi ed aluminum dross tailings thus produced. The effects of temperature, time of reaction, and acid concentration on leaching and extraction processes were studied. The product alums were analyzed using x-ray diffraction and thermal analysis techniques.

  7. Agglomeration behavior of solid nickel on polycrystalline barium titanate

    SciTech Connect

    Weil, K Scott; Mast, Eric S; Sprenkle, Vince

    2007-11-01

    This letter describes the phenomenon that takes place between nickel/barium titanate couples when heated under conditions employed in multilayer ceramic capacitor manufacturing practice: a 4hr, 1300°C isothermal anneal in 1% H2 – 99% N2. Dense, sputtered nickel films were observed to dewet the titanate and agglomerate into discrete or interconnected islands via a solid-state process. Up to a critical film thickness value of ~1.4 μm, the degree of agglomeration was found to display an exponential dependence on the thickness of the original nickel film.

  8. Defect chemistry and proton conductivity in barium-based perovskites

    NASA Astrophysics Data System (ADS)

    Wu, Jian

    The site incorporation mechanism of M3+ dopats into A 2+B4+O3 perovskites controls the overall defect chemistry and thus their transport properties. For charge balance reasons, incorporation onto the A2+ site would require the creation of negatively charged point defects, such as cation vacancies, whereas incorporation onto the B4+ site is accompanied by the generation of positively charged defects, typically oxygen vacancies. Oxygen vacancy content, in turn, is relevant to proton conducting oxides in which protons are introduced via the dissolution of hydroxyl ions at vacant oxygen sites. This work proposes that, on the basis of X-ray powder diffraction studies, electron microscopy, chemical analysis, thermal gravimetric analysis, AC impedance spectroscopy, extended X-ray fine structure (EXAFS) and atomistic simulation, that nominally B-site doped barium cerate can exhibit dopant partitioning partially as a consequence of barium evaporation at elevated temperatures. Such partitioning and the presence of significant dopant concentrations on the A-site negatively impact proton conductivity. As a consequence of the greater ability of larger cations to exist on the Ba site, the H2O adsorption and proton conductivities of large-cation doped barium cerates are lower than those of small-cation doped analogs. A series of dopats, La, Nd, Sm, Gd and Yb are adopted in doped BaCeO 3 with the composition BaCe0.85M0.15O3-delta . Yb doped BaCeO3 yields the highest proton conductivity among all the doped samples. Compositional non-stoichiometry, which is closely tied to sample processing, is studied in a BaXCe0.85M 0.15O3+/-delta series. It is indicated that low temperature synthesis is beneficial to reduce barium evaporation at elevated temperatures and in turn increase the proton conductivity. The chemical stability of BaCeO 3 is investigated and Zr is used to stabilize BaCeO3 in CO 2-rich atmosphere effectively. This result helps to commercialize doped BaCeO3 as the

  9. The barium ion jet experiments of the Porcupine project

    NASA Astrophysics Data System (ADS)

    Haerendel, G.

    1980-06-01

    The injection of a barium plasma from a sounding rocket by the shaped charge technique offers several possibilities that cannot be achieved by conventional releases. This is due to high initial velocities of the atoms of up to 14 km/sec. Most of the the applications are related to the great heights that the ions can reach, but some depend directly on the initial momentum. Typical applications are: tracing at high altitudes, modifications, and alternate Ionization processes. Project Porcupine contributions in this field are summarized.

  10. Radium and barium in the Amazon River system

    SciTech Connect

    Moore, W.S.; Edmond, J.M.

    1984-03-20

    Data for /sup 226/Ra and /sup 228/Ra in the Amazon River system show that the activity of each radium isotope is strongly correlated with barium concentrations. Two trends are apparent, one for rivers which drain shield areas and another for all other rivers. These data suggest that there has been extensive fractionation of U, Th, and Ba during weathering in the Amazon basin. The /sup 226/Ra data fit a flux model for the major ions indicating that /sup 226/Ra behaves conservatively along the main channel of the Amazon River.

  11. Nanodielectric system for cryogenic applications: Barium titanate filled polyvinyl alcohol

    SciTech Connect

    Tuncer, Enis; Sauers, Isidor; James, David Randy; Ellis, Alvin R; Duckworth, Robert C

    2008-01-01

    In the current study the focus is on dielectric properties (as a function of frequency and temperature) of a polymeric composite system composed of polyvinyl alcohol and barium titanate nano powder. In the investigations, the temperature range is between 50-295 K, and the frequency range is between $20\\ \\hertz-1\\ \\mega\\hertz$. Polarization and conduction processes are investigated in the linear regime. Dielectric breakdown strengths of samples are also reported. The materials presented have potential to be implemented in cryogenic capacitor or field grading applications.

  12. Magnetic and structural investigations on barium hexaferrite ferrofluids

    NASA Astrophysics Data System (ADS)

    Müller, R.; Hiergeist, R.; Gawalek, W.; Hoell, A.; Wiedenmann, A.

    2002-11-01

    Barium hexaferrite BaFe 12-2 xTi xCo xO 19 ferrofluids have been prepared using oleic acid as surfactant and Isopar M ® or dodecane as carrier liquid. The ferrite particles were prepared by glass crystallization. Hysteresis parameters, the initial susceptibility versus temperature and the magnetic particle size were obtained by VSM. Ferrofluids with a partly deuterated carrier liquid were investigated by small angle neutron scattering (SANS). SANS curves lead to a bimodal size distribution consisting of single magnetic particles with an organic shell and aggregated particles with an incomplete organic layer.

  13. Enhanced flexoelectricity through residual ferroelectricity in barium strontium titanate

    SciTech Connect

    Garten, Lauren M. Trolier-McKinstry, Susan

    2015-03-07

    Residual ferroelectricity is observed in barium strontium titanate ceramics over 30 °C above the global phase transition temperature, in the same temperature range in which anomalously large flexoelectric coefficients are reported. The application of a strain gradient leads to strain gradient-induced poling or flexoelectric poling. This was observed by the development of a remanent polarization in flexoelectric measurements, an induced d{sub 33} piezoelectric response even after the strain gradient was removed, and the production of an internal bias of 9 kV m{sup −1}. It is concluded that residual ferroelectric response considerably enhances the observed flexoelectric response.

  14. Strain engineered barium strontium titanate for tunable thin film resonators

    SciTech Connect

    Khassaf, H.; Khakpash, N.; Sun, F.; Sbrockey, N. M.; Tompa, G. S.; Kalkur, T. S.; Alpay, S. P.

    2014-05-19

    Piezoelectric properties of epitaxial (001) barium strontium titanate (BST) films are computed as functions of composition, misfit strain, and temperature using a non-linear thermodynamic model. Results show that through adjusting in-plane strains, a highly adaptive rhombohedral ferroelectric phase can be stabilized at room temperature with outstanding piezoelectric response exceeding those of lead based piezoceramics. Furthermore, by adjusting the composition and the in-plane misfit, an electrically tunable piezoelectric response can be obtained in the paraelectric state. These findings indicate that strain engineered BST films can be utilized in the development of electrically tunable and switchable surface and bulk acoustic wave resonators.

  15. Barium dierbium(III) tetra­sulfide

    PubMed Central

    Mesbah, Adel; Stojko, Wojciech; Ibers, James. A

    2013-01-01

    Barium dierbium(III) tetra­sulfide, BaEr2S4, crystallizes with four formula units in the ortho­rhom­bic space group Pnma in the CaFe2O4 structure type. The asymmetric unit contains two Er, one Ba, and four S atoms, each with .m. site symmetry. The structure consists of channels formed by corner- and edge-sharing ErS6 octa­hedra in which Ba atoms reside. The resultant coordination of Ba is that of a bicapped trigonal prism. PMID:23476480

  16. 21 CFR 73.1645 - Aluminum powder.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 21 Food and Drugs 1 2013-04-01 2013-04-01 false Aluminum powder. 73.1645 Section 73.1645 Food and... ADDITIVES EXEMPT FROM CERTIFICATION Drugs § 73.1645 Aluminum powder. (a) Identity. (1) The color additive aluminum powder shall be composed of finely divided particles of aluminum prepared from virgin aluminum....

  17. 21 CFR 73.1645 - Aluminum powder.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 21 Food and Drugs 1 2012-04-01 2012-04-01 false Aluminum powder. 73.1645 Section 73.1645 Food and... ADDITIVES EXEMPT FROM CERTIFICATION Drugs § 73.1645 Aluminum powder. (a) Identity. (1) The color additive aluminum powder shall be composed of finely divided particles of aluminum prepared from virgin aluminum....

  18. 21 CFR 73.1645 - Aluminum powder.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 21 Food and Drugs 1 2014-04-01 2014-04-01 false Aluminum powder. 73.1645 Section 73.1645 Food and... ADDITIVES EXEMPT FROM CERTIFICATION Drugs § 73.1645 Aluminum powder. (a) Identity. (1) The color additive aluminum powder shall be composed of finely divided particles of aluminum prepared from virgin aluminum....

  19. 21 CFR 73.1645 - Aluminum powder.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 21 Food and Drugs 1 2011-04-01 2011-04-01 false Aluminum powder. 73.1645 Section 73.1645 Food and... ADDITIVES EXEMPT FROM CERTIFICATION Drugs § 73.1645 Aluminum powder. (a) Identity. (1) The color additive aluminum powder shall be composed of finely divided particles of aluminum prepared from virgin aluminum....

  20. 21 CFR 73.1645 - Aluminum powder.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Aluminum powder. 73.1645 Section 73.1645 Food and... ADDITIVES EXEMPT FROM CERTIFICATION Drugs § 73.1645 Aluminum powder. (a) Identity. (1) The color additive aluminum powder shall be composed of finely divided particles of aluminum prepared from virgin aluminum....

  1. The Thermoelectric Power of Calcium (1-X) Aluminum(x), CALCIUM(.60) ALUMINUM(.40-Y) Gallium(y), and LANTHANUM(1 - Aluminum(x) Metallic Glasses.

    NASA Astrophysics Data System (ADS)

    Delgado, Rolando

    The thermopower, S, and normalized resistance, R(T)/R(,o), as a function of temperature of some Ca(,1 -x)Al(,x), .20 < x < .45, Ca(,.60)Al(,.40-y)Ga(,y), y = .10 and .20, and La(,1-x)Al(,x), .18 < x < .35 metallic glasses have been measured. It is found that the temperature coefficient of resistivity, (alpha) = (rho)('-1)d(rho)/dT, for all the samples is negative and the thermopower is positive for the Ca(,1-x)Al(,x) and Ca(,.60)Al(,.40-y)Ga(,y) alloys while it is negative for the La(,1-x)Al(,x) alloys. The thermopower and resistivity of the Ca(,.55)Al(,.45), Ca(,.60)Al(,.40) and both Ca-Al-Ga alloys are anomalously high. The value of 502 (mu)(OMEGA)-cm and 32 (eta)V/K('2) for the Ca(,.60)Al(,.20)Ga(,.20) alloy are the largest reported room temperature value of (rho) and S/T, respectively, of any non-magnetic amorphous alloy. The value of S/T for the Ca(,1-x)Al(,x) alloys with x = .30, .33, .40 and .45 increase steadily as the temperature decreases and exhibit a small shoulder like structure at approximately 50 K. Below this temperature S/T increases much more rapidly and reaches a maximum value at very low temperatures. This type of temperature dependence in S/T is also observed in both Ca-Al-Ga alloys with the exception that the shoulder like structure is much less pronounced. The value of S/T for the La(,1-x)Al(,x) alloys remains relatively constant at high temperatures, ((theta)(,D) < T < 300 K). However, below (theta)(,D), the value of S/T exhibits a smooth and rapid increase as the temperature decreases and reaches a maximum value just before the onset of superconductivity. The observed temperature dependence of the thermopower at low temperatures, (T < (theta)(,D)), may be understood in terms of the electron-phonon mass enhancement. Neither the Ziman-Faber diffraction model nor the Mott s-d scattering model are able to explain the magnitude and compositional dependence of the thermopower and resistivity of these three alloy systems.

