Science.gov

Sample records for interstitial acochlidian gastropod

  1. MICROANATOMY, ULTRASTRUCTURE, AND SYSTEMATIC SIGNIFICANCE OF THE EXCRETORY SYSTEM AND MANTLE CAVITY OF AN ACOCHLIDIAN GASTROPOD (OPISTHOBRANCHIA).

    PubMed

    Fahrner, A.; Haszprunar, G.

    2002-05-01

    The microanatomy and ultrastructure of the excretory system of an undescribed mesopsammic gastropod of the genus Hedylopsis have been examined by means of semithin serial sections, reconstructions, and transmission electron microscopy. The functional metanephridial system comprises a monotocardian heart with a single ventricle and auricle in a spacious pericardium as well as a single, large kidney. Podocytes in the auricular epicardium represent the site of ultrafiltration and formation of the primary urine, whereas the flat epithelium of the kidney with extensive basal infoldings, large vacuoles and the apical microvillous border indicates modification of the primary filtrate. Solitary rhogocytes (pore cells) represent additional loci of ultrafiltration with an identical fine-structure as those of the podocytes (meandering slits with diaphragms covered by extracellular matrix). The presence of podocytes situated in the epicardial wall of the auricle is regarded as plesiomorphic for the Opisthobranchia and is confirmed for the Acochlidia for the first time. Kidney and rectum both open into a small, yet distinct mantle cavity. Within the Acochlidia this condition represents a plesiomorphic character only known from one further Hedylopsis species until now. Special cells (here termed microvillous pit-cells) with a presumed absorptive function are interspersed between the epithelial cells of the mantle cavity. They are mainly characterized by a prominent invagination of the apical border with densely arranged, very large microvilli. The presence of a mantle cavity that has been lost in all other acochlidian genera supports the systematic placement of the Hedylopsidae at the base of the Achochlidia. PMID:12011235

  2. On the origin of Acochlidia and other enigmatic euthyneuran gastropods, with implications for the systematics of Heterobranchia

    PubMed Central

    2010-01-01

    Background A robust phylogenetic hypothesis of euthyneuran gastropods, as a basis to reconstructing their evolutionary history, is still hindered by several groups of aberrant, more or less worm-like slugs with unclear phylogenetic relationships. As a traditional "order" in the Opisthobranchia, the Acochlidia have a long history of controversial placements, among others influenced by convergent adaptation to the mainly meiofaunal habitats. The present study includes six out of seven acochlidian families in a comprehensive euthyneuran taxon sampling with special focus on minute, aberrant slugs. Since there is no fossil record of tiny, shell-less gastropods, a molecular clock was used to estimate divergence times within Euthyneura. Results Our multi-locus molecular study confirms Acochlidia in a pulmonate relationship, as sister to Eupulmonata. Previous hypotheses of opisthobranch relations, or of a common origin with other meiofaunal Euthyneura, are clearly rejected. The enigmatic amphibious and insectivorous Aitengidae incerta sedis clusters within Acochlidia, as sister to meiofaunal and brackish Pseudunelidae and limnic Acochlidiidae. Euthyneura, Opisthobranchia and Pulmonata as traditionally defined are non-monophyletic. A relaxed molecular clock approach indicates a late Palaeozoic diversification of Euthyneura and a Mesozoic origin of the major euthyneuran diversity, including Acochlidia. Conclusions The present study shows that the inclusion of small, enigmatic groups is necessary to solve deep-level phylogenetic relationships, and underlines that "pulmonate" and "opisthobranch" phylogeny, respectively, cannot be solved independently from each other. Our phylogenetic hypothesis requires reinvestigation of the traditional classification of Euthyneura: morphological synapomorphies of the traditionally defined Pulmonata and Opisthobranchia are evaluated in light of the presented phylogeny, and a redefinition of major groups is proposed. It is demonstrated that

  3. Interstitial Nephritis

    MedlinePlus

    ... rye-tus) is a kidney disorder. The kidneys filter waste and extra fluid from the body. Interstitial nephritis reduces the kidneys’ ability to filter properly. Interstitial nephritis is a serious condition, but ...

  4. [Gastropods associated with the calcareous alga Halimeda opuntia (Udoteaceae) in Puerto Rico].

    PubMed

    García-Ríos, Cedar I; Soto-Santiago, Francisco J; Colón-Rivera, Ricardo J; Medina-Hernández, Javier R

    2008-12-01

    Gastropod communities associated with the calcareous green alga Halimeda opuntia are described and compared for two Puerto Rico coral reefs: one in the northeast with front tradewinds (windward zone) and one in the southwest (leeward zone). We analyzed the content of 21 lots (2432 g) of H. opuntia from leeward zone and 15 lots (2448 g) from the windward zone. In total we recovered 526 gastropods (prosobranchs) classified in 54 taxa. Thirteen species of gastropods represented 79.6% of the community. Differences between species richness and mean density values were not significant (p > 0.100). Forty species were identified from leeward and thirty one (31) species from windward. Gastropod mean density was 13.9/100 g of algae in leeward and 7.6/100 g in windward. Significant differences were found for the Simpson Diversity Index (0.91 in the leeward and 0.82 in the windward community; t = 3.44, alpha = 0.005). We found no correlation between the weight of the algae and the frequency of the gastropods (R2 = 0.0893 in leeward, 0.0249 windward and 0.0923 for both). The relationship between species composition in lots of windward and leeward study sites was explored via polar ordination and no segregation was found. When compared, the gastropod communities found in H. opuntia collected in coral reefs in Puerto Rico were more similar within them than any other communities found in other genera of seaweed and in other environments. Our results agree with the hypothesis that H. opuntia offers the interstitial community a protected microhabitat from water movement impact. H. opuntia creates more homogenous conditions than those of the habitat where we found the algae. PMID:19419075

  5. Interstitial keratitis

    MedlinePlus

    ... cornea. This condition is often caused by infections. Syphilis is the most common cause of interstitial keratitis, ... Tuberculosis In the United States, most cases of syphilis are recognized and treated before this eye condition ...

  6. Fracture Mitigation Strategies in Gastropod Shells

    NASA Astrophysics Data System (ADS)

    Salinas, Christopher; Kisailus, David

    2013-04-01

    For hundreds of millions of years, gastropods have been evolving, modifying their external calcified shells for defense against shell-breaking and drilling predators. They have evolved primarily to use two different aragonitic microstructures: the evolutionary older Nacre (mother of pearl) structure and the more recently developed crossed-lamellar structure. By using both of these structures, gastropods are able to produce shells that are significantly tougher then geologic aragonite. However, the crossed-lamellar structure allows for a wider variety of shell morphologies, ensuring its increasing presence since the Mesozoic Marine Revolution more than 200 million years ago.

  7. Gastropod Seed Dispersal: An Invasive Slug Destroys Far More Seeds in Its Gut than Native Gastropods

    PubMed Central

    Blattmann, Tamara; Boch, Steffen; Türke, Manfred; Knop, Eva

    2013-01-01

    Seed dispersal is one of the most important mechanisms shaping biodiversity, and animals are one of the key dispersal vectors. Animal seed dispersal can directly or indirectly be altered by invasive organisms through the establishment of new or the disruption of existing seed dispersal interactions. So far it is known for a few gastropod species that they ingest and defecate viable plant seeds and consequently act as seed dispersers, referred to as gastropodochory. In a multi-species experiment, consisting of five different plant species and four different gastropod species, we tested with a fully crossed design whether gastropodochory is a general mechanism across native gastropod species, and whether it is altered by the invasive alien slug species Arion lusitanicus. Specifically, we hypothesized that a) native gastropod species consume the seeds from all tested plant species in equal numbers (have no preference), b) the voracious invasive alien slug A. lusitanicus – similarly to its herbivore behaviour – consumes a higher amount of seeds than native gastropods, and that c) seed viability is equal among different gastropod species after gut passage. As expected all tested gastropod species consumed all tested plant species. Against our expectation there was a difference in the amount of consumed seeds, with the largest and native mollusk Helix pomatia consuming most seeds, followed by the invasive slug and the other gastropods. Seed damage and germination rates did not differ after gut passage through different native species, but seed damage was significantly higher after gut passage through the invasive slug A. lusitanicus, and their germination rates were significantly reduced. PMID:24086477

  8. Interstitial cystitis - resources

    MedlinePlus

    Resources - interstitial cystitis ... The following organizations are good resources for information on interstitial cystitis : Interstitial Cystitis Association -- www.ichelp.org National Kidney and Urologic Diseases Information Clearinghouse -- www.kidney.niddk. ...

  9. Childhood Interstitial Lung Disease

    MedlinePlus

    ... from the NHLBI on Twitter. What Is Childhood Interstitial Lung Disease? Childhood interstitial (in-ter-STISH-al) lung disease, ... with similar symptoms—it's not a precise diagnosis. Interstitial lung disease (ILD) also occurs in adults. However, the cause ...

  10. Could gastropods crawl using Newtonian mucus?

    NASA Astrophysics Data System (ADS)

    Lai, Janice; Vazquez-Torres, Maria; Del Alamo, Juan C.; Rodriguez-Rodriguez, Javier; Lasheras, Juan C.

    2010-11-01

    The locomotion of terrestrial gastropods is driven by a train of periodic muscle contractions (pedal waves) and relaxations (interwaves) that propagate from their tail to their head (direct waves). We study the locomotion of these animals on smooth flat surfaces by measuring the three-dimensional displacements of the ventral foot surface induced by the passage of the waves. A simple model based on lubrication theory is proposed in accordance with the experimental observations. This model uncovers a new mode of locomotion that works even when the lubricant between the foot and the animal is Newtonian. The model can also be adapted to situations where the animal's foot is in contact with the ground only at discrete points, as is the case when it crawls on a wire mesh or on rough soil surfaces. Furthermore, comparison between the stress exerted by the animal on the substrate and the model predictions allows us to clarify the role of the complex rheology observed in the mucus of terrestrial gastropods.

  11. Interstitial Lung Diseases

    MedlinePlus

    Interstitial lung disease is the name for a large group of diseases that inflame or scar the lungs. The inflammation and ... is responsible for some types of interstitial lung diseases. Specific types include Black lung disease among coal ...

  12. Phylogenomic analyses of deep gastropod relationships reject Orthogastropoda

    PubMed Central

    Zapata, Felipe; Wilson, Nerida G.; Howison, Mark; Andrade, Sónia C. S.; Jörger, Katharina M.; Schrödl, Michael; Goetz, Freya E.; Giribet, Gonzalo; Dunn, Casey W.

    2014-01-01

    Gastropods are a highly diverse clade of molluscs that includes many familiar animals, such as limpets, snails, slugs and sea slugs. It is one of the most abundant groups of animals in the sea and the only molluscan lineage that has successfully colonized land. Yet the relationships among and within its constituent clades have remained in flux for over a century of morphological, anatomical and molecular study. Here, we re-evaluate gastropod phylogenetic relationships by collecting new transcriptome data for 40 species and analysing them in combination with publicly available genomes and transcriptomes. Our datasets include all five main gastropod clades: Patellogastropoda, Vetigastropoda, Neritimorpha, Caenogastropoda and Heterobranchia. We use two different methods to assign orthology, subsample each of these matrices into three increasingly dense subsets, and analyse all six of these supermatrices with two different models of molecular evolution. All 12 analyses yield the same unrooted network connecting the five major gastropod lineages. This reduces deep gastropod phylogeny to three alternative rooting hypotheses. These results reject the prevalent hypothesis of gastropod phylogeny, Orthogastropoda. Our dated tree is congruent with a possible end-Permian recovery of some gastropod clades, namely Caenogastropoda and some Heterobranchia subclades. PMID:25232139

  13. Invasion of Impatiens glandulifera affects terrestrial gastropods by altering microclimate

    NASA Astrophysics Data System (ADS)

    Ruckli, Regina; Rusterholz, Hans-Peter; Baur, Bruno

    2013-02-01

    Invasive species can have far-reaching impacts on ecosystems. Invasive plants may be able to change habitat structure and quality. We conducted a field experiment to examine whether the invasive plant Impatiens glandulifera affects native terrestrial gastropods. We also evaluated whether the invasive plant alters forest soil characteristics and microclimate which in turn may influence gastropod abundance. We sampled gastropods in plots installed in patches of I. glandulifera, in plots in which I. glandulifera was regularly removed by hand, and in control plots which were not yet colonized by the invasive plant. The three types of plots were equally distributed over three mixed deciduous forest areas that were slightly, moderately or heavily affected by a wind throw 11 years ago. A total of 33 gastropod species were recorded. Gastropod species richness was not affected by delayed effects of the wind throw, but it was significantly higher in invaded plots than in uninvaded plots. Similarly, gastropod abundance was higher in invaded plots than in the two types of control plots. Canonical correspondence analysis revealed marginally significant shifts of gastropod communities between the three types of plots and indicated that soil moisture, presence of I. glandulifera and cover of woody debris affected gastropod species composition. Field measurements showed that soil moisture was higher and daily soil temperature was more damped in patches of I. glandulifera than in the native ground vegetation. The changed microclimatic conditions may favour certain gastropod species. In particular, ubiquitous species and species with a high inundation tolerance increased in abundance in plots invaded by I. glandulifera. Our field experiment demonstrated that an invasive plant can indirectly affect native organisms by changing soil characteristics and microclimate.

  14. Gastropod fauna of the Cameroonian coasts

    NASA Astrophysics Data System (ADS)

    Bandel, K.; Kowalke, T.

    1999-11-01

    Eighteen species of gastropods were encountered living near and within the large coastal swamps, mangrove forests, intertidal flats and the rocky shore of the Cameroonian coast of the Atlantic Ocean. These represent members of the subclasses Neritimorpha, Caenogastropoda, and Heterostropha. Within the Neritimorpha, representatives of the genera Nerita, Neritina, and Neritilia could be distinguished by their radula anatomy and ecology. Within the Caenogastropoda, representatives of the families Potamididae with Tympano-tonos and Planaxidae with Angiola are characterized by their early ontogeny and ecology. The Pachymelaniidae are recognized as an independent group and are introduced as a new family within the Cerithioidea. Littorinimorpha with Littorina, Assiminea and Potamopyrgus as well as Neogastropoda (Thais) and Heterostropha (Melampus and Onchidium) are described and compared with representatives of the Caribbean and Indo-Pacific province.

  15. Cretaceous gastropods: contrasts between tethys and the temperate provinces.

    USGS Publications Warehouse

    Sohl, N.F.

    1987-01-01

    During the Cretaceous Period, gastropod faunas show considerable differences in their evolution between the Tethyan Realm (tropical) and the Temperate Realms to the north and south. Like Holocene faunas, prosobranch, gastropods constitute the dominant part of Cretaceous marine snail faunas. Entomotaeneata and opisthobranchs usually form all of the remainder. In Tethyan faunas the Archaeogastropoda form a consistent high proportion of total taxa but less than the Mesogastropoda throughout the period. In contrast, the Temperate faunas beginning in Albian times show a decline in percentages of archaeogastropod taxa and a significant increase in the Neogastropoda, until they constitute over 50 percent of the taxa in some faunas. The neogastropods never attain high diversity in the Cretaceous of the Tethyan Realm and are judged to be of Temperate Realm origin. Cretaceous Tethyan gastropod faunas are closely allied to those of the 'corallien facies' of the Jurassic and begin the period evolutionarily mature and well diversified. Three categories of Tethyan gastropods are analyzed. The first group consists of those of Jurassic ancestry. The second group orginates mainly during the Barremian and Aptian, reaches a climax in diversification during middle Cretaceous time, and usually declines during the latest Cretaceous. The third group originates late in the Cretaceous and consists of taxa that manage to either survive the Cretaceous-Tertiary crisis or give rise to forms of prominence among Tertiary warm water faunas. Temperate Realm gastropod faunas are less diverse than those of Tethys during the Early Cretaceous. They show a steady increase in diversity, primarily among the Mesogastropoda and Neogastropoda. This trend culminates in latest Cretaceous times when the gastropod assemblages of the clastic provinces of the inner shelf contain an abundance of taxa outstripping that of any other part of the Cretaceous of either realm. Extinction at the Cretaceous

  16. Does energy availability predict gastropod reproductive strategies?

    PubMed Central

    McClain, Craig R.; Filler, Ryan; Auld, Josh R.

    2014-01-01

    The diversity of reproductive strategies in nature is shaped by a plethora of factors including energy availability. For example, both low temperatures and limited food availability could increase larval exposure to predation by slowing development, selecting against pelagic and/or feeding larvae. The frequency of hermaphroditism could increase under low food availability as population density (and hence mate availability) decreases. We examine the relationship between reproductive/life-history traits and energy availability for 189 marine gastropod families. Only larval type was related to energy availability with the odds of having planktotrophic larvae versus direct development decreasing by 1% with every one-unit increase in the square root of carbon flux. Simultaneous hermaphroditism also potentially increases with carbon flux, but this effect disappears when accounting for evolutionary relationships among taxa. Our findings are in contrast to some theory and empirical work demonstrating that hermaphroditism should increase and planktotrophic development should decrease with decreasing productivity. Instead, they suggest that some reproductive strategies are too energetically expensive at low food availabilities, or arise only when energy is available, and others serve to capitalize on opportunities for aggregation or increased energy availability. PMID:25009058

  17. Does energy availability predict gastropod reproductive strategies?

    PubMed

    McClain, Craig R; Filler, Ryan; Auld, Josh R

    2014-08-22

    The diversity of reproductive strategies in nature is shaped by a plethora of factors including energy availability. For example, both low temperatures and limited food availability could increase larval exposure to predation by slowing development, selecting against pelagic and/or feeding larvae. The frequency of hermaphroditism could increase under low food availability as population density (and hence mate availability) decreases. We examine the relationship between reproductive/life-history traits and energy availability for 189 marine gastropod families. Only larval type was related to energy availability with the odds of having planktotrophic larvae versus direct development decreasing by 1% with every one-unit increase in the square root of carbon flux. Simultaneous hermaphroditism also potentially increases with carbon flux, but this effect disappears when accounting for evolutionary relationships among taxa. Our findings are in contrast to some theory and empirical work demonstrating that hermaphroditism should increase and planktotrophic development should decrease with decreasing productivity. Instead, they suggest that some reproductive strategies are too energetically expensive at low food availabilities, or arise only when energy is available, and others serve to capitalize on opportunities for aggregation or increased energy availability. PMID:25009058

  18. Interstitial Lung Diseases

    MedlinePlus

    Interstitial lung disease is the name for a large group of diseases that inflame or scar the lungs. The inflammation and scarring make it hard to ... air is responsible for some types of interstitial lung diseases. Specific types include Black lung disease among ...

  19. ‘Clumped isotopes’ thermometry in land gastropod carbonate shells

    NASA Astrophysics Data System (ADS)

    Zaarur, S.; Affek, H. P.

    2009-12-01

    The carbonate ‘clumped isotope’ (Δ47) thermometer is based on the dependence of the abundance of 13C-18O bonds in carbonates on the carbonate formation temperature. We repeated at higher analytical precision the original thermometer calibration experiments of Ghosh et al., (2006) using carbonates precipitated synthetically by slow degassing of CO2 from saturated Ca(HCO3)2 solutions at a temperature range of 8°C to 70°C. Our data fall within error of the original calibration and generally confirms it. However, the samples precipitated at lower temperatures are slightly shifted, forming a line with a lower slope, fitting better the theoretical calibration thermometer predicted by Guo et al., (in press). We tested the Δ47 thermometer in land gastropods (snails) by analyzing modern gastropod shells from various geographical locations in comparison to the gastropods’ growing season temperatures. No significant inhomogeneity was observed within an individual shell. Segments growing at different stages in the gastropods’ life (e.g., inner part of the helix reflecting young gastropod growth and outer shell that grew at older gastropod age) revealed no significant variations within a specimen in either Δ47 or δ18O, whereas δ13C varied significantly (0.5 ‰) implying a change in the gastropods’ food source. Inter-species comparison revealed significant δ13C and δ18O variations among specimens collected at the same location (Sphincterochila zonata and Trochoidea simulate, south Israel, and Pleurodonte acuta and Orthalicus undutus, Jamaica) but no significant interspecies variations in Δ47, providing a strong indication for carbonate precipitation in isotopic equilibrium. Gastropod shells do not grow year-round, with most gastropods being dormant during dry cold seasons. ‘Clumped isotopes’ values are therefore expected to record the temperature of the gastropods’ growth season. Hence gastropod ecology and preferred growth conditions has to be taken

  20. Annotated Checklist of the Terrestrial Gastropods of Nepal

    PubMed Central

    Budha, Prem B.; Naggs, Fred; Backeljau, Thierry

    2015-01-01

    Abstract This is the very first checklist of the terrestrial gastropods of Nepal. It includes 138 species and six subspecies, of which 22 species are endemic and four are introduced. It highlights 34 species recorded for the first time in Nepal and provides new distribution records for another 30 species. PMID:25878541

  1. Density estimates for deep-sea gastropod assemblages

    NASA Astrophysics Data System (ADS)

    Rex, Michael A.; Etter, Ron J.; Nimeskern, Phillip W.

    1990-04-01

    Extensive boxcore sampling in the Atlantic Continental Slope and Rise study permitted the first precise measurement of gastropod density in the bathyal region of the deep sea. Gastropod density decreases significantly and exponentially with depth (250-3494 m), and density-depth regression lines do not differ significantly in either slope or elevatiob over horizontal scales of approximately 1000 km. The subclasses Prosobranchia and Opisthobranchia both show significant decreases in density with depth. Predatory taxa (neogastropods and opisthobranchs) exhibit significantly steeper declines in density with depth than do taxa dominated by deposit feeders (archaeogastropods and mesogastropods). Members of upper trophic levels may be more sensitive to the reduction in nutrient input with increased depth because of the energy loss between trophic levels in the food chain. A comparison of density estimates of gastropods from boxcore, grab and anchor-dredge samples taken in the same region revealed no significant differences in density-depth relationships among the sampling methods. A synthesis of data from 777 boxcore samples collected from the Atlantic, Caribbean and Pacific over a depth range of 250-7298 m indicates that the decline in gastropod density with depth is a global trend with only moderate inter-regional variation.

  2. Vermetid gastropods and intertidal reefs in Israel and bermuda.

    PubMed

    Safriel, U N

    1974-12-20

    Small-rimmed intertidal reefs develop in the subtropical marine waters of Israel and Bermuda when erosion of exposed promontories is arrested by vermetid gastropods. The reefs in Bermuda are actively growing, wave-resistant biogenic structures, while those in Israel are limestone structures only encrusted by a relatively thin layer of vermetid shells cemented by coralline algae. PMID:17818625

  3. Pennsylvanian gastropod Pseudozygopleura (Pseudozygopleura) from the Appalachian basin: II

    SciTech Connect

    Hoare, R.E.; Sturgeon, M.T.

    1985-01-01

    Twenty-five additional taxa to those described by Hoare and Sturgeon (1981) of the gastropod Pseudozygopleura (Pseudozygopleura) are described from the Pennsylvania System of the Appalachian Basin. A key for identification of known Pennsylvanian species from this region is included.

  4. Radiocarbon dating of small terrestrial gastropod shells in North America

    USGS Publications Warehouse

    Pigati, J.S.; Rech, J.A.; Nekola, J.C.

    2010-01-01

    Fossil shells of small terrestrial gastropods are commonly preserved in wetland, alluvial, loess, and glacial deposits, as well as in sediments at many archeological sites. These shells are composed largely of aragonite (CaCO3) and potentially could be used for radiocarbon dating, but they must meet two criteria before their 14C ages can be considered to be reliable: (1) when gastropods are alive, the 14C activity of their shells must be in equilibrium with the 14C activity of the atmosphere, and (2) after burial, their shells must behave as closed systems with respect to carbon. To evaluate the first criterion, we conducted a comprehensive examination of the 14C content of the most common small terrestrial gastropods in North America, including 247 AMS measurements of modern shell material (3749 individual shells) from 46 different species. The modern gastropods that we analyzed were all collected from habitats on carbonate terrain and, therefore, the data presented here represent worst-case scenarios. In sum, ~78% of the shell aliquots that we analyzed did not contain dead carbon from limestone or other carbonate rocks even though it was readily available at all sites, 12% of the aliquots contained between 5 and 10% dead carbon, and a few (3% of the total) contained more than 10%. These results are significantly lower than the 20-30% dead carbon that has been reported previously for larger taxa living in carbonate terrain. For the second criterion, we report a case study from the American Midwest in which we analyzed fossil shells of small terrestrial gastropods (7 taxa; 18 AMS measurements; 173 individual shells) recovered from late-Pleistocene sediments. The fossil shells yielded 14C ages that were statistically indistinguishable from 14C ages of well-preserved plant macrofossils from the same stratum. Although just one site, these results suggest that small terrestrial gastropod shells may behave as closed systems with respect to carbon over geologic

  5. Pulmonary interstitial emphysema.

    PubMed Central

    Greenough, A; Dixon, A K; Roberton, N R

    1984-01-01

    Forty one of 210 preterm infants ventilated for respiratory distress syndrome in a three year period had radiological evidence of pulmonary interstitial emphysema. The development of this condition was significantly associated with malpositioning of the endotracheal tube in a main bronchus and the use of high peak pressure ventilation. Pulmonary interstitial emphysema was associated with a significant increase in the number of pneumothoraces, intraventricular haemorrhages, and the need for prolonged respiratory support, but did not increase mortality. Although in 12 infants in whom fast rate ventilation was used there was a significant reduction in the number of pneumothoraces, outcome was not altered in any other way. Fast rate ventilation may be of greater benefit if initiated before the development of pulmonary interstitial emphysema. Images Fig. 1 Fig. 2 Fig. 3 Fig. 4 PMID:6508339

  6. Inherited interstitial lung disease.

    PubMed

    Garcia, Christine Kim; Raghu, Ganesh

    2004-09-01

    This article focuses on recent advances in the identification of genes and genetic polymorphisms that have been implicated in the development of human interstitial lung diseases. It focuses on the inherited mendelian diseases in which pulmonary fibrosis is part of the clinical phenotype and the genetics of familial idiopathic pulmonary fibrosis and other rare inherited interstitial lung diseases. The article also reviews the association studies that have been published to date regarding the genetics of sporadic idiopathic pulmonary fibrosis. The reader is directed to recent reviews on human genetic predisposition of sarcoidosis, environmental-related, drug-related, connective tissue related pulmonary fibrosis, and genetic predisposition of fibrosis in animal models. PMID:15331184

  7. Interstitial Cystitis / Painful Bladder Syndrome

    MedlinePlus

    ... by the National Institutes of Health. Articles and Book Chapters Keay SK, Warren JW. Is interstitial cystitis ... Incontinence. Paris: Health Publication Ltd.; 2009: 1459–1518. Books and Booklets Moldwin RM. Interstitial Cystitis Survival Guide: ...

  8. Are gastropods, rather than ants, important dispersers of seeds of myrmecochorous forest herbs?

    PubMed

    Türke, Manfred; Andreas, Kerstin; Gossner, Martin M; Kowalski, Esther; Lange, Markus; Boch, Steffen; Socher, Stephanie A; Müller, Jörg; Prati, Daniel; Fischer, Markus; Meyhöfer, Rainer; Weisser, Wolfgang W

    2012-01-01

    Seed dispersal by ants (myrmecochory) is widespread, and seed adaptations to myrmecochory are common, especially in the form of fatty appendices (elaiosomes). In a recent study, slugs were identified as seed dispersers of myrmecochores in a central European beech forest. Here we used 105 beech forest sites to test whether myrmecochore presence and abundance is related to ant or gastropod abundance and whether experimentally exposed seeds are removed by gastropods. Myrmecochorous plant cover was positively related to gastropod abundance but was negatively related to ant abundance. Gastropods were responsible for most seed removal and elaiosome damage, whereas insects (and rodents) played minor roles. These gastropod effects on seeds were independent of region or forest management. We suggest that terrestrial gastropods can generally act as seed dispersers of myrmecochorous plants and even substitute myrmecochory, especially where ants are absent or uncommon. PMID:22173465

  9. Spermiogenesis in the vermetid gastropod Dendropoma petraeum (Gastropoda, Prosobranchia).

    PubMed

    D'Ancona Lunetta, G; Damiani, F

    2002-01-01

    The structure and maturation of the male gonad of the Mediterranean vermetid gastropod Dendropoma petraeum are described. Histological sections of the gonads were made throughout development and gonad activity was monitored at regular monthly intervals. During the autumn months the gonad is very small and is surrounded by a large quantity of connective tissue; it becomes more voluminous from December to August, with the highest growth peak in springtime. The stages of spermatogenesis were also observed and described. PMID:12044050

  10. Predation through geological time: evidence from gastropod shell repair.

    PubMed

    Vermeij, G J; Schindel, D E; Zipser, E

    1981-11-27

    Warm-water marine gastropods from soft-bottom habitats show an increase in the incidence of breakage-resistant shell characteristics over geological time. The hypothesis that breakage became a more important component of selection in the middle of the Mesozoic Era is supported by the finding that frequencies of breakage-induced shell repair increased from the Pennsylvanian and Triassic periods to the Cretaceous, Miocene, and Recent. PMID:17808668

  11. Methanotrophic gastropods from a bathyal hydrocarbon seep, Gulf of Mexico

    SciTech Connect

    Anderson, L.C.; Aharon, P.; Gupta, S. )

    1992-01-01

    Two gastropods, Neritina sp. and Truncatella sp., collected live from a Gulf of Mexico active gas seep with the submersible Johnson Sea Link in September 1991, apparently incorporate methane-derived carbon in their soft tissues. Flesh of an individual Neritina sp. had a delta C-13 of [minus]50.92 per mil PDB, and that of two coexisting individuals of Truncatella sp. had values of [minus]45.11 and [minus]49.27 per mil. These isotope values are comparable to those reported for the methanotrophic mytilid bivalve Bathymodiolus sp. from other hydrocarbon seeps on the Gulf of Mexico, and are lighter than published isotopic values of chemosynthetic organisms with sulfur-oxidizing symbionts. The anomalously light carbon-isotopic values of Neritina sp. and Truncatella sp. may steam from one of three causes: (1) these gastropods host symbiotic methanotrophic bacteria, (2) their chief food is methane-oxidizing bacteria present at the seep, or (3) they incorporate some carbon from the periostracum of mussels on which they may graze. The presence of abundant juveniles of Bathymodiolus, reported to settle preferentially in areas of active seepage and high methane release, indicates that methane was abundant and supported a community with multiple trophic levels. Generally, studies of hydrocarbon-seep communities have focused on larger community members, especially bivalves and tube worms. The presence of living Neritina and Truncatella at the authors sampling site, however, draws attention to the fact that these gastropods are integral and significant parts of hydrocarbon-seep communities. Both gastropod species are members of genera that characteristically inhabit shallow marine, intertidal, and semiterrestrial environments. The presence of these genera in bathyal hydrocarbon seeps indicates that they have very broad environmental ranges, thus limiting their utility in paleoecologic reconstructions.

  12. Pathology of Haplosporidium patagon affecting siphonariid gastropods in Patagonia.

    PubMed

    Di Giorgio, Gisele; Gilardoni, Carmen; Ituarte, Cristián

    2014-11-13

    Haplosporidium patagon was found parasitizing Siphonaria lessonii and S. lateralis, 2 siphonariid gastropods co-occurring on the littoral rocky shore at Puerto Deseado, Santa Cruz, Argentina. Gastropods from 2 habitats representing 2 different levels of environmental harshness were studied. In both cases, S. lessonii showed a higher prevalence of infection (3.78%) over the entire 14 mo study period than S. lateralis (0.13%). Very different values of prevalence of infection were observed at the different sampling sites: Site 1, the more restrictive habitat (exposed for long periods to desiccation during low tides, higher ultraviolet exposure, and high ranges of temperature variation) showed a higher prevalence value (5.99%) than Site 2 (1.46%). Statistical differences in prevalence were also found between values corresponding to the austral spring (3.35% at Site 1 and 0.74% at Site 2) and winter (13.79% at Site 1 and 2.13% at Site 2). The presence/absence of H. patagon did not vary significantly with gastropod shell length. Infection affected the digestive gland, whose normal histology was greatly modified. The hermaphroditic gonads were also affected; the female germinal cells disappeared or only a few primary or previtellogenic oocytes were present, and vitellogenesis was inhibited. The function of the male germinal epithelium, as well as spermatogenesis and spermiogenesis processes and associated organs (seminal vesicles and seminal receptacles), were not affected. However, the glandular pallial complex of the reproductive systemwas affected, and we observed a significant reduction in development in parasitized gastropods. H. patagon sporocysts also invaded the supporting connective tissues of both the kidney and pseudobranch. PMID:25392043

  13. Karyomegalic Interstitial Nephritis

    PubMed Central

    Isnard, Pierre; Rabant, Marion; Labaye, Jacques; Antignac, Corinne; Knebelmann, Bertrand; Zaidan, Mohamad

    2016-01-01

    Abstract Karyomegalic interstitial nephritis is a rare cause of hereditary chronic interstitial nephritis, described for the first time over 40 years ago. A 36-year-old woman, of Turkish origin, presented with chronic kidney disease and high blood pressure. She had a history of recurrent upper respiratory tract infections but no familial history of nephropathy. Physical examination was unremarkable. Laboratory tests showed serum creatinine at 2.3 mg/dL with an estimated glomerular filtration rate of 26 mL/min/1.73m2, and gamma-glutamyl transpeptidase and alkaline phosphatase at 3 and 1.5 times the upper normal limit. Urinalysis showed 0.8 g/day of nonselective proteinuria, microscopic hematuria, and aseptic leukocyturia. Immunological tests and tests for human immunodeficiency and hepatitis B and C viruses were negative. Complement level and serum proteins electrophoresis were normal. Analysis of the renal biopsy showed severe interstitial fibrosis and tubular atrophy. Numerous tubular cells had nuclear enlargement with irregular outlines, hyperchromatic aspect, and prominent nucleoli. These findings were highly suggestive of karyomegalic interstitial nephritis, which was further confirmed by exome sequencing of FAN1 gene showing an identified homozygous frameshift mutation due to a one-base-pair deletion in exon 12 (c.2616delA). The present case illustrates a rare but severe cause of hereditary interstitial nephritis, sometimes accompanied by subtle extrarenal manifestations. Identification of mutations in FAN1 gene underscores recent insights linking inadequate DNA repair and susceptibility to chronic kidney disease. PMID:27196444

  14. Granulomatous interstitial nephritis

    PubMed Central

    Shah, Shivani; Carter-Monroe, Naima; Atta, Mohamed G.

    2015-01-01

    Granulomatous interstitial nephritis (GIN) is a rare entity detected in ∼0.5–0.9% of all renal biopsies. GIN has been linked to several antibiotics such as cephalosporins, vancomycin, nitrofurantoin and ciprofloxacin. It is also associated with NSAIDs and granulomatous disorders such as sarcoidosis, tuberculosis, fungal infections, and granulomatosis with polyangiitis. Renal biopsy is critical in establishing this diagnosis, and the extent of tubular atrophy and interstitial fibrosis may aid in determining prognosis. Retrospective data and clinical experience suggest that removal of the offending agent in conjunction with corticosteroid therapy often results in improvement in renal function. We describe a patient with a history of multiple spinal surgeries complicated by wound infection who presented with confusion and rash with subsequent development of acute kidney injury. Urinalysis demonstrated pyuria and eosinophiluria, and renal biopsy revealed acute interstitial nephritis with granulomas. These findings were attributed to doxycycline treatment of his wound infection. This review explores the clinical associations, presentation, diagnosis, and treatment of this uncommon cause of acute kidney injury. PMID:26413275

  15. Granulomatous interstitial nephritis.

    PubMed

    Shah, Shivani; Carter-Monroe, Naima; Atta, Mohamed G

    2015-10-01

    Granulomatous interstitial nephritis (GIN) is a rare entity detected in ∼0.5-0.9% of all renal biopsies. GIN has been linked to several antibiotics such as cephalosporins, vancomycin, nitrofurantoin and ciprofloxacin. It is also associated with NSAIDs and granulomatous disorders such as sarcoidosis, tuberculosis, fungal infections, and granulomatosis with polyangiitis. Renal biopsy is critical in establishing this diagnosis, and the extent of tubular atrophy and interstitial fibrosis may aid in determining prognosis. Retrospective data and clinical experience suggest that removal of the offending agent in conjunction with corticosteroid therapy often results in improvement in renal function. We describe a patient with a history of multiple spinal surgeries complicated by wound infection who presented with confusion and rash with subsequent development of acute kidney injury. Urinalysis demonstrated pyuria and eosinophiluria, and renal biopsy revealed acute interstitial nephritis with granulomas. These findings were attributed to doxycycline treatment of his wound infection. This review explores the clinical associations, presentation, diagnosis, and treatment of this uncommon cause of acute kidney injury. PMID:26413275

  16. Using microwaves to prepare gastropods for DNA barcoding.

    PubMed

    Galindo, L A; Puillandre, N; Strong, E E; Bouchet, P

    2014-07-01

    Extracting DNA from gastropods presents particular difficulties due to the capacity of the living animal to retract into the shell, resulting in poor penetration of the ethanol into the tissues. Because the shell is essential to establish the link between sequences and traditional taxonomic identity, cracking the shell to facilitate fixation is not ideal. Several methods are currently in routine use to overcome this difficulty, including chemical relaxation, drilling the shell and boiling. Most of these methods are time-consuming, may be safety hazards and constitute a bottleneck in the preparation of large numbers of specimens in the field. We have experimented with a method traditionally used to clean shells that involves placing the living gastropods in a microwave (MW) oven; the electromagnetic radiation very quickly heats both the animal and the water trapped inside the shell, resulting in separation of the muscles that anchor the animal to the shell. Done properly, the body can be removed intact from the shell and the shell voucher is preserved undamaged. To test the method, the bodies of live-collected specimens from two gastropod species were separated from their shell by microwaving and by anesthetizing/drilling. After identical extraction and PCR procedures, the gels showed no difference in DNA quantity or quality, and the resulting sequences are identical within species. The method was then implemented on a large scale during expeditions, resulting in higher percentage of DNA extraction success. The MWs are also effective for quickly and easily removing other molluscs from their shells, that is, bivalves and scaphopods. Workflows implementing the MW technique show a three- to fivefold increase in productivity compared with other methods. PMID:24450943

  17. Phylogeographical disjunction in abundant high-dispersal littoral gastropods.

    PubMed

    Waters, J M; King, T M; O'Loughlin, P M; Spencer, H G

    2005-08-01

    Abstract Phylogeographical disjunctions in high-dispersal marine taxa are variously ascribed to palaeogeographical conditions or contemporary ecological factors. Associated biogeographical studies, however, seldom incorporate the sampling design required to confidently discriminate among such competing hypotheses. In the current study, over 7800 gastropod specimens were examined for operculum colour, and 129 specimens genetically, to test ecological and historical biogeographical hypotheses relating to biogeographical disjunction in the Southern Hemisphere, and to southern Australia in particular. Mitochondrial DNA sequence analysis of the high-dispersal intertidal gastropod Nerita atramentosa in southern Australia (88 specimens; 18 localities) revealed an east-west phylogeographical split involving two highly divergent clades (26.0 +/- 1.9%) exhibiting minimal geographical overlap in the southeast. The eastern clade of Nerita atramentosa is also widespread in northern New Zealand (43 specimens, 10 localities), but no significant genetic differentiation is explained by the Tasman Sea, a 2000-km-wide oceanic barrier. Spatial genetic structure was not detected within either clade, consistent with the species' dispersive planktotrophic phase lasting for 5-6 months. Digital analysis of operculum colouration revealed substantial differences between eastern (tan) and western (black) specimens. Genetic analysis and visual inspection of 88 Australian specimens revealed a completely nonrandom association between mtDNA data and operculum colouration. Independent examination of a further 7822 specimens from 14 sites in southern Australia revealed both colour morphs at all localities, but reinforced the phylogeographical data by indicating a marked turnover in colour morph abundance associated with a palaeogeographical barrier: Wilsons Promontory. This sharp biogeographical disjunction is in marked contrast to the species' high dispersal abilities. The genetic similarity of

  18. Spatially explicit analysis of gastropod biodiversity in ancient Lake Ohrid

    NASA Astrophysics Data System (ADS)

    Hauffe, T.; Albrecht, C.; Schreiber, K.; Birkhofer, K.; Trajanovski, S.; Wilke, T.

    2011-01-01

    The quality of spatial analyses of biodiversity is improved by (i) utilizing study areas with well defined physiogeographical boundaries, (ii) limiting the impact of widespread species, and (iii) using taxa with heterogeneous distributions. These conditions are typically met by ecosystems such as oceanic islands or ancient lakes and their biota. While research on ancient lakes has contributed significantly to our understanding of evolutionary processes, statistically sound studies of spatial variation of extant biodiversity have been hampered by the frequently vast size of ancient lakes, their limited accessibility, and the lack of scientific infrastructure. The European ancient Lake Ohrid provides a rare opportunity for such a reliable spatial study. The comprehensive horizontal and vertical sampling of a species-rich taxon, the Gastropoda, presented here, revealed interesting patterns of biodiversity, which, in part, have not been shown before for other ancient lakes. In a total of 284 samples from 224 different locations throughout the Ohrid Basin, 68 gastropod species, with 50 of them (= 73.5%) being endemic, could be reported. The spatial distribution of these species shows the following characteristics: (i) within Lake Ohrid, the most frequent species are endemic taxa with a wide depth range, (ii) widespread species (i.e. those occurring throughout the Balkans or beyond) are rare and mainly occur in the upper layer of the lake, (iii) while the total number of species decreases with water depth, the proportion of endemics increases, and (iv) the deeper layers of Lake Ohrid appear to have a higher spatial homogeneity of biodiversity. Moreover, gastropod communities of Lake Ohrid and its feeder springs are both distinct from each other and from the surrounding waters. The analysis also shows that community similarity of Lake Ohrid is mainly driven by niche processes (e.g. environmental factors), but also by neutral processes (e.g. dispersal limitation and

  19. [Conotoxins: from the biodiversity of gastropods to new drugs].

    PubMed

    Fedosov, A É; Moshkovskiĭ, S A; Kuznetsova, K G; Olivera, B M

    2013-01-01

    A review describes general trends in research of conotoxins that are peptide toxins isolated from sea gastropods of the Conus genus, since the toxins were discovered in 1970th. There are disclosed a conotoxin classification, their structure diversity and different ways of action to their molecular targets, mainly, ion channels. In the applied aspect of conotoxin research, drug discovery and development is discussed, the drugs being based on conotoxin structure. A first exemplary drug is a ziconotide, which is an analgesic of new generation. PMID:23987066

  20. Space: A non-limiting resource in the niches of some abundant coral reef gastropods

    NASA Astrophysics Data System (ADS)

    Reichelt, R. E.

    1982-06-01

    Given the importance attributed to the occupation of space in benthic coral reef communities, this study asks the question: are any particular microhabitat types limiting resources for an assemblage of worm-eating gastropods on Heron reef (Great Barrier Reef). Microhabitat resource use was measured on three occasions, separated by 12 and 20-month periods. The gastropod populations were typical of those of other Indo-Pacific sites with respect to mean shell size and density. Fluctuations in species' size and density are assumed to have not significantly influenced availability of microhabitat resources. Gastropods occurred mainly in the structurally complex “refuge” microhabitats during the day and showed an increased abundance in smooth, exposed, “foraging” microhabitat nocturnally. Nassarius gaudiosus is the most extreme microhabitat specialist diurnally and the most extreme microhabitat generalist nocturnally. A similar, although less pronounced trend was exhibited by other gastropod species. Microhabitat niche overlap was high for Conus coronatus, C. miliaris, C. flavidus, Vasum turbinellus and N. gaudiosus at night and was also high during the day for all these species except N. gaudiosus, which showed little overlap with other gastropod species diurnally. Using gastropod abundance data from all samples, and independently derived microhabitat abundance data, multiple regression analysis demonstrated: 1) A significant relationship between the abundances of N. gaudiosus, C. coronatus, and C. flavidus and the abundance of microhabitat 2 (sand under rocks=“refuge”). 2) No positive association between gastropod abundance and the abundance of microhabitat 7a (thin layer of algal-bound sand on reef limestone). Only N. gaudiosus is abundant in microhabitat 2. Therefore it is concluded that, with some exceptions, microhabitat abundance does not have a significant influence, directly or indirectly, on gastropod abundance. It is possible that density

  1. Interstitial duplication 19p

    SciTech Connect

    Stratton, R.F.; DuPont, B.R.; Moore, C.M.

    1995-07-17

    We report on a 9-month-old girl with an interstitial duplication of 19p, developmental delay, and multiple anomalies including bifrontal prominence, obtuse frontonasal angle, short columella, additional midline philtral pillar, midline ridge on the tongue, vertical midline ridge at the mental symphysis, and a complex congenital heart defect including severe branch pulmonary artery stenosis, secundum atrial septal defect (ASD), and several ventricular septal defects (VSDs). Use of fluorescent in situ hybridization (FISH) with chromosome 19- specific probes showed a direct duplication of bands 19p13.13 and 19p13.2. 6 refs., 1 fig.

  2. Lymphocytic Interstitial Pneumonia.

    PubMed

    Panchabhai, Tanmay S; Farver, Carol; Highland, Kristin B

    2016-09-01

    Lymphocytic interstitial pneumonia (LIP) is a rare lung disease on the spectrum of benign pulmonary lymphoproliferative disorders. LIP is frequently associated with connective tissue diseases or infections. Idiopathic LIP is rare; every attempt must be made to diagnose underlying conditions when LIP is diagnosed. Computed tomography of the chest in patients with LIP may reveal ground-glass opacities, centrilobular and subpleural nodules, and randomly distributed thin-walled cysts. Demonstrating polyclonality with immunohistochemistry is the key to differentiating LIP from lymphoma. The 5-year mortality remains between 33% and 50% and is likely to vary based on the underlying disease process. PMID:27514593

  3. Feedlot Acute Interstitial Pneumonia.

    PubMed

    Woolums, Amelia R

    2015-11-01

    Acute interstitial pneumonia (AIP) of feedlot cattle is a sporadically occurring respiratory condition that is often fatal. Affected cattle have a sudden onset of labored breathing. There is no confirmed effective treatment of feedlot AIP; however, administration of antibiotics effective against common bacterial respiratory pathogens and nonsteroidal anti-inflammatory drugs, especially aspirin, has been recommended. Protective strategies are not well defined, but efforts to limit dust exposure and heat stress; to ensure consistent formulation, mixing, and delivery of feed; and to identify and treat infectious respiratory disease in a timely manner may decrease rates of feedlot AIP. PMID:26253266

  4. Interstitial Collagen Catabolism*

    PubMed Central

    Fields, Gregg B.

    2013-01-01

    Interstitial collagen mechanical and biological properties are altered by proteases that catalyze the hydrolysis of the collagen triple-helical structure. Collagenolysis is critical in development and homeostasis but also contributes to numerous pathologies. Mammalian collagenolytic enzymes include matrix metalloproteinases, cathepsin K, and neutrophil elastase, and a variety of invertebrates and pathogens possess collagenolytic enzymes. Components of the mechanism of action for the collagenolytic enzyme MMP-1 have been defined experimentally, and insights into other collagenolytic mechanisms have been provided. Ancillary biomolecules may modulate the action of collagenolytic enzymes. PMID:23430258

  5. The vermetid gastropod Dendropoma maximum reduces coral growth and survival

    PubMed Central

    Shima, Jeffrey S.; Osenberg, Craig W.; Stier, Adrian C.

    2010-01-01

    Coral reefs are one of the most diverse systems on the planet; yet, only a small fraction of coral reef species have attracted scientific study. Here, we document strong deleterious effects of an often overlooked species—the vermetid gastropod, Dendropoma maximum—on growth and survival of reef-building corals. Our surveys of vermetids on Moorea (French Polynesia) revealed a negative correlation between the density of vermetids and the per cent cover of live coral. Furthermore, the incidence of flattened coral growth forms was associated with the presence of vermetids. We transplanted and followed the fates of focal colonies of four species of corals on natural reefs where we also manipulated presence/absence of vermetids. Vermetids reduced skeletal growth of focal corals by up to 81 per cent and survival by up to 52 per cent. Susceptibility to vermetids varied among coral species, suggesting that vermetids could shift coral community composition. Our work highlights the potential importance of a poorly studied gastropod to coral dynamics. PMID:20484230

  6. The vermetid gastropod Dendropoma maximum reduces coral growth and survival.

    PubMed

    Shima, Jeffrey S; Osenberg, Craig W; Stier, Adrian C

    2010-12-23

    Coral reefs are one of the most diverse systems on the planet; yet, only a small fraction of coral reef species have attracted scientific study. Here, we document strong deleterious effects of an often overlooked species-the vermetid gastropod, Dendropoma maximum-on growth and survival of reef-building corals. Our surveys of vermetids on Moorea (French Polynesia) revealed a negative correlation between the density of vermetids and the per cent cover of live coral. Furthermore, the incidence of flattened coral growth forms was associated with the presence of vermetids. We transplanted and followed the fates of focal colonies of four species of corals on natural reefs where we also manipulated presence/absence of vermetids. Vermetids reduced skeletal growth of focal corals by up to 81 per cent and survival by up to 52 per cent. Susceptibility to vermetids varied among coral species, suggesting that vermetids could shift coral community composition. Our work highlights the potential importance of a poorly studied gastropod to coral dynamics. PMID:20484230

  7. Carbonate biomineralization in terrestrial gastropods: environmental vs. physiological constraints

    NASA Astrophysics Data System (ADS)

    Mierzwa, D.; Stolarski, J.

    2009-04-01

    Preservational potential of shells of terrestrial gastropods allows to use them as valuable (paleo)climatic proxies. Despite of the fact, that the elements incorporated in their skeleton derive almost entirely from their diet, details of the ion uptake routes have not been studied in details. This work is a first step in the investigations of element uptake and biomineralization processes in pulmonate gastropod Cepaea vindobonensis (Férussac, 1821). Although phenotypic plasticity in the shell characters of the species appears to be mainly genetic in nature, some differences seem to correlate with availability of ions used in biomineralization. For example, shells of individuals living in marginal parts of flood plains (environment extreme for the species and generally depleted in calcium) have weakened structure and faded color pattern, whereas individuals from the lime substrata form typically developed, pigmented shells with several cross-lamellar layers. Micro- and nanostructural characteristics of shells from different environments are visualized by SEM and AFM imaging techniques and some biogeochemical properties are characterized by spectroscopic and fluorescence methods. Further experiments are required to elucidate the ion/trace elements transfer between the substratum, nutrients, organism, and the shell.

  8. Variation in the diets of hydrothermal vent gastropods

    NASA Astrophysics Data System (ADS)

    Govenar, Breea; Fisher, Charles R.; Shank, Timothy M.

    2015-11-01

    A prevailing paradigm of hydrothermal vent ecology is that primary consumers feed on chemoautotrophic bacteria. However, for the purposes of reconstructing vent food webs and for tracking energy flow from the generation of rock and fluid chemistry through primary/ secondary productivity and consumption to the overlying water column, it remains unclear which consumers feed on which bacteria. In paired analyses of carbon and nitrogen tissue stable isotope values with unique 16S rRNA sequences from the stomach contents, we determined that two species of gastropod grazers appear to feed on epsilon-proteobacteria, while two other species have more diverse diets, including one species that consumes alpha-proteobacteria, planctomycetes, and non-green sulfur bacteria. Different carbon fixation pathways used by epsilon- and alpha-proteobacteria may account for the variation in the carbon stable isotope values among the consumers. Furthermore, our results indicate that trophic specialization and niche partitioning may contribute to the distribution and abundance of vent-endemic gastropods and support the hypothesis that consumers in the warmer habitats commonly feed on epsilon-proteobacteria that use the rTCA cycle, while in the cooler habitats they feed on additional bacteria that use the CBB cycle. These results suggest that the phylogenetic and metabolic diversity of free-living bacteria may play an important and previously overlooked role in facilitating species coexistence among primary consumers at hydrothermal vents and other chemosynthesis-based ecosystems.

  9. Evolution of corallivory in the gastropod genus Drupella

    NASA Astrophysics Data System (ADS)

    Claremont, M.; Reid, D. G.; Williams, S. T.

    2011-12-01

    Although muricid gastropods in the genus Drupella are well-known consumers of Indo-Pacific corals, their evolutionary and ecological history is unclear, as is their relationship to the apparently facultative coral-feeder Ergalatax margariticola, which has been reported to feed upon corals in Hong Kong. We use a well resolved molecular phylogeny (reconstructed from one nuclear and two mitochondrial genes) to show that the monophyletic genus Drupella falls into the muricid subfamily Ergalataxinae and that the genus includes ` E. margariticola', which is composed of two cryptic species. We show that genetic structure within the here reassigned ` Drupella margariticola' species complex does not relate to feeding mode, but instead seems to correspond to broad patterns of habitat ecology found in other gastropod taxa. Our analyses suggest that Drupella originated in the late Miocene (approximately 9.6 Ma) and diversified approximately 5.0 Ma, much later than the appearance of modern coral reefs in the early Cenozoic. Thus, it is possible that corallivory in Drupella evolved in response to the major expansion and reorganization of reefs that took place in the early Miocene.

  10. Subclinical Interstitial Lung Disease

    PubMed Central

    Doyle, Tracy J.; Hunninghake, Gary M.

    2012-01-01

    The widespread use of high-resolution computed tomography in clinical and research settings has increased the detection of interstitial lung abnormalities (ILA) in asymptomatic and undiagnosed individuals. We reported that in smokers, ILA were present in about 1 of every 12 high-resolution computed tomographic scans; however, the long-term significance of these subclinical changes remains unclear. Studies in families affected with pulmonary fibrosis, smokers with chronic obstructive pulmonary disease, and patients with inflammatory lung disease have shown that asymptomatic and undiagnosed individuals with ILA have reductions in lung volume, functional limitations, increased pulmonary symptoms, histopathologic changes, and molecular profiles similar to those observed in patients with clinically significant interstitial lung disease (ILD). These findings suggest that, in select at-risk populations, ILA may represent early stages of pulmonary fibrosis or subclinical ILD. The growing interest surrounding this topic is motivated by our poor understanding of the inciting events and natural history of ILD, coupled with a lack of effective therapies. In this perspective, we outline past and current research focused on validating radiologic, physiological, and molecular methods to detect subclinical ILD. We discuss the limitations of the available cross-sectional studies and the need for future longitudinal studies to determine the prognostic and therapeutic implications of subclinical ILD in populations at risk of developing clinically significant ILD. PMID:22366047

  11. Renal Medullary Interstitial Cells

    NASA Astrophysics Data System (ADS)

    Rao, Reena; Hao, Chuan-Ming; Breyer, Matthew D.

    2007-04-01

    Renal medullary interstitial cells (RMICs) are specialized fibroblast-like cells that reside in the renal medulla among the vasa recta, the thin limbs of Henle's loop, and medullary collecting ducts. These cells are characterized by abundant lipid droplets in the cytoplasm. The lipid droplets are composed of triglycerides, cholesterol esters and free long-chain fatty acids, including arachidonic acid. RMICs are also a major site of cyclooxygenase2 (COX-2) expression, and thus a major site of COX-2 derived prostanoid biosynthesis. RMICs are also a potential target of hormones such as angiotensin II and endothelin. The RMIC COX-2 expression and the abundance of lipid droplets change with salt and water intake. These properties of RMICs are consistent with an important role of these cells in modulating physiologic and pathologic processes of the kidney.