  2. Quasicrystalline particulate reinforced aluminum composite

    SciTech Connect

    Anderson, I.E.; Biner, S.B.; Sordelet, D.J.; Unal, O.

    1997-07-01

    Particulate reinforced aluminum and aluminum alloy composites are rapidly emerging as new commercial materials for aerospace, automotive, electronic packaging and other high performance applications. However, their low processing ductility and difficulty in recyclability have been the key concern. In this study, two composite systems having the same aluminum alloy matrix, one reinforced with quasicrystals and the other reinforced with the conventional SiC reinforcements were produced with identical processing routes. Their processing characteristics and tensile mechanical properties were compared.

  3. Cathodic phenomena in aluminum electrowinning

    NASA Astrophysics Data System (ADS)

    Bouteillon, J.; Poignet, J. C.; Rameau, J. J.

    1993-02-01

    Although aluminum is one of the world's highest production-volume primary metals, it is particularly costly to produce for a variety of factors, not the least of which are the expenses associated with electrolytic reduction. Based on the scale of global aluminum processing, even minor improvements in the electrowinning technology can result in significant savings of resources. Thus, from this perspective, the following reviews recent studies of cathodic phenomena in aluminum electrowinning.

  4. Barium impaction therapy with balloon occlusion for deep colonic diverticular bleeding: a three-case series

    PubMed Central

    Koga, Mikinori; Kusano, Chika; Gotoda, Takuji; Suzuki, Sho; Sato, Takemasa; Fukuzawa, Masakatsu; Itoi, Takao; Moriyasu, Fuminori

    2016-01-01

    Background and aims: In hemostasis for colonic diverticular bleeding, the incidence of recurrent bleeding is higher in deep colonic diverticulum than in shallow. We aimed to improve and evaluate barium impaction therapy using an enteroscopic overtube with balloon. Patients and method: We performed barium impaction therapy in three patients with a diagnosis of deep colonic diverticular bleeding. The tip of the overtube was inserted to reach the cecum using the conventional method. After deflating the colon, the enteroscope was removed. The balloon in the tube was inflated, followed by barium filling via the tube. Sufficient pressure was applied by ensuring no regurgitation into the small intestine side. The entire colon was continuously filled with barium in stages. Results: Post-treatment bleeding was controllable without adverse events in all three patients. Conclusion: This novel barium impaction therapy using an enteroscopic overtube with balloon was effectively performed without adverse events. PMID:27227115

  5. Occultation of the ATS-3 satellite by the AVEFRIA barium ion cloud

    SciTech Connect

    Fitzgerald, T.J.; Simons, D.J.; Pongratz, M.B.; Clynch, J.R.

    1981-01-01

    During the AVEFRIA DOS barium release experiment, sponsored by the Los Alamos National Laboratory and the Defense Nuclear Agency in May 1978, the line of sight from one of the ground observation stations to the ATS-3 satellite was occulted by the barium ion cloud for a period of approximately five minutes. Optical measurements of the structured barium ion cloud were made with intensified cameras using the 455.4-nm wavelength fluorescent ion line. These measurements have been related to barium ion column density. During the occultation, the amplitude scintillations of the 136.47-MHz signal from the ATS-3 satellite were monitored. The optical measurements have been used to correlate the barium column density with the total electron content measurements and to calculate the scintillation index, S/sub 4/, and the two dimensional intensity pattern for comparison with the measured amplitude scintillations.

  6. Hydration of Portland cement with additions of calcium sulfoaluminates

    SciTech Connect

    Le Saout, Gwenn; Lothenbach, Barbara; Hori, Akihiro; Higuchi, Takayuki; Winnefeld, Frank

    2013-01-15

    The effect of mineral additions based on calcium aluminates on the hydration mechanism of ordinary Portland cement (OPC) was investigated using isothermal calorimetry, thermal analysis, X-ray diffraction, scanning electron microscopy, solid state nuclear magnetic resonance and pore solution analysis. Results show that the addition of a calcium sulfoaluminate cement (CSA) to the OPC does not affect the hydration mechanism of alite but controls the aluminate dissolution. In the second blend investigated, a rapid setting cement, the amorphous calcium aluminate reacts very fast to ettringite. The release of aluminum ions strongly retards the hydration of alite but the C-S-H has a similar composition as in OPC with no additional Al to Si substitution. As in CSA-OPC, the aluminate hydration is controlled by the availability of sulfates. The coupling of thermodynamic modeling with the kinetic equations predicts the amount of hydrates and pore solution compositions as a function of time and validates the model in these systems.

  7. Biochemical and hematological changes in low-level aluminum intoxication.

    PubMed

    González-Revaldería, J; Casares, M; de Paula, M; Pascual, T; Giner, V; Miravalles, E

    2000-03-01

    The aim of this study was to investigate the biochemical and hematological changes in patients on routine hemodialysis treatment when they were accidentally exposed to moderately high serum aluminum concentrations during a period of time of less than four months. We studied the changes in biochemical and hematological measurements in 33 patients on dialysis in our hospital before and during the exposure to about 0.85 pmol/l of aluminum in dialysis water due to a malfunction of the reverse osmosis system of water purification. Patients showed a decrease in the hemoglobin concentration from 115+/-12.4 g/l to 108+/-12.2 g/l (p=0.026) and in the mean corpuscular hemoglobin concentration from 5.15+/-0.22 to 5.02+/-0.30 mmol/l (p=0.014). Ferritin was decreased from 243+/-192 microg/l to 196+/-163 microg/l (p=0.047) and transferrin saturation from 0.20+/-0.06 to 0.15+/-0.07 (p=0.004). Biochemical measurements related to calcium-phosphate metabolism did not change. Otherwise, all patients showed an increase in serum aluminum from 0.56+/-0.44 to 1.63+/-0.52 micromol/l (p<0.001). No differences were detected in serum aluminum between patients receiving and not receiving oral aluminum salts. Even moderately high aluminum concentrations maintained during a short period of time could produce significant hematological alterations and a depletion of body iron stores before clinical manifestations were evident. PMID:10905758

  8. Multi-colony calibrations of coral Ba/Ca with a contemporaneous in situ seawater barium record

    NASA Astrophysics Data System (ADS)

    LaVigne, Michèle; Grottoli, Andréa G.; Palardy, James E.; Sherrell, Robert M.

    2016-04-01

    The coral skeleton barium to calcium ratio (Ba/Cacoral), a proxy for seawater barium concentrations (BaSW), has been interpreted as a tracer of upwelling based on the characteristic "nutrient like" depth profile of BaSW. However, in some tropical regions, such as the Gulf of Panamá, substantial influence of terrestrial runoff inputs and differences between the vertical distribution of BaSW and that of the major nutrients (nitrate and phosphate) in the upper water column can complicate the interpretation of Ba/Cacoral as an upwelled nutrient proxy. In the Gulf of Panamá, contemporaneous Ba/Cacoral records from multiple colonies of Porites lobata, Pavona gigantea, and Pavona clavus corals record a nearly twofold change in surface water BaSW as a 20-70% increase in skeletal Ba/Ca with excellent correlation among Ba/Ca records from co-located colonies (r = 0.86-0.99). These results provide, for the first time, an absolute calibration of the coral Ba proxy with a contemporaneous BaSW record. Compiling the Ba/Cacoral records from three co-located colonies of each species into taxon-specific composite regressions reveals strong statistically significant correlations with the BaSW time-series record (p < 0.001). Differences among taxa in regression slope, y-intercept, and average distribution coefficient, as well as a demonstration of the application of the P. clavus calibration to a previously published Ba/Cacoral record, emphasize the necessity of using taxon-specific calibrations to reconstruct changes in BaSW with accuracy. These results support the application of Ba/Cacoral to reconstruct past changes in absolute BaSW concentrations, adding an important tool to the collection of geochemical proxies for reconstructing surface ocean biogeochemical processes in the past.

  9. Laser welding of aluminum alloys

    SciTech Connect

    Leong, K.H.; Sabo, K.R.; Sanders, P.G.; Spawr, W.J.

    1997-03-01

    Recent interest in reducing the weight of automobiles to increase fuel mileage has focused attention on the use of aluminum and associated joining technologies. Laser beam welding is one of the more promising methods for high speed welding of aluminum. Consequently, substantial effort has been expended in attempting to develop a robust laser beam welding process. Early results have not been very consistent in the process requirements but more definitive data has been produced recently. This paper reviews the process parameters needed to obtain consistent laser welds on 5,000 series aluminum alloys and discusses the research necessary to make laser processing of aluminum a reality for automotive applications.

  10. Mineral of the month: aluminum

    USGS Publications Warehouse

    Plunkert, Patricia A.

    2005-01-01

    Aluminum is the second most abundant metallic element in Earth’s crust after silicon. Even so, it is a comparatively new industrial metal that has been produced in commercial quantities for little more than 100 years. Aluminum is lightweight, ductile, malleable and corrosion resistant, and is a good conductor of heat and electricity. Weighing about one-third as much as steel or copper per unit of volume, aluminum is used more than any other metal except iron. Aluminum can be fabricated into desired forms and shapes by every major metalworking technique to add to its versatility.

  11. [Calcium and health].

    PubMed

    Ortega Anta, Rosa M; Jiménez Ortega, Ana I; López-Sobaler, Ana M

    2015-01-01

    An adequate intake of calcium is only not limited to avoid the risk of osteoporosis and its benefits in longterm bone health, but also it has been linked to protection against various major diseases, such as hypertension, cancer, kidney stones, insulin resistance, diabetes... and several investigations suggest its importance in preventing and controlling obesity. Studies conducted in Spanish representative samples show that a high percentage of adults and children (> 75%) don't achieve the recommended intake of calcium. Moreover, are growing trends among the population suggesting that calcium intake and dairy consumption (main food source of the mineral) are high, and even excessive, in many individuals. This misconception results in that the calcium intake is increasingly far from the recommended one. The maximum tolerable intake of the mineral is fixed at 2.500 mg/day, but this intake is unusual, and it's more disturbing and frequent, to find intakes below the recommended calcium intakes (1.000 and 1.200 mg/day in adults, men and women, respectively). Data from different studies highlight the risk of an inadequate calcium intake and the damages that may affect the health in a long term. It is not about transmitting indiscriminate guidelines in order to increase the intake of calcium / dairy, but the recommended intakes must be met to achieve both the nutritional and health benefits. Also activities for demystification of misconceptions are need, increasingly frequent, that may impair health population. PMID:25862324

  12. Dissolution of Barium from Barite in Sewage Sludges and Cultures of Desulfovibrio desulfuricans

    PubMed Central

    Baldi, F.; Pepi, M.; Burrini, D.; Kniewald, G.; Scali, D.; Lanciotti, E.

    1996-01-01

    High concentrations of total barium, ranging from 0.42 to 1.58 mg(middot)g(sup-1) (dry weight) were found in sludges of two sewage treatment plants near Florence, Italy. Barium concentrations in the suspended matter decreased as redox potential values changed from negative to positive. An anoxic sewage sludge sample was aerated, and 30% of the total barium was removed in 24 h. To demonstrate that barium was solubilized from barite by sulfate-reducing bacteria, a strain of Desulfovibrio desulfuricans was used to study the solubilization of barium from barite under laboratory conditions. During cell growth with different concentrations of barite from 0.01 to 0.3 g(middot)liter(sup-1) (the latter is the MIC) as the only source of sulfates in the cultures, the D. desulfuricans strain accumulated barium up to 0.58 (mu)g(middot)mg(sup-1) (dry weight). Three times the quantity of barium was dissolved by bacteria than in the uninoculated medium (control). The unexpectedly low concentration of soluble barium (1.2 mg of Ba(middot)liter(sup-1)) with respect to the quantity expected (109 mg of Ba(middot)liter(sup-1)), calculated on the basis of the free H(inf2)S evolved from the dissimilatory reduction of sulfate from barite, was probably due to the formation of other barium compounds, such as witherite (BaCO(inf3)) and the transient species barium sulfide (BaS). The D. desulfuricans strain, growing on barite, formed visible aggregates. Confocal microscopy analysis showed that aggregates consisted of bacteria and barite. After 3 days of incubation, several autofluorescent crystals surrounded by a dissolution halo were observed. The crystals were identified as BaS by comparison with the commercial compound. PMID:16535353

  13. Effects of Different Barium Compounds on the Corrosion Resistance of Andalusite-Based Low-Cement Castables in Contact with Molten Al-Alloy

    NASA Astrophysics Data System (ADS)

    Adabifiroozjaei, Esmaeil; Koshy, Pramod; Rastkerdar, Ebad

    2011-08-01

    An experimental study was conducted to investigate the interfacial phenomena between an Al alloy and andalusite low-cement castables (LCCs) containing fixed contents of barium compounds (BaO, BaSO4, and BaCO3) at 1123 K and 1433 K (850 °C and 1160 °C) using the Alcoa cup test. Interfacial reaction products and phases formed during heat treatment of the refractory samples were characterized using scanning electron microscopy (SEM) coupled with energy dispersive spectrometry (EDS) and X-ray diffraction analysis (XRD). The addition of both BaO and BaSO4 led to a significant reduction of alloy penetration into the refractory. Hexa-celsian formation was observed in both these refractories, which drastically increased their corrosion resistance. Barite decomposition was observed at 1373 K (1100 °C) in the presence of alumina and silica, which was the precursor for hexa-celsian formation. Barium silicates were formed in all samples containing additives; however, this did not have any major influence on the corrosion resistance. Solidified eutectics of BaSi2 and α-BaAl2Si2 formed in all these samples, which acted as an interfacial barrier that prevented additional molten aluminum penetration; however, the positive effect of intermetallic formation was offset by glassy phase formation in samples containing BaCO3 as the additive.

  14. Production of aluminum metal by electrolysis of aluminum sulfide

    DOEpatents

    Minh, N.Q.; Loutfy, R.O.; Yao, N.P.

    1982-04-01

    Metallic aluminum may be produced by the electrolysis of Al/sub 2/S/sub 3/ at 700 to 800/sup 0/C in a chloride melt composed of one or more alkali metal chlorides, and one or more alkaline earth metal chlorides and/or aluminum chloride to provide improved operating characteristics of the process.

  15. Production of aluminum metal by electrolysis of aluminum sulfide

    DOEpatents

    Minh, Nguyen Q.; Loutfy, Raouf O.; Yao, Neng-Ping

    1984-01-01

    Production of metallic aluminum by the electrolysis of Al.sub.2 S.sub.3 at 700.degree.-800.degree. C. in a chloride melt composed of one or more alkali metal chlorides, and one or more alkaline earth metal chlorides and/or aluminum chloride to provide improved operating characteristics of the process.

  16. Proton trapping in yttrium-doped barium zirconate

    NASA Astrophysics Data System (ADS)

    Yamazaki, Yoshihiro; Blanc, Frédéric; Okuyama, Yuji; Buannic, Lucienne; Lucio-Vega, Juan C.; Grey, Clare P.; Haile, Sossina M.

    2013-07-01

    The environmental benefits of fuel cells have been increasingly appreciated in recent years. Among candidate electrolytes for solid-oxide fuel cells, yttrium-doped barium zirconate has garnered attention because of its high proton conductivity, particularly in the intermediate-temperature region targeted for cost-effective solid-oxide fuel cell operation, and its excellent chemical stability. However, fundamental questions surrounding the defect chemistry and macroscopic proton transport mechanism of this material remain, especially in regard to the possible role of proton trapping. Here we show, through a combined thermogravimetric and a.c. impedance study, that macroscopic proton transport in yttrium-doped barium zirconate is limited by proton-dopant association (proton trapping). Protons must overcome the association energy, 29 kJ mol-1, as well as the general activation energy, 16 kJ mol-1, to achieve long-range transport. Proton nuclear magnetic resonance studies show the presence of two types of proton environment above room temperature, reflecting differences in proton-dopant configurations. This insight motivates efforts to identify suitable alternative dopants with reduced association energies as a route to higher conductivities.

  17. Brillouin function characteristics for La-Co substituted barium hexaferrites

    NASA Astrophysics Data System (ADS)

    Wu, Chuanjian; Yu, Zhong; Yang, Yan; Sun, Ke; Guo, Rongdi; Jiang, Xiaona; Lan, Zhongwen

    2015-09-01

    La-Co substituted barium hexaferrites with the chemical formula of Ba1-xLaxFe12-xCoxO19 (x = 0.0, 0.1, 0.3, and 0.5), prepared by a conventional ceramic method, were systematically investigated by Raman spectra, X-ray photoelectron spectroscopy, Rietveld refinement of X-ray diffraction patterns, and vibrating sample magnetometer. The result manifests that all the compounds are crystallized in magnetoplumbite hexagonal structure. Trivalent cobalt ions prevailingly occupy the 2a, 4f1, and 12k sites. According to Néel model of collinear-spin ferrimagnetism, the molecular-field coefficients ωbf2, ωkf1, ωaf1, ωkf2, and ωbk of La-Co substituted barium hexaferrites have been calculated using the nonlinear fitting method, and the magnetic moment of five sublattices (2a, 2b, 4f1, 4f2, and 12k) versus temperature T has been also investigated. The fitting results are coincided well with the experimental data. Moreover, with the increase of La-Co substitution amount x, the molecular-field coefficients ωbf2 and ωaf1 decrease constantly, while the molecular-field coefficients ωkf1, ωkf2, and ωbk show a slight change.

  18. Results of magnetospheric barium ion cloud experiment of 1971

    NASA Technical Reports Server (NTRS)

    Adamson, D.; Fricke, C. L.; Long, S. A. T.

    1975-01-01

    The barium ion cloud experiment involved the release of about 2 kg of barium at an altitude of 31 482 km, a latitude of 6.926 N., and a longitude of 74.395 W. Significant erosion of plasma from the main ion core occurred during the initial phase of the ion cloud expansion. From the motion of the outermost striational filaments, the electric field components were determined to be 0.19 mV/m in the westerly direction and 0.68 mV/m in the inward direction. The differences between these components and those measured from balloons flown in the proximity of the extremity of the field line through the release point implied the existence of potential gradients along the magnetic field lines. The deceleration of the main core was greater than theoretically predicted. This was attributed to the formation of a polarization wake, resulting in an increase of the area of interaction and resistive dissipation at ionospheric levels. The actual orientation of the magnetic field line through the release point differed by about 10.5 deg from that predicted by magnetic field models that did not include the effect of ring current.

  19. Plasma waves associated with the first AMPTE magnetotail barium release

    NASA Technical Reports Server (NTRS)

    Gurnett, D. A.; Anderson, R. R.; Bernhardt, P. A.; Luehr, H.; Haerendel, G.

    1986-01-01

    Plasma waves observed during the March 21, 1985, AMPTE magnetotail barium release are described. Electron plasma oscillations provided local measurements of the plasma density during both the expansion and decay phases. Immediately after the explosion, the electron density reached a peak of about 400,000/cu cm, and then started decreasing approximately as t to the -2.4 as the cloud expanded. About 6 minutes after the explosion, the electron density suddenly began to increase, reached a secondary peak of about 240/cu cm, and then slowly decayed down to the preevent level over a period of about 15 minutes. The density increase is believed to be caused by the collapse of the ion cloud into the diamagnetic cavity created by the initial expansion. The plasma wave intensities observed during the entire event were quite low. In the diamagnetic cavity, electrostatic emissions were observed near the barium ion plasma frequency, and in another band at lower frequencies. A broadband burst of electrostatic noise was also observed at the boundary of the diamagnetic cavity. Except for electron plasma oscillations, no significant wave activity was observed outside of the diamagnetic cavity.

  20. Critical properties of aluminum.

    PubMed

    Bhatt, Divesh; Jasper, Ahren W; Schultz, Nathan E; Siepmann, J Ilja; Truhlar, Donald G

    2006-04-01

    Gibbs ensemble Monte Carlo calculations are performed using a validated embedded-atom potential to obtain the vapor-liquid coexistence curve for elemental aluminum in good agreement with available experimental data up to the boiling point. These calculations are then extended to make a reliable prediction of the critical temperature, pressure, and density of Al, which have previously been known only with very large uncertainties. This demonstrates the ability of modern simulations to predict fundamental physical properties that are extremely difficult to measure directly. PMID:16568986

  1. Releasing-addition method for the flame-photometric determination of calcium in thermal waters

    USGS Publications Warehouse

    Rowe, J.J.

    1963-01-01

    Study of the interferences of silica and sulfate in the flame-photometric determination of calcium in thermal waters has led to the development of a method requiring no prior chemical separations. The interference effects of silica, sulfate, potassium, sodium, aluminum, and phosphate are overcome by an addition technique coupled with the use of magnesium as a releasing agent. ?? 1963.

  2. Liquid-Phase Processing of Barium Titanate Thin Films

    NASA Astrophysics Data System (ADS)

    Harris, David Thomas

    Processing of thin films introduces strict limits on the thermal budget due to substrate stability and thermal expansion mismatch stresses. Barium titanate serves as a model system for the difficulty in producing high quality thin films because of sensitivity to stress, scale, and crystal quality. Thermal budget restriction leads to reduced crystal quality, density, and grain growth, depressing ferroelectric and nonlinear dielectric properties. Processing of barium titanate is typically performed at temperatures hundreds of degrees above compatibility with metalized substrates. In particular integration with silicon and other low thermal expansion substrates is desirable for reductions in costs and wider availability of technologies. In bulk metal and ceramic systems, sintering behavior has been encouraged by the addition of a liquid forming second phase, improving kinetics and promoting densification and grain growth at lower temperatures. This approach is also widespread in the multilayer ceramic capacitor industry. However only limited exploration of flux processing with refractory thin films has been performed despite offering improved dielectric properties for barium titanate films at lower temperatures. This dissertation explores physical vapor deposition of barium titanate thin films with addition of liquid forming fluxes. Flux systems studied include BaO-B2O3, Bi2O3-BaB2O 4, BaO-V2O5, CuO-BaO-B2O3, and BaO-B2O3 modified by Al, Si, V, and Li. Additions of BaO-B2O3 leads to densification and an increase in average grain size from 50 nm to over 300 nm after annealing at 900 °C. The ability to tune permittivity of the material improved from 20% to 70%. Development of high quality films enables engineering of ferroelectric phase stability using residual thermal expansion mismatch in polycrystalline films. The observed shifts to TC match thermodynamic calculations, expected strain from the thermal expansion coefficients, as well as x-ray diffract measurements

  3. The determination of calcium in phosphate, carbonate, and silicate rocks by flame photometer

    USGS Publications Warehouse

    Kramer, Henry

    1956-01-01

    A method has been developed for the determination of calcium in phosphate, carbonate, and silicate rocks using the Beckman flame photometer, with photomultiplier attachement. The sample is dissolved in hydrofluoric, nitric, and perchloric acids, the hydrofluoric and nitric acids are expelled, a radiation buffer consisting of aluminum, magnesium, iron, sodium, potassium, phosphoric acid, and nitric acid is added, and the solution is atomized in an oxy-hydrogen flame with an instrument setting of 554 mµ. Measurements are made by comparison against calcium standards, prepared in the same manner, in the 0 to 50 ppm range. The suppression of calcium emission by aluminum and phosphate was overcome by the addition of a large excess of magnesium. This addition almost completely restores the standard curve obtained from a solution of calcium nitrate. Interference was noted when the iron concentration in the aspirated solution (including the iron from the buffer) exceeded 100 ppm iron. Other common rock-forming elements did not interfere. The results obtained by this procedure are within ± 2 percent of the calcium oxide values obtained by other methods in the range 1 to 95 percent calcium oxide. In the 0 to 1 percent calcium oxide range the method compares favorably with standard methods.