  12. Europe's Neogene and Quaternary lake gastropod diversity - a statistical approach

    NASA Astrophysics Data System (ADS)

    Neubauer, Thomas A.; Georgopoulou, Elisavet; Harzhauser, Mathias; Mandic, Oleg; Kroh, Andreas

    2014-05-01

    During the Neogene Europe's geodynamic history gave rise to several long-lived lakes with conspicuous endemic radiations. However, such lacustrine systems are rare today as well as in the past compared to the enormous numbers of "normal" lakes. Most extant European lakes are mainly results of the Ice Ages and are due to their (geologically) temporary nature largely confined to the Pleistocene-Holocene. As glacial lakes are also geographically restricted to glacial regions (and their catchment areas) their preservation potential is fairly low. Also deposits of streams, springs, and groundwater, which today are inhabited by species-rich gastropod assemblages, are rarely preserved. Thus, the pre-Quaternary lacustrine record is biased towards long-lived systems, such as the Late Miocene Lake Pannon, the Early to Middle Miocene Dinaride Lake System, the Middle Miocene Lake Steinheim and several others. All these systems have been studied for more than 150 years concerning their mollusk inventories and the taxonomic literature is formidable. However, apart from few general overviews precise studies on the γ-diversities of the post-Oligocene European lake systems and the shifting biodiversity in European freshwater systems through space and time are entirely missing. Even for the modern faunas, literature on large-scale freshwater gastropod diversity in extant lakes is scarce and lacks a statistical approach. Our preliminary data suggest fundamental differences between modern and pre-Pleistocene freshwater biogeography in central Europe. A rather homogenous central European Pleistocene and Holocene lake fauna is contrasted by considerable provincialism during the early Middle Miocene. Aside from the ancient Dessaretes lakes of the Balkan Peninsula, Holocene lake faunas are dominated by planorbids and lymnaeids in species numbers. This composition differs considerably from many Miocene and Pliocene lake faunas, which comprise pyrgulid-, hydrobiid-, viviparid-, melanopsid

  13. The Effects of Experimentally Induced Adelphophagy in Gastropod Embryos

    PubMed Central

    Thomsen, Olaf; Collin, Rachel; Carrillo-Baltodano, Allan

    2014-01-01

    Adelphophagy, development where embryos grow large by consuming morphologically distinct nutritive embryos or their own normal siblings is widespread but uncommon among animal phyla. Among invertebrates it is particularly common in some families of marine gastropods and segmented worms, but rare or unknown in other closely related families. In calyptraeid gastropods phylogenetic analysis indicates that adelphophagy has arisen at least 9 times from species with planktotrophic larval development. This pattern of frequent parallel evolution of adelphophagy suggests that the embryos of planktotrophic species might be predisposed to evolve adelphophagy. Here we used embryos of three species of planktotrophic calyptraeids, one from each of three major genera in the family (Bostrycapulus, Crucibulum, and Crepidula), to answer the following 3 questions: (1) Can embryos of species with planktotrophic development benefit, in terms of pre-hatching growth, from the ingestion of yolk and tissue from experimentally damaged siblings? (2) Does ingestion of this material from damaged siblings increase variation in pre-hatching size? and (3) Does this experimentally induced adelphophagy alter the allometry between the velum and the shell, increasing morphological similarity to embryos of normally adelphophagic species? We found an overall increase in shell length and velum diameter when embryos feed on damaged siblings within their capsules. There was no detectable increase in variation in shell length or velum diameter, or changes in allometry. The overall effect of our treatment was small compared to the embryonic growth observed in naturally adelphophagic development. However each embryo in our experiment probably consumed less than one sibling on average, whereas natural adelphophages often each consume 10–30 or more siblings. These results suggest that the ability to consume, assimilate, and benefit from yolk and tissue of their siblings is widespread across calyptraeids

  14. Trapping of interstitials in metals

    SciTech Connect

    Wert, C.A.; Frank, R.C.

    1983-01-01

    The term trapping is used extensively to refer to the fact that interstitial atoms often find interstices associated with lattice imperfections to be energetically preferable to normal sites. This preference results in a delay of diffusion of interstitial atoms near these sites. As understanding of the details of lattice imperfections has improved, understanding of the effect of traps on the diffusion process has increased. Trapping is often illustrated by the use of a potential energy diagram. This simple model is characterized by a potential energy well deeper than those of surrounding interstitial sites. The energy required for the interstitial to jump into the trap is the same as that required for jumping into other adjacent interstitial sites, but that required for jumping out is greater. The additional energy required to leave the site is often designated as the trap binding energy, E/sub B/. Potential energy diagrams appropriate for most traps in metals are likely to be more complicated, but this simple model is a starting point for more sophisticated models of trapping. Imperfections may occasionally produce interstitial sites less favorable than normal sites and thus be less preferred. Little experimental exploration of this anti-trapping phenomenon has been carried out, however. Developments in understanding at various levels of trapping of interstitial impurities by lattice imperfections are examined.

  15. Mitochondrial genome of the endangered marine gastropod Strombus gigas Linnaeus, 1758 (Mollusca: Gastropoda).

    PubMed

    Márquez, Edna J; Castro, Erick R; Alzate, Juan F

    2016-01-01

    The queen conch Strombus gigas is an endangered marine gastropod of significant economic importance across the Greater Caribbean region. This work reports for the first time the complete mitochondrial genome of S. gigas, obtained by FLX 454 pyrosequencing. The mtDNA genome encodes for 13 proteins, 22 tRNAs and 2 ribosomal RNAs. In addition, the coding sequences and gene synteny were similar to other previously reported mitogenomes of gastropods. PMID:25186797

  16. Prior exposure influences the behavioural avoidance by an intertidal gastropod, Bembicium auratum, of acidified waters

    NASA Astrophysics Data System (ADS)

    Amaral, Valter; Cabral, Henrique N.; Bishop, Melanie J.

    2014-01-01

    Phenotypic plasticity may be critical to the maintenance of viable populations under future environmental change. Here we examined the role of behavioural avoidance of sub-optimal conditions in enabling the intertidal gastropod, Bembicium auratum, to persist in mangrove forests affected by the low pH runoff from acid sulphate soils (ASS). Behaviourally, the gastropod may be able to avoid periods of particularly high acidity by using pneumatophores and/or mangrove trunks to vertically migrate above the water line or by retreating into its shell. We hypothesised that (1) B. auratum would display greater and more rapid vertical migration out of acidified than reference estuarine waters, and (2) responses would be more pronounced in gastropods collected from acidified than reference sites. Gastropods from acidified sites showed significantly higher activity in and more rapid migration out of acidified waters of pH 6.2-7.0, than reference waters or waters of pH < 5.0. Gastropods from reference locations showed a significantly weaker response to acidified water than those from acidified waters, and which did not significantly differ from their response to reference water. At extremely low pHs, <5.0, a higher proportion of both acidified and reference gastropods retreated into their shell than at higher pHs. Both the migration of gastropods out of acidified waters and retraction into their shells serves to reduce exposure time to acidified waters and may reduce the impact of this stressor on their populations. The stronger response to acidification of gastropods from populations previously exposed to this stressor suggests that the response may be learned, inherited or induced over multiple exposures. Our study adds to growing evidence that estuarine organisms may exhibit considerable physiological and behaviour adaptive capacity to acidification. The potential for such adaptive capacity should be incorporated into studies seeking to forecast impacts to marine organisms

  17. Interstitial lung disease - adults - discharge

    MedlinePlus

    ... lung disease Pulmonary alveolar proteinosis Rheumatoid lung disease Sarcoidosis Patient Instructions Eating extra calories when sick - adults ... team. Related MedlinePlus Health Topics Interstitial Lung Diseases Sarcoidosis Browse the Encyclopedia A.D.A.M., Inc. ...

  18. Spatially explicit analyses of gastropod biodiversity in ancient Lake Ohrid

    NASA Astrophysics Data System (ADS)

    Hauffe, T.; Albrecht, C.; Schreiber, K.; Birkhofer, K.; Trajanovski, S.; Wilke, T.

    2010-07-01

    Spatial heterogeneity of biodiversity arises from evolutionary processes, constraints of environmental factors and the interaction of communities. The quality of such spatial analyses of biodiversity is improved by (i) utilizing study areas with well defined physiogeographical boundaries, (ii) limiting the impact of widespread species, and (iii) using taxa with heterogeneous distributions. These conditions are typically met by ecosystems such as oceanic islands or ancient lakes and their biota. While research on ancient lakes has contributed significantly to our understanding of evolutionary processes, statistically sound studies of spatial variation of extant biodiversity have been hampered by the frequently vast size of ancient lakes, their limited accessibility, and the lack of infrastructure around them. The small European ancient Lake Ohrid provides a rare opportunity for such a reliable spatial study. The comprehensive horizontal and vertical sampling of a species-rich taxon, the Gastropoda, presented here, revealed interesting patterns of biodiversity, which, in part, have not been shown before for other ancient lakes. In a total of 224 locations throughout the Ohrid Basin, representatives of 68 gastropod species with 50 of them being endemic (=73.5%) could be reported. The spatial distribution of these species shows the following characteristics: (i) within Lake Ohrid, the most frequent species are endemic taxa with a wide depth range, (ii) widespread species (i.e. those occurring throughout the Balkans or beyond) are rare and mainly occur in the upper layer of the lake, (iii) while the total number of species decreases with water depth, the share of endemics increases, (iv) the deeper layers of Lake Ohrid appear to have a higher spatial homogeneity of biodiversity and related environmental factors, (v) biotic interaction due to possible spillover effects may contribute to the establishment of hotspots, and (vi) eco-insularity within the Ohrid Basin occurs

  19. Assessing open-system behavior of 14C in terrestrial gastropod shells

    USGS Publications Warehouse

    Rech, Jason A.; Pigati, Jeffrey S.; Lehmann, Sophie B.; McGimpsey, Chelsea N.; Grimley, David A.; Nekola, Jeffrey C.

    2011-01-01

    In order to assess open-system behavior of radiocarbon in fossil gastropod shells, we measured the 14C activity on 10 aliquots of shell material recovered from Illinoian (~190-130 ka) and pre-Illinoian (~800 ka) loess and lacustrine deposits in the Midwestern USA. Eight of the 10 aliquots yielded measurable 14C activities that ranged from 0.25 to 0.53 percent modern carbon (pMC), corresponding to apparent 14C ages between 48.2 and 42.1 ka. This small level of open-system behavior is common in many materials that are used for 14C dating (e.g. charcoal), and typically sets the upper practical limit of the technique. Two aliquots of gastropod shells from the Illinoian-aged Petersburg Silt (Petersburg Section) in central Illinois, USA, however, yielded elevated 14C activities of 1.26 and 1.71 pMC, which correspond to apparent 14C ages of 35.1 and 32.7 ka. Together, these results suggest that while many fossil gastropods shells may not suffer from major (>1%) open-system problems, this is not always the case. We then examined the mineralogy, trace element chemistry, and physical characteristics of a suite of fossil and modern gastropod shells to identify the source of contamination in the Petersburg shells and assess the effectiveness of these screening techniques at identifying samples suitable for 14C dating. Mineralogical (XRD) and trace element analyses were inconclusive, which suggests that these techniques are not suitable for assessing open-system behavior in terrestrial gastropod shells. Analysis with scanning electron microscopy (SEM), however, identified secondary mineralization (calcium carbonate) primarily within the inner whorls of the Petersburg shells. This indicates that SEM examination, or possibly standard microscope examination, of the interior of gastropod shells should be used when selecting fossil gastropod shells for 14C dating.

  20. Assessing open-system behavior of 14C in terrestrial gastropod shells

    USGS Publications Warehouse

    Rech, J.A.; Pigati, J.S.; Lehmann, S.B.; McGimpsey, C.N.; Grimley, D.A.; Nekola, J.C.

    2011-01-01

    In order to assess open-system behavior of radiocarbon in fossil gastropod shells, we measured the 14C activity on 10 aliquots of shell material recovered from Illinoian (~190-130 ka) and pre-Illinoian (~800 ka) loess and lacustrine deposits in the Midwestern USA. Eight of the 10 aliquots yielded measurable 14C activities that ranged from 0.25 to 0.53 percent modern carbon (pMC), corresponding to apparent 14C ages between 48.2 and 42.1 ka. This small level of open-system behavior is common in many materials that are used for 14C dating (e.g. charcoal), and typically sets the upper practical limit of the technique. Two aliquots of gastropod shells from the Illinoian-aged Petersburg Silt (Petersburg Section) in central Illinois, USA, however, yielded elevated 14C activities of 1.26 and 1.71 pMC, which correspond to apparent 14C ages of 35.1 and 32.7 ka. Together, these results suggest that while many fossil gastropods shells may not suffer from major (>1%) open-system problems, this is not always the case. We then examined the mineralogy, trace element chemistry, and physical characteristics of a suite of fossil and modern gastropod shells to identify the source of contamination in the Petersburg shells and assess the effectiveness of these screening techniques at identifying samples suitable for 14C dating. Mineralogical (XRD) and trace element analyses were inconclusive, which suggests that these techniques are not suitable for assessing open-system behavior in terrestrial gastropod shells. Analysis with scanning electron microscopy (SEM), however, identified secondary mineralization (calcium carbonate) primarily within the inner whorls of the Petersburg shells. This indicates that SEM examination, or possibly standard microscope examination, of the interior of gastropod shells should be used when selecting fossil gastropod shells for 14C dating. ?? 2011 by the Arizona Board of Regents on behalf of the University of Arizona.

  1. Species, Diaspore Volume and Body Mass Matter in Gastropod Seed Feeding Behavior

    PubMed Central

    Türke, Manfred; Weisser, Wolfgang W.

    2013-01-01

    Background Seed dispersal of ant-dispersed plants (myrmecochores) is a well studied ecosystem function. Recently, slugs have been found to act as seed dispersers of myrmecochores. The aim of our study was to (1) further generalize the finding that gastropods feed on seeds of myrmecochores and hence may act as seed dispersers, (2) to test whether gastropod body mass and the volume of diaspores have an influence on the seed dispersal potential. Methodology and Principal Findings We assessed the seed dispersal potential of four slug and snail species with a set of seven myrmecochorous plant species from seven different plant families common to Central European beech forests. Diaspores differed in shape and size. Gastropods differed in their readiness to feed on diaspores and in the proportion of seeds that were swallowed as a whole, and this readiness generally decreased with increasing diaspore size. Smaller Arionid slugs (58 mm body length; mean) mostly fed on the elaiosome but also swallowed small diaspores and therefore not only act as elaiosome consumers, a nutrient rich appendage on myrmecochorous diaspores, but may also disperse seeds. Large Arionid slugs (>100 mm body length) swallowed diaspores of all sizes. Diaspores swallowed by gastropods were defecated without damage. Within-species variability in body size also affect seed dispersal potential, as larger individuals of the red slug (Arion rufus) swallowed more diaspores of wood anemone (Anemone nemorosa) than smaller ones. Conclusions and Significance Our results help to generalize the finding that gastropods consume and potentially disperse seeds of myrmecochores. The dispersal potential of gastropods is strongly influenced by diaspore size in relation to gastropod size. PMID:23844239

  2. A molecular phylogenetic analysis of strombid gastropod morphological diversity.

    PubMed

    Latiolais, Jared M; Taylor, Michael S; Roy, Kaustuv; Hellberg, Michael E

    2006-11-01

    The shells of strombid gastropods show a wide variety of forms, ranging from small and fusiform to large and elaborately ornamented with a strongly flared outer lip. Here, we present the first species-level molecular phylogeny for strombids and use the resulting phylogenetic framework to explore relationships between species richness and morphological diversity. We use portions of one nuclear (325 bp of histone H3) and one mitochondrial (640 bp of cytochrome oxidase I, COI) gene to infer relationships within the two most species-rich genera in the Strombidae: Strombus and Lambis. We include 32 species of Strombus, representing 10 of 11 extant subgenera, and 3 of the 9 species of Lambis, representing 2 of 3 extant subgenera. Maximum likelihood and Bayesian analyses of COI and of H3 and COI combined suggest Lambis is nested within a paraphyletic Strombus. Eastern Pacific and western Atlantic species of Strombus form a relatively recent monophyletic radiation within an older, paraphyletic Indo-West Pacific grade. Morphological diversity of subclades scales positively with species richness but does not show evidence of strong phylogenetic constraints. PMID:16839783

  3. Spatial vision in the prosobranch gastropod ampularia sp

    PubMed

    Seyer; Nilsson; Warrant

    1998-05-01

    The eyes of gastropods of the genus Ampularia superficially resemble the well-developed camera-type eyes of Littorina littorea and Strombus raninus. The eyes are of the closed-vesicle type, having a cornea and a lens that is separated from the retina by a narrow vitreous body. Light and electron microscopy were used to generate an accurate geometrical model of the Ampularia sp. eye, which was then used to predict its optical performance. The image quality of the lens was investigated using a modified microscope and revealed that images suffer from severe aberrations. The focal length was estimated to be approximately 430 microm, putting the plane of best focus in or just proximal to the rhabdoms. The aberrant optics result in a large retinal blur-circle with a diameter of approximately 120 microm and an angular half-width of approximately 17 degrees, allowing only comparatively poor resolution compared with the eyes of Littorina littorea and Strombus raninus. Behavioural experiments revealed no significant optomotor response. The results imply that Ampularia sp. has poor spatial vision, limited by the blur-circles on the retina. The eyes appear to be suitable only for relatively simple visual tasks, such as finding an open water surface for breathing, but the large size of the eye allows it to perform this task even at night. PMID:9556547

  4. Characterization of a Venom Peptide from a Crassispirid Gastropod

    PubMed Central

    Cabang, April B.; Imperial, Julita S.; Gajewiak, Joanna; Watkins, Maren; Corneli, Patrice Showers; Olivera, Baldomero M.; Concepcion, Gisela P.

    2011-01-01

    The crassispirids are a large branch of venomous marine gastropods whose venoms have not been investigated previously. We demonstrate that crassispirids comprise a major group of toxoglossate snails in a clade distinct from all turrids whose venoms have been analyzed. The isolation and biochemical definition of the first venom component from any crassispirid is described. Crassipeptide cce9a from Crassispira cerithina (Anton, 1838) was purified from crude venom by following biological activity elicited in young mice, lethargy and a lack of responsiveness to external stimuli. Using Edman sequencing and mass spectrometry, the purified peptide was shown to be 29 amino acid residues long, with the sequence: GSCGLPCHENRRCGWACYCDDGICKPLRV. The sequence assignment was verified through the analysis of a cDNA clone encoding the peptide. The peptide was chemically synthesized and folded; the synthetic peptide was biologically active and coelution with the native venom peptide was demonstrated. When injected into mice of various ages, the peptide elicited a striking shift in behavioral phenotype between 14 and 16 days, from lethargy to hyperactivity. PMID:21939682

  5. [Lipids composition and speed of energy metabolism in gastropods].

    PubMed

    Arakelova, E S

    2008-01-01

    Lipid composition of digestive gland and pedal muscle of two northern freshwater pulmonate snails Lymnaea stagnalis and Lymnaea ovata and three marine prosobranch gastropods Littorina obtusata, Littorina littorea, Buccinum undatum from the White Sea was studied. The species differ in ecology, particularly in trophic nabits and motor activity. The content of triacilglycerides both in digestive gland and pedal was higher in littoral dwellers Littorina the activity of which depends on the tide level. The phospholipids content in digestive gland does not differ in quantity in all cases and does not relate to type of feeding or resource quality. In a pedal muscle of marine species the quantity of common phospholipids is higher in comparison with the freshwater ones. The amount of total phospholipids in pedal muscle correlates with mass of metabolic inert formation which constitutes a part of whole mass of snails. The presence of massive shell enhances demands in energy needed for supporting movement and activity. Because the intensity of energy metabolism is related to quantity of total phospholipids, mitochondria and activity of their oxidizing ferments, the presence of thick shell in marine snails together with motor activity costs more in terms of energy than in freshwater snails with thin shell. This hypothesis is supported by the higher specific rate of oxygen consumption in marine snails than in freshwaters. PMID:19140337

  6. Substrate attributes determine gait in a terrestrial gastropod.

    PubMed

    McKee, Amberle; Voltzow, Janice; Pernet, Bruno

    2013-02-01

    Some terrestrial gastropods are able to move using two gaits: adhesive crawling, where the entire foot is separated from the substrate only by a thin layer of mucus and the snail leaves a continuous mucus trail; and loping, where regions of the foot arch above the substrate and the snail leaves a discontinuous mucus trail. Loping has been interpreted as a means of rapidly escaping predators. We found that the pulmonate Cornu aspersum moved using adhesive crawling on dry acrylic or glass substrates, but loped on dry concrete or wood. Loping snails did not move more rapidly than snails using adhesive crawling. Snails moving on concrete secreted a greater volume of pedal mucus per area of trail than those moving on acrylic; locomotion on concrete thus requires greater expenditure of mucus than does locomotion on acrylic. Because loping snails deposit a smaller area of mucus per distance traveled than do snails using adhesive crawling, loping may conserve mucus when moving on porous, absorbent substrates. Members of several other terrestrial pulmonate taxa can also lope on concrete, suggesting that this plasticity in gait is widespread among terrestrial snails. PMID:23493509

  7. [Toxicity and tetramine contents of salivary glands from carnivorous gastropods].

    PubMed

    Kawashima, Yoko; Nagashima, Yuji; Shiomi, Kazuo

    2002-12-01

    Salivary glands from 29 species of marine carnivorous gastropods in nine families were examined for lethal activity against mice and tetramine content. Mouse lethality was assayed by intravenous injection of buffer extracts into mice, and was detected in 14 species. Heat-stability tests confirmed that toxins in four species were thermolabile, while those in eight species were thermostable. Based on the tetramine contents determined by the colorimetric method using methanolic extracts, the thermostable toxins in seven species (Neptunea eulimatalamellosa, N. vinosa, N. arthritica, N. bulbacea, N. intersculpta f. pribiloffensis, N. intersculpta f. frater pilsbry and Hemifusus tuba) were considered to be tetramine contained at high levels (more than 900 micrograms/g salivary gland), but that in one species (Buccinum opisthoplectum) appeared to be a low-molecular-weight compound differing from tetramine. It is interesting that one (Hemifusus tuba) of the seven species containing high amounts of tetramine belongs to the family Melongenidae, although the other six Neptunea species are members of the family Buccinidae, as expected from previous studies. PMID:12635343

  8. A Method for Quantifying, Visualising, and Analysing Gastropod Shell Form

    PubMed Central

    Liew, Thor-Seng; Schilthuizen, Menno

    2016-01-01

    Quantitative analysis of organismal form is an important component for almost every branch of biology. Although generally considered an easily-measurable structure, the quantification of gastropod shell form is still a challenge because many shells lack homologous structures and have a spiral form that is difficult to capture with linear measurements. In view of this, we adopt the idea of theoretical modelling of shell form, in which the shell form is the product of aperture ontogeny profiles in terms of aperture growth trajectory that is quantified as curvature and torsion, and of aperture form that is represented by size and shape. We develop a workflow for the analysis of shell forms based on the aperture ontogeny profile, starting from the procedure of data preparation (retopologising the shell model), via data acquisition (calculation of aperture growth trajectory, aperture form and ontogeny axis), and data presentation (qualitative comparison between shell forms) and ending with data analysis (quantitative comparison between shell forms). We evaluate our methods on representative shells of the genera Opisthostoma and Plectostoma, which exhibit great variability in shell form. The outcome suggests that our method is a robust, reproducible, and versatile approach for the analysis of shell form. Finally, we propose several potential applications of our methods in functional morphology, theoretical modelling, taxonomy, and evolutionary biology. PMID:27280463

  9. Interstitial Functionalization in elemental Si

    NASA Astrophysics Data System (ADS)

    Kiefer, Boris; Fohtung, Edwin

    Societies in the 21st century will face many challenges. Materials science and materials design will be essential to address and master some if not all of these challenges. Semiconductors are among the most important technological material classes. Properties such as electrical transport are strongly affected by defects and a central goal continues to be the reduction of defect densities as much as possible in these compounds. Here we present results of interstitial Fe doping in elemental Si using first-principles DFT calculations. The preliminary results show that Fe will only occupy octahedral interstitial sites. The analysis of the electronic structure shows that the compounds are ferromagnetic and that a bandgap opens as interstitial Fe concentrations decrease, with a possible intermittent semi-metallic phase. The formation energy for interstitial Fe is unfavorable, as expected, by ~1.5 eV but becomes favorable as the chemical potential of Fe increases. Therefore, we expect that biasing the system with an external electrical field will lead to the formation of these materials. Thus, our results show that interstitial defects can be beneficial for the design of functionalities that differ significantly from those of the host material.

  10. Pathology of Idiopathic Interstitial Pneumonias

    PubMed Central

    Hashisako, Mikiko; Fukuoka, Junya

    2015-01-01

    The updated classification of idiopathic interstitial pneumonias (IIPs) in 2013 by American Thoracic Society/European Respiratory Society included several important revisions to the categories described in the 2002 classification. In the updated classification, lymphoid interstitial pneumonia (LIP) was moved from major to rare IIPs, pleuroparenchymal fibroelastosis (PPFE) was newly included in the rare IIPs, acute fibrinous and organizing pneumonia (AFOP) and interstitial pneumonias with a bronchiolocentric distribution are recognized as rare histologic patterns, and unclassifiable IIP (UCIP) was classified as an IIP. However, recent reports indicate the areas of concern that may require further evaluation. Here, we describe the histopathologic features of the updated IIPs and their rare histologic patterns and also point out some of the issues to be considered in this context. PMID:26949346

  11. Genetics and Idiopathic Interstitial Pneumonias.

    PubMed

    Chu, Sarah G; El-Chemaly, Souheil; Rosas, Ivan O

    2016-06-01

    Significant progress has been made in elucidating the genetics of parenchymal lung diseases, particularly idiopathic interstitial pneumonias (IIPs). IIPs are a heterogeneous group of diffuse interstitial lung diseases of uncertain etiology, diagnosed only after known causes of interstitial lung disease have been excluded. Idiopathic pulmonary fibrosis is the most common IIP. Through candidate gene approaches and genome wide association studies, much light has been shed on the genetic origins of IIPs, enhancing our understanding of risk factors and pathogenesis. However, significant work remains to be accomplished in identifying novel genetic variants and characterizing the function of validated candidate genes in lung pathobiology, their interplay with environmental factors, and ultimately translating these discoveries to patient care. PMID:27231858

  12. Digenean-gastropod host associations inform on aspects of specific immunity in snails

    PubMed Central

    Adema, C.M.; Loker, E.S.

    2014-01-01

    Gastropod immunology is informed importantly by the study of the frequent encounters snails endure with digeneans (digenetic trematodes). One of the hallmarks of gastropod-digenean associations is their specificity: any particular digenean parasite species is transmitted by a limited subset of snail taxa. We discuss the nature of this specificity, including its immunological basis. We then review studies of the model gastropod Biomphalaria glabrata indicating that the baseline responses of snails to digeneans can be elevated in a specific manner. Studies incorporating molecular and functional approaches are then highlighted, and are further suggestive of the capacity for specific gastropod immune responses. These studies have led to the compatibility polymorphism hypothesis: the interactions between diversified fibrinogen-related proteins (FREPs) and diverse carbohydrate-decorated polymorphic parasite antigens determine recognition and trigger specific immunity. Complex glycan structures are also likely to play a role in the host specificity typifying snail-digenean interactions. We conclude by noting the dynamic and consequential interactions between snails and digeneans can be considered as drivers of diversification of digenean parasites and in the development and maintenance of specific immunity in gastropods. PMID:25034871

  13. Conservation status of freshwater gastropods of Canada and the United States

    USGS Publications Warehouse

    Johnson, Paul D.; Bogan, Arthur E.; Brown, Kenneth M.; Burkhead, Noel M.; Cordeiro, James R.; Garner, Jeffrey T.; Hartfield, Paul D.; Lepitzki, Dwayne A.; Mackie, Gerry L.; Pip, Eva; Tarpley, Thomas A.; Tiemann, Jeremy S.; Whelan, Nathan V.; Strong, Ellen E.