  4. Calcium in diet

    MedlinePlus

    ... level based on scientific research evidence. Adequate Intake (AI): This level is established when there is not ... enough calcium from the foods they eat. Infants (AI) 0 to 6 months: 200 milligrams per day ( ...

  5. Get Enough Calcium

    MedlinePlus

    ... Previous section Overview 2 of 4 sections Take Action! Take Action: Calcium Sources Protect your bones – get plenty of ... Foods and Vitamins 3 of 4 sections Take Action: Vitamin D Get enough vitamin D. Vitamin D ...

  6. Stoichiometry of Calcium Medicines

    ERIC Educational Resources Information Center

    Pinto, Gabriel

    2005-01-01

    The topic of calcium supplement and its effects on human lives is presented in the way of questions to the students. It enables the students to realize the relevance of chemistry outside the classroom surrounding.

  7. Calcium pyrophosphate arthritis

    MedlinePlus

    ... that can cause attacks of arthritis. Like with gout, crystals form in the joints. But in calcium ... pyrophosphate arthritis can be misdiagnosed as: Gouty arthritis (gout) Osteoarthritis Rheumatoid arthritis

  8. Aluminum Nanoholes for Optical Biosensing.

    PubMed

    Barrios, Carlos Angulo; Canalejas-Tejero, Víctor; Herranz, Sonia; Urraca, Javier; Moreno-Bondi, María Cruz; Avella-Oliver, Miquel; Maquieira, Ángel; Puchades, Rosa

    2015-01-01

    Sub-wavelength diameter holes in thin metal layers can exhibit remarkable optical features that make them highly suitable for (bio)sensing applications. Either as efficient light scattering centers for surface plasmon excitation or metal-clad optical waveguides, they are able to form strongly localized optical fields that can effectively interact with biomolecules and/or nanoparticles on the nanoscale. As the metal of choice, aluminum exhibits good optical and electrical properties, is easy to manufacture and process and, unlike gold and silver, its low cost makes it very promising for commercial applications. However, aluminum has been scarcely used for biosensing purposes due to corrosion and pitting issues. In this short review, we show our recent achievements on aluminum nanohole platforms for (bio)sensing. These include a method to circumvent aluminum degradation--which has been successfully applied to the demonstration of aluminum nanohole array (NHA) immunosensors based on both, glass and polycarbonate compact discs supports--the use of aluminum nanoholes operating as optical waveguides for synthesizing submicron-sized molecularly imprinted polymers by local photopolymerization, and a technique for fabricating transferable aluminum NHAs onto flexible pressure-sensitive adhesive tapes, which could facilitate the development of a wearable technology based on aluminum NHAs. PMID:26184330

  9. The Benefits of Aluminum Windows.

    ERIC Educational Resources Information Center

    Goyal, R. C.

    2002-01-01

    Discusses benefits of aluminum windows for college construction and renovation projects, including that aluminum is the most successfully recycled material, that it meets architectural glass deflection standards, that it has positive thermal energy performance, and that it is a preferred exterior surface. (EV)

  10. Primary Aluminum Plants Worldwide - 1998

    USGS Publications Warehouse

    1999-01-01

    The 1990 U.S. Bureau of Mines publication, Primary Aluminum Plants Worldwide, has been updated and is now available. The 1998 USGS edition of Primary Aluminum Plants Worldwide is published in two parts. Part I—Detail contains information on individual primary smelter capacity, location, ownership, sources of energy, and other miscellaneous information. Part II—Summary summarizes the capacity data by country

  11. Lost-Soap Aluminum Casting.

    ERIC Educational Resources Information Center

    Mihalow, Paula

    1980-01-01

    Lost-wax casting in sterling silver is a costly experience for the average high school student. However, this jewelry process can be learned at no cost if scrap aluminum is used instead of silver, and soap bars are used instead of wax. This lost-soap aluminum casting process is described. (Author/KC)

  12. Boron carbide-aluminum cermets

    SciTech Connect

    Halverson, D.C.

    1986-09-03

    We have developed boron carbide-aluminum cermets by means of thermodynamic, kinetic, and processing studies. Our research indicates that boron carbide-aluminum cermets offer ''tailorable'' microstructures with designable properties through process control. This new class of cermets has the potential to become a very important material with wide industrial applications.

  13. Aluminum Nanoholes for Optical Biosensing

    PubMed Central

    Barrios, Carlos Angulo; Canalejas-Tejero, Víctor; Herranz, Sonia; Urraca, Javier; Moreno-Bondi, María Cruz; Avella-Oliver, Miquel; Maquieira, Ángel; Puchades, Rosa

    2015-01-01

    Sub-wavelength diameter holes in thin metal layers can exhibit remarkable optical features that make them highly suitable for (bio)sensing applications. Either as efficient light scattering centers for surface plasmon excitation or metal-clad optical waveguides, they are able to form strongly localized optical fields that can effectively interact with biomolecules and/or nanoparticles on the nanoscale. As the metal of choice, aluminum exhibits good optical and electrical properties, is easy to manufacture and process and, unlike gold and silver, its low cost makes it very promising for commercial applications. However, aluminum has been scarcely used for biosensing purposes due to corrosion and pitting issues. In this short review, we show our recent achievements on aluminum nanohole platforms for (bio)sensing. These include a method to circumvent aluminum degradation—which has been successfully applied to the demonstration of aluminum nanohole array (NHA) immunosensors based on both, glass and polycarbonate compact discs supports—the use of aluminum nanoholes operating as optical waveguides for synthesizing submicron-sized molecularly imprinted polymers by local photopolymerization, and a technique for fabricating transferable aluminum NHAs onto flexible pressure-sensitive adhesive tapes, which could facilitate the development of a wearable technology based on aluminum NHAs. PMID:26184330

  14. In vitro adsorption of aluminum by an edible biopolymer poly(γ-glutamic acid).

    PubMed

    Rajan, Yesudoss Christu; Inbaraj, Baskaran Stephen; Chen, Bing Huei

    2014-05-21

    Accumulation of aluminum in human has been reported to be associated with dementia, Parkinson's disease, and Alzheimer's disease. The objectives of this study were to evaluate an edible biopolymer poly(γ-glutamic acid) (γ-PGA) for aluminum removal efficiency under in vitro conditions as affected by pH, contact time, aluminum concentration, temperature, ionic strength, and essential metals in both aqueous aluminum solution and simulated gastrointestinal fluid (GIF). A low aluminum adsorption occurred at pH 1.5-2.5, followed by a maximum adsorption at pH 3.0-4.0 and precipitating thereafter as aluminum hydroxide at pH > 4. Adsorption was extremely fast with 81-96% of total adsorption being attained within 1 min, reaching equilibrium in 5-10 min. Kinetic data at low (10 mg/L) and high (50 mg/L) concentrations were well described by pseudo-first-order and pseudo-second-order models, respectively. Equilibrium adsorption isotherms at different temperatures were precisely fitted by both Langmuir and Redlich-Peterson models with the maximum adsorption capacities at 25, 37, and 50 °C being 35.85, 38.68, and 44.23 mg/g, respectively. Thermodynamic calculations suggested endothermic and spontaneous nature of aluminum adsorption by γ-PGA with increased randomness at the solid/solution interface. Variation in ionic strengths did not alter the adsorption capacity, however, the incorporation of essential metals significantly reduced the aluminum adsorption by following the order copper > iron > zinc > calcium > potassium. Compared to aqueous solution, the aluminum adsorption from simulated GIF was high at all studied pH (1-4) with Langmuir monolayer adsorption capacity being 49.43 mg/g at 37 °C and pH 4. The outcome of this study suggests that γ-PGA could be used as a safe detoxifying agent for aluminum. PMID:24799126

  15. Oxygen octahedral rotation mapping in calcium titanate/strontium titanate superlattices by transmission electron microscopy

    NASA Astrophysics Data System (ADS)

    Stone, Greg; Ciston, Jim; Haislmaier, Ryan; Vanleeuwen, Brian; Alem, Nasim; Schlom, Darrell; Gopalan, Venkatraman

    2014-03-01

    We report the investigation of oxygen octahedral rotation mapping in calcium titanate/barium titanate superlattices epitaxially grown on LSAT (001) with transmission electron microscopy. Analysis of the images shows induced antiphase rotations of the oxygen octahedral the strontium titanate layers that is absent in the bulk material at room temperature. These rotations play a key role in breaking the centrosymmetry of the material leading to polar properties as seen by second harmonic generation. We also map the local position of the cations to provide a complete picture of any relative local displacements and the oxygen-cation-oxygen bond angles.

  16. Channeling of aluminum in silicon

    SciTech Connect

    Wilson, R.G.; Hopkins, C.G.

    1985-05-15

    A systematic study of channeling of aluminum in the silicon crystal is reported. Depth distributions measured by secondary ion mass spectrometry are reported for 40-, 75-, and 150-keV aluminum channeled in the <100> and <110> directions of silicon. The profile dependence on alignment angle is shown for 150-keV aluminum in the <110> of silicon. Aluminum has low electronic stopping in silicon and corresponding deep channeled profiles are observed for aligned implants and deep channeling tails are observed on random implants. The maximum channeling range for 150-keV Al in <100> silicon is about 2.8 ..mu..m and is about 6.4 ..mu..m in <110> silicon. Some ions will reach the maximum channeling range even for 2/sup 0/ misalignment. Many of the deep channeling tails and ''supertails'' reported in earlier literature can be explained by the normal channeling of aluminum in silicon.

  17. SNX-325, a novel calcium antagonist from the spider Segestria florentina.

    PubMed

    Newcomb, R; Palma, A; Fox, J; Gaur, S; Lau, K; Chung, D; Cong, R; Bell, J R; Horne, B; Nadasdi, L

    1995-07-01

    A novel selective calcium channel antagonist peptide, SNX-325, has been isolated from the venom of the spider Segestria florentina. The peptide was isolated using as bioassays the displacement of radioiodinated omega-conopeptide SNX-230 (MVIIC) from rat brain synaptosomal membranes, as well as the inhibition of the barium current through cloned expressed calcium channels in oocytes. The primary sequence of SNX-325 is GSCIESGKSCTHSRSMKNGLCCPKSRCNCRQIQHRHDYLGKRKYSCRCS, which is a novel amino acid sequence. Solid-phase synthesis resulted in a peptide that is chromatographically identical with the native peptide and which has the same configuration of cysteine residues as the spider venom peptide omega-Aga-IVa [Mintz, I. M., et al., (1992) Nature 355, 827-829]. At micromolar concentrations, SNX-325 is an inhibitor of most calcium, but not sodium or potassium, currents. At nanomolar concentrations, SNX-325 is a selective blocker of the cloned expressed class B (N-type), but not class C (cardiac L), A, or E, calcium channels. SNX-325 is approximately equipotent with the N-channel selective omega-conopeptides (GVIA and MVIIA as well as closely related synthetic derivatives) in blocking the potassium induced release of tritiated norepinephrine from hippocampal slices (IC50s, 0.1-0.5 nM) and in blocking the barium current through cloned expressed N-channels in oocytes (IC50s 3-30 nM). By contrast, SNX-325 is 4-5 orders of magnitude less potent than is SNX-111 (synthetic MVIIA) at displacing radioiodinated SNX-111 from rat brain synaptosomal membranes. SNX-325 will be a useful comparative tool in further defining the function and pharmacology of the N- and possibly other types of high-voltage activated calcium channels. PMID:7541240

  18. Fabrication and characterization of cerium-doped barium titanate inverse opal by sol-gel method

    SciTech Connect

    Jin Yi; Zhu Yihua Yang Xiaoling; Li Chunzhong; Zhou Jinghong

    2007-01-15

    Cerium-doped barium titanate inverted opal was synthesized from barium acetate contained cerous acetate and tetrabutyl titanate in the interstitial spaces of a polystyrene (PS) opal. This procedure involves infiltration of precursors into the interstices of the PS opal template followed by hydrolytic polycondensation of the precursors to amorphous barium titanate and removal of the PS opal by calcination. The morphologies of opal and inverse opal were characterized by scanning electron microscope (SEM). The pores were characterized by mercury intrusion porosimetry (MIP). X-ray photoelectron spectroscopy (XPS) investigation showed the doping structure of cerium, barium and titanium. And powder X-ray diffraction allows one to observe the influence of doping degree on the grain size. The lattice parameters, crystal size and lattice strain were calculated by the Rietveld refinement method. The synthesis of cerium-doped barium titanate inverted opals provides an opportunity to electrically and optically engineer the photonic band structure and the possibility of developing tunable three-dimensional photonic crystal devices. - Graphical abstract: Cerium-doped barium titanate inverted opal was synthesized from barium acetate acid contained cerous acetate and tetrabutyl titanate in the interstitial spaces of a PS opal, which involves infiltration of precursors into the interstices of the PS opal template and removal of the PS opal by calcination.