    2013-01-01

    This is the first American Fisheries Society conservation assessment of freshwater gastropods (snails) from Canada and the United States by the Gastropod Subcommittee (Endangered Species Committee). This review covers 703 species representing 16 families and 93 genera, of which 67 species are considered extinct, or possibly extinct, 278 are endangered, 102 are threatened, 73 are vulnerable, 157 are currently stable, and 26 species have uncertain taxonomic status. Of the entire fauna, 74% of gastropods are imperiled (vulnerable, threatened, endangered) or extinct, which exceeds imperilment levels in fishes (39%) and crayfishes (48%) but is similar to that of mussels (72%). Comparison of modern to background extinction rates reveals that gastropods have the highest modern extinction rate yet observed, 9,539 times greater than background rates. Gastropods are highly susceptible to habitat loss and degradation, particularly narrow endemics restricted to a single spring or short stream reaches. Compilation of this review was hampered by a paucity of current distributional information and taxonomic uncertainties. Although research on several fronts including basic biology, physiology, conservation strategies, life history, and ecology are needed, systematics and curation of museum collections and databases coupled with comprehensive status surveys (geographic limits, threat identification) are priorities.

  14. Radiocarbon dating loess deposits in the Mississippi Valley using terrestrial gastropod shells (Polygyridae, Helicinidae, and Discidae)

    NASA Astrophysics Data System (ADS)

    Pigati, Jeffrey S.; McGeehin, John P.; Muhs, Daniel R.; Grimley, David A.; Nekola, Jeffrey C.

    2015-03-01

    Small terrestrial gastropod shells (mainly Succineidae) have been used successfully to date late Quaternary loess deposits in Alaska and the Great Plains. However, Succineidae shells are less common in loess deposits in the Mississippi Valley compared to those of the Polygyridae, Helicinidae, and Discidae families. In this study, we conducted several tests to determine whether shells of these gastropods could provide reliable ages for loess deposits in the Mississippi Valley. Our results show that most of the taxa that we investigated incorporate small amounts (1-5%) of old carbon from limestone in their shells, meaning that they should yield ages that are accurate to within a few hundred years. In contrast, shells of the genus Mesodon (Mesodon elevatus and Mesodon zaletus) contain significant and variable amounts of old carbon, yielding ages that are up to a couple thousand 14C years too old. Although terrestrial gastropod shells have tremendous potential for 14C dating loess deposits throughout North America, we acknowledge that accuracy to within a few hundred years may not be sufficient for those interested in developing high-resolution loess chronologies. Even with this limitation, however, 14C dating of terrestrial gastropod shells present in Mississippi Valley loess deposits may prove useful for researchers interested in processes that took place over multi-millennial timescales or in differentiating stratigraphic units that have significantly different ages but similar physical and geochemical properties. The results presented here may also be useful to researchers studying loess deposits outside North America that contain similar gastropod taxa.

  15. Self-Interstitial in Germanium

    NASA Astrophysics Data System (ADS)

    Carvalho, A.; Jones, R.; Janke, C.; Goss, J. P.; Briddon, P. R.; Coutinho, J.; Öberg, S.

    2007-10-01

    Low-temperature radiation damage in n- and p-type Ge is strikingly different, reflecting the charge-dependent properties of vacancies and self-interstitials. We find, using density functional theory, that in Ge the interstitial is bistable, preferring a split configuration when neutral and an open cage configuration when positively charged. The split configuration is inert while the cage configuration acts as a double donor. We evaluate the migration energies of the defects and show that the theory is able to explain the principal results of low-temperature electron-irradiation experiments.

  16. How Is Childhood Interstitial Lung Disease Treated?

    MedlinePlus

    ... the NHLBI on Twitter. How Is Childhood Interstitial Lung Disease Treated? Childhood interstitial lung disease (chILD) is ... prevent acid reflux, which can lead to aspiration. Lung Transplant A lung transplant may be an option ...

  17. Types of Childhood Interstitial Lung Disease

    MedlinePlus

    ... the NHLBI on Twitter. Types of Childhood Interstitial Lung Disease The broad term "childhood interstitial lung disease" ( ... affect are shown in the illustration below. Normal Lungs and Lung Structures Figure A shows the location ...

  18. At the limits of a successful body plan – 3D microanatomy, histology and evolution of Helminthope (Mollusca: Heterobranchia: Rhodopemorpha), the most worm-like gastropod

    PubMed Central

    2013-01-01

    Background Gastropods are among the most diverse animal clades, and have successfully colonized special habitats such as the marine sand interstitial. Specialized meiofaunal snails and slugs are tiny and worm-shaped. They combine regressive features – argued to be due to progenetic tendencies – with convergent adaptations. Microscopic size and concerted convergences make morphological examination non-trivial and hamper phylogenetic reconstructions. The enigmatic turbellarian-like Rhodopemorpha are a small group that has puzzled systematists for over a century. A preliminary molecular framework places the group far closer to the root of Heterobranchia – one of the major gastropod groups – than previously suggested. The poorly known meiofaunal Helminthope psammobionta Salvini-Plawen, 1991 from Bermuda is the most worm-shaped free-living gastropod and shows apparently aberrant aspects of anatomy. Its study may give important clues to understand the evolution of rhodopemorphs among basal heterobranchs versus their previously thought origin among ‘higher’ euthyneuran taxa. Results We describe the 3D-microanatomy of H. psammobionta using three-dimensional digital reconstruction based on serial semithin histological sections. The new dataset expands upon the original description and corrects several aspects. Helminthope shows a set of typical adaptations and regressive characters present in other mesopsammic slugs (called ‘meiofaunal syndrome’ herein). The taxonomically important presence of five separate visceral loop ganglia is confirmed, but considerable further detail of the complex nervous system are corrected and revealed. The digestive and reproductive systems are simple and modified to the thread-like morphology of the animal; the anus is far posterior. There is no heart; the kidney resembles a protonephridium. Data on all organ systems are compiled and compared to Rhodope. Conclusions Helminthope is related to Rhodope sharing unique apomorphies

  19. The Environmental Context of Gastropods on Western Laurentia (Basin and Range Province) during the Great Ordovician Biodiversification Event

    ERIC Educational Resources Information Center

    Dahl, Robyn Mieko

    2015-01-01

    Gastropods are a major component of modern marine ecosystems and can be found in nearly every type of marine ecosystem. They experienced their first notable radiation during the Great Ordovician Biodiversification Event (~470 Ma), during which their diversity tripled. This study examines the gastropod assemblage preserved in the Basin and Range…

  20. Cheсklist of gastropod molluscs in mangroves of Khanh Hoa province, Vietnam.

    PubMed

    Zvonareva, Sofya; Kantor, Yuri

    2016-01-01

    Gastropod molluscs are one of the most important components of mangrove ecosystem. Mangroves in Central Vietnam have a rather limited distribution due to peculiarities of the coastline morphology and presently their fauna remains understudied. Extensive surveys were conducted in both natural vegetation and artificial mangrove plantations in several localities in Nha Trang Bay from 2005 to 2015. In total 65 species of gastropod molluscs were found alive, 17 of which can be considered as predominantly mangrove-associated. An illustrated guide is provided, with short synonymies and data on ecology and distribution. The recorded molluscan diversity is compared with published data on mangrove gastropods in different regions of the Indo-Pacific. Total species number and the proportion of mangrove-associated species are similar to studied faunas in Hong Kong, Malaysia and Thailand, but the diversity is much lower than that of the mangal fauna of the Philippines. PMID:27615983

  1. Antimicrobial secondary metabolites from marine gastropod egg capsules and egg masses

    PubMed Central

    Kaviarasan, T; Siva, Sankar R; Yogamoorthi, A

    2012-01-01

    Marine organisms have attracted special attention in the last three decades for their ability to produce interesting pharmacological active compounds. Even though all marine organisms have the potential to produce antimicrobial secondary metabolites, the gastropod has the vital sources of secondary metabolites particularly their egg capsule which has the promising antimicrobial secondary metabolites. In the present review, we intend to focus on marine secondary metabolites from marine gastropod egg capsule. The following compounds i.e. Kabiramid C, Aplysianin E, Aplysianin A, Thisaplysianin E and Tyrian purple have been documented in egg capsule of various gastropod and most of the antimicrobial secondary metabolites have not been isolated from the egg capsule because of the odious, and complex chemical structure. Stability of the compounds is unknown. PMID:23569871

  2. Bioaccumulation of 210Po in common gastropod and bivalve species from the northern Gulf.

    PubMed

    Uddin, S; Bebhehani, M

    2014-06-01

    This study sets the baseline for the concentration of the natural-series radionuclide polonium-210 in two species of gastropods and four species of bivalves that are common to the Northern Arabian/Persian Gulf. (210)Po is primarily absorbed from water and via ingestion of detrital material by gastropoda and bivalves. This concentrated (210)Po can then be passed along to the next trophic level of the marine food web. The lowest (210)Po concentration was measured in the gastropod Stomatella auricular (10.36-12.39Bq kg(-1)dry) and the highest in the bivalve Marica marmorata (193.51-215.60Bq kg(-1)dry). The measured concentration factor for these molluscs in the northern Gulf varied between 4.8 and 115×10(3), values very similar to the IAEA recommended value for bivalves and gastropods of 2×10(4). PMID:24675441

  3. Ultrasound in Rheumatologic Interstitial Lung Disease: A Case Report of Nonspecific Interstitial Pneumonia in Rheumatoid Arthritis.

    PubMed

    Laria, A; Lurati, A; Scarpellini, M

    2015-01-01

    According to the American Thoracic Society (ATS)/European Respiratory Society consensus classification, idiopathic interstitial pneumonias (IIPs) include several clinic-radiologic-pathologic entities: idiopathic pulmonary fibrosis (IPF), usual interstitial pneumonia (UIP), nonspecific interstitial pneumonia (NSIP), cryptogenic organizing pneumonia, acute interstitial pneumonia, respiratory bronchiolitis-associated ILD, desquamative interstitial pneumonia, and lymphoid interstitial pneumonia. Ultrasound Lung Comets (ULCs) are an echographic chest-sonography hallmark of pulmonary interstitial fibrosis. We describe the ultrasound (US) findings in the follow-up of a NSIP's case in rheumatoid arthritis (RA). PMID:26240772

  4. Late Mississippian gastropods of the Chainman Shale, west-central Utah

    USGS Publications Warehouse

    Gordon, Mackenzie, Jr.; Yochelson, Ellis L.

    1987-01-01

    The Chainman Shale of Mississippian (Osagean to late Chesterian) age, well exposed in the Confusion Range of western Utah, has yielded a profusion of fossils during investigations conducted by the U.S. Geological Survey in the past 30 years. Conspicuous among these fossils are gastropods, which range in age from latest Meramecian to late Chesterian. In west-central Utah, not far from the State boundary, the Chainman outcrop belt stretches from Granite Mountain south to the northern part of the Needle Range, a distance of69 miles (110 km). The Chainman thickens from north to south; the section at Granite Mountain is 1,315 feet (401 m) thick and that at Jensen Wash in the Burbank Hills, 2,203 feet (671 m). The rocks of the Chainman Shale record a general though irregular shallowing of the area from moderate depths of 330 feet (100 m) or so to quite shallow depths of perhaps locally little more than 3-6 feet (1-2 m). Most of the gastropods occur with ammonoids in a facies of shale or shale containing phosphatic limestone concretions, In this lutaceous facies, Glabrocingulum is predominant and Lunulazona and Retispira are common; these genera are represented by a succession of species. A thick limestone unit is present in some areas in the upper part of the formation, particularly in the vicinity of Skunk Spring, where it is 318 feet (97 m) thick. This limestone unit represents a calcareous shoal facies having an entirely different gastropod fauna, characterized by Catazona and species of Naticopsis. The Chainman Shale could be easily zoned by gastropods, but we are not proposing such azonation. A framework of ammonoid and foraminiferal zones already is available, and we prefer to regard the gastropod assemblages as part of this framework. The assemblages are confined to the major ammonoid and foraminiferal zones, and only three of the gastropod species seem to range across major zonal boundaries. These species are Bellerophon (Bellerophon vespertinus Gordon and

  5. Smoking and interstitial lung diseases.

    PubMed

    Margaritopoulos, George A; Vasarmidi, Eirini; Jacob, Joseph; Wells, Athol U; Antoniou, Katerina M

    2015-09-01

    For many years has been well known that smoking could cause lung damage. Chronic obstructive pulmonary disease and lung cancer have been the two most common smoking-related lung diseases. In the recent years, attention has also focused on the role of smoking in the development of interstitial lung diseases (ILDs). Indeed, there are three diseases, namely respiratory bronchiolitis-associated ILD, desquamative interstitial pneumonia and pulmonary Langerhans cell histiocytosis, that are currently considered aetiologically linked to smoking and a few others which are more likely to develop in smokers. Here, we aim to focus on the most recent findings regarding the role of smoking in the pathogenesis and clinical behaviour of ILDs. PMID:26324804

  6. [Interstitial granulomatous dermatitis with arthritis].

    PubMed

    Ebschner, U; Hartschuh, W; Petzoldt, D

    2000-02-01

    Interstitial granulomatous dermatitis with arthritis is a rare dermatologic disorder seen in patients suffering from diseases in which circulating immune complexes occur. The typical cutaneous signs are linear cords usually located on the lateral aspect of the trunk. The characteristic, although not specific, histology reveals a dense diffuse infiltrate composed mostly of histiocytes, accompanied by neutrophils and eosinophils, and degenerated collagen surrounded by palisades of histiocytes. We discuss this disorder and its differential diagnosis. PMID:10743580

  7. Toxin-screening and identification of bacteria isolated from highly toxic marine gastropod Nassarius semiplicatus.

    PubMed

    Wang, Xiao-Jie; Yu, Ren-Cheng; Luo, Xuan; Zhou, Ming-Jiang; Lin, Xiang-Tian

    2008-07-01

    Bacteria isolated from a highly toxic sample of gastropod Nassarius semiplicatus in Lianyungang, Jiangsu Province in July 2007, were studied to probe into the relationship between bacteria and toxicity of nassariid gastropod. The toxicity of the gastropod sample was 2 x 10(2)mouse unit (MU) per gram of tissue (wet weight). High concentration of tetrodotoxin (TTX) and its analogues (TTXs) were found in the digestive gland and muscle of the gastropod, using high performance liquid chromatography coupled with mass chromatography (LC-MS). Bacterial strains isolated from the digestive gland were cultured and screened for TTX with a competitive ELISA method. Tetrodotoxin was detected in a proportion of bacterial strains, but the toxin content was low. Partial 16S ribosomal DNA (rDNA) of the TTX-producing strains was then sequenced and compared with those published in the GenBank to tentatively identify the toxic strains. It was found that most of the toxic strains were closely affiliated with genus Vibrio, and the others were related to genus Shewanella, Marinomonas, Tenacibaculum and Aeromonas. These findings suggest that tetrodotoxin-producing bacteria might play an important role in tetrodotoxin accumulation/production in N. semiplicatus. PMID:18573274

  8. First detection and seasonal variation of lipophilic toxins okadaic acid, dinophysistoxin-1, and yessotoxin in Korean gastropods.

    PubMed

    Lee, Ka Jeong; Mok, Jong Soo; Song, Ki Cheol; Yu, Hongsik; Lee, Doo Seog; Jung, Jee Hyung; Kim, Ji Hoe

    2012-11-01

    Okadaic acid (OA), dinophysistoxin-1 (DTX1), pectenotoxin-2, and yessotoxin (YTX) are classes of lipophilic toxins found in marine animals. OA and DTX1 accumulation causes diarrhetic shellfish poisoning, a worldwide public health problem. Diarrhetic shellfish poisoning has not previously been reported in gastropods, which are widely consumed in Korea. Seasonal variation in marine lipophilic toxins in gastropods was investigated using liquid chromatography-tandem mass spectrometry. Eighty specimens of Neptunea cumingii, 65 specimens of Rapana venosa, and 95 specimens of Batillus cornutus were collected at the Tongyeong fish market on the southern coast of Korea between May 2009 and December 2010. OA, DTX1, and YTX were detected in meat and digestive glands in all gastropod species studied. Pectenotoxin-2 was not found in any sample tested. Lipophilic toxins were detected in the digestive glands of gastropods; no lipophilic toxin was detected in the salivary glands of the carnivorous gastropods, N. cumingii and R. venosa. The highest concentrations of OA (21.5 ng/g) and DTX1 (8.4 ng/g) were detected in the digestive glands of R. venosa, and the maximum concentration of YTX (13.7 ng/g) was found in the digestive glands of N. cumingii. The maximum toxicities in gastropod tissues were lower than the European standard for acceptable levels. The concentrations of lipophilic toxins in carnivorous gastropods showed a high degree of seasonal variation; lipophilic toxins in carnivorous gastropods were found predominantly in spring and summer. This is the first report of the occurrence of lipophilic toxins in Korean gastropods. PMID:23127709

  9. Large-Scale Spatial Distribution Patterns of Gastropod Assemblages in Rocky Shores

    PubMed Central

    Miloslavich, Patricia; Cruz-Motta, Juan José; Klein, Eduardo; Iken, Katrin; Weinberger, Vanessa; Konar, Brenda; Trott, Tom; Pohle, Gerhard; Bigatti, Gregorio; Benedetti-Cecchi, Lisandro; Shirayama, Yoshihisa; Mead, Angela; Palomo, Gabriela; Ortiz, Manuel; Gobin, Judith; Sardi, Adriana; Díaz, Juan Manuel; Knowlton, Ann; Wong, Melisa; Peralta, Ana C.

    2013-01-01

    Gastropod assemblages from nearshore rocky habitats were studied over large spatial scales to (1) describe broad-scale patterns in assemblage composition, including patterns by feeding modes, (2) identify latitudinal pattern of biodiversity, i.e., richness and abundance of gastropods and/or regional hotspots, and (3) identify potential environmental and anthropogenic drivers of these assemblages. Gastropods were sampled from 45 sites distributed within 12 Large Marine Ecosystem regions (LME) following the NaGISA (Natural Geography in Shore Areas) standard protocol (www.nagisa.coml.org). A total of 393 gastropod taxa from 87 families were collected. Eight of these families (9.2%) appeared in four or more different LMEs. Among these, the Littorinidae was the most widely distributed (8 LMEs) followed by the Trochidae and the Columbellidae (6 LMEs). In all regions, assemblages were dominated by few species, the most diverse and abundant of which were herbivores. No latitudinal gradients were evident in relation to species richness or densities among sampling sites. Highest diversity was found in the Mediterranean and in the Gulf of Alaska, while highest densities were found at different latitudes and represented by few species within one genus (e.g. Afrolittorina in the Agulhas Current, Littorina in the Scotian Shelf, and Lacuna in the Gulf of Alaska). No significant correlation was found between species composition and environmental variables (r≤0.355, p>0.05). Contributing variables to this low correlation included invasive species, inorganic pollution, SST anomalies, and chlorophyll-a anomalies. Despite data limitations in this study which restrict conclusions in a global context, this work represents the first effort to sample gastropod biodiversity on rocky shores using a standardized protocol across a wide scale. Our results will generate more work to build global databases allowing for large-scale diversity comparisons of rocky intertidal assemblages. PMID

  10. Large-scale spatial distribution patterns of gastropod assemblages in rocky shores.

    PubMed

    Miloslavich, Patricia; Cruz-Motta, Juan José; Klein, Eduardo; Iken, Katrin; Weinberger, Vanessa; Konar, Brenda; Trott, Tom; Pohle, Gerhard; Bigatti, Gregorio; Benedetti-Cecchi, Lisandro; Shirayama, Yoshihisa; Mead, Angela; Palomo, Gabriela; Ortiz, Manuel; Gobin, Judith; Sardi, Adriana; Díaz, Juan Manuel; Knowlton, Ann; Wong, Melisa; Peralta, Ana C

    2013-01-01

    Gastropod assemblages from nearshore rocky habitats were studied over large spatial scales to (1) describe broad-scale patterns in assemblage composition, including patterns by feeding modes, (2) identify latitudinal pattern of biodiversity, i.e., richness and abundance of gastropods and/or regional hotspots, and (3) identify potential environmental and anthropogenic drivers of these assemblages. Gastropods were sampled from 45 sites distributed within 12 Large Marine Ecosystem regions (LME) following the NaGISA (Natural Geography in Shore Areas) standard protocol (www.nagisa.coml.org). A total of 393 gastropod taxa from 87 families were collected. Eight of these families (9.2%) appeared in four or more different LMEs. Among these, the Littorinidae was the most widely distributed (8 LMEs) followed by the Trochidae and the Columbellidae (6 LMEs). In all regions, assemblages were dominated by few species, the most diverse and abundant of which were herbivores. No latitudinal gradients were evident in relation to species richness or densities among sampling sites. Highest diversity was found in the Mediterranean and in the Gulf of Alaska, while highest densities were found at different latitudes and represented by few species within one genus (e.g. Afrolittorina in the Agulhas Current, Littorina in the Scotian Shelf, and Lacuna in the Gulf of Alaska). No significant correlation was found between species composition and environmental variables (r≤0.355, p>0.05). Contributing variables to this low correlation included invasive species, inorganic pollution, SST anomalies, and chlorophyll-a anomalies. Despite data limitations in this study which restrict conclusions in a global context, this work represents the first effort to sample gastropod biodiversity on rocky shores using a standardized protocol across a wide scale. Our results will generate more work to build global databases allowing for large-scale diversity comparisons of rocky intertidal assemblages. PMID

  11. Abundance, diversity, and latitudinal gradients of southeastern Atlantic and Antarctic abyssal gastropods

    NASA Astrophysics Data System (ADS)

    Schrödl, M.; Bohn, J. M.; Brenke, N.; Rolán, E.; Schwabe, E.

    2011-03-01

    Mollusca are widely used for deriving concepts on deep-sea biology and biodiversity, yet abyssal collections are limited to only a few regions of the world ocean and biased toward the northern Atlantic. The present study compares gastropod molluscs sampled along a transect through the southern Atlantic from the equator to Antarctica. The DIVA I and II expeditions concentrated on the hardly explored Guinea, Angola, and Cape Basins. Of the 145 deep-sea deployments (5025-5656 m depth) analyzed to date, 20 have yielded 68 specimens of benthic gastropods, representing 27 species. Only five abyssal species were previously known, four of them from the northern Atlantic deep sea; the remainder appear to be undescribed. Interestingly, there is no faunal overlap with the nearby Antarctic deep-sea. Most of these DIVA species (63%) are represented by single individuals, or limited to one or two stations. The rarity (i.e. 0.55 specimens m -2 calculated from quantitative corers) and still undetectable patchiness of southeastern Atlantic abyssal gastropods may indicate "source-sink" dynamics, but comparison is needed with thus far hardly explored regional bathyal faunas. The BRENKE-epibenthic sledge (EBS) may be efficient at surveying the abyssal gastropod species richness, but is shown to drastically underestimate true abundances. Low diversity values throughout the three southern Atlantic ocean basins do further challenge earlier estimates of a hyperdiverse global abyssal macrofauna. Comparative EBS data available from the southern hemisphere indicate a gradient from the equatorial Guinea Basin towards higher gastropod abundances and diversity in Antarctica. This is in clear contrast to the paradigm of a globally strongly decreasing marine diversity from lower to higher latitudes, highlighting the importance of further exploring the southern fauna from the tropics to Antarctica.

  12. Radiocarbon dating loess deposits in the Mississippi Valley using terrestrial gastropod shells (Polygyridae, Helicinidae, and Discidae)

    USGS Publications Warehouse

    Pigati, Jeffery S.; McGeehin, John P.; Muhs, Daniel; Grimley, David A.; Nekola, Jeffery C.

    2014-01-01

    Small terrestrial gastropod shells (mainly Succineidae) have been used successfully to date late Quaternary loess deposits in Alaska and the Great Plains. However, Succineidae shells are less common in loess deposits in the Mississippi Valley compared to those of the Polygyridae, Helicinidae, and Discidae families. In this study, we conducted several tests to determine whether shells of these gastropods could provide reliable ages for loess deposits in the Mississippi Valley. Our results show that most of the taxa that we investigated incorporate small amounts (1–5%) of old carbon from limestone in their shells, meaning that they should yield ages that are accurate to within a few hundred years. In contrast, shells of the genus Mesodon(Mesodon elevatus and Mesodon zaletus) contain significant and variable amounts of old carbon, yielding ages that are up to a couple thousand 14C years too old. Although terrestrial gastropod shells have tremendous potential for 14C dating loess deposits throughout North America, we acknowledge that accuracy to within a few hundred years may not be sufficient for those interested in developing high-resolution loess chronologies. Even with this limitation, however, 14C dating of terrestrial gastropod shells present in Mississippi Valley loess deposits may prove useful for researchers interested in processes that took place over multi-millennial timescales or in differentiating stratigraphic units that have significantly different ages but similar physical and geochemical properties. The results presented here may also be useful to researchers studying loess deposits outside North America that contain similar gastropod taxa..

  13. Suspected ciprofloxacin-induced interstitial nephritis.

    PubMed

    Murray, K M; Wilson, M G

    1990-04-01

    Interstitial nephritis is a rare but serious adverse effect of many drugs and usually is diagnosed by clinical signs and symptoms of hematuria, proteinuria, eosinophilia, fever, azotemia, and rash. Ciprofloxacin is one drug that has been reported to cause interstitial nephritis. Renal toxicities have been reported in less than one percent of the patients receiving ciprofloxacin therapy. Limited documentation of this adverse effect exists in the literature. This article describes a patient with suspected ciprofloxacin-induced interstitial nephritis. PMID:2327115

  14. Granulomatous interstitial nephritis and Crohn's disease.

    PubMed

    Timmermans, Sjoerd A M E G; Christiaans, Maarten H L; Abdul-Hamid, Myrurgia A; Stifft, Frank; Damoiseaux, Jan G M C; van Paassen, Pieter

    2016-08-01

    Granulomatous interstitial nephritis has been observed in <1% of native renal biopsies. Here, we describe two patients with granulomatous interstitial nephritis in relation to Crohn's disease. Circulating helper and cytotoxic T cells were highly activated, and both cell types predominated in the interstitial infiltrate, indicating a cellular autoimmune response. After immunosuppressive treatment, renal function either improved or stabilized in both patients. In conclusion, granulomatous interstitial nephritis is a genuine extraintestinal manifestation of Crohn's disease, the treatment of which should include immunosuppressive agents. PMID:27478596

  15. Grazing damage to plants and gastropod and grasshopper densities in a CO 2-enrichment experiment on calcareous grassland

    NASA Astrophysics Data System (ADS)

    Ledergerber, Stephan; Thommen, G. Heinrich; Baur, Bruno

    Plant-herbivore interactions may change as atmospheric CO 2 concentrations continue to rise. We examined the effects of elevated atmospheric CO 2 and CO 2-exposure chambers on the grazing damage to plants, and on the abundances of potential herbivores (terrestrial gastropods and grasshoppers) in a calcareous grassland in the Jura mountains of Switzerland (village of Nenzlingen). Individuals of most plant species examined showed slight grazing damage. However, plots with CO 2 enrichment and plots with ambient atmosphere did not differ in the extent of grazing damage. Similarly, plots with CO 2 enrichment and plots with ambient atmosphere did not differ in either gastropod or grasshopper density. Experimental plots with and without chambers did not differ in the number of gastropods. However, the densities of gastropods and grasshoppers and extent of grazing damage to plants were generally lower in the experimental area than in the grassland outside the experimental field.

  16. Radiocarbon dating late Quaternary loess deposits using small terrestrial gastropod shells

    NASA Astrophysics Data System (ADS)

    Pigati, Jeffrey S.; McGeehin, John P.; Muhs, Daniel R.; Bettis, E. Arthur

    2013-09-01

    Constraining the ages and mass accumulation rates of late Quaternary loess deposits is often difficult because of the paucity of organic material typically available for 14C dating and the inherent limitations of luminescence techniques. Radiocarbon dating of small terrestrial gastropod shells may provide an alternative to these methods as fossil shells are common in loess and contain ˜12% carbon by weight. Terrestrial gastropod assemblages in loess have been used extensively to reconstruct past environmental conditions but have been largely ignored for dating purposes. Here, we present the results of a multi-faceted approach to understanding the potential for using small terrestrial gastropod shells to date loess deposits in North America. First, we compare highly resolved 14C ages of well-preserved wood and gastropod shells (Succineidae) recovered from a Holocene loess section in Alaska. Radiocarbon ages derived from the shells are nearly identical to wood and plant macrofossil ages throughout the section, which suggests that the shells behaved as closed systems with respect to carbon for at least the last 10 ka (thousands of calibrated 14C years before present). Second, we apply 14C dating of gastropod shells to late Pleistocene loess deposits in the Great Plains using stratigraphy and independent chronologies for comparison. The new shell ages require less interpretation than humic acid radiocarbon ages that are commonly used in loess studies, provide additional stratigraphic coverage to previous dating efforts, and are in correct stratigraphic order more often than their luminescence counterparts. Third, we show that Succineidae shells recovered from historic loess in the Matanuska River Valley, Alaska captured the 20th century 14C bomb spike, which suggests that the shells can be used to date late Holocene and historic-aged loess. Finally, results from Nebraska and western Iowa suggest that, similar to other materials, shell ages approaching ˜40 ka should

  17. Radiocarbon dating late Quaternary loess deposits using small terrestrial gastropod shells

    USGS Publications Warehouse

    Pigati, Jeff S.; McGeehin, John P.; Muhs, Daniel R.; Bettis, E. Arthur, III

    2013-01-01

    Constraining the ages and mass accumulation rates of late Quaternary loess deposits is often difficult because of the paucity of organic material typically available for 14C dating and the inherent limitations of luminescence techniques. Radiocarbon dating of small terrestrial gastropod shells may provide an alternative to these methods as fossil shells are common in loess and contain ∼12% carbon by weight. Terrestrial gastropod assemblages in loess have been used extensively to reconstruct past environmental conditions but have been largely ignored for dating purposes. Here, we present the results of a multi-faceted approach to understanding the potential for using small terrestrial gastropod shells to date loess deposits in North America. First, we compare highly resolved 14C ages of well-preserved wood and gastropod shells (Succineidae) recovered from a Holocene loess section in Alaska. Radiocarbon ages derived from the shells are nearly identical to wood and plant macrofossil ages throughout the section, which suggests that the shells behaved as closed systems with respect to carbon for at least the last 10 ka (thousands of calibrated 14C years before present). Second, we apply 14C dating of gastropod shells to late Pleistocene loess deposits in the Great Plains using stratigraphy and independent chronologies for comparison. The new shell ages require less interpretation than humic acid radiocarbon ages that are commonly used in loess studies, provide additional stratigraphic coverage to previous dating efforts, and are in correct stratigraphic order more often than their luminescence counterparts. Third, we show that Succineidae shells recovered from historic loess in the Matanuska River Valley, Alaska captured the 20th century 14C bomb spike, which suggests that the shells can be used to date late Holocene and historic-aged loess. Finally, results from Nebraska and western Iowa suggest that, similar to other materials, shell ages approaching ∼40 ka should

  18. Sildenafil Induced Acute Interstitial Nephritis

    PubMed Central

    Burkhart, Ryan; Shah, Nina; Lewin, Matthew

    2015-01-01

    Acute interstitial nephritis (AIN) is characterized by inflammation of the renal interstitium and usually occurs in a temporal relationship with the medication. We present a case of an Asian male who had nephrotic range proteinuria and presented with acute kidney injury. The patient reported an acute change in physical appearance and symptomatology after the ingestion of a single dose of sildenafil. Renal biopsy was notable for minimal change disease (MCD) with acute and chronic interstitial nephritis. Renal replacement and glucocorticoid therapy were initiated. Renal recovery within six weeks permitted discontinuation of dialysis. AIN superimposed on MCD is a known association of NSAID induced nephropathy. The temporal association and the absence of any new drugs suggest that the AIN was most likely due to the sildenafil. NSAIDs are less likely to have caused the AIN given their remote use. The ease of steroid responsiveness would also suggest another cause as NSAID induced AIN is often steroid resistant. The MCD was most likely idiopathic given the lack of temporal association with a secondary cause. As the number of sildenafil prescriptions increases, more cases of AIN may be identified and physician awareness for this potential drug disease association is necessary. PMID:26491581

  19. Symmetry breaking in gastropod locomotion through acceleration or deceleration of the pedal waves

    NASA Astrophysics Data System (ADS)

    Del Alamo, Juan C.; Rodriguez-Rodriguez, Javier; Lai, Janice; Shepherd, Robert D.; Lasheras, Juan C.

    2008-03-01

    Marine and terrestrial gastropods move by gliding over a ventral foot that is lubricated by secreted mucus (terrestrial) or simply by water (marine). The rim of the ventral foot generates suction forces that keep the animal adhered to the substrate. The central part of the foot produces a forward traction force by generating trains of pedal waves through periodic muscle contractions. Recent experiments show that, in some gastropods, these pedal waves become faster and longer as they move forward, suggesting a mechanism for breaking the symmetry in the flow between the pedal waves and the substrate. To investigate this mechanism, we have analyzed theoretically a two-dimensional lubrication layer between a train of waves of slowly varying length and speed, and a flat, rigid, impermeable surface. The inhomogeneity of the pedal waves has been modeled through multiple-scale asymptotics. We have considered a Newtonian fluid to separate the effect of this inhomogeneity from the viscoelastic symmetry breaking reported in previous works.

  20. [Interstitial lung diseases associated with smoking].

    PubMed

    Nová, Markéta; Hornychová, Helena; Matěj, Radoslav

    2016-01-01

    There are many different interstitial lung diseases associated with smoking. This short review describes officially recognized disorders (desquamative interstitial pneumonia, respiratory bronchiolitis and pulmonary Langerhans´cells histiocytosis) and entities with uncertain relationship to smoking, which have recently been published in the literature. Histopathological pictures and differential diagnosis of smoking-related diseases of the lungs are discussed. PMID:27223588

  1. Neuromuscular development in Patellogastropoda (Mollusca: Gastropoda) and its importance for reconstructing ancestral gastropod bodyplan features

    PubMed Central

    Kristof, Alen; de Oliveira, André Luiz; Kolbin, Konstantin G.; Wanninger, Andreas

    2015-01-01

    Within Gastropoda, limpets (Patellogastropoda) are considered the most basal branching taxon and its representatives are thus crucial for research into evolutionary questions. Here, we describe the development of the neuromuscular system in Lottia cf. kogamogai. In trochophore larvae, first serotonin-like immunoreactivity (lir) appears in the apical organ and in the prototroch nerve ring. The arrangement and number of serotonin-lir cells in the apical organ (three flask-shaped, two round cells) are strikingly similar to those in putatively derived gastropods. First, FMRFamide-lir appears in veliger larvae in the Anlagen of the future adult nervous system including the cerebral and pedal ganglia. As in other gastropods, the larvae of this limpet show one main and one accessory retractor as well as a pedal retractor and a prototroch muscle ring. Of these, only the pedal retractor persists until after metamorphosis and is part of the adult shell musculature. We found a hitherto undescribed, paired muscle that inserts at the base of the foot and runs towards the base of the tentacles. An apical organ with flask-shaped cells, one main and one accessory retractor muscle is commonly found among gastropod larvae and thus might have been part of the last common ancestor. PMID:26869747

  2. Dominant species of the gastropod fauna from the littoral region in Lake Ohrid of R. Macedonia.

    PubMed

    Smiljkov, S; Budzakoska-Gjoreska, B; Sapkarev, J; Trajanovski, S

    2007-07-01

    The class of Gastropoda is one of the Lake Ohrid' macrozoobenthic groups, which characterize highest level of endemism. Since the first published references until now, studying the Lake Ohrid's snail fauna represents huge scientific challenge for many malacologists from the world. The high percent of endemic as well as relic forms among the lake's gastropods could be explained by the processes of intralacustric speciation during the history and evolution of this aquatic ecosystem. These processes no doubt have been enabled by the complexity and stability of the Lake's basin. This work represents the results of the dominant species, from both qualitative and quantitative sense of the gastropod fauna from 19 investigated littoral localities of Lake Ohrid. The results from the investigations on gastropod fauna has shown that following species: Chilopyrgula sturanyi, Radix relicta and Valvata stenotrema quailtatively predominates in the samples from the littoral region of the Macedonian part of Lake Ohrid. The quantitative analyses (according to their presence on m2), has shown that the following species predominate: Chilopyrgula sturanyi (6879 No x m2), Theodoxus fluviatilis dalmaticus (6412 No x m2), Pyrgohydrobia grochmalickii (5504 No x m2) and Valvata stenotrema (5009 No x m2). PMID:17921924

  3. New gastropods from deep-sea hydrocarbon seeps off West Africa

    NASA Astrophysics Data System (ADS)

    Warén, Anders; Bouchet, Philippe

    2009-12-01

    Thirteen new species of gastropods are described from the Zairov 1-2 and Biozaire 1-3 cruises to the methane seeps off the Congo River: Patellogastropoda: Paralepetopsis sasakii sp. nov. (Neolepetopsidae); Cocculiniformia: Pyropelta oluae sp. nov. and P. sibuetae sp. nov. (Pyropeltidae); Tentaoculus granulatus sp. nov. (Pseudococculinidae); Neomphalina: Leptogyra costellata sp. nov. (Family uncertain); Vetigastropoda: Puncturella similis sp. nov. (Fissurellidae); Lepetodrilus shannonae sp. nov. (Lepetodrilidae); Caenogastropoda: Provanna reticulata sp. nov. and P. chevalieri sp. nov., Cordesia provannoides gen. et sp. nov. (Provannidae); Phymorhynchus coseli sp. nov. and P. cingulata sp. nov. (Conidae); Heterobranchia: Hyalogyrina rissoella sp. nov. (Hyalogyrinidae). All species except T. granulatus (from a settlement trap) belong to groups known from cold seeps and the entire seep fauna here is new to science. Biogeographical affinity of this gastropod fauna is to the West Atlantic seeps, not to the Mediterranean seeps or Mid-Atlantic vents. Fragments of the autecology of the species are presented. The evolution of the seep gastropod fauna is briefly discussed and a continuous immigration of taxa is supported. The oldest verified occurrences of modern taxa in the seeps date back to Cenomanian (Cretaceous) time, while some taxa seem not to appear until very late Tertiary.

  4. Update on lymphoid interstitial pneumonitis.

    PubMed

    Fishback, N; Koss, M

    1996-09-01

    Lymphoid interstitial pneumonitis (LIP) involves a clinicopathologic pattern of pulmonary disease characterized by diffuse interstitial reactive lymphoid infiltrates. In adults, it occurs most commonly in autoimmune diseases, such as Sjögren's syndrome (0.9% of these patients) and primary biliary cirrhosis, whereas in children it is usually seen in HIV infection. Dysproteinemias (hyper- and hypogammaglobulinemia) are found in more than 60% of patients. Children can show CD8-lymphocytosis in bronchoalveolar lavage fluid, lung tissue, peripheral blood, and salivary gland, associated with HLA-DR5 haplotype. Radiographically, most patients with LIP have reticulonodular infiltrates, with or without patchy areas of consolidation. CT scans can show both small nodular and ground glass patterns, patterns that are diagnostically nonspecific. Reduced lung volumes and diffusing capacities are consistent and sensitive indicators of disease in LIP. In an experimental model, diffusing capacity was the single most sensitive functional index of disease progression. Microscopically, LIP is part of a spectrum of pulmonary lymphoid proliferations, ranging from follicular bronchitis-bronchiolitis and pulmonary lymphoid hyperplasia (the latter in AIDS patients), proliferations largely limited to airways, to low-grade malignant lymphoma. These patterns may be difficult to differentiate from each other. It appears that LIP sometimes evolves to lymphoma; the frequency of this evolution is probably low but is difficult to assess because low-grade lymphomas may mimic LIP. A relatively high frequency of LIP patients have Epstein-Barr virus DNA in their lungs but not all patients with LIP show this finding, suggesting other possible etiologies. PMID:9363179

  5. Functional respiratory assessment in interstitial lung disease.

    PubMed

    Miguel-Reyes, José Luis; Gochicoa-Rangel, Laura; Pérez-Padilla, Rogelio; Torre-Bouscoulet, Luis

    2015-01-01

    Interstitial lung diseases are a heterogeneous group of disorders that affect, to a greater or lesser degree, the alveolus, peripheral airway, and septal interstitium. Functional assessment in patients suspected of having an interstitial lung disease has implications for diagnosis and makes it possible to objectively analyze both response to treatment and prognosis. Recently the clinical value of lung-diffusing capacity and the six-minute walking test has been confirmed, and these are now important additions to the traditional assessment of lung function that is based on spirometry. Here we review the state-of-the-art methods for the assessment of patients with interstitial lung disease. PMID:25857578

  6. Interstitial Ectopic Pregnancy: Conservative Surgical Management

    PubMed Central

    Warda, Hussein; Mamik, Mamta M.; Ashraf, Mohammad

    2014-01-01

    Introduction: Interstitial pregnancy is a rare and life-threatening condition. Diagnosis and appropriate management are critical in preventing morbidity and death. Case Description: Four cases of interstitial pregnancy are presented. Diagnostic laparoscopy followed by laparotomy and cornuostomy with removal of products of conception was performed in 1 case. Laparoscopic cornuostomy and removal of products of conception were performed in the subsequent 3 cases with some modifications of the technique. Subsequent successful reproductive outcomes are also presented. Discussion: Progressively conservative surgical measures are being used to treat interstitial pregnancy successfully, with no negative impact on subsequent pregnancies. PMID:24960482

  7. Imaging of Childhood Interstitial Lung Disease

    PubMed Central

    2010-01-01

    The aphorism that children are not little adults certainly applies for the imaging of interstitial lung disease. Acquiring motion-free images of fine pulmonary structures at desired lung volumes is much more difficult in children than in adults. Several forms of interstitial lung disease are unique to children, and some forms of interstitial lung disease encountered in adults rarely, if ever, occur in children. Meticulous attention to imaging technique and specialized knowledge are required to properly perform and interpret chest imaging studies obtained for the evaluation of childhood interstitial lung disease (chILD). This review will address technique recommendations for imaging chILD, the salient imaging findings in various forms of chILD, and the efficacy of imaging in the diagnosis and management of chILD. PMID:22332031

  8. Interstitial fibrosis and growth factors.

    PubMed Central

    Lasky, J A; Brody, A R

    2000-01-01

    Interstitial pulmonary fibrosis (IPF) is scarring of the lung caused by a variety of inhaled agents including mineral particles, organic dusts, and oxidant gases. The disease afflicts millions of individuals worldwide, and there are no effective therapeutic approaches. A major reason for this lack of useful treatments is that few of the molecular mechanisms of disease have been defined sufficiently to design appropriate targets for therapy. Our laboratory has focused on the molecular mechanisms through which three selected peptide growth factors could play a role in the development of IPF. Hundreds of growth factors and cytokines could be involved in the complex disease process. We are studying platelet-derived growth factor because it is the most potent mesenchymal cell mitogen yet described, transforming growth factor beta because it is a powerful inducer of extracellular matrix (scar tissue) components by mesenchymal cells, and tumor necrosis factor alpha because it is a pleiotropic cytokine that we and others have shown is essential for the development of IPF in animal models. This review describes some of the evidence from studies in humans, in animal models, and in vitro, that supports the growth factor hypothesis. The use of modern molecular and transgenic technologies could elucidate those targets that will allow effective therapeutic approaches. Images Figure 1 Figure 2 PMID:10931794

  9. Interstitial lung diseases in children

    PubMed Central

    2010-01-01

    Interstitial lung disease (ILD) in infants and children comprises a large spectrum of rare respiratory disorders that are mostly chronic and associated with high morbidity and mortality. These disorders are characterized by inflammatory and fibrotic changes that affect alveolar walls. Typical features of ILD include dyspnea, diffuse infiltrates on chest radiographs, and abnormal pulmonary function tests with restrictive ventilatory defect and/or impaired gas exchange. Many pathological situations can impair gas exchange and, therefore, may contribute to progressive lung damage and ILD. Consequently, diagnosis approach needs to be structured with a clinical evaluation requiring a careful history paying attention to exposures and systemic diseases. Several classifications for ILD have been proposed but none is entirely satisfactory especially in children. The present article reviews current concepts of pathophysiological mechanisms, etiology and diagnostic approaches, as well as therapeutic strategies. The following diagnostic grouping is used to discuss the various causes of pediatric ILD: 1) exposure-related ILD; 2) systemic disease-associated ILD; 3) alveolar structure disorder-associated ILD; and 4) ILD specific to infancy. Therapeutic options include mainly anti-inflammatory, immunosuppressive, and/or anti-fibrotic drugs. The outcome is highly variable with a mortality rate around 15%. An overall favorable response to corticosteroid therapy is observed in around 50% of cases, often associated with sequelae such as limited exercise tolerance or the need for long-term oxygen therapy. PMID:20727133

  10. Lupus-erythematous-associated interstitial granulomatous dermatitis.

    PubMed

    Marmon, Shoshana; Robinson, Maria; Meehan, Shane A; Franks, Andrew G

    2012-12-01

    A 41-year-old woman with a prior diagnosis of lupus erythematous presented with a five-year history of small, erythematous, flesh-colored papules and nodules that coalesced into symmetrically-distributed plaques on her upper back. A biopsy specimen showed an interstitial, granulomatous mixed-cell dermatitis with eosinophils. These clinicopathologic findings are consistent with a diagnosis of lupus erythematous-associated interstitial granulomatous dermatitis. PMID:23286821

  11. Interstitial zinc clusters in zinc oxide

    NASA Astrophysics Data System (ADS)

    Gluba, M. A.; Nickel, N. H.; Karpensky, N.

    2013-12-01

    Doped zinc oxide (ZnO) exhibits anomalous Raman modes in the range of 270 to 870 cm-1. Commonly, the resonance at 275 cm-1 is attributed to the local vibration of Zn atoms in the vicinity of extrinsic dopants. We revisit this assignment by investigating the influence of isotopically purified zinc oxide thin films on the frequency of the vibrational mode around 275 cm-1. For this purpose, undoped and nitrogen-doped ZnO thin-films with Zn isotope compositions of natural Zn, 64Zn, 68Zn, and a 1:1 mixture of 64Zn and 68Zn were grown by pulsed laser deposition. The isotopic shift and the line shape of the Raman resonance around 275 cm-1 are analyzed in terms of three different microscopic models, which involve the vibration of (i) interstitial zinc atoms bound to extrinsic defects, (ii) interstitial diatomic Zn molecules, and (iii) interstitial zinc clusters. The energy diagram of interstitial Zn-Zn bonds in a ZnO matrix is derived from density functional theory calculations. The interstitial Zn-Zn bond is stabilized by transferring electrons from the antibonding orbital into the ZnO conduction band. This mechanism facilitates the formation of interstitial Zn clusters and fosters the common n-type doping asymmetry of ZnO.

  12. Interstitial cystitis. Etiology, diagnosis, and treatment.

    PubMed Central

    Nickel, J. C.

    2000-01-01

    OBJECTIVE: To review current knowledge about the epidemiology, etiology, diagnosis, and treatment of interstitial cystitis, with special emphasis on management of this condition by family physicians. QUALITY OF EVIDENCE: Articles were identified through MEDLINE and review of abstracts presented at Urology and Interstitial Cystitis meetings during the last decade. Recent reviews were further searched for additional studies and trials. Data were summarized from large epidemiologic studies. Etiologic theories were extracted from current concepts and reviews of scientific studies. Diagnostic criteria described in this review are based on clinical interpretation of National Institutes of Health (NIH) research guidelines, interpretation of data from the NIH Interstitial Cystitis Cohort Study, and recent evidence on use of the potassium sensitivity test. Treatment suggestions are based on six randomized placebo-controlled clinical treatment trials and best available clinical data. MAIN MESSAGE: Interstitial cystitis affects about 0.01% to 0.5% of women. Its etiology is unknown, but might involve microbiologic, immunologic, mucosal, neurogenic, and other yet undefined agents. The diagnosis of interstitial cystitis is a diagnosis of exclusion. It is impossible to provide a purely evidence-based treatment strategy, but review of available evidence suggests that conservative supportive therapy (including diet modification); oral treatment with pentosan polysulfate, amitriptyline, or hydroxyzine; and intravesical treatments with heparinlike medications, dimethyl sulfoxide, or BCG vaccine could benefit some patients. CONCLUSION: Family physicians should have an understanding of interstitial cystitis and be able to make a diagnosis and formulate an evidence-based treatment strategy for their patients. PMID:11153410

  13. Human telomeric proteins occupy selective interstitial sites

    PubMed Central

    Yang, Dong; Xiong, Yuanyan; Kim, Hyeung; He, Quanyuan; Li, Yumei; Chen, Rui; Songyang, Zhou

    2011-01-01

    Human telomeres are bound and protected by protein complexes assembled around the six core telomeric proteins RAP1, TRF1, TRF2, TIN2, TPP1, and POT1. The function of these proteins on telomeres has been studied extensively. Recently, increasing evidence has suggested possible roles for these proteins outside of telomeres. However, the non-canonical (extra-telomeric) function of human telomeric proteins remains poorly understood. To this end, we systematically investigated the binding sites of telomeric proteins along human chromosomes, by performing whole-genome chromatin immunoprecipitation (ChIP) for RAP1 and TRF2. ChIP sequencing (ChIP-seq) revealed that RAP1 and TRF2 could be found on a small number of interstitial sites, including regions that are proximal to genes. Some of these binding sites contain short telomere repeats, suggesting that telomeric proteins could directly bind to interstitial sites. Interestingly, only a small fraction of the available interstitial telomere repeat-containing regions were occupied by RAP1 and TRF2. Ectopically expressed TRF2 was able to occupy additional interstitial telomere repeat sites, suggesting that protein concentration may dictate the selective targeting of telomeric proteins to interstitial sites. Reducing RAP1 and TRF2 expression by RNA interference led to altered transcription of RAP1- and TRF2-targeted genes. Our results indicate that human telomeric proteins could occupy a limited number of interstitial sites and regulate gene transcription. PMID:21423278

  14. Freshwater gastropods of Neogene and Quaternary lake systems of Europe - state of the art and outlook

    NASA Astrophysics Data System (ADS)

    Neubauer, Thomas A.; Harzhauser, Mathias; Mandic, Oleg; Kroh, Andreas

    2013-04-01

    Globally, about 4000 extant species of freshwater gastropod species have been described. In contrast, only 225 species are listed by MollBase2012 for North- and Central Europe. Many of these are rare species, limited to certain springs and in fact the typical diversity of gastropods in lakes of North and Central Europe is much lower. The high number is boosted by several highly speciose endemic radiations in long-lived ancient lakes, which are hotspots for biodiversity. These long-lived ancient lakes provide key examples for understanding evolutionary processes and therefore are intensively studied. During the Neogene, Europe's geodynamic history gave rise to several such long-lived lakes with conspicuous endemic radiations. However, these lacustrine systems are rare today as well as in the past compared to the enormous numbers of "normal" lakes. Most extant European lakes are mainly results of the Ice Ages and are due to their geologically temporary nature largely confined to the Pleistocene-Holocene. Also deposits of streams, springs, and groundwater, which today are inhabited by species-rich gastropod assemblages, are rarely preserved. Thus, the pre-Quaternary lacustrine record is biased towards long-lived systems. Apart from few general overviews precise studies on the γ-diversities of the post-Oligocene European lake systems and the shifting biodiversity in European freshwater systems through space and time are entirely missing. Even for the modern faunas, literature on large-scale freshwater gastropod diversity in extant lakes is scarce and lacks a statistical approach. Building upon a great amount of existing literature, a new project will provide the first detailed assessment of the composition of European freshwater gastropods during the Neogene and Quaternary at species, genus and family levels, with emphasis on lake faunas. The γ-diversity of several hundred modern and fossil European lakes will be evaluated. Data will be made available permanently for

  15. Bivalves and gastropods from the middle Campanian Anacacho limestone, South Central Texas

    USGS Publications Warehouse

    Elder, W.P.

    1996-01-01

    The Anacacho Limestone was deposited during the Campanian and represents two depositional intervals, one of early Campanian and one of middle Campanian age. These two intervals correspond to periods of major eustatic sea level rise. This study focuses on the molluscan paleontology of the middle Campanian interval in the eastern part of the Anacacho exposure belt in Medina County, Texas. Molluscan assemblages in this area are indicative of inner to mid-shelf environments. No significant reef components are present. These eastern Anacacho deposits are interpreted to represent more offshore, deeper water environments than those to the southwest, where reef and lagoonal deposits have been reported. Analysis of the macrofossil components from these eastern localities has expanded the number of invertebrate species known from the Anacacho Limestone by nearly three-fold. This increase in diversity, based on a small amount of new work, suggests that many more taxa are yet to be identified, particularly in the western part of the exposure belt in Uvalde and Kinney Counties. This paper documents the bivalve and gastropod fauna, discussing and illustrating 24 bivalve taxa and 11 gastropod species. Two new bivalve species are named, Panopea anacachoensis new species and Spondylus siccus new species, and two potentially new gastropod species are identified but not named herein due to inadequate material. This paper expands the distribution of many eastern Gulf Coast and Atlantic Coast taxa westward into Texas and shows strong ties between the Anacacho fauna and that of the Campanian Tar Heel and Bladen Formations of the Black Creek Group in North Carolina. The taxonomic ties between these two areas probably reflect the thorough documentation of the North Carolina fauna, which is the best documented Campanian bivalve fauna in the Gulf or Atlantic Coast regions.

  16. Increasing sea surface temperature and range shifts of intertidal gastropods along the Iberian Peninsula

    NASA Astrophysics Data System (ADS)

    Rubal, Marcos; Veiga, Puri; Cacabelos, Eva; Moreira, Juan; Sousa-Pinto, Isabel

    2013-03-01

    There are well-documented changes in abundance and geographical range of intertidal invertebrates related to climate change at north Europe. However, the effect of sea surface warming on intertidal invertebrates has been poorly studied at lower latitudes. Here we analyze potential changes in the abundance patterns and distribution range of rocky intertidal gastropods related to climate change along the Iberian Peninsula. To achieve this aim, the spatial distribution and range of sub-tropical, warm- and cold-water species of intertidal gastropods was explored by a fully hierarchical sampling design considering four different spatial scales, i.e. from region (100 s of km apart) to quadrats (ms apart). Variability on their patterns of abundance was explored by analysis of variance, changes on their distribution ranges were detected by comparing with previous records and their relationship with sea water temperature was explored by rank correlation analyses. Mean values of sea surface temperature along the Iberian coast, between 1949 and 2010, were obtained from in situ data compiled for three different grid squares: south Portugal, north Portugal, and Galicia. Lusitanian species did not show significant correlation with sea water temperature or changes on their distributional range or abundance, along the temperature gradient considered. The sub-tropical species Siphonaria pectinata has, however, increased its distribution range while boreal cold-water species showed the opposite pattern. The latter was more evident for Littorina littorea that was almost absent from the studied rocky shores of the Iberian Peninsula. Sub-tropical and boreal species showed significant but opposite correlation with sea water temperature. We hypothesized that the energetic cost of frequent exposures to sub-lethal temperatures might be responsible for these shifts. Therefore, intertidal gastropods at the Atlantic Iberian Peninsula coast are responding to the effect of global warming as it

  17. New porcellioidean gastropods from early Devonian of Royal Creek area, Yukon Territory, Canada, with notes on their early phylogeny

    USGS Publications Warehouse

    Fryda, J.; Blodgett, R.B.; Lenz, A.C.; Manda, S.

    2008-01-01

    This paper presents a description of new gastropods belonging to the superfamily Porcellioidea (Vetigastropoda) from the richly diverse Lower Devonian gastropod fauna of the Road River Formation in the Royal Creek area, Yukon Territory. This fauna belongs to Western Canada Province of the Old World Realm. The Pragian species Porcellia (Porcellia) yukonensis n. sp. and Porcellia (Paraporcellia) sp. represent the oldest presently known members of subgenera Porcellia (Porcellia) and Porcellia (Paraporcellia). Their simple shell ornamentation fits well with an earlier described evolutionary trend in shell morphology of the Porcellinae. Late Pragian to early Emsian Perryconcha pulchra n. gen. and n. sp. is the first member of the Porcellioidea bearing a row of tremata on adult teleoconch whorls. The occurrence of this shell feature in the Porcellioidea is additional evidence that the evolution of the apertural slit was much more complicated than has been proposed in classical models of Paleozoic gastropod evolution. Copyright ?? 2008, The Paleontological Society.