  19. Bio-based barium alginate film: Preparation, flame retardancy and thermal degradation behavior.

    PubMed

    Liu, Yun; Zhang, Chuan-Jie; Zhao, Jin-Chao; Guo, Yi; Zhu, Ping; Wang, De-Yi

    2016-03-30

    A bio-based barium alginate film was prepared via a facile ionic exchange and casting approach. Its flammability, thermal degradation and pyrolysis behaviors, thermal degradation mechanism were studied systemically by limiting oxygen index (LOI), vertical burning (UL-94), microscale combustion calorimetry (MCC), thermogravimetric analysis (TGA) coupled with Fourier transform infrared analysis (FTIR) and pyrolysis-gas chromatography-mass spectrometry (Py-GC-MS). It showed that barium alginate film had much higher LOI value (52.0%) than that of sodium alginate film (24.5%). Moreover, barium alginate film passed the UL-94 V-0 rating, while the sodium alginate film showed no classification. Importantly, peak of heat release rate (PHRR) of barium alginate film in MCC test was much lower than that of sodium alginate film, suggested that introduction of barium ion into alginate film significantly decreased release of combustible gases. TG-FTIR and Py-GC-MS results indicated that barium alginate produced much less flammable products than that of sodium alginate in whole thermal degradation procedure. Finally, a possible degradation mechanism of barium alginate had been proposed. PMID:26794953

  20. Magnetic properties of Ni substituted Y-type barium ferrite

    NASA Astrophysics Data System (ADS)

    Won, Mi Hee; Kim, Chul Sung

    2014-05-01

    Y-type barium hexaferrite is attractive material for various applications, such as high frequency antennas and RF devices, because of its interesting magnetic properties. Especially, Ni substituted Y- type hexaferrites have higher magnetic ordering temperature than other Y-type. We have investigated macroscopic and microscopic properties of Y-type barium hexaferrite. Ba2Co2-xNixFe12O22 (x = 0, 0.5, 1.0, 1.5, and 2.0) samples are prepared by solid-state reaction method and studied by X-ray diffraction (XRD), vibrating sample magnetometer, and Mössbauer spectroscopy, as well as a network analyzer for high frequency characteristics. The XRD pattern is analyzed by Rietveld refinement method and confirms the hexagonal structure with R-3m. The hysteresis curve shows ferrimagnetic behavior. Saturation magnetization (Ms) decreases with Ni contents. Ni2+, which preferentially occupies the octahedral site with up-spin sub-lattice, has smaller spin value S of 1 than Co2+ having S = 3/2. The zero-field-cooled (ZFC) measurement of Ba2Co1.5Ni0.5Fe12O22 shows that Curie and spin transition temperatures are found to be 718 K and 209 K, respectively. The Curie temperature TC is increased with Ni contents, while TS is decreased with Ni. The Mössbauer spectra were measured at various temperatures and fitted by using a least-squares method with six sextet of six Lorentzian lines for Fe sites, corresponding to the 3bVI, 6cIV*, 6cVI, 18hVI, 6cIV, and 3aIV sites at below TC. From Mössbauer measurements, we confirmed the spin state of Fe ion to be Fe3+ and obtained the isomer shift (δ), magnetic hyperfine field (Hhf), and the occupancy ratio of Fe ions at six sub-lattices. The complex permeability and permittivity are measured between 100 MHz and 4 GHz, suggesting that Y-type barium hexaferrite is promising for antenna applications in UHF band.

  1. Magnetic properties of Ni substituted Y-type barium ferrite

    SciTech Connect

    Won, Mi Hee; Kim, Chul Sung

    2014-05-07

    Y-type barium hexaferrite is attractive material for various applications, such as high frequency antennas and RF devices, because of its interesting magnetic properties. Especially, Ni substituted Y- type hexaferrites have higher magnetic ordering temperature than other Y-type. We have investigated macroscopic and microscopic properties of Y-type barium hexaferrite. Ba{sub 2}Co{sub 2−x}Ni{sub x}Fe{sub 12}O{sub 22} (x = 0, 0.5, 1.0, 1.5, and 2.0) samples are prepared by solid-state reaction method and studied by X-ray diffraction (XRD), vibrating sample magnetometer, and Mössbauer spectroscopy, as well as a network analyzer for high frequency characteristics. The XRD pattern is analyzed by Rietveld refinement method and confirms the hexagonal structure with R-3m. The hysteresis curve shows ferrimagnetic behavior. Saturation magnetization (M{sub s}) decreases with Ni contents. Ni{sup 2+}, which preferentially occupies the octahedral site with up-spin sub-lattice, has smaller spin value S of 1 than Co{sup 2+} having S = 3/2. The zero-field-cooled (ZFC) measurement of Ba{sub 2}Co{sub 1.5}Ni{sub 0.5}Fe{sub 12}O{sub 22} shows that Curie and spin transition temperatures are found to be 718 K and 209 K, respectively. The Curie temperature T{sub C} is increased with Ni contents, while T{sub S} is decreased with Ni. The Mössbauer spectra were measured at various temperatures and fitted by using a least-squares method with six sextet of six Lorentzian lines for Fe sites, corresponding to the 3b{sub VI}, 6c{sub IV}*, 6c{sub VI}, 18h{sub VI}, 6c{sub IV}, and 3a{sub IV} sites at below T{sub C}. From Mössbauer measurements, we confirmed the spin state of Fe ion to be Fe{sup 3+} and obtained the isomer shift (δ), magnetic hyperfine field (H{sub hf}), and the occupancy ratio of Fe ions at six sub-lattices. The complex permeability and permittivity are measured between 100 MHz and 4 GHz, suggesting that Y-type barium hexaferrite is promising for antenna

  2. An XPS study of the optimum loading of barium on high-silica MFI zeolite

    NASA Astrophysics Data System (ADS)

    Mohamed, M. H.; Abdillahi, M. M.; Abbas, N. M.; Siddiqui, A. B.

    1995-12-01

    X-ray photoelectron spectroscopy (XPS) has been applied to the characterization of barium-impregnated MFI high-silica zeolites which are used for the conversion of methanol to light alkenes. X-ray photoelectron spectroscopy provided information about the degree of the dispersion of the various barium loadings on the silicalite structure, and this information helped in elucidating the observed relationship between the activity/selectivity of the catalysts and the barium loading. The XPS results also helped in predicting that the performance of the catalyst would be optimized at 4 wt% Ba loading which was found to agree with the catalytic conversion of methanol to light alkenes.

  3. Aluminum Zintl anion moieties within sodium aluminum clusters

    SciTech Connect

    Wang, Haopeng; Zhang, Xinxing; Ko, Yeon Jae; Grubisic, Andrej; Li, Xiang; Ganteför, Gerd; Bowen, Kit H. E-mail: kiran@mcneese.edu; Schnöckel, Hansgeorg; Eichhorn, Bryan W.; Lee, Mal-Soon; Jena, P.; Kandalam, Anil K. E-mail: kiran@mcneese.edu; Kiran, Boggavarapu E-mail: kiran@mcneese.edu

    2014-02-07

    Through a synergetic combination of anion photoelectron spectroscopy and density functional theory based calculations, we have established that aluminum moieties within selected sodium-aluminum clusters are Zintl anions. Sodium–aluminum cluster anions, Na{sub m}Al{sub n}{sup −}, were generated in a pulsed arc discharge source. After mass selection, their photoelectron spectra were measured by a magnetic bottle, electron energy analyzer. Calculations on a select sub-set of stoichiometries provided geometric structures and full charge analyses for both cluster anions and their neutral cluster counterparts, as well as photodetachment transition energies (stick spectra), and fragment molecular orbital based correlation diagrams.

  4. Aluminum Zintl anion moieties within sodium aluminum clusters

    NASA Astrophysics Data System (ADS)

    Wang, Haopeng; Zhang, Xinxing; Ko, Yeon Jae; Grubisic, Andrej; Li, Xiang; Ganteför, Gerd; Schnöckel, Hansgeorg; Eichhorn, Bryan W.; Lee, Mal-Soon; Jena, P.; Kandalam, Anil K.; Kiran, Boggavarapu; Bowen, Kit H.

    2014-02-01

    Through a synergetic combination of anion photoelectron spectroscopy and density functional theory based calculations, we have established that aluminum moieties within selected sodium-aluminum clusters are Zintl anions. Sodium-aluminum cluster anions, NamAln-, were generated in a pulsed arc discharge source. After mass selection, their photoelectron spectra were measured by a magnetic bottle, electron energy analyzer. Calculations on a select sub-set of stoichiometries provided geometric structures and full charge analyses for both cluster anions and their neutral cluster counterparts, as well as photodetachment transition energies (stick spectra), and fragment molecular orbital based correlation diagrams.

  5. Aluminum Zintl anion moieties within sodium aluminum clusters.

    PubMed

    Wang, Haopeng; Zhang, Xinxing; Ko, Yeon Jae; Grubisic, Andrej; Li, Xiang; Ganteför, Gerd; Schnöckel, Hansgeorg; Eichhorn, Bryan W; Lee, Mal-Soon; Jena, P; Kandalam, Anil K; Kiran, Boggavarapu; Bowen, Kit H

    2014-02-01

    Through a synergetic combination of anion photoelectron spectroscopy and density functional theory based calculations, we have established that aluminum moieties within selected sodium-aluminum clusters are Zintl anions. Sodium-aluminum cluster anions, Na(m)Al(n)(-), were generated in a pulsed arc discharge source. After mass selection, their photoelectron spectra were measured by a magnetic bottle, electron energy analyzer. Calculations on a select sub-set of stoichiometries provided geometric structures and full charge analyses for both cluster anions and their neutral cluster counterparts, as well as photodetachment transition energies (stick spectra), and fragment molecular orbital based correlation diagrams. PMID:24511934

  6. First principles pseudopotential calculations on aluminum and aluminum alloys

    SciTech Connect

    Davenport, J.W.; Chetty, N.; Marr, R.B.; Narasimhan, S.; Pasciak, J.E.; Peierls, R.F.; Weinert, M.

    1993-12-31

    Recent advances in computational techniques have led to the possibility of performing first principles calculations of the energetics of alloy formation on systems involving several hundred atoms. This includes impurity concentrations in the 1% range as well as realistic models of disordered materials (including liquids), vacancies, and grain boundaries. The new techniques involve the use of soft, fully nonlocal pseudopotentials, iterative diagonalization, and parallel computing algorithms. This approach has been pioneered by Car and Parrinello. Here the authors give a review of recent results using parallel and serial algorithms on metallic systems including liquid aluminum and liquid sodium, and also new results on vacancies in aluminum and on aluminum-magnesium alloys.

  7. Aluminum plasmonic photocatalysis

    PubMed Central

    Hao, Qi; Wang, Chenxi; Huang, Hao; Li, Wan; Du, Deyang; Han, Di; Qiu, Teng; Chu, Paul K.