  18. Radiocarbon ages of terrestrial gastropods extend duration of ice-free conditions at the Two Creeks forest bed, Wisconsin, USA

    USGS Publications Warehouse

    Rech, Jason A.; Nekola, Jeffrey C.; Pigati, Jeffrey S.

    2012-01-01

    Analysis of terrestrial gastropods that underlie the late Pleistocene Two Creeks forest bed (~ 13,800–13,500 cal yr BP) in eastern Wisconsin, USA provides evidence for a mixed tundra-taiga environment prior to formation of the taiga forest bed. Ten new AMS 14C analyses on terrestrial gastropod shells indicate the mixed tundra-taiga environment persisted from ~ 14,500 to 13,900 cal yr BP. The Twocreekan climatic substage, representing ice-free conditions on the shore of Lake Michigan, therefore began near the onset of peak warming conditions during the Bølling–Allerød interstadial and lasted ~ 1000 yr, nearly 600 yr longer than previously thought. These results provide important data for understanding the response of continental ice sheets to global climate forcing and demonstrate the potential of using terrestrial gastropod fossils for both environmental reconstruction and age control in late Quaternary sediments.

  19. Cap-shaped gastropods from Upper Jurassic and Lower Cretaceous deposits of northern East Siberia

    NASA Astrophysics Data System (ADS)

    Guzhov, A. V.; Zakharov, V. A.

    2015-09-01

    Cap-shaped gastropods are first identified in Upper Jurassic and Lower Cretaceous sections of northern East Siberia. They belong to three new genera of the subclass Pectinibranchia ( Boreioconus gen. nov., Nixepileolus gen. nov., and Taimyroconus gen. nov.), which are identified at the species level ( B. bojarkensis sp. nov., N. depressus sp. nov., T. zakharovi sp. nov.), and several species with the open nomenclature. The genus Taimyroconus attributed to the family Calyptraeidae is considered as an ancestral form of the genus Crepidula. The stratigraphic position of each taxon is determined for several sections. The facies confinement, habitat conditions, and ethology of defined genera are considered with the analysis of their geographic distribution.

  20. Subtidal gastropods consume sulfur-oxidizing bacteria: evidence from coastal hydrothermal vents

    SciTech Connect

    Stein, J.L.

    1984-02-17

    The black abalone (Haliotis cracherodii), a commercially important shallow-water gastropod common off White Point, Southern California, is found frequently at subtidal hydrothermal vents within mats of filamentous sulfur-oxidizing bacteria. Foraging vent abalones actively consume the bacteria and confine their nightly feeding forays to bacterial mats surrounding the vents. The growth of abalones consuming the sulfur bacteria exceeds that of control individuals consuming microalgae and is comparable to reported growth rates of abalones consuming macroalgae. Thus, off White Point, the black abalone may derive a portion of its nutrition from the subsidy of geothermal energy.

  1. A pioneer survey and DNA barcoding of some commonly found gastropod molluscs on Robben Island

    PubMed Central

    van der Bank, Herman; Greenfield, Richard

    2015-01-01

    Abstract Nineteen species of abundant gastropods were collected at Robben Island, including introduced dune snails and European brown garden snails. They were identified using morphology and DNA barcoding. It was expected that the species recorded would be similar to those from the Cape peninsula, South Africa, but we were surprised to find some exceptions: the very abundant invasive mussel species in South Africa, the South American bisexual mussel (Semimytilus algosus), and the beaded topshells (Oxystele impervia) were not found on Robben Island. Possible explanations are presented for these differences. PMID:25685029

  2. Subtidal Gastropods Consume Sulfur-Oxidizing Bacteria: Evidence from Coastal Hydrothermal Vents

    NASA Astrophysics Data System (ADS)

    Stein, Jeffrey L.

    1984-02-01

    The black abalone (Haliotis cracherodii), a commercially important shallow-water gastropod common off White Point, Southern California, is found frequently at subtidal hydrothermal vents within mats of filamentous sulfur-oxidizing bacteria. Foraging vent abalones actively consume the bacteria and confine their nightly feeding forays to bacterial mats surrounding the vents. The growth of abalones consuming the sulfur bacteria exceeds that of control individuals consuming microalgae and is comparable to reported growth rates of abalones consuming macroalgae. Thus, off White Point, the black abalone may derive a portion of its nutrition from the subsidy of geothermal energy.

  3. Subtidal gastropods consume sulfur-oxidizing bacteria: evidence from coastal hydrothermal vents.

    PubMed

    Stein, J L

    1984-02-17

    The black abalone (Haliotis cracherodii), a commercially important shallow-water gastropod common off White Point, Southern California, is found frequently at subtidal hydrothermal vents within mats of filamentous sulfur-oxidizing bacteria. Foraging vent abalones actively consume the bacteria and confine their nightly feeding forays to bacterial mats surrounding the vents. The growth of abalones consuming the sulfur bacteria exceeds that of control individuals consuming microalgae and is comparable to reported growth rates of abalones consuming macroalgae. Thus, off White Point, the black abalone may derive a portion of its nutrition from the subsidy of geothermal energy. PMID:17841030

  4. The Environmental Context of Gastropods on Western Laurentia (Basin and Range Province) During the Great Ordovician Biodiversification Event

    NASA Astrophysics Data System (ADS)

    Dahl, Robyn Mieko

    Gastropods are a major component of modern marine ecosystems and can be found in nearly every type of marine ecosystem. They experienced their first notable radiation during the Great Ordovician Biodiversification Event (~470 Ma), during which their diversity tripled. This study examines the gastropod assemblage preserved in the Basin and Range Province of the Western United States to establish the environmental context for the Ordovician gastropod radiation. Gastropods are present within every facies examined, but their relative abundance and distribution varies. Gastropods are rare in normal marine settings and abundant in harsh (i.e., dysoxic, hypersaline) environments. Their environmental context is shown to impact survivorship through the end-Ordovician extinction event and throughout the Paleozoic and Mesozoic. Collecting accurate density data for fossil deposits can prove challenging, especially when beds are not exposed in plane view. In these cases, paleontologists are tasked with reconstructing shellbed density from cross section exposure. This study presents a mathematical model to calculate the density of fossil material within a bed from bedding cross section counts. The model is calibrated against an Ordovician biofacies comprised of oncoids, macluritid gastropods and receptaculitids exposed in the Arrow Canyon Range of Southern Nevada, where unique preservation provides both cross section exposures and plan view of fossil concentrations. University Earth Science Departments seeking to establish impactful geoscience outreach programs often pursue large-scale, grant funded programs. While this type of outreach is highly successful, it is also extremely costly, and grant funding can be difficult to secure. Here, we present the Geoscience Education Outreach Program (GEOP), a small-scale, very affordable model tested over five years in the Department of Earth Sciences at UCR. GEOP provides a variety of outreach events and allows UCR Earth Sciences to

  5. Interstitial granulomatous drug reaction with a histological pattern of interstitial granulomatous dermatitis.

    PubMed

    Perrin, C; Lacour, J P; Castanet, J; Michiels, J F

    2001-08-01

    The interstitial granulomatous drug reaction (IGDR) is a novel drug-associated entity, characterized by violaceous plaques with a predilection for skin fold areas. Light microscopically, it resembles the incipient diffuse interstitial phase of granuloma annulare. Differentiating light microscopic features include the absence of complete collagen necrobiosis, the presence of interface dermatitis, and variable lymphoid atypia. The lack of vasculitis rules out the extravascular necrotizing granuloma (Winkelmann granuloma) associated with systemic disease. The differential diagnosis with interstitial granulomatous dermatitis with arthritis as defined by Ackerman et al. has not been studied until now. Our aim was to determine the histologic criteria allowing us to differentiate IGDR without interface dermatitis and lymphoid atypia from interstitial granulomatous dermatitis. We report three patients with IGDR triggered, in two cases by respectively angiotensin convertin enzyme (ACE) inhibitors and furosemide, and in one case by the association of an ACE inhibitor, furosemide, and fluindione. Histologic examination showed a histological pattern of interstitial granulomatous dermatitis. We found a dense, diffuse histiocytic infiltrate distributed interstitially and in palisaded array within the reticular dermis. Eosinophils and some neutrophils were scattered throughout the infiltrate. In some tiny foci, enveloped by histiocytes, thick collagen bundles associated with basophilic nuclear debris or "flame figures" were seen. Vasculitis, interface dermatitis, or lymphoid atypia were absent. Our study allowed us to expand the histological spectrum of IGDR including a histological pattern similar to interstitial granulomatous dermatitis. The lack of degenerated collagen could be a subtle clue in favor of interstitial granulomatous dermatitis triggered by a drug. PMID:11481519

  6. Parasitic infection alters the physiological response of a marine gastropod to ocean acidification.

    PubMed

    Macleod, C D; Poulin, R

    2016-09-01

    Increased hydrogen ion concentration and decreased carbonate ion concentration in seawater are the most physiologically relevant consequences of ocean acidification (OA). Changes to either chemical species may increase the metabolic cost of physiological processes in marine organisms, and reduce the energy available for growth, reproduction and survival. Parasitic infection also increases the energetic demands experienced by marine organisms, and may reduce host tolerance to stressors associated with OA. This study assessed the combined metabolic effects of parasitic infection and OA on an intertidal gastropod, Zeacumantus subcarinatus. Oxygen consumption rates and tissue glucose content were recorded in snails infected with one of three trematode parasites, and an uninfected control group, maintained in acidified (7·6 and 7·4 pH) or unmodified (8·1 pH) seawater. Exposure to acidified seawater significantly altered the oxygen consumption rates and tissue glucose content of infected and uninfected snails, and there were clear differences in the magnitude of these changes between snails infected with different species of trematode. These results indicate that the combined effects of OA and parasitic infection significantly alter the energy requirements of Z. subcarinatus, and that the species of the infecting parasite may play an important role in determining the tolerance of marine gastropods to OA. PMID:27222227

  7. Hydrothermal vent gastropods from the same family (Provannidae) harbour epsilon- and gamma-proteobacterial endosymbionts.

    PubMed

    Urakawa, Hidetoshi; Dubilier, Nicole; Fujiwara, Yoshihiro; Cunningham, Dale E; Kojima, Shigeaki; Stahl, David A

    2005-05-01

    The discovery of new hydrothermal vent systems in the back-arc basins of the Western Pacific revealed chemosynthesis-based faunal communities distinct from those of other vents. These vents are dominated by two related gastropods (Alviniconcha spp. and Ifremeria nautilei) that harbour symbiotic bacteria in their gills. We used comparative 16S ribosomal RNA (rRNA) gene sequencing and in situ hybridization with rRNA-targeted probes to characterize the bacterial symbionts of Alviniconcha sp. and I. nautilei from the Manus Basin in the Western Pacific. The analyses revealed that these two gastropod species, although affiliated with the same family, harbour phylogenetically distant chemosymbionts, suggesting independent origins of these endosymbioses. The I. nautilei endosymbiont clusters with sulfur-oxidizing bacteria within the gamma-Proteobacteria, as is the case for all previously characterized endosymbionts from a wide diversity of host taxa harbouring thioautotrophic prokaryotes. In contrast, the Alviniconcha endosymbiont is affiliated with sulfur-oxidizing bacteria within the epsilon-Proteobacteria. These results show that bacteria from the epsilon-Proteobacteria are also capable of forming endosymbiotic associations with marine invertebrates from chemosynthetic environments. More generally, the endosymbiotic lifestyle is now shown to be distributed throughout all recognized classes of the Proteobacteria. PMID:15819856

  8. Rhodopsin and retinochrome in the retina of a marine gastropod, Conomulex luhuanus.

    PubMed

    Ozaki, K; Terakita, A; Hara, R; Hara, T

    1986-01-01

    Photopigments in the conch retina were examined with special attention given to the photic vesicles characteristic of gastropod photoreceptors. Three different fractions of visual cell fragments were prepared from the retina: the MV-fraction containing the rhabdomal microvilli, and the PVH- and PVL-fractions containing the photic vesicles located in the visual cell body. Rhodopsin was found in the MV-fraction (lambda max = 474 nm), and yielded a photoequilibrium mixture with metarhodopsin (lambda max = 512 nm) on irradiation with blue light. Retinochrome was found in both of the PVH- and PVL-fractions (lambda max = approximately 510 nm), and was bleached into metaretinochrome by exposure to orange light, showing no marked shift of the absorption peak. Unlike the PVH-fraction, the PVL-fraction contains much aporetinochrome in addition to retinochrome, suggesting that the large mass of photic vesicles around the nucleus may serve as storage for retinal in retinochrome and for newly synthesized aporetinochrome. The total amount of retinochrome in the retina was several times higher than that of rhodopsin, distinguishing the gastropod eye from the cephalopod eye. PMID:3750849

  9. Mobile Element Evolution Playing Jigsaw—SINEs in Gastropod and Bivalve Mollusks

    PubMed Central

    Matetovici, Irina; Sajgo, Szilard; Ianc, Bianca; Ochis, Cornelia; Bulzu, Paul; Popescu, Octavian; Damert, Annette

    2016-01-01

    SINEs (Short INterspersed Elements) are widely distributed among eukaryotes. Some SINE families are organized in superfamilies characterized by a shared central domain. These central domains are conserved across species, classes, and even phyla. Here we report the identification of two novel such superfamilies in the genomes of gastropod and bivalve mollusks. The central conserved domain of the first superfamily is present in SINEs in Caenogastropoda and Vetigastropoda as well as in all four subclasses of Bivalvia. We designated the domain MESC (Romanian for MElc—snail and SCoica—mussel) because it appears to be restricted to snails and mussels. The second superfamily is restricted to Caenogastropoda. Its central conserved domain—Snail—is related to the Nin-DC domain. Furthermore, we provide evidence that a 40-bp subdomain of the SINE V-domain is conserved in SINEs in mollusks and arthropods. It is predicted to form a stable stem-loop structure that is preserved in the context of the overall SINE RNA secondary structure in invertebrates. Our analysis also recovered short retrotransposons with a Long INterspersed Element (LINE)-derived 5′ end. These share the body and/or the tail with transfer RNA (tRNA)-derived SINEs within and across species. Finally, we identified CORE SINEs in gastropods and bivalves—extending the distribution range of this superfamily. PMID:26739168

  10. Mobile Element Evolution Playing Jigsaw - SINEs in Gastropod and Bivalve Mollusks.

    PubMed

    Matetovici, Irina; Sajgo, Szilard; Ianc, Bianca; Ochis, Cornelia; Bulzu, Paul; Popescu, Octavian; Damert, Annette

    2016-01-01

    SINEs (Short INterspersed Elements) are widely distributed among eukaryotes. Some SINE families are organized in superfamilies characterized by a shared central domain. These central domains are conserved across species, classes, and even phyla. Here we report the identification of two novel such superfamilies in the genomes of gastropod and bivalve mollusks. The central conserved domain of the first superfamily is present in SINEs in Caenogastropoda and Vetigastropoda as well as in all four subclasses of Bivalvia. We designated the domain MESC (Romanian for MElc-snail and SCoica-mussel) because it appears to be restricted to snails and mussels. The second superfamily is restricted to Caenogastropoda. Its central conserved domain-Snail-is related to the Nin-DC domain. Furthermore, we provide evidence that a 40-bp subdomain of the SINE V-domain is conserved in SINEs in mollusks and arthropods. It is predicted to form a stable stem-loop structure that is preserved in the context of the overall SINE RNA secondary structure in invertebrates. Our analysis also recovered short retrotransposons with a Long INterspersed Element (LINE)-derived 5' end. These share the body and/or the tail with transfer RNA (tRNA)-derived SINEs within and across species. Finally, we identified CORE SINEs in gastropods and bivalves-extending the distribution range of this superfamily. PMID:26739168

  11. The role of the ventral pedal waves in the locomotion of terrestrial gastropods

    NASA Astrophysics Data System (ADS)

    Lai, Janice; Shepherd, Robert D.; Del Alamo, Juan C.; Rodriguez-Rodriguez, Javier; Lasheras, Juan C.

    2008-03-01

    The locomotion of terrestrial gastropods exhibits unique characteristics which allow these animals to crawl on steep surfaces. Gastropods move by gliding over a ventral foot lubricated by mucus. They generate trains of pedal waves through periodic muscle contractions in the central portion of the ventral foot, producing a forward traction, while the rim of the foot adheres to the substrate and generates suction forces. We analyzed the kinematics and dynamics of locomotion by conducting two sets of experiments. In the first set, we used digital image processing to correlate the frequency and wavelength of the pedal waves to the migration velocity. In the second set, we computed the traction and adhesion forces produced by these animals from measurements of the deformation of an elastic substrate of known properties. We found that the strain energy exerted by the animal on the substrate is quasi-periodic, and explored a possible correlation between the mean speed of migration and the period of this energy fluctuation. In addition, we found that the pedal waves accelerate as they move forward along the ventral foot producing the symmetry break necessary for the generation of a net traction force.

  12. Effects of gastropod predation on the reproductive output of an overexploited deep octocoral

    NASA Astrophysics Data System (ADS)

    Priori, C.; Erra, F.; Angiolillo, M.; Santangelo, G.

    2015-03-01

    The study presented herein is aimed at quantifying the effects of the partial predation exerted by the gastropod Pseudosimnia carnea on the reproductive features of the highly valuable, slow-growing, and long-lived red coral, Corallium rubrum. Seventy-five colonies were collected just before annual spawning from a red coral population living between 85 and 90 m deep in the NW Mediterranean; of these, 35 % were affected by P. carnea. Female colonies were more frequently preyed upon than males (3:1 ratio). Overall, 1,100 polyps were dissected and examined for their reproductive content. The mean number of polyps per colony and the mean fecundity of female polyps and colonies were significantly reduced by gastropod predation, which affected colonies independently of their size; in particular, colony fecundity was reduced by 81 %. The consequent reduction in population reproductive output is likely to have long-term effects on preyed-upon populations and thereby limit their resilience to intense commercial harvesting.

  13. What can aquatic gastropods tell us about phenotypic plasticity? A review and meta-analysis.

    PubMed

    Bourdeau, P E; Butlin, R K; Brönmark, C; Edgell, T C; Hoverman, J T; Hollander, J

    2015-10-01

    There have been few attempts to synthesise the growing body of literature on phenotypic plasticity to reveal patterns and generalities about the extent and magnitude of plastic responses. Here, we conduct a review and meta-analysis of published literature on phenotypic plasticity in aquatic (marine and freshwater) gastropods, a common system for studying plasticity. We identified 96 studies, using pre-determined search terms, published between 1985 and November 2013. The literature was dominated by studies of predator-induced shell form, snail growth rates and life history parameters of a few model taxa, accounting for 67% of all studies reviewed. Meta-analyses indicated average plastic responses in shell thickness, shell shape, and growth and fecundity of freshwater species was at least three times larger than in marine species. Within marine gastropods, species with planktonic development had similar average plastic responses to species with benthic development. We discuss these findings in the context of the role of costs and limits of phenotypic plasticity and environmental heterogeneity as important constraints on the evolution of plasticity. We also consider potential publication biases and discuss areas for future research, indicating well-studied areas and important knowledge gaps. PMID:26219231

  14. The Heritability of Shell Morphometrics in the Freshwater Pulmonate Gastropod Physa

    PubMed Central

    Dillon, Robert T.; Jacquemin, Stephen J.

    2015-01-01

    The cosmopolitan freshwater pulmonate snail Physa acuta hybridizes readily with Physa carolinae in the laboratory, although their F1 progeny are sterile. The two species differ qualitatively in shell shape, the former bearing a more globose shell and the latter more fusiform. We performed a hybridization experiment, measuring a set of 14 traditional (linear) and landmark-based shell morphological variables on even-aged parents and their offspring from both hybrids and purebred control lines. Parent-offspring regression yielded a strikingly high heritability estimate for score on the first relative warp axis, h2 = 0.819 ± 0.073, a result that would seem to confirm the value of geometric morphometrics as a tool for retrieving evolutionary relationships from gastropod shell form. Score on the second relative warp axis was also significantly heritable (h2 = 0.312 ± 0.123), although more moderate, as were scores on second principal components extracted from traditional measurements (correlation h2 = 0.308 ± 0.069, covariance h2 = 0.314 ± 0.050). Although score on the first relative warp axis was significantly correlated with centroid size (p < 0.001), scores on none of the three second axes were so correlated. This result suggests that second axis score might prove especially useful for estimating genetic divergence among mixed-age populations of gastropods sampled from the field. PMID:25876155

  15. Vermetid gastropods reduce foraging by herbivorous fishes on algae on coral reefs

    NASA Astrophysics Data System (ADS)

    Tootell, Jesse S.; Steele, Mark A.

    2014-12-01

    Vermetid gastropods have the potential to reduce foraging by herbivorous fishes on algae on coral reefs because they produce mucous nets that cover the surfaces of coral skeletons, potentially inhibiting foraging by fishes. We assessed this possibility using both observational and experimental approaches in Moorea, French Polynesia. Foraging rates of herbivorous fishes (total number of bites by all species per minute) were recorded in plots that varied naturally in the cover of vermetid mucous nets. This study, done at six sites, revealed that foraging on algal turf declined with increasing cover of vermetid mucous nets, ranging from ~2 to 22 bites m-2 min-1 at 0 % coverage to 0-5 bites m-2 min-1 at 100 % coverage. The magnitude of this effect of vermetid nets varied among microhabitats (high, mid, and low bommies) and sites, presumably due to variation in the intensity of herbivory. Experimental removal of vermetid mucous nets from plots more than doubled the foraging intensity on turf algae relative to when vermetid nets were present at high (≥70 %) cover. Our results indicate that algal turf on coral reefs may benefit from associational refuge from grazing provided by vermetid gastropods, which might in turn harm corals via increased competition with algal turf.

  16. Body Size Extinction and Origination Selectivity: A Case Study of Marine Gastropods

    NASA Astrophysics Data System (ADS)

    Kuo, E.; Seixas, G.; Faerber, M.; Payne, J.

    2012-12-01

    Body size has received exceptional interest in evolutionary biology because of its correlation with many ecological and physiological traits. Because large size is typically associated with long generation time and small population size, it has been widely assumed that extinction risk is positively correlated with body size. Data from Pleistocene and Holocene terrestrial mammals and birds support this inference. However, there have been few studies on size bias of marine invertebrate animals, so the true extent of this pattern remains unknown. For this study, we compiled genus-level body size data for marine gastropods spanning the entire Phanerozoic. We use this dataset to examine the statistical evidence for size bias in both origination and extinction of marine gastropods. We perform logistic regression analyses on the data from each Phanerozoic stage to determine the association of body size with origination and extinction. Contrary to previous studies on terrestrial vertebrates, we observe no strong or persistent association between body size and the probability that a genus either originated or went extinct during that stage. Hence, our findings indicate that size bias in extinction risk may reflect particular aspects of mammalian biology or anthropogenic environmental change rather than a general pattern of animal evolution.

  17. Invasive diagnostic techniques in idiopathic interstitial pneumonias.

    PubMed

    Poletti, Venerino; Ravaglia, Claudia; Gurioli, Carlo; Piciucchi, Sara; Dubini, Alessandra; Cavazza, Alberto; Chilosi, Marco; Rossi, Andrea; Tomassetti, Sara

    2016-01-01

    Fibrosing interstitial lung diseases (f-ILDs) represent a heterogeneous group of disorders in which the aetiology may be identified or, not infrequently, remain unknown. Establishing a correct diagnosis of a distinct f-ILD requires a multidisciplinary approach, integrating clinical profile, physiological and laboratory data, radiological appearance and, when appropriate, histological findings. Surgical lung biopsy is still considered the most important diagnostic tool as it is able to provide lung samples large enough for identification of complex patterns such as usual interstitial pneumonitis (UIP) and nonspecific interstitial pneumonitis. However, this procedure is accompanied by significant morbidity and mortality. Bronchoalveolar lavage is still a popular diagnostic tool allowing identification of alternative diagnoses in patients with suspected idiopathic pulmonary fibrosis (IPF) when an increase in lymphocytes is detected. Conventional transbronchial lung biopsy has a very low sensitivity in detecting the UIP pattern and its role in this clinical-radiological context is marginal. The introduction of less invasive methods such as transbronchial cryobiopsy show great promise to clinical practice as they can be used to obtain samples large enough to morphologically support a diagnosis of IPF or other idiopathic interstitial pneumonias, along with fewer complications. Recent advances in the field suggest that less invasive methods of lung sampling, without significant side effects, in combination with other diagnostic methods could replace the need for surgical lung biopsy in the future. Indeed, these new multidisciplinary procedures may become the main diagnostic work-up method for patients with suspected idiopathic interstitial pneumonia. PMID:26682637

  18. Interstitial Cells: Regulators of Smooth Muscle Function

    PubMed Central

    Sanders, Kenton M.; Ward, Sean M.; Koh, Sang Don

    2014-01-01

    Smooth muscles are complex tissues containing a variety of cells in addition to muscle cells. Interstitial cells of mesenchymal origin interact with and form electrical connectivity with smooth muscle cells in many organs, and these cells provide important regulatory functions. For example, in the gastrointestinal tract, interstitial cells of Cajal (ICC) and PDGFRα+ cells have been described, in detail, and represent distinct classes of cells with unique ultrastructure, molecular phenotypes, and functions. Smooth muscle cells are electrically coupled to ICC and PDGFRα+ cells, forming an integrated unit called the SIP syncytium. SIP cells express a variety of receptors and ion channels, and conductance changes in any type of SIP cell affect the excitability and responses of the syncytium. SIP cells are known to provide pacemaker activity, propagation pathways for slow waves, transduction of inputs from motor neurons, and mechanosensitivity. Loss of interstitial cells has been associated with motor disorders of the gut. Interstitial cells are also found in a variety of other smooth muscles; however, in most cases, the physiological and pathophysiological roles for these cells have not been clearly defined. This review describes structural, functional, and molecular features of interstitial cells and discusses their contributions in determining the behaviors of smooth muscle tissues. PMID:24987007

  19. The Significance of Interstitial Cells in Neurogastroenterology

    PubMed Central

    Blair, Peter J; Rhee, Poong-Lyul; Sanders, Kenton M; Ward, Sean M

    2014-01-01

    Smooth muscle layers of the gastrointestinal tract consist of a heterogeneous population of cells that include enteric neurons, several classes of interstitial cells of mesenchymal origin, a variety of immune cells and smooth muscle cells (SMCs). Over the last number of years the complexity of the interactions between these cell types has begun to emerge. For example, interstitial cells, consisting of both interstitial cells of Cajal (ICC) and platelet-derived growth factor receptor alpha-positive (PDGFRα+) cells generate pacemaker activity throughout the gastrointestinal (GI) tract and also transduce enteric motor nerve signals and mechanosensitivity to adjacent SMCs. ICC and PDGFRα+ cells are electrically coupled to SMCs possibly via gap junctions forming a multicellular functional syncytium termed the SIP syncytium. Cells that make up the SIP syncytium are highly specialized containing unique receptors, ion channels and intracellular signaling pathways that regulate the excitability of GI muscles. The unique role of these cells in coordinating GI motility is evident by the altered motility patterns in animal models where interstitial cell networks are disrupted. Although considerable advances have been made in recent years on our understanding of the roles of these cells within the SIP syncytium, the full physiological functions of these cells and the consequences of their disruption in GI muscles have not been clearly defined. This review gives a synopsis of the history of interstitial cell discovery and highlights recent advances in structural, molecular expression and functional roles of these cells in the GI tract. PMID:24948131

  20. [Modern Views on Children's Interstitial Lung Disease].

    PubMed

    Boĭtsova, E V; Beliashova, M A; Ovsiannikov, D Iu

    2015-01-01

    Interstitial lung diseases (ILD, diffuse lung diseases) are a heterogeneous group of diseases in which a pathological process primarily involved alveoli and perialveolar interstitium, resulting in impaired gas exchange, restrictive changes of lung ventilation function and diffuse interstitial changes detectable by X-ray. Children's interstitial lung diseases is an topical problem ofpediatricpulmonoogy. The article presents current information about classification, epidemiology, clinical presentation, diagnostics, treatment and prognosis of these rare diseases. The article describes the differences in the structure, pathogenesis, detection of various histological changes in children's ILD compared with adult patients with ILD. Authors cite an instance of registers pediatric patients with ILD. The clinical semiotics of ILD, the possible results of objective research, the frequency of symptoms, the features of medical history, the changes detected on chest X-rays, CT semiotics described in detail. Particular attention was paid to interstitial lung diseases, occurring mainly in newborns and children during the first two years of life, such as congenital deficiencies of surfactant proteins, neuroendocrine cell hyperplasia of infancy, pulmonary interstitial glycogenosis. The diagnostic program for children's ILD, therapy options are presented in this article. PMID:26234096

  1. Timolol-induced interstitial lung disease

    PubMed Central

    Patel, Hetain; Wilches, Lina Vanessa; Guerrero, Jorge

    2015-01-01

    Timolol maleate is a non-selective beta-adrenergic receptor blocking agent with demonstrated efficacy in the treatment of open-angle glaucoma. A 76 year old female who presented with productive cough, progressive dyspnea and hypoxia after starting timolol maleate opthalamic drops following glaucoma surgery. The patient was diagnosed with interstitial lung disease secondary to timolol treatment and after cessation of the offending agent along with corticosteroid treatment, symptoms improved drastically. Elimination of other possible causes of disease along with evolution of radiological and functional signs left us with a diagnosis of timolol-induced interstitial lung disease. To our knowledge, this is the second reported case of timolol-induced interstitial lung disease. PMID:26236595

  2. Wear evaluation of high interstitial stainless steel

    SciTech Connect

    Rawers, J.C.; Tylczak, J.H.

    2008-07-01

    A new series of high nitrogen-carbon manganese stainless steel alloys are studied for their wear resistance. High nitrogen and carbon concentrations were obtained by melting elemental iron-chromium-manganese (several with minor alloy additions of nickel, silicon, and molybdenum) in a nitrogen atmosphere and adding elemental graphite. The improvement in material properties (hardness and strength) with increasing nitrogen and carbon interstitial concentration was consistent with previously reported improvements in similar material properties alloyed with nitrogen only. Wear tests included: scratch, pin-on-disk, sand-rubber-wheel, impeller, and jet erosion. Additions of interstitial nitrogen and carbon as well as interstitial nitrogen and carbide precipitates were found to greatly improve material properties. In general, with increasing nitrogen and carbon concentrations, strength, hardness, and wear resistance increased.

  3. An overview of interstitial brachytherapy and hyperthermia

    SciTech Connect

    Brandt, B.B.; Harney, J.

    1989-11-01

    Interstitial thermoradiotherapy, an experimental cancer treatment that combines interstitial radiation implants (brachytherapy) and interstitial hyperthermia, is in the early stages of investigation. In accordance with the procedure used in a current national trial protocol, a 60-minute hyperthermia treatment is administered after catheters are placed into the tumor area while the patient is under general anesthesia. This is immediately followed by loading of radioactive Iridium-192 seeds into the catheters for a defined period of time. Once the prescribed radiation dose is delivered, the radioactive sources are removed and a second, 60-minute hyperthermia treatment is administered. Clinical trials with hyperthermia in combination with radiation have increased in recent years. Nurses caring for these patients need to become more knowledgeable about this investigational therapy. This paper provides an overview of the biologic rationale for this therapy, as well as a description of the delivery method and clinical application. Specific related nursing interventions are defined in a nursing protocol.23 references.

  4. Interstitial Pneumonitis from Treatment with Gemcitabine

    PubMed Central

    Poole, Brolin B.; Brockman, Megan M.; Byrd, Debbie C.

    2014-01-01

    Introduction: The use of gemcitabine may lead to numerous adverse effects ranging from mild to very severe, such as interstitial pneumonitis. The diagnosis of this complication is based on multiple laboratory findings, radiographic evidence, and high clinical suspicion. Presented is a case report of a patient who met these criteria and had onset consistent with drug-induced interstitial pneumonitis. Case Presentation: A 76-year-old White female was treated with gemcitabine for pancreatic cancer. Two months after the initiation of therapy, she was admitted to the hospital for worsening dyspnea and cough. High clinical suspicion, bilateral interstitial opacities on chest x-ray, worsening pulmonary status, and onset 2 months after initiation of therapy led to the diagnosis of gemcitabine-induced interstitial pneumonitis. Steroid therapy with prednisone was initiated, and the patient’s clinical symptoms and radiographic findings improved. Discussion: Gemcitabine-induced interstitial pneumonitis is well described in the literature. It is a rare but serious complication associated with gemcitabine therapy in which patients present with worsening dyspnea. Most patients only require supportive care and discontinuation of the drug for treatment, but in severe cases supplemental oxygen and steroid therapy must be used before resolution of symptoms. It is important to obtain an accurate medication history to evaluate for other potentially pulmonary toxic medications. Radiographic findings such as bilateral infiltrates should be completely resolved after therapy. Conclusion: Radiographic findings, clinical symptoms, and clinical suspicion can lead to early recognition of interstitial pneumonitis from gemcitabine. Physician awareness of this adverse effect and early recognition are keys to providing prompt treatment in resolving symptoms and decreasing mortality. PMID:25477616

  5. Smoking-related interstitial lung diseases.

    PubMed

    Vassallo, Robert; Ryu, Jay H

    2012-03-01

    Cigarette smoke, a toxic collection of thousands of chemicals generated from combustion of tobacco, is recognized as the primary causative agent of certain diffuse interstitial and bronchiolar lung diseases. Most patients afflicted with these disorders are cigarette smokers, and smoking cessation has been shown to be capable of inducing disease remission and should occupy a pivotal role in the management of all smokers with these diffuse lung diseases. The role of pharmacotherapy with corticosteroids or other immunomodulating agents is not well established but may be considered in patients with progressive forms of smoking-related interstitial lung diseases. PMID:22365253

  6. [Interstitial cystitis. A challenge for the clinician].

    PubMed

    Young, Pablo; Finn, Bárbara C; González, Martín; Comercio, Laura P; Quezel, Mariano; Bruetman, Julio E

    2010-01-01

    Interstitial cystitis is characterized by over 6 months of chronic pain, pressure and discomfort felt in the lower pelvis or bladder. It is often relieved with voiding, along with daytime frequency and nocturia in the absence of an urinary tract infection. The disorder can be divided clinically into two groups -ulcerative and non-ulcerative- based on cystoscopic findings and response to treatment. Management follows an approach of applying the least invasive therapy that affords sufficient relief of symptoms. We report a case of a patient with interstitial cystitis. The diagnosis was performed by symptoms and lesion in the cystoscopy and excellent response to amitriptyline. PMID:20679058

  7. Interstitial irradiation of brain tumors: a review

    SciTech Connect

    Bernstein, M.; Gutin, P.H.

    1981-12-01

    As an adjuvant to surgery, radiation therapy has consistently proven to be the most successful form of treatment for primary and secondary malignant brain tumors and possibly for inoperable benign tumors. Because the risk of radiation necrosis of normal brain limits the amount of radiation that can be given by external beam therapy at conventional dose rates, interstitial radiation of brain tumors is a logical alternative treatment approach. We discuss the radiobiological advantages of low dose rate irradiation and intratumoral placement of sources that make interstitial irradiation an attractive treatment for brain tumors and review the history of clinical brachytherapy for intracranial neoplasia.

  8. Edemagenic gain and interstitial fluid volume regulation.

    PubMed

    Dongaonkar, R M; Quick, C M; Stewart, R H; Drake, R E; Cox, C S; Laine, G A

    2008-02-01

    Under physiological conditions, interstitial fluid volume is tightly regulated by balancing microvascular filtration and lymphatic return to the central venous circulation. Even though microvascular filtration and lymphatic return are governed by conservation of mass, their interaction can result in exceedingly complex behavior. Without making simplifying assumptions, investigators must solve the fluid balance equations numerically, which limits the generality of the results. We thus made critical simplifying assumptions to develop a simple solution to the standard fluid balance equations that is expressed as an algebraic formula. Using a classical approach to describe systems with negative feedback, we formulated our solution as a "gain" relating the change in interstitial fluid volume to a change in effective microvascular driving pressure. The resulting "edemagenic gain" is a function of microvascular filtration coefficient (K(f)), effective lymphatic resistance (R(L)), and interstitial compliance (C). This formulation suggests two types of gain: "multivariate" dependent on C, R(L), and K(f), and "compliance-dominated" approximately equal to C. The latter forms a basis of a novel method to estimate C without measuring interstitial fluid pressure. Data from ovine experiments illustrate how edemagenic gain is altered with pulmonary edema induced by venous hypertension, histamine, and endotoxin. Reformulation of the classical equations governing fluid balance in terms of edemagenic gain thus yields new insight into the factors affecting an organ's susceptibility to edema. PMID:18056984

  9. Mica-associated pulmonary interstitial fibrosis.

    PubMed

    Landas, S K; Schwartz, D A

    1991-09-01

    We present the clinical and biopsy findings of a 63-yr-old white male with interstitial pulmonary fibrosis and a long history of extensive exposure to mica while working in the rubber industry. The patient presented 30 yr after the initial exposure with complaints of progressive shortness of breath and a chronic nonproductive cough. Pulmonary function testing revealed restrictive lung function with a mild reduction in the total lung capacity (80% of predicted) and a moderate-to-severe reduction in the diffusing capacity of carbon monoxide (50% of predicted). The chest radiogram and high-resolution chest CT scan showed diffuse fibrosis and focal honeycombing involving the upper and lower lung zones bilaterally. Bronchoalveolar lavage revealed 20% neutrophils in the lavage fluid with abundant rectangular flaking crystals. Open-lung biopsy exhibited extensive fibrosis and architectural remodeling with abundant sheets and fragments of engulfed polarizable crystalline material. Energy-dispersive spectroscopy and electron diffraction studies confirmed the material to have the features of mica. Asbestos and other silicates were not identified. The documentation of prolonged exposure to mica, the clinical and radiographic features of severe interstitial fibrosis, and the histopathologic delineation of the interstitial lesion, including spectroscopic and crystallographic verification of crystalline mica, support the causal relationship between mica and interstitial fibrosis. PMID:1892315

  10. Acute and subacute idiopathic interstitial pneumonias.

    PubMed

    Taniguchi, Hiroyuki; Kondoh, Yasuhiro

    2016-07-01

    Idiopathic interstitial pneumonias (IIPs) may have an acute or subacute presentation, or acute exacerbation may occur in a previously subclinical or unrecognized chronic IIP. Acute or subacute IIPs include acute interstitial pneumonia (AIP), cryptogenic organizing pneumonia (COP), nonspecific interstitial pneumonia (NSIP), acute exacerbation of idiopathic pulmonary fibrosis (AE-IPF) and AE-NSIP. Interstitial lung diseases (ILDs) including connective tissue disease (CTD) associated ILD, hypersensitivity pneumonitis, acute eosinophilic pneumonia, drug-induced lung disease and diffuse alveolar haemorrhage need to be differentiated from acute and subacute IIPs. Despite the severe lack of randomized controlled trials for the treatment of acute and subacute IIPs, the mainstream treatment remains corticosteroid therapy. Other potential therapies reported in the literature include corticosteroids and immunosuppression, antibiotics, anticoagulants, neutrophil elastase inhibitor, autoantibody-targeted treatment, antifibrotics and hemoperfusion therapy. With regard to mechanical ventilation, patients in recent studies with acute and subacute IIPs have shown better survival than those in previous studies. Therefore, a careful value-laden decision about the indications for endotracheal intubation should be made for each patient. Noninvasive ventilation may be beneficial to reduce ventilator associated pneumonia. PMID:27123874

  11. Protection mechanisms of the iron-plated armor of a deep-sea hydrothermal vent gastropod

    PubMed Central

    Yao, Haimin; Dao, Ming; Imholt, Timothy; Huang, Jamie; Wheeler, Kevin; Bonilla, Alejandro; Suresh, Subra; Ortiz, Christine

    2010-01-01

    Biological exoskeletons, in particular those with unusually robust and multifunctional properties, hold enormous potential for the development of improved load-bearing and protective engineering materials. Here, we report new materials and mechanical design principles of the iron-plated multilayered structure of the natural armor of Crysomallon squamiferum, a recently discovered gastropod mollusc from the Kairei Indian hydrothermal vent field, which is unlike any other known natural or synthetic engineered armor. We have determined through nanoscale experiments and computational simulations of a predatory attack that the specific combination of different materials, microstructures, interfacial geometries, gradation, and layering are advantageous for penetration resistance, energy dissipation, mitigation of fracture and crack arrest, reduction of back deflections, and resistance to bending and tensile loads. The structure-property-performance relationships described are expected to be of technological interest for a variety of civilian and defense applications. PMID:20133823

  12. Gastropods from the Campanian-Maastrichtian Aruma Formation, Central Saudi Arabia

    NASA Astrophysics Data System (ADS)

    Gameil, Mohamed; El-Sorogy, Abdelbaset S.

    2015-03-01

    The gastropod fauna of the Upper Cretaceous Aruma Formation in central Saudi Arabia comprises fifteen species belonging to fifteen genera, fourteen families, and five clades. The species are not abundant at any individual stratigraphic level but are equally and irregularly scattered in the formation. The studied species come mainly from the Hajajah Member of Upper Cretaceous Aruma Formation in central Saudi Arabia. Calliomphalus orientalis (Douvillé, 1916); Coelobolma corbarica Cossmann, 1918; Turritella (Torquesia) figarii Quaas, 1902; Neoptyxis olisiponensis (Sharpe, 1850) and Otostoma (Otostoma) divaricatum (d'Orbigny, 1847) are recorded from the Upper Cretaceous of central Arabia for the first time. The identified species have a close affinity to the Tethyan fauna known from other parts in Asia, Africa and Europe. Herbivores and predators are the dominant trophic groups which may indicate shallow marine lagoonal and relatively open marine environment.

  13. Ocean acidification disrupts induced defences in the intertidal gastropod Littorina littorea.

    PubMed

    Bibby, Ruth; Cleall-Harding, Polly; Rundle, Simon; Widdicombe, Steve; Spicer, John

    2007-12-22

    Carbon dioxide-induced ocean acidification is predicted to have major implications for marine life, but the research focus to date has been on direct effects. We demonstrate that acidified seawater can have indirect biological effects by disrupting the capability of organisms to express induced defences, hence, increasing their vulnerability to predation. The intertidal gastropod Littorina littorea produced thicker shells in the presence of predation (crab) cues but this response was disrupted at low seawater pH. This response was accompanied by a marked depression in metabolic rate (hypometabolism) under the joint stress of high predation risk and reduced pH. However, snails in this treatment apparently compensated for a lack of morphological defence, by increasing their avoidance behaviour, which, in turn, could affect their interactions with other organisms. Together, these findings suggest that biological effects from ocean acidification may be complex and extend beyond simple direct effects. PMID:17939976

  14. Accumulation of Cu and Zn in discarded antifouling paint particles by the marine gastropod, Littorina littorea

    NASA Astrophysics Data System (ADS)

    Gammon, Melanie; Turner, Andrew; Brown, Murray T.

    2009-10-01

    The short-term (5 day) accumulation of Cu and Zn in different tissues of the marine gastropod, Littorina littorea, has been studied in the presence of ˜10 mg l -1 of antifouling paint particles and pre- or simultaneously contaminated algal food ( Ulva lactuca). Accumulation of Cu was observed in the head-foot, digestive gland-gonad complex and gills to extents dependent on how and when food was contaminated and administered. However, retention of Zn was only observed in the gills and only when L. littorea and U. lactuca were simultaneously exposed to paint particles. Relative to the alga, faecal material was highly enriched in Zn, suggesting that the animal is able to rapidly eliminate this metal, most likely through the formation and egestion of insoluble phosphate granules. Thus, L. littorea is a useful biomonitor of marine contamination by antifouling applications in respect of Cu but not Zn.

  15. Gonyautoxin-3 as a minor toxin in the gastropod Niotha clathrata in Taiwan.

    PubMed

    Hwang, D F; Cheng, C A; Jeng, S S

    1994-12-01

    Paralytic toxicity was detected in the gastropod mollusc Niotha clathrata collected from South Taiwan in April and November 1993. Each seasonal toxin was partially purified from toxic specimens of N. clathrata by ultrafiltration using a membrane (Diaflo YM-2), followed by chromatography on a column (Bio-Gel P-2). Two toxin fractions (I and II) were then obtained for each seasonal shell toxin. The ratio of fraction I to fraction II for each seasonal shell toxin was about 4:1 according to tetrodotoxin bioassay. Based on analyses by TLC, electrophoresis, and HPLC, fraction I toxin contained tetrodotoxin and its derivative anhydrotetrodotoxin, and fraction II toxin contained gonyautoxin-3 for each seasonal shell toxin. PMID:7725326

  16. Odontomariinae, a new middle paleozoic subfamily of slit-bearing euophaloidean gastropods (Euophalomorpha, Gastropoda)

    USGS Publications Warehouse

    Fryda, J.; Heidelberger, D.; Blodgett, R.B.

    2006-01-01

    A new subfamily, the Odontomariinae subfam. nov., is established herein for a distinctive group of uncoiled, slit-bearing Middle Devonian euomphalid gastropods. Its taxonomic position is based on the recent discovery of open coiled protoconchs and it is placed within the Euomphalomorpha. The genera Odontomaria Odontomaria C. F. Roemer and Tubiconcha n. gen. belonging to this new subfamily are enlarged based on studies on new material of the following species: Odontomaria semiplicata (Sandberger & Sandberger), Odontomaria gracilis n. sp., Odontomaria jankei n. sp., Odontomaria cheeneetnukensis n. sp., Odontomaria cindiprellerae n. sp. and Tubiconcha leunissi (Heidelberger, 2001). Members of the Odontomariinae were mainly sedentary organisms in high-energy, moderately shallow water. ?? 2006 E. Schweizerbart'sche Verlagsbuchhandlung.

  17. New Gastropod Vectors and Tetrodotoxin Potential Expansion in Temperate Waters of the Atlantic Ocean

    PubMed Central

    Silva, Marisa; Azevedo, Joana; Rodriguez, Paula; Alfonso, Amparo; Botana, Luis M.; Vasconcelos, Vítor

    2012-01-01

    Tetrodotoxin is a potent low weight marine toxin found in warm waters, especially of the Indian and Pacific Oceans. Intoxications are usually linked to the consumption of the puffer fish, although TTX was already detected in several different edible taxa. Benthic organisms such as mollusks and echinoderms, with different feeding habits, were collected monthly along the Portuguese coast from the summer of 2009 until the end of 2010. The extraction and analysis techniques were optimized and TTX and some analogues were detected for the first time in two intertidal gastropod species—Gibbula umbilicalis and Monodonta lineata by LC-MS/MS and UPLC-MS/MS. Although the levels are low, these findings suggest that monitoring of TTX and analogues in North Atlantic species should be implemented so as to detect potentially new toxin vectors and seasonal and/or geographical patterns. PMID:22690139

  18. Five new cryptic freshwater gastropod species from New Caledonia (Caenogastropoda, Truncatelloidea, Tateidae)

    PubMed Central

    Haase, Martin; Zielske, Susan

    2015-01-01

    Abstract During the course of a project aiming at the reconstruction of the colonization of the South Pacific islands by tateid gastropods based on molecular data we discovered five new species on New Caledonia belonging to the genera Hemistomia and Leiorhagium, respectively. We describe these species based on morphological, anatomical and genetic data. All five species are morphologically cryptic as they closely resemble or are even indistinguishable from known species stressing the importance of a comprehensive taxonomic approach integrating several methods. As a consequence of their small and fragmented geographic ranges and the rapidly progressing anthropogenic land cover changes on New Caledonia, all five species qualify as critically endangered according to the criteria of the IUCN. PMID:26478699

  19. Hyaluronan in Tubular and Interstitial Nephrocalcinosis

    NASA Astrophysics Data System (ADS)

    Verkoelen, Carl F.

    2007-04-01

    Hyaluronan (HA) is the major glycosaminoglycan (GAG) component of the renal medullary interstitium. HA is extremely large (up to 104 kDa) and composed of thousands repeating disaccharides of glucuronic acid (GlcUA) and N-acetylglucosamine (GlcNAc). HA is synthesized by hyaluronan synthases (HASs) and degraded by hyaluronidases (Hyals). The production of HA by renomedullary interstitial cells is mediated by local osmolality. When excess water needs to be excreted, increased interstitial HA seems to antagonize water reabsorption, while the opposite occurs during water conservation. Hence, papillary interstitial HA is low and Hyal high during anti-diuresis, whereas during diuresis HA is high and Hyal low. The polyanion HA plays a role in the reabsorption of hypotonic fluid by immobilizing cations (Na+) via the carboxylate (COO-) groups of GlcUA. The binding of Ca2+ to anionic HA is probably also responsible for the fact that the papilla does not become a stone despite the extremely high interstitial phosphate and oxalate. HA is also an excellent crystal binding molecule. The expression of HA at the luminal surface of renal tubular cells leads to tubular nephrocalcinosis (tubular NC). Calcium staining methods (Von Kossa, Yasue) demonstrated that crystallization inhibitors cannot avoid the occasional precipitation of calcium phosphate in the papillary interstitium (interstitial NC). These crystals are probably immediately immobilized by the gel-like HA matrix. After ulcerating through the pelvic wall the calcified matrix becomes a Randall's plaque. The attachment of calcium oxalate crystals from the primary urine to plaque may ultimately lead to the development of clinical stones in the renal calyces (nephrolithiasis).

  20. Microstructures in shells of the freshwater gastropod Viviparus viviparus: a potential sensor for temperature change?

    PubMed

    Füllenbach, Christoph S; Schöne, Bernd R; Branscheid, Robert

    2014-09-01

    Mollusk shells contain a plethora of information on past climate variability. However, only a limited toolkit is currently available to reconstruct such data from the shells. The environmental data of some proxies (e.g. Sr/Ca ratios) is obscured by physiological effects, whereas other proxies, such as δ(18)O, simultaneously provide information on two or more different environmental variables. The present study investigates whether microstructures of the freshwater gastropod Viviparus viviparus provide an alternative means to reconstruct past water temperature. Cold and highly variable temperature regimes resulted in the precipitation of highly unordered first-order lamellae of simple crossed-lamellar (XLM) structures if new shell formed from scratch. However, during stable and warm conditions, well-ordered first-order lamellae were laid down irrespective of pre-existing shell material. Homogeneous first-order lamellae also formed during times of cold and highly variable temperatures if the new shell was deposited onto existing shell material with well-ordered first-order lamellae. The growth front seems to contain instructions for building specific microstructure variants, irrespective of environmental conditions. However, if this template is missing, the animal forms a deviating microstructure. Under extremely stressful situations (e.g. removal from habitat, calcein staining, extreme temperature shifts), the gastropod precipitates an evolutionarily older microstructure (irregular simple prisms) rather than XLM structures. These shell portions were macroscopically described as disturbance lines. In addition, repetitive, presumably periodic growth patterns were observed, which consisted of gradually changing third-order lamellae between consecutive faint, organic-rich growth lines. These growth patterns were probably controlled by intrinsic biological clocks and exhibited a two-daily periodicity. The results of this study may provide the basis for using changes in

  1. 17β-Oestradiol may prolong reproduction in seasonally breeding freshwater gastropod molluscs.

    PubMed

    Benstead, Rachel S; Baynes, Alice; Casey, Daire; Routledge, Edwin J; Jobling, Susan

    2011-01-25

    Whilst the effects of oestrogenic contaminants in the aquatic environment are well documented in fish, effects in invertebrate species has been subject to debate, possibly due to differences in experimental conditions (temperature, timing and duration of exposure) between studies. It has been suggested that molluscs are only susceptible to oestrogens in periods either following the main spawning or leading up to the maturation of gametes. To investigate this possibility, two temperate, seasonally reproducing gastropods (Planorbarius corneus and Viviparus viviparus) were exposed to two concentrations of 17β-oestradiol (E2; 10ng/l and 100ng/l nominal) in an outdoor mesocosm (subject to natural seasons). In addition, P. corneus was also exposed to E2 (1, 10 and 100ng/l) in the laboratory at temperatures and photoperiods to simulate summer and autumn. In the mesocosm, both snail species produced similar numbers of eggs/embryos as reference groups in the summer, but the groups exposed to 10ngE2/l (nominal) had significantly higher productivities after the onset of autumn, when entering their quiescent phase, whilst the snails exposed to a higher concentration (100ng/l, nominal) had an increased rate of mortality, and did not experience increased reproduction. In the laboratory, the rate of egg laying in P. corneus was unaffected in simulated summer (20°C, 16h photoperiod), but snails exposed to 10 and 100ng/l (nominal) in simulated autumn (15°C, 12h photoperiod) showed a concentration-dependent inhibition of the natural decline in egg laying observed in the control snails. Overall, rather than an increase in reproductive rate, the response of this species was a perpetuation of summer reproductive rates into autumn. We conclude that exposure to E2 can affect reproduction in the freshwater gastropods studied, but in P. corneus at least, this is dependent on the seasonal conditions (temperature and photoperiod) at which exposures are made. PMID:21216342

  2. [Composition, abundance and distribution of populations of commercially important gastropods in La Guajira, Colombian Caribbean].

    PubMed

    Nieto-Bernal, Ramón; Luis, Chasqui; Rodriguez, Angélica María; Castro, Erick; Gil-Agudelo, Diego L

    2013-06-01

    In the continental Colombian Caribbean the conch resource exploitation and the status of snails populations has been poorly studied, which are reflected in the lack of fisheries management. This study assesses composition, population density and distribution of the gastropods species that make conch resource in La Guajira region. Underwater visual censuses for snails were performed between September-November 2009 in 145100x4m (400m2) transects, spanning a total area of 56920m2 between Riohacha and Cabo de la Vela. The study was complemented with the evaluation of composition, abundance and size of gastropods conch found in the discarded-by-fishermen shell mounds in 13 beaches. In October 2010 another 40 transects were evaluated (16 000 m2) from the Southern of Riohacha to the Camarones village (La Guajira). We found a total of 9911 snails belonging to 12 species, the most abundant being Strombus pugilis with 8 912 individuals and an average density of 1 538.4 +/- 3 662.6 ind./ha, followed by Vasum muricatum with 374 individuals and an average density of 51.8 +/- 91.2 ind./ha. Calculating the importance value index (IVI) for both living organisms as the empty shells on beaches, shows that Turbinella angulata is the most used species by artisanal fishermen in the region. Cassis madagascariensis and Cassis tuberosa are also important snail resources in the region (as suggested by the number of empty shells found in beaches), but its densities were low. Strombus gigas, with only three living organisms found in the area, presented the lowest abundance ever found in the Colombian Caribbean (0.52 +/- 3.6 ind./ha), showing that queen conch population in La Guajira cannot support commercial exploitation. The abundance of discarded S. gigas shells on beaches suggests resource exploitation in the recent past. Results remarks the urgency of implementing management plans for snail fisheries in the region. PMID:23885583

  3. The ultrastructure of spermatozoa and spermiogenesis in pyramidellid gastropods, and its systematic importance

    NASA Astrophysics Data System (ADS)

    Healy, John M.