    2015-01-01

    The effectiveness of photocatalytic processes is dictated largely by plasmonic materials with the capability to enhance light absorption as well as the energy conversion efficiency. Herein, we demonstrate how to improve the plasmonic photocatalytic properties of TiO2/Al nano-void arrays by overlapping the localized surface plasmon resonance (LSPR) modes with the TiO2 band gap. The plasmonic TiO2/Al arrays exhibit superior photocatalytic activity boasting an enhancement of 7.2 folds. The underlying mechanisms concerning the radiative energy transfer and interface energy transfer processes are discussed. Both processes occur at the TiO2/Al interface and their contributions to photocatalysis are evaluated. The results are important to the optimization of aluminum plasmonic materials in photocatalytic applications. PMID:26497411

  8. Photorefractive properties of cobalt-doped strontium barium niobate crystals

    SciTech Connect

    Bogodaev, N V; Ivleva, Lyudmila I; Lykov, P A; Polozkov, N M; Osiko, Vyacheslav V

    1999-05-31

    The two-wave interaction (at {lambda} = 488 nm) in strontium barium niobate crystals doped with cobalt ions (Co:SBN) was studied. The experimental dependences of the gain coefficient on the grating period and of the grating response time on the writing beam intensity were used to calculate the Debye screening length, the diffusion length, the dark conductivity, and the effective concentration of carrier traps for a series of Co:SBN crystals with different dopant concentrations. The crystals were shown to have high coupling coefficients ({Gamma} = 33 cm{sup -1}) and short optical response times ({tau} = 140 ms for I = 1 W cm{sup -2} ). This, in combination with a high photorefractive sensitivity (S = 39 cm{sup 2} J{sup -1} ), determines the efficiency of their use in the storage of optical information and in laser phase conjugation. (nonlinear optical phenomena)

  9. Synthesis, microstructure and dielectric properties of zirconium doped barium titanate

    NASA Astrophysics Data System (ADS)

    Kumar, Rohtash; Asokan, K.; Patnaik, S.; Birajdar, Balaji

    2016-05-01

    We report on synthesis, microstructural and relaxor ferroelectric properties of Zirconium(Zr) doped Barium Titanate (BT) samples with general formula Ba(Ti1-xZrx)O3 (x=0.20, 0.35). These lead-free ceramics were prepared by solid state reaction route. The phase transition behavior and temperature dependent dielectric properties and composition dependent ferroelectric properties were investigated. XRD analysis at room temperature confirms phase purity of the samples. SEM observations revealed retarded grain growth with increasing Zr mole fraction. Dielectric properties of BZT ceramics is influenced significantly by small addition of Zr mole fraction. With increasing Zr mole fraction, dielectric constant decreases while FWHM and frequency dispersion increases. Polarization vs electric field hysteresis measurements reveal ferroelectric relaxor phase at room temperature. The advantages of such substitution maneuvering towards optimizing ferroelectric properties of BaTiO3 are discussed.

  10. Laser irradiation in Nd3+ doped strontium barium niobate glass

    NASA Astrophysics Data System (ADS)

    Haro-González, P.; Martín, I. R.; Arbelo-Jorge, E.; González-Pérez, S.; Cáceres, J. M.; Núñez, P.

    2008-07-01

    A local nanocrystalline formation in a neodymium doped strontium barium niobate (SBN) glass has been obtained under argon laser irradiation. The intense emission around 880 nm, originated from the F43/2 (F45/2) thermalized level when the glass structure changes to a glass ceramic structure due to the irradiation of the laser beam, has been studied. The intensities and lifetimes change from this level inside and outside the irradiated area made by the laser excitation. They have been analyzed and demonstrated that the desvitrification process has been successfully achieved. These results confirm that nanocrystals of SBN have been created by the laser action confirming that the transition from glass to glass ceramic has been completed. These results are in agreement with the emission properties of nanocrystals of the bulk glass ceramic sample. The present study also suggests that the SBN nanocrystal has a potential application as temperature detector.

  11. The Performance of Barium Sulfate Nanoparticles/polypropylene Hybrid Multifilament

    NASA Astrophysics Data System (ADS)

    Li, Ying; Wang, Xuanjun; Mu, Xiaoxi; Zhang, Shujuan

    2012-01-01

    Nanosize barium sulfate (BaSO4) particles prepared with dodecyl benzene sulfonic acid (DBSA) in ethanol-water reaction system are used to prepare BaSO4/polypropylene (PP) nanocomposites by melt mixing method. It is then made into hybrid fibers by melt spinning and subsequent drawing with different ratios. The hybrid fibers are characterized by rheology, morphology, thermal stability and mechanical properties, respectively. The results indicate that the DBSA-modified BaSO4 can improve the spinnability of BaSO4/PP hybrid multifilament even at high BaSO4 nanoparticles concentration. DBSA can be used as compatibilizer to enhance the interface interaction of BaSO4/PP nanocomposites, because DBSA contains both hydrophobicity long alkyl chain and hydrophilic sulfonic group. Therefore, it can improve the performances of BaSO4/PP hybrid multifilament.

  12. A buffer gas cooled beam of barium monohydride

    NASA Astrophysics Data System (ADS)

    Iwata, Geoffrey; Tarallo, Marco; Zelevinsky, Tanya

    2016-05-01

    Significant advances in direct laser cooling of diatomic molecules have opened up a wide array of molecular species to precision studies spanning many-body physics, quantum collisions and ultracold dissociation. We present a cryogenic beam source of barium monohydride (BaH), and study laser ablation of solid precursor targets as well as helium buffer gas cooling dynamics. Additionally, we cover progress towards a molecular magneto-optical trap, with spectroscopic studies of relevant cooling transitions in the B2 Σ <--X2 Σ manifold in laser ablated molecules, including resolution of hyperfine structure and precision measurements of the vibrational Frank-Condon factors. Finally, we examine the feasibility of photo dissociation of trapped BaH molecules to yield optically accessible samples of ultracold hydrogen.

  13. Study on a flexoelectric microphone using barium strontium titanate

    NASA Astrophysics Data System (ADS)

    Kwon, S. R.; Huang, W. B.; Zhang, S. J.; Yuan, F. G.; Jiang, X. N.

    2016-04-01

    In this study, a flexoelectric microphone was, for the first time, designed and fabricated in a bridge structure using barium strontium titanate (Ba0.65Sr0.35TiO3) ceramic and tested afterwards. The prototyped flexoelectric microphone consists of a 1.5 mm  ×  768 μm  ×  50 μm BST bridge structure and a silicon substrate with a cavity. The sensitivity and resonance frequency were designed to be 0.92 pC/Pa and 98.67 kHz, respectively. The signal to noise ratio was measured to be 74 dB. The results demonstrate that the flexoelectric microphone possesses high sensitivity and a wide working frequency range simultaneously, suggesting that flexoelectricity could be an excellent alternative sensing mechanism for microphone applications.

  14. Barium depletion study on impregnated cathodes and lifetime prediction

    NASA Astrophysics Data System (ADS)

    Roquais, J. M.; Poret, F.; le Doze, R.; Ricaud, J. L.; Monterrin, A.; Steinbrunn, A.

    2003-06-01

    In the thermionic cathodes used in cathode ray-tubes (CRTs), barium is the key element for the electronic emission. In the case of the dispenser cathodes made of a porous tungsten pellet impregnated with Ba, Ca aluminates, the evaporation of Ba determines the cathode lifetime with respect to emission performance in the CRT. The Ba evaporation results in progressive depletion of the impregnating material inside the pellet. In the present work, the Ba depletion with time has been extensively characterized over a large range of cathode temperature. Calculations using the depletion data allowed modeling of the depletion as a function of key parameters. The link between measured depletion and emission in tubes has been established, from which an end-of-life criterion was deduced. Taking modeling into account, predicting accelerated life-tests were performed using high-density maximum emission current (MIK).

  15. Gamma radiation induced darkening in barium gallo-germanate glass.

    PubMed

    Chen, Xiaodong; Heng, Xiaobo; Tang, Guowu; Zhu, Tingting; Sun, Min; Shan, Xiujie; Wen, Xin; Guo, Jingyuan; Qian, Qi; Yang, Zhongmin

    2016-05-01

    Barium gallo-germanate (BGG) glass is an important glass matrix material used for mid-infrared transmission and mid-infrared fiber laser. In this study, we investigated the γ-ray irradiation induced darkening effect of BGG glass. Optical transmittance spectra, electron paramagnetic resonance (EPR) and thermoluminescence (TL) spectra were employed to investigate the γ-ray irradiation induced defects. Two kinds of Ge-related defects in the irradiated BGG glass, named Ge-related non-bridging oxygen hole center (Ge-NBOHC) and Ge-related electron centers (GEC), were verified. In addition, the absorption bands of the two defects have been separated and the peak absorptivity of Ge-NBOHC and GEC defects is at 375 nm and 315 nm, respectively. PMID:27137531

  16. Synthesis and optical study of barium magnesium aluminate blue phosphors

    NASA Astrophysics Data System (ADS)

    Jeet, Suninder; Sharma, Manoj; Pandey, O. P.

    2015-05-01

    Europium doped barium magnesium aluminate (BaMgAl10O17:Eu2+) phosphor was prepared via solution combustion method at 550°C using urea as a fuel. Morphological and optical properties of the prepared sample was studied by X-ray diffraction (XRD), Transmission electron microscopy (TEM) and Photoluminescence spectroscopy (PL). XRD result showed the formation of pure phase BaMgAl10O17(JCPDS 26-0163) along with an additional phase BaAl2O4(JCPDS 01-082-1350). TEM image indicated the formation of faceted particles with average particle size 40 nm. From PL spectra, a broad emission band obtained at about 450 nm attributes to 4f6 5d → 4f7 transition of Eu2+ which lies in the blue region of the visible spectrum.

  17. Studies on immobilization of thorium in barium borosilicate glass

    NASA Astrophysics Data System (ADS)

    Mishra, R. K.; Sengupta, Pranesh; Kaushik, C. P.; Tyagi, A. K.; Kale, G. B.; Raj, Kanwar

    2007-02-01

    The barium borosilicate glass (BBS) matrix has shown considerable solubility of ThO2 at 1000 °C. As seen by X-ray diffractometry (XRD) and Electron probe micro analysis (EPMA) up to 15.86 wt% of ThO2 could be dissolved in this matrix. The homogeneity of thoria loaded glass was convincingly ascertained by EPMA. Attempts to load more than 16 wt% ThO2 led to the phase separation of crystalline phases identified as major phase of ThO2 and minor percentage of ThSiO4 phase with altogether different morphologies, as seen by XRD. Interestingly, the back scattered images of thorite crystals point towards the presence of chemical zoning. The results being reported in this paper are of interest especially with respect to immobilization of other actinides in borosilicate glass matrix.

  18. Small polarons and point defects in barium cerate

    NASA Astrophysics Data System (ADS)

    Swift, Michael; Janotti, Anderson; Van de Walle, Chris G.

    2015-12-01

    Barium cerate (BaCeO3) is a well-known ionic conductor of both hydrogen and oxygen. In applications, it is frequently doped (for instance with Y) to increase stability and promote diffusion. However, the effects of doping and native defects are not fully understood. Computational studies have been stymied by the nature of the conduction band, which is made up of cerium 4 f states. These states present a challenge to ab initio techniques based on density functional theory within the standard approximations for exchange and correlation. Using a hybrid functional, we investigate the effects of hydrogen impurities and native defects on the electrical and optical properties of BaCeO3. We discuss the tendency of excess electrons or holes to localize in the form of small polarons. We also explore the interactions of polarons with hydrogen impurities and oxygen vacancies, and their impact on luminescence properties.

  19. Ultrasonic de-agglomeration of barium titanate powder.

    PubMed

    Marković, S; Mitrić, M; Starcević, G; Uskoković, D

    2008-01-01

    BaTiO3 (BT) powder, with average particle size of 1.4 microm, was synthesized by solid-state reaction. A high-intensity ultrasound irradiation (ultrasonication) was used to de-agglomerate micro-sized powder to nano-sized one. The crystal structure, crystallite size, morphology, particle size, particle size distribution, and specific surface area of the BT powder de-agglomerated for different ultrasonication times (0, 10, 60, and 180 min) were determined. It was found that the particles size of the BT powder was influenced by ultrasonic treatment, while its tetragonal structure was maintained. Therefore, ultrasonic irradiation can be proposed as an environmental-friendly, economical, and effective tool for the de-agglomeration of barium titanate powders. PMID:17845864

  20. Synthesis and optical study of barium magnesium aluminate blue phosphors

    SciTech Connect

    Jeet, Suninder Pandey, O. P.; Sharma, Manoj

    2015-05-15

    Europium doped barium magnesium aluminate (BaMgAl{sub 10}O{sub 17}:Eu{sup 2+}) phosphor was prepared via solution combustion method at 550°C using urea as a fuel. Morphological and optical properties of the prepared sample was studied by X-ray diffraction (XRD), Transmission electron microscopy (TEM) and Photoluminescence spectroscopy (PL). XRD result showed the formation of pure phase BaMgAl{sub 10}O{sub 17}(JCPDS 26-0163) along with an additional phase BaAl{sub 2}O{sub 4}(JCPDS 01-082-1350). TEM image indicated the formation of faceted particles with average particle size 40 nm. From PL spectra, a broad emission band obtained at about 450 nm attributes to 4f{sup 6} 5d → 4f{sup 7} transition of Eu{sup 2+} which lies in the blue region of the visible spectrum.

  1. Dynamics of the CRRES barium releases in the magnetosphere

    NASA Technical Reports Server (NTRS)

    Fuselier, S. A.; Mende, S. B.; Geller, S. P.; Miller, M.; Hoffman, R. A.; Wygant, J. R.; Pongratz, M.; Meredith, N. P.; Anderson, R. R.

    1994-01-01

    The Combined Release and Radiation Effects Satellite (CRRES) G-2, G-3, and G-4 ionized and neutral barium cloud positions are triangulated from ground-based optical data. From the time history of the ionized cloud motion perpendicular to the magnetic field, the late time coupling of the ionized cloud with the collisionless ambient plasma in the magnetosphere is investigated for each of the releases. The coupling of the ionized clouds with the ambient medium is quantitatively consistent with predictions from theory in that the coupling time increases with increasing distance from the Earth. Quantitative comparison with simple theory for the couping time also yields reasonable agreement. Other effects not predicted by the theory are discussed in the context of the observations.

  2. Pulsating aurora induced by upper atmospheric barium releases

    NASA Technical Reports Server (NTRS)

    Deehr, C.; Romick, G.

    1977-01-01

    The paper reports the apparent generation of pulsating aurora by explosive releases of barium vapor near 250 km altitude. This effect occurred only when the explosions were in the path of precipitating electrons associated with the visible aurora. Each explosive charge was a standard 1.5 kg thermite mixture of Ba and CuO with an excess of Ba metal which was vaporized and dispersed by the thermite explosion. Traces of Sr, Na, and Li were added to some of the charges, and monitoring was achieved by ground-based spectrophotometric observations. On March 28, 1976, an increase in emission at 5577 A and at 4278 A was observed in association with the first two bursts, these emissions pulsating with roughly a 10 sec period for approximately 60 to 100 sec after the burst.

  3. Dielectric behavior of barium modified strontium bismuth titanate ceramic

    SciTech Connect

    Nayak, P.; Badapanda, T.; Anwar, S.; Panigrahi, S.

    2014-04-24

    Barium Modified Strontium Bismuth Titanate(SBT) ceramic with general formula Sr1−xBaxBi4Ti4O15 is prepared by solid state reaction route. The structural analysis of the ceramics was done by X-ray diffraction technique. The X-ray patterns show that all the compositions are of single phase with orthorhombic structure. The temperature dependent dielectric behavior shows that the transition temperature decreases with Ba content but the maximum dielectric constant increases. The decreases of the transition with increase in Ba{sup 2+} ion, may be due to the decrease of orthorhombicity by the incorporation of Ba{sup 2+} ion in SBT lattice.

  4. Structural and magnetic properties of barium-gadolinium hexaferrites

    NASA Astrophysics Data System (ADS)

    Litsardakis, G.; Manolakis, I.; Serletis, C.; Efthimiadis, K. G.

    A series of Gd-substituted M-type barium hexaferrites has been prepared by the ceramic route, according to the formula (Ba 1-xGd x)O·5.25Fe 2O 3 ( x=0-0.30). XRD analysis revealed that all the samples present primarily an M-type structure. Samples x=0 and x=0.05 are single-phase. Hematite (Fe 2O 3) and GdFeO 3 were detected in the remaining samples. Coercivity ( Hc) shows remarkably high values, ˜293 kA/m for x=0.20 and 0.30 with a maximum of 322 kA/m for x=0.25. Specific saturation magnetization ( σsat) of the samples presents a small increase up to x=0.10. The microstructure examination indicates that Gd may act as a grain growth inhibitor.

  5. Barium titanate nanocomposite capacitor FY09 year end report.

    SciTech Connect

    Stevens, Tyler E.; DiAntonio, Christopher Brian; Yang, Pin; Chavez, Tom P.; Winter, Michael R.; Monson, Todd C.; Roesler, Alexander William; Fellows, Benjamin D.

    2009-11-01

    This late start RTBF project started the development of barium titanate (BTO)/glass nanocomposite capacitors for future and emerging energy storage applications. The long term goal of this work is to decrease the size, weight, and cost of ceramic capacitors while increasing their reliability. Ceramic-based nanocomposites have the potential to yield materials with enhanced permittivity, breakdown strength (BDS), and reduced strain, which can increase the energy density of capacitors and increase their shot life. Composites of BTO in glass will limit grain growth during device fabrication (preserving nanoparticle grain size and enhanced properties), resulting in devices with improved density, permittivity, BDS, and shot life. BTO will eliminate the issues associated with Pb toxicity and volatility as well as the variation in energy storage vs. temperature of PZT based devices. During the last six months of FY09 this work focused on developing syntheses for BTO nanoparticles and firing profiles for sintering BTO/glass composite capacitors.

  6. Spray Rolling Aluminum Strip

    SciTech Connect

    Lavernia, E.J.; Delplanque, J-P; McHugh, K.M.

    2006-05-10

    Spray forming is a competitive low-cost alternative to ingot metallurgy for manufacturing ferrous and non-ferrous alloy shapes. It produces materials with a reduced number of processing steps, while maintaining materials properties, with the possibility of near-net-shape manufacturing. However, there are several hurdles to large-scale commercial adoption of spray forming: 1) ensuring strip is consistently flat, 2) eliminating porosity, particularly at the deposit/substrate interface, and 3) improving material yield. Through this program, a new strip/sheet casting process, termed spray rolling, has been developed, which is an innovative manufacturing technique to produce aluminum net-shape products. Spray rolling combines the benefits of twin-roll casting and conventional spray forming, showing a promising potential to overcome the above hurdles associated with spray forming. Spray rolling requires less energy and generates less scrap than conventional processes and, consequently, enables the development of materials with lower environmental impacts in both processing and final products. Spray Rolling was developed as a collaborative project between the University of California-Davis, the Colorado School of Mines, the Idaho National Engineering and Environmental Laboratory, and an industry team. The following objectives of this project were achieved: (1) Demonstration of the feasibility of the spray rolling process at the bench-scale level and evaluation of the materials properties of spray rolled aluminum strip alloys; and (2) Demonstration of 2X scalability of the process and documentation of technical hurdles to further scale up and initiate technology transfer to industry for eventual commercialization of the process.

  7. Aluminum toxicity. Hematological effects.

    PubMed

    Mahieu, S; del Carmen Contini, M; Gonzalez, M; Millen, N; Elias, M M

    2000-01-01

    Sequential effects of intoxication with aluminum hydroxide (Al) (80 mg/Kg body weight, i.p., three times a week), were studied on rats from weaning and up to 28 weeks. The study was carried out on hematological and iron metabolism-related parameters on peripheral blood, at the end of the 1st, 2nd, 3rd, 4th, 5th and 6th months of exposure. As it was described that hematotoxic effects of Al are mainly seen together with high levels of uremia, renal function was measured at the same periods. The animals treated developed a microcytosis and was accompanied by a decrease in mean corpuscular hemoglobin (MCH). Significantly lower red blood cell counts (RBC million/microl) were found in rats treated during the 1st month. These values matched those obtained for control rats during the 2nd month. From the 3rd month onwards, a significant increase was observed as compared to control groups, and the following values were obtained by the 6th month: (T) 10.0 +/- 0.3 versus (C) 8.7 +/- 0.2 (million/microl). Both MCH and mean corpuscular volume (MCV) were found to be significantly lower in groups treated from the 2nd month. At the end of the 6th month the following values were found: MCH (T) 13.3 +/- 0.1 versus (C) 16.9 +/- 0.3 (pg); MCV (T) 42.1 +/- 0.7 versus (C) 51.8 +/- 0.9 (fl). Al was found responsible for lower serum iron concentration levels and in the percentage of transferrin saturation. Thus, although microcytic anemia constitutes an evidence of chronic aluminum exposure, prolonged exposure could lead to a recovery of hematocrit and hemoglobin concentration values with an increase in red cell number. Nevertheless, both microcytosis and the decrease of MCH would persist. These modifications took place without changes being observed in the renal function during the observation period. PMID:10643868

  8. Aluminum: Industry of the future

    SciTech Connect

    1998-11-01

    For over a century, the US aluminum industry has led the global market with advances in technology, product development, and marketing. Industry leaders recognize both the opportunities and challenges they face as they head into the 21st century, and that cooperative R and D is key to their success. In a unique partnership, aluminum industry leaders have teamed with the US Department of Energy`s Office of Industrial Technologies (OIT) to focus on innovative technologies that will help to strengthen the competitive position of the US aluminum industry and, at the same time, further important national goals. This industry-led partnership, the Aluminum Industry of the Future, promotes technologies that optimize the use of energy and materials in operations and reduce wastes and energy-related emissions. Led by The Aluminum Association, industry leaders began by developing a unified vision of future market, business, energy, and environmental goals. Their vision document, Partnerships for the Future, articulates a compelling vision for the next 20 years: to maintain and grow the aluminum industry through the manufacture and sale of competitively priced, socially desirable, and ecologically sustainable products. Continued global leadership in materials markets will require the combined resources of industry, universities, and government laboratories. By developing a unified vision, the aluminum industry has provided a framework for the next step in the Industries of the Future process, the development of a technology roadmap designed to facilitate cooperative R and D.

  9. Brillouin function characteristics for La-Co substituted barium hexaferrites

    SciTech Connect

    Wu, Chuanjian E-mail: ksun@uestc.edu.cn; Yu, Zhong; Sun, Ke E-mail: ksun@uestc.edu.cn; Guo, Rongdi; Jiang, Xiaona; Lan, Zhongwen; Yang, Yan

    2015-09-14

    La-Co substituted barium hexaferrites with the chemical formula of Ba{sub 1−x}La{sub x}Fe{sub 12−x}Co{sub x}O{sub 19} (x = 0.0, 0.1, 0.3, and 0.5), prepared by a conventional ceramic method, were systematically investigated by Raman spectra, X-ray photoelectron spectroscopy, Rietveld refinement of X-ray diffraction patterns, and vibrating sample magnetometer. The result manifests that all the compounds are crystallized in magnetoplumbite hexagonal structure. Trivalent cobalt ions prevailingly occupy the 2a, 4f{sub 1}, and 12k sites. According to Néel model of collinear-spin ferrimagnetism, the molecular-field coefficients ω{sub bf2}, ω{sub kf1}, ω{sub af1}, ω{sub kf2}, and ω{sub bk} of La-Co substituted barium hexaferrites have been calculated using the nonlinear fitting method, and the magnetic moment of five sublattices (2a, 2b, 4f{sub 1}, 4f{sub 2}, and 12k) versus temperature T has been also investigated. The fitting results are coincided well with the experimental data. Moreover, with the increase of La-Co substitution amount x, the molecular-field coefficients ω{sub bf2} and ω{sub af1} decrease constantly, while the molecular-field coefficients ω{sub kf1}, ω{sub kf2}, and ω{sub bk} show a slight change.

  10. CALCIUM ISOTOPE COMPOSITION OF METEORITES, EARTH, AND MARS

    SciTech Connect

    Simon, Justin I.; DePaolo, Donald J.; Moynier, Frederic

    2009-09-01

    The relative abundances of calcium isotopes in the mass range 40-44 were measured in primitive and differentiated meteorites and igneous rocks from Earth and Mars in search of non-mass-dependent variations that could provide clues about early solar system processes. Most bulk samples of planetary materials have calcium isotopic compositions identical with Earth's within the current resolution of about 0.01% in {sup 40}Ca/{sup 44}Ca. Possible exceptions include carbonaceous chondrites, some ordinary chondrites, and two samples of calcium-aluminum-rich inclusions, which have small excesses of {sup 40}Ca. The samples with {sup 40}Ca excesses are also known to have {sup 50}Ti and {sup 135}Ba excesses and {sup 142}Nd and {sup 144}Sm deficits. Collectively these data from refractory elements suggest that the planetary embryos represented by chondrites preserve isotopic heterogeneity that reflects different nucleosynthetic sources. No late admixture from a single nucleosynthetic source can explain all observations. The results are most compatible with variable proportions of material derived from Type II supernovae. The initial calcium isotope compositions of Earth and Mars are indistinguishable and similar to the {sup 40}Ca abundance found in some chondrites and all differentiated meteorites studied. It appears that isotopic heterogeneity in calcium was still present at the completion of disk formation but was homogenized during planetary accretion.

  11. Modelling of calcium phosphates

    NASA Astrophysics Data System (ADS)

    Calderin Hidalgo, Lazaro Juan

    This work is a contribution to a large scale joint experimental and theoretical effort to understand the biological properties of silicon doped calcium phosphates undertaken by Queen's University and Millenium Biologix Corp. We have modeled calcium phosphates and silicon doped calcium phosphates in close relation to experiment in order to study possible location of silicon in the lattice. Density functional theory has been used to study the structural and dynamical properties of small systems of calcium phosphates to gain preliminary information on phosphates and the performance of the theoretical methods. The same methods were used to investigate structural and electronic properties of larger scale calcium phosphate systems, while a classical shell model was developed to investigate the dynamical properties of such large and complex systems. In the context of the shell model a method was devised to calculate the dynamical matrix corrected for the long range Coulomb interaction in the long wave length limit. It was necessary also to develop a theoretical expression for the dielectric function in the context of the shell model. Infrared spectra and thermal parameters were calculated based on these methods. We also propose some directions for future research.

  12. Subsurface Aluminum Nitride Formation in Iron-Aluminum Alloys

    NASA Astrophysics Data System (ADS)

    Bott, June H.

    Transformation-induced plasticity (TRIP) steels containing higher amounts of aluminum than conventional steels are ideal for structural automotive parts due to their mechanical properties. However, the aluminum tends to react with any processing environment at high temperatures and therefore presents significant challenges during manufacturing. One such challenge occurs during secondary cooling, reheating, and hot-rolling and is caused by a reaction with nitrogen-rich atmospheres wherein subsurface aluminum nitride forms in addition to internal and external oxides. The nitrides are detrimental to mechanical properties and cause surface cracks. It is important to understand how these nitrides and oxides form and their consequences for the quality of steel products. This study looks at model iron-aluminum (up to 8 wt.% aluminum) alloys and uses confocal laser scanning microscopy, x-ray diffraction, scanning electron microscopy with energy dispersive x-ray spectrometry, and transmission electron microscopy to study the effect of various conditions on the growth and development of these precipitates in a subsurface oxygen-depleted region. By using model alloys and controlling the experimental atmosphere, this study is able to understand some of the more fundamental materials science behind aluminum nitride formation in aluminum-rich iron alloys and the relationship between internal nitride and oxide precipitation and external oxide scale morphology and composition. The iron-aluminum alloys were heated in N2 atmospheres containing oxygen impurities. It was found that nitrides formed when bulk aluminum content was below 8 wt.% when oxygen was sufficiently depleted due to the internal oxidation. In the samples containing 1 wt.% aluminum, the depth of the internal oxide and nitride zones were in agreement with a diffusion-based model. Increasing aluminum content to 3 and 5 wt% had the effects of modifying the surface-oxide scale composition and increasing its continuity

  13. [Microbiological corrosion of aluminum alloys].

    PubMed

    Smirnov, V F; Belov, D V; Sokolova, T N; Kuzina, O V; Kartashov, V R

    2008-01-01

    Biological corrosion of ADO quality aluminum and aluminum-based construction materials (alloys V65, D16, and D16T) was studied. Thirteen microscopic fungus species and six bacterial species proved to be able to attack aluminum and its alloys. It was found that biocorrosion of metals by microscopic fungi and bacteria was mediated by certain exometabolites. Experiments on biocorrosion of the materials by the microscopic fungus Alternaria alternata, the most active biodegrader, demonstrated that the micromycete attack started with the appearance of exudate with pH 8-9 on end faces of the samples. PMID:18669265

  14. Plasma Source Ion Implantation of Aluminum and Aluminum Alloys

    NASA Astrophysics Data System (ADS)

    Walter, Kevin Carl

    Three plasma source ion implantation (PSII) schemes applied to three aluminum systems have been studied. Pure aluminum, and aluminum alloys 7075 (Al-Cu-Mg-Zn) and A390 (Al-17Si-Cu-Fe) were (1) argon ion sputter-cleaned and nitrogen-implanted, (2) nitrogen-implanted without sputter -cleaning, and (3) argon-implanted. Nitrogen implantation was performed with the goal of modifying the surface properties by transformation of the surface to aluminum-nitride. Argon implantation was performed with the goal of modifying the surface properties by inducing radiation damage. All implantation schemes were accomplished using a glow discharge mode of the PSII process. Implanted surfaces were investigated using Auger depth profiling and Transmission Electron Microscopy. The profiles indicated a stoichiometric layer, ~ 0.15 μm thick, of AlN on the nitrogen-implanted samples. Electron microscopy confirmed the complete conversion of the aluminum surface to AlN. Knoop microhardness tests showed an increase in surface hardness, especially at low loads. The improvements were independent of prior sputter-cleaning and were approximately equal for the studied aluminum systems. Pin-on-disk wear tests were conducted using a ruby stylus and isopropanol lubrication. Argon implantation decreased the wear resistance of pure aluminum and 7075. Nitrogen implantation improved the wear rates by a factor of ~10 for pure aluminum and 7075. These improvements were independent of prior sputter-cleaning. The coefficient of friction was not significantly influenced by the implantation schemes. Due to a coarse microstructure, tribological tests of ion-implanted A390 were inconclusive. Corrosion studies performed in a 3.5 wt% NaCl solution (seawater) indicated nitrogen implantation gave pure aluminum improved corrosion resistance. The improvement is due to the complete conversion of the aluminum surface to AlN. Because of pre-existing precipitates, the corrosion properties of 7075 and A390 were not

  15. PREPARATION OF URANIUM-ALUMINUM ALLOYS

    DOEpatents

    Moore, R.H.

    1962-09-01

    A process is given for preparing uranium--aluminum alloys from a solution of uranium halide in an about equimolar molten alkali metal halide-- aluminum halide mixture and excess aluminum. The uranium halide is reduced and the uranium is alloyed with the excess aluminum. The alloy and salt are separated from each other. (AEC)

  16. Raman Gain Coefficient of Barium Nitrate Measured for the Spectral Region of TI:SAPPHIRE Laser

    NASA Astrophysics Data System (ADS)

    Lisinetskii, V. A.; Mishkel', I. I.; Chulkov, R. V.; Grabtchikov, A. S.; Apanasevich, P. A.; Eichler, H.-J.; Orlovich, V. A.

    We report the measurements of the Raman gain coefficient for a barium nitrate crystal in the spectral region of a Ti:Sapphire laser using Raman amplification. The experimentally-obtained data are well described by the known empirical formula.

  17. The value of the preoperative barium-enema examination in the assessment of pelvic masses

    SciTech Connect

    Gedgaudas, R.K.; Kelvin, F.M.; Thompson, W.M.; Rice, R.P.

    1983-03-01

    The value of the barium-enema examination in the assessment of pelvic masses was studied in 44 patients. Findings from those barium-enema examinations and from pathological specimens from 37 patients who had malignant tumors and seven patients who had endometriosis were retrospectively analyzed to determine if the barium-enema examination is useful in differentiating extrinsic lesions with and without invasion of the colon. None of the 12 patients who had extrinsic lesions had any of the criteria that indicated bowel-wall invasion. These criteria included fixation and serrations of the bowel wall in all patients with invasion, and ulceration and fistulizaton in those patients who had complete transmural invasion. In patients with pelvic masses, the preoperative barium-enema examination may be useful to the surgeon in planning surgery and in preparing the patient for the possibility of partial colectomy or colostomy.

  18. Numberical simulation of the effects of radially injected barium plasma in the ionosphere

    NASA Technical Reports Server (NTRS)

    Swift, D. W.

    1985-01-01

    The morphology of the ion cloud in the radial shaped charge barium injection was studied. The shape of the ion cloud that remains after the explosive products and neutral barium clears away was examined. The ion cloud which has the configuration of a rimless wagon wheel is shown. The major features are the 2.5 km radius black hole in the center of the cloud, the surrounding ring of barium ion and the spokes of barium ionization radiating away from the center. The cloud shows no evolution after it emerges from the neutral debris and it is concluded that it is formed within 5 seconds of the event. A numerical model is used to calculate the motion of ions and electrons subject to the electrostatic and lorenz forces.

  19. Gravimetric Determination of Calcium as Calcium Carbonate Hydrate.

    ERIC Educational Resources Information Center

    Henrickson, Charles H.; Robinson, Paul R.

    1979-01-01

    The gravimetric determination of calcium as calcium carbonate is described. This experiment is suitable for undergraduate quantitative analysis laboratories. It is less expensive than determination of chloride as silver chloride. (BB)

  20. Effect of dendroaspis natriuretic peptide (DNP) on L-type calcium channel current and its pathway.

    PubMed

    Zhang, Shu-Ying; Cai, Zheng-Xu; Li, Ping; Cai, Chun-Yu; Qu, Cheng-Long; Guo, Hui-Shu

    2010-09-24

    Dendroaspis natriuretic peptide (DNP), a newly-described natriuretic peptide, relaxes gastrointestinal smooth muscle. L-type calcium channel currents play an important role in regulating smooth muscle contraction. The effect of DNP on L-type calcium channel currents in gastrointestinal tract is still unclear. This study was designed to investigate the effect of DNP on barium current (I(Ba)) through the L-type calcium channel in gastric antral myocytes of guinea pigs and cGMP-pathway mechanism. The whole-cell patch-clamp technique was used to record L-type calcium channel currents. The content of cGMP in guinea pig gastric antral smooth muscle and perfusion solution was measured using radioimmunoassay. DNP markedly enhanced cGMP levels in gastric antral smooth muscle tissue and in perfusion medium. DNP concentration-dependently inhibited I(Ba) in freshly isolated guinea pig gastric antral circular smooth muscle cells (SMCs) of guinea pigs. DNP-induced inhibition of I(Ba) was partially blocked by LY83583, an inhibitor of guanylate cyclase. KT5823, a cGMP-dependent protein kinase (PKG) inhibitor, almost completely blocked DNP-induced inhibition of I(Ba). However, DNP-induced inhibition of I(Ba) was potentiated by zaprinast, an inhibitor of cGMP-sensitive phosphodiesterase. Taken together, DNP inhibits L-type calcium channel currents via pGC-cGMP-PKG-dependent signal pathway in gastric antral myocytes of guinea pigs. PMID:20594955