    1988-06-01

    Ultrastructural observations on spermiogenesis and spermatozoa of selected pyramidellid gastropods (species of Turbonilla, Pyrgulina, Cingulina and Hinemoa) are presented. During spermatid developement, the condensing nucleus becomes initially anterio-posteriorly compressed or sometimes cup-shaped. Concurrently, the acrosomal complex attaches to an electrondense layer at the presumptive anterior pole of the nucleus, while at the opposite (posterior) pole of the nucleus a shallow invagination is formed to accommodate the centriolar derivative. Midpiece formation begins soon after these events have taken place, and involves the following processes: (1) the wrapping of individual mitochondria around the axoneme/coarse fibre complex; (2) later internal metamorphosis resulting in replacement of cristae by paracrystalline layers which envelope the matrix material; and (3) formation of a glycogen-filled helix within the mitochondrial derivative (via a secondary wrapping of mitochondria). Advanced stages of nuclear condensation (elongation, transformation of fibres into lamellae, subsequent compaction) and midpiece formation proceed within a microtubular sheath (‘manchette’). Pyramidellid spermatozoa consist of an acrosomal complex (round to ovoid apical vesicle; column-shaped acrosomal pedestal), helically-keeled nucleus (short, 7 10 μm long, shallow basal invagination for axoneme/coarse fibre attachment), elongate helical midpiece (composed of axoneme, coarse fibres, paracrystalline and matrix materials, glycogen-filled helix), glycogen piece (length variable, preceeded by a dense ring structure at junction with midpiece). The features of developing and mature spermatozoa observed in the Pyramidellidae are as observed in opisthobranch and pulmonate gastropods indicating that the Pyramidelloidea should be placed within the Euthyneura/Heterobranchia, most appropriately as a member group of the Opisthobranchia.

  4. Correlated Evolution between Mode of Larval Development and Habitat in Muricid Gastropods

    PubMed Central

    Pappalardo, Paula; Rodríguez-Serrano, Enrique; Fernández, Miriam

    2014-01-01

    Abstract Larval modes of development affect evolutionary processes and influence the distribution of marine invertebrates in the ocean. The decrease in pelagic development toward higher latitudes is one of the patterns of distribution most frequently discussed in marine organisms (Thorson's rule), which has been related to increased larval mortality associated with long pelagic durations in colder waters. However, the type of substrate occupied by adults has been suggested to influence the generality of the latitudinal patterns in larval development. To help understand how the environment affects the evolution of larval types we evaluated the association between larval development and habitat using gastropods of the Muricidae family as a model group. To achieve this goal, we collected information on latitudinal distribution, sea water temperature, larval development and type of substrate occupied by adults. We constructed a molecular phylogeny for 45 species of muricids to estimate the ancestral character states and to assess the relationship between traits using comparative methods in a Bayesian framework. Our results showed high probability for a common ancestor of the muricids with nonpelagic (and nonfeeding) development, that lived in hard bottoms and cold temperatures. From this ancestor, a pelagic feeding larva evolved three times, and some species shifted to warmer temperatures or sand bottoms. The evolution of larval development was not independent of habitat; the most probable evolutionary route reconstructed in the analysis of correlated evolution showed that type of larval development may change in soft bottoms but in hard bottoms this change is highly unlikely. Lower sea water temperatures were associated with nonpelagic modes of development, supporting Thorson's rule. We show how environmental pressures can favor a particular mode of larval development or transitions between larval modes and discuss the reacquisition of feeding larva in muricids

  5. Correlated evolution between mode of larval development and habitat in muricid gastropods.

    PubMed

    Pappalardo, Paula; Rodríguez-Serrano, Enrique; Fernández, Miriam

    2014-01-01

    Larval modes of development affect evolutionary processes and influence the distribution of marine invertebrates in the ocean. The decrease in pelagic development toward higher latitudes is one of the patterns of distribution most frequently discussed in marine organisms (Thorson's rule), which has been related to increased larval mortality associated with long pelagic durations in colder waters. However, the type of substrate occupied by adults has been suggested to influence the generality of the latitudinal patterns in larval development. To help understand how the environment affects the evolution of larval types we evaluated the association between larval development and habitat using gastropods of the Muricidae family as a model group. To achieve this goal, we collected information on latitudinal distribution, sea water temperature, larval development and type of substrate occupied by adults. We constructed a molecular phylogeny for 45 species of muricids to estimate the ancestral character states and to assess the relationship between traits using comparative methods in a Bayesian framework. Our results showed high probability for a common ancestor of the muricids with nonpelagic (and nonfeeding) development, that lived in hard bottoms and cold temperatures. From this ancestor, a pelagic feeding larva evolved three times, and some species shifted to warmer temperatures or sand bottoms. The evolution of larval development was not independent of habitat; the most probable evolutionary route reconstructed in the analysis of correlated evolution showed that type of larval development may change in soft bottoms but in hard bottoms this change is highly unlikely. Lower sea water temperatures were associated with nonpelagic modes of development, supporting Thorson's rule. We show how environmental pressures can favor a particular mode of larval development or transitions between larval modes and discuss the reacquisition of feeding larva in muricids gastropods

  6. Evolution and development of gastropod larval shell morphology: experimental evidence for mechanical defense and repair.

    PubMed

    Hickman, C S

    2001-01-01

    The structural diversity of gastropod veliger larvae offers an instructive counterpoint to the view of larval forms as conservative archetypes. Larval structure, function, and development are fine-tuned for survival in the plankton. Accordingly, the study of larval adaptation provides an important perspective for evolutionary-developmental biology as an integrated science. Patterns of breakage and repair in the field, as well as patterns of breakage in arranged encounters with zooplankton under laboratory conditions, are two powerful sources of data on the adaptive significance of morphological and microsculptural features of the gastropod larval shell. Shells of the planktonic veliger larvae of the caenogastropod Nassarius paupertus [GOULD] preserve multiple repaired breaks, attributed to unsuccessful zooplankton predators. In culture, larvae isolated from concentrated zooplankton samples rapidly repaired broken apertural margins and restored the "ideal" apertural form, in which an elaborate projection or "beak" covers the head of the swimming veliger. When individuals with repaired apertures were reintroduced to a concentrated mixture of potential zooplankton predators, the repaired margins were rapidly chipped and broken back. The projecting beak of the larval shell is the first line of mechanical defense, covering the larval head and mouth and potentially the most vulnerable part of the shell to breakage. Patterns of mechanical failure show that spiral ridges do reinforce the beak and retard breakage. The capacity for rapid shell repair and regeneration, and the evolution of features that resist or retard mechanical damage, may play a more prominent role than previously thought in enhancing the ability of larvae to survive in the plankton. PMID:11256430

  7. 3D-Ultrastructure, Functions and Stress Responses of Gastropod (Biomphalaria glabrata) Rhogocytes

    PubMed Central

    Kokkinopoulou, Maria; Güler, M. Alptekin; Lieb, Bernhard; Barbeck, Mike; Ghanaati, Shahram; Markl, Jürgen

    2014-01-01

    Rhogocytes are pore cells scattered among the connective tissue of different body parts of gastropods and other molluscs, with great variation in their number, shape and size. They are enveloped by a lamina of extracellular matrix. Their most characteristic feature is the “slit apparatus”, local invaginations of the plasma membrane bridged by cytoplasmic bars, forming slits of ca. 20 nm width. A slit diaphragm creates a molecular sieve with permeation holes of 20×20 nm. In blue-blooded gastropods, rhogocytes synthesize and secrete the respiratory protein hemocyanin, and it has been proposed–though not proven–that in the rare red-blooded snail species they might synthesize and secrete the hemoglobin. However, the cellular secretion pathway for respiratory proteins, and the functional role(s) of the enigmatic rhogocyte slit apparatus are still unclear. Additional functions for rhogocytes have been proposed, notably a role in protein uptake and degradation, and in heavy metal detoxification. Here we provide new structural and functional information on the rhogocytes of the red-blooded freshwater snail Biomphalaria glabrata. By in situ hybridization of mantle tissues, we prove that rhogocytes indeed synthesize hemoglobin. By electron tomography, the first three dimensional (3D) reconstructions of the slit apparatus are provided, showing detail of highly dense material in the cytoplasmic bars close to the slits. By immunogold labelling, we collected evidence that a major component of this material is actin. By genome databank mining, the complete sequence of a B. glabrata nephrin was obtained, and localized to the rhogocytes by immunofluorescence microscopy. The presence of both proteins fit the ultrastructure-based hypothesis that rhogocytes are related to mammalian podocytes and insect nephrocytes. Reactions of the rhogocytes to deprivation of food and cadmium toxification are also documented, and a possible secretion pathway of newly synthesized respiratory

  8. Non-Random Sibling Cannibalism in the Marine Gastropod Crepidula coquimbensis

    PubMed Central

    Brante, Antonio; Fernández, Miriam; Viard, Frédérique

    2013-01-01

    Sibling cannibalism is commonly observed in marine species. For instance, intrabrood cannibalism has been documented in marine gastropods with direct development, suggesting a relationship between embryo behavior and the evolution of life history strategies. However, there has been little effort to document the factors driving sibling cannibalism in marine species. The kin selection theory suggests that the level of relatedness plays an important role in cannibalism patterns. We examined Crepidula coquimbensis, a marine gastropod that broods and encloses its brooded offspring in capsules. Encapsulated embryos show sibling cannibalism and high levels of intracapsular multiple paternity. Given these features, cannibalistic behavior may be driven by kin-relatedness. To test this hypothesis, we constructed artificial aggregations of embryos to mimic three levels of relatedness: high, medium and low. For each category of aggregation, the cannibalism rate and benefits (i.e. size at hatching of surviving offspring) were estimated. In addition, at the end of embryo development, we performed parentage analyses to determine if cannibalism was associated with the relatedness between cannibal and victim embryos. Our results show that the intensity of sibling cannibalism increased in aggregations characterized by the lowest level of relatedness. There were important benefits of cannibalism in terms of hatching cannibal size. In addition, cannibalism between embryos was not random: the variation in reproductive success between males increased over the course of the experiment and the effective number of fathers decreased. Altogether, these results suggest that polyandry may play an important role in the evolution of sibling cannibalism in C. coquimbensis and that kin selection may operate during early embryonic stages in this species. PMID:23805291

  9. Non-Random Sibling Cannibalism in the Marine Gastropod Crepidula coquimbensis.

    PubMed

    Brante, Antonio; Fernández, Miriam; Viard, Frédérique

    2013-01-01

    Sibling cannibalism is commonly observed in marine species. For instance, intrabrood cannibalism has been documented in marine gastropods with direct development, suggesting a relationship between embryo behavior and the evolution of life history strategies. However, there has been little effort to document the factors driving sibling cannibalism in marine species. The kin selection theory suggests that the level of relatedness plays an important role in cannibalism patterns. We examined Crepidula coquimbensis, a marine gastropod that broods and encloses its brooded offspring in capsules. Encapsulated embryos show sibling cannibalism and high levels of intracapsular multiple paternity. Given these features, cannibalistic behavior may be driven by kin-relatedness. To test this hypothesis, we constructed artificial aggregations of embryos to mimic three levels of relatedness: high, medium and low. For each category of aggregation, the cannibalism rate and benefits (i.e. size at hatching of surviving offspring) were estimated. In addition, at the end of embryo development, we performed parentage analyses to determine if cannibalism was associated with the relatedness between cannibal and victim embryos. Our results show that the intensity of sibling cannibalism increased in aggregations characterized by the lowest level of relatedness. There were important benefits of cannibalism in terms of hatching cannibal size. In addition, cannibalism between embryos was not random: the variation in reproductive success between males increased over the course of the experiment and the effective number of fathers decreased. Altogether, these results suggest that polyandry may play an important role in the evolution of sibling cannibalism in C. coquimbensis and that kin selection may operate during early embryonic stages in this species. PMID:23805291

  10. 3D-ultrastructure, functions and stress responses of gastropod (Biomphalaria glabrata) rhogocytes.

    PubMed

    Kokkinopoulou, Maria; Güler, M Alptekin; Lieb, Bernhard; Barbeck, Mike; Ghanaati, Shahram; Markl, Jürgen

    2014-01-01

    Rhogocytes are pore cells scattered among the connective tissue of different body parts of gastropods and other molluscs, with great variation in their number, shape and size. They are enveloped by a lamina of extracellular matrix. Their most characteristic feature is the "slit apparatus", local invaginations of the plasma membrane bridged by cytoplasmic bars, forming slits of ca. 20 nm width. A slit diaphragm creates a molecular sieve with permeation holes of 20×20 nm. In blue-blooded gastropods, rhogocytes synthesize and secrete the respiratory protein hemocyanin, and it has been proposed-though not proven-that in the rare red-blooded snail species they might synthesize and secrete the hemoglobin. However, the cellular secretion pathway for respiratory proteins, and the functional role(s) of the enigmatic rhogocyte slit apparatus are still unclear. Additional functions for rhogocytes have been proposed, notably a role in protein uptake and degradation, and in heavy metal detoxification. Here we provide new structural and functional information on the rhogocytes of the red-blooded freshwater snail Biomphalaria glabrata. By in situ hybridization of mantle tissues, we prove that rhogocytes indeed synthesize hemoglobin. By electron tomography, the first three dimensional (3D) reconstructions of the slit apparatus are provided, showing detail of highly dense material in the cytoplasmic bars close to the slits. By immunogold labelling, we collected evidence that a major component of this material is actin. By genome databank mining, the complete sequence of a B. glabrata nephrin was obtained, and localized to the rhogocytes by immunofluorescence microscopy. The presence of both proteins fit the ultrastructure-based hypothesis that rhogocytes are related to mammalian podocytes and insect nephrocytes. Reactions of the rhogocytes to deprivation of food and cadmium toxification are also documented, and a possible secretion pathway of newly synthesized respiratory proteins

  11. Consumption rates and prey preference of the invasive gastropod Rapana venosa in the Northern Adriatic Sea

    NASA Astrophysics Data System (ADS)

    Savini, Dario; Occhipinti-Ambrogi, Anna

    2006-05-01

    The alien Asian gastropod Rapana venosa (Valenciennes 1846) was first recorded in 1973 along the Italian coast of the Northern Adriatic Sea. Recently, this predator of bivalves has been spreading all around the world oceans, probably helped by ship traffic and aquaculture trade. A caging experiment in natural environment was performed during the summer of 2002 in Cesenatico (Emilia-Romagna, Italy) in order to estimate consumption rates and prey preference of R. venosa. The prey items chosen were the Mediterranean mussel Mytilus galloprovincialis (Lamarck 1819), the introduced carpet clam Tapes philippinarum (Adams and Reeve 1850), both supporting the local fisheries, and the Indo-Pacific invasive clam Anadara (Scapharca) inaequivalvis (Bruguière 1789). Results showed an average consumption of about 1 bivalve prey per day (or 1.2 g wet weight per day). Predation was species and size selective towards small specimens of A. inaequivalvis; consumption of the two commercial species was lower. These results might reduce the concern about the economical impact on the local bivalve fishery due to the presence of the predatory gastropod. On the other hand, selective predation might probably alter local community structure, influencing competition amongst filter feeder/suspension feeder bivalve species and causing long-term ecological impact. The large availability of food resource and the habitat characteristics of the Emilia-Romagna littoral makes this area an important breeding ground for R. venosa in the Mediterranean Sea, thus worthy of consideration in order to understand the bioinvasion ecology of this species and to control its likely further dispersal.

  12. Genetic Analysis of Sporadic and Familial Interstitial Pneumonia

    PubMed Central

    Schwartz, David A.

    2008-01-01

    Although much progress has been made in understanding the biology and clinical course of interstitial pneumonia, the etiology of this disease remains elusive. Epidemiologic studies have consistently identified cigarette smoke as an important exposure; however, most smokers do not develop interstitial pneumonia and many individuals with interstitial pneumonia do not smoke cigarettes. Moreover, interstitial pneumonias have been reported to cluster in families. Thus, a more thorough understanding of the genetic etiology of interstitial pneumonia may prove critically important in defining the biology and clinical course of this complex human disease. PMID:18403331

  13. Pancreas tumor interstitial pressure catheter measurement

    NASA Astrophysics Data System (ADS)

    Nieskoski, Michael D.; Gunn, Jason; Marra, Kayla; Trembly, B. Stuart; Pogue, Brian W.

    2016-03-01

    This paper highlights the methodology in measuring interstitial pressure in pancreatic adenocarcinoma tumors. A Millar Mikrotip pressure catheter (SPR-671) was used in this study and a system was built to amplify and filter the output signal for data collection. The Millar pressure catheter was calibrated prior to each experiment in a water column at 37°C, range of 0 to 60 inH2O (112 mmHg), resulting in a calibration factor of 33 mV / 1 inH2O. The interstitial pressures measured in two orthotopically grown pancreatic adenocarcinoma tumor were 57 mmHg and 48 mmHg, respectively. Verteporfin uptake into the pancreatic adenocarcinoma tumor was measured using a probe-based experimental dosimeter.

  14. Irradiation system for interstitial photodynamic therapy

    NASA Astrophysics Data System (ADS)

    Pacheco, L.; Stolik, S.; De la Rosa, J.

    2013-11-01

    Interstitial Photodynamic Therapy (IPDT) is a promising form of treatment of deep-seated and bulky malignant tumors, based on the lethal cell response to the photochemical reactions when drug is light activated in presence of oxygen. In order to accomplish an effective internal illumination, laser sources are preferably used because of two important reasons: the monochromatic light can be confined to the narrow absorption band of the drug and the laser beam is easily focused into optical fibers. In this work the development of a diode-laser-light-source is presented. The system is tuned by temperature to get a better match in the 5-ALA absorption band. This system also comprises a trifurcated fiber system to accomplish interstitial illumination.

  15. Surface effects in Si interstitial formation energies

    NASA Astrophysics Data System (ADS)

    Mattsson, Ann E.; Wixom, Ryan R.; Armiento, Rickard

    2007-03-01

    We are calculating Si self-interstitial formation energies using Density Functional Theory and several different exchange-correlation energy functionals. We show that the difference in results obtained with the LDA, PBE, PW91, and AM05 [1] functionals can be explained by the functionals' different surface intrinsic errors. We explain why surface effects are important for formation energies of interstitials in semi-conductors. Surface effects have previously been studied for metal vacancy formation energies. Sandia is a multiprogram laboratory operated by Sandia Corporation, a Lockheed Martin Company, for the United States Department of Energy's National Nuclear Security Administration under contract DE-AC04-94AL85000. [1] R. Armiento and A. E. Mattsson, Phys. Rev. B 72, 085108 (2005).

  16. [Computer-assisted system for interstitial hyperthermia].

    PubMed

    Kneschaurek, P; Weisser, M

    1987-03-01

    The combination of interstitial radiotherapy and interstitial hyperthermia is more promising in the treatment of tumors than one of these methods alone. The unit developed by us uses the afterloading needles for heating up the tumor tissue with ohm current and for controlling the distribution of temperature in the target volume. Up to twelve needles are provided by one commutator with the R.F. current controlled by the computer. The temperature is measured by three thermistors per needle which are arranged at an axial distance of 2 cm each. The linearization of the thermistor characteristics and the control of cummutator and R.F. generator is performed by the computer over an interface constructed by us. In order to achieve a homogeneous distribution of temperature in the target volume and to avoid hot spots, we have examined several needle configurations by measuring in an homogeneous phantom. PMID:3563878

  17. Interstitial devices for treating deep seated tumors

    NASA Astrophysics Data System (ADS)

    Lafon, Cyril; Cathignol, Dominique; Prat, Frédéric; Melodelima, David; Salomir, Rares; Theillère, Yves; Chapelon, Jean-Yves

    2006-05-01

    Techniques using intracavitary or interstitial applicators have been proposed because extracorporeal HIFU techniques are not always suitable for deep-seated tumors. Bones or gaseous pockets may indeed be located in the intervening tissue. The objective is to bring the ultrasound source as close as possible to the target through natural routes in order to minimize the effects of attenuation and phase aberration along the ultrasound pathway. Under these circumstances, it becomes possible to use higher frequency, thus increasing the ultrasonic absorption coefficient and resulting in more efficient heating of the treatment region. In contrast to extra-corporeal applicators, the design of interstitial probes imposes additional constraints relative to size and ergonomy. The goal of this paper is to present the range of miniature interstitial applicators we developed at INSERM for various applications. The sources are rotating plane water-cooled transducers that operate at a frequency between 3 and 10 MHz depending on the desired therapeutic depth. The choice of a plane transducer rather than divergent sources permits to extend the therapeutic depth and to enhance the angular selectivity of the treatment Rotating single element flat transducer can also be replaced by cylindrical arrays for rotating electronically a reconstructed plane wave. When extended zone of coagulation are required, original therapeutic modalities combining cavitation and thermal effects are used. These methods consist in favoring in depth heating by increasing the acoustic attenuation away from the transducer with the presence of bubbles. When associated to modern imaging modalities, these minimally invasive therapeutic devices offer very promising options for cancer treatment. For examples, two versions of an image-guided esophageal applicator are designed: one uses a retractable ultrasound mini probe for the positioning of the applicator, while the other is MRI compatible and offers on line

  18. Interstitial cystitis/painful bladder syndrome.

    PubMed

    Panzera, Alis Kolter

    2007-02-01

    Interstitial cystitis (IC) is a chronic, painful bladder syndrome primarily found in women. Although the direct cause(s) of IC are unknown, several theories exist. Common symptoms include urinary urgency, frequency, and pain. Treatment options include behavioral therapies, use of pharmacologic agents, and surgery. Patients benefit from prompt diagnosis and initiation of treatments. Important clinical features of IC in women including the pathology, common symptoms, and recommended evaluation and management strategies are reviewed. PMID:17390922

  19. Ecosystem engineering potential of the gastropod Terebralia palustris (Linnaeus, 1767) in mangrove wastewater wetlands--a controlled mesocosm experiment.

    PubMed

    Penha-Lopes, Gil; Bartolini, Fabrizio; Limbu, Samwel; Cannicci, Stefano; Mgaya, Yunus; Kristensen, Erik; Paula, José

    2010-01-01

    The effect of different sewage concentrations (0, 20, 60 and 100%), vegetation (Bare, Avicennia marina or Rhizophora mucronata) and immersion periods (immersion/emersion period of 12/12 h or 3/3 days just for 100%) conditions were studied for 6 months on survival and growth rates of Terebralia palustris (Linnaeus, 1767). Gastropods' activity and ecosystem engineering preformed at bare and A. marina planted cells and 3 sewage conditions (0, 20 and 60%) were determined. Survival rates were higher than 70% in all treatments. Growth rate decreased significantly with increasing sewage concentrations (mainly at unplanted conditions) and longer immersion periods. A complete shift (from immersion to emersion periods) and a significant decrease in mobility and consequently its engineer potential, due to sewage contamination, lead to a 3-4 fold decrease in the amount of sediment disturbed. Sewage contamination, primary producers' abundance and environmental conditions may have influenced the gastropods survival, growth and its ecosystem engineering potential. PMID:19640623

  20. [Distribution of acetylcholinesterase activity in the digestive system of the gastropod molluscs Littorina littorea and Achatina fulica].

    PubMed

    Zaĭtseva, O V; Kuznetsova, T V

    2008-01-01

    With the use of the histochemical procedure for the demonstration of acetylcholinesterase (AchE) activity, the distribution cholinergic regulatory elements was studied in the esophagus, the pharynx, the stomach, the liver (the digestive gland) and the intestine in sea and terrestrial gastropod molluscs that differed in their general organization level, lifestyle, habitat and feeding type. In both molluscs, all the parts of the digestive tract contained the significant amount of intraepithelial AchE-positive cells of the open type, single subepithelial neurons and the nervous fibers localized among the muscle cells of the wall of the organs. The basal processes of the AchE-positive intraepithelial cells were shown to form the intraepithelial nerve plexus and to pass under the epithelium. The peculiarities and common principles in the distribution of the nervous elements detected, their possible function and the regulatory role in the digestion in gastropod molluscs and other animals are discussed. PMID:19069417

  1. A new freshwater snail genus (Hydrobiidae, Gastropoda) from Montenegro, with a discussion on gastropod diversity and endemism in Skadar Lake

    PubMed Central

    Pešić, Vladimir; Glöer, Peter

    2013-01-01

    Abstract Karucia sublacustrina a new species of freshwater snails (Hydrobiidae, Gastropoda) is described based on material collected from Skadar Lake (Montenegro, Albania). The new species belongs to monotypic genus Karucia gen. n. The shell morphology and body shape of the new genus resembles Radomaniola Szarowska, 2006 and Grossuana Radoman, 1973, from which it differs in the larger shells with relatively slim and a slightly, but clearly shouldered body whorl. The number of gastropods from Skadar Lake basin tallies now 50 species. The adjusted rate of gastropod endemicity for Skadar Lake basin is estimated to be 38%. By compiling faunal and taxonomic data we also aim to provide information of relevance as to conservation efforts. PMID:23794834

  2. Breast conservation treatment with perioperative interstitial irradiation

    SciTech Connect

    Krishnan, L.; Mansfield, C.M.; Jewell, W.R.; Reddy, E.K.; Thomas, J.H.; Krishnan, E.C.

    1987-10-01

    Limited resection of the breast combined with radiation has proved to be as effective as more radical surgery in treating early breast cancer. At the University of Kansas Medical Center, the radiotherapy consists of an interstitial implant at the time of lumpectomy to deliver an interstitial boost dose to the tumor bed with iridium-192 immediately following the surgical procedure. An axillary node dissection is also performed at the time of lumpectomy. A dose of 2000 cGy is delivered to the tumor bed between 40 and 60 h. Two to three weeks later, 4500-5000 cGy is delivered to the entire breast with external beam radiation over 5-5.5 weeks. One hundred breasts in 98 patients were so treated between June 1982 and February 1986, with 2 carcinomas in situ, 40 stage I, 51 stage II, and 7 stage III cancers, consisting of 2 TIS, 54 T1, 39 T2, and 5 T3 lesions. Locoregional control with a median follow-up of 31 months was 98%. One recurrence was in a different quadrant, and the other revealed predominantly the in situ component. Immediate implant did not compromise wound healing or cosmesis. The cosmetic result was graded as good to excellent in 88% of the breasts. Our preliminary results appear to suggest a better local control with immediate interstitial irradiation.

  3. Interstitial loop transformations in FeCr

    DOE PAGESBeta

    Béland, Laurent Karim; Osetsky, Yuri N.; Stoller, Roger E.; Xu, Haixuan

    2015-03-27

    Here, we improve the Self-Evolving Atomistic Kinetic Monte Carlo (SEAKMC) algorithm by integrating the Activation Relaxation Technique nouveau (ARTn), a powerful open-ended saddle-point search method, into the algorithm. We use it to investigate the reaction of 37-interstitial 1/2[1 1 1] and 1/2[View the MathML source] loops in FeCr at 10 at.% Cr. They transform into 1/2[1 1 1], 1/2[View the MathML source], [1 0 0] and [0 1 0] 74-interstitial clusters with an overall barrier of 0.85 eV. We find that Cr decoration locally inhibits the rotation of crowdions, which dictates the final loop orientation. Moreover, the final loop orientationmore » depends on the details of the Cr decoration. Generally, a region of a given orientation is favored if Cr near its interface with a region of another orientation is able to inhibit reorientation at this interface more than the Cr present at the other interfaces. Also, we find that substitutional Cr atoms can diffuse from energetically unfavorable to energetically favorable sites within the interlocked 37-interstitial loops conformation with barriers of less than 0.35 eV.« less

  4. Interstitial loop transformations in FeCr

    SciTech Connect

    Béland, Laurent Karim; Osetsky, Yuri N.; Stoller, Roger E.; Xu, Haixuan

    2015-03-27

    Here, we improve the Self-Evolving Atomistic Kinetic Monte Carlo (SEAKMC) algorithm by integrating the Activation Relaxation Technique nouveau (ARTn), a powerful open-ended saddle-point search method, into the algorithm. We use it to investigate the reaction of 37-interstitial 1/2[1 1 1] and 1/2[View the MathML source] loops in FeCr at 10 at.% Cr. They transform into 1/2[1 1 1], 1/2[View the MathML source], [1 0 0] and [0 1 0] 74-interstitial clusters with an overall barrier of 0.85 eV. We find that Cr decoration locally inhibits the rotation of crowdions, which dictates the final loop orientation. Moreover, the final loop orientation depends on the details of the Cr decoration. Generally, a region of a given orientation is favored if Cr near its interface with a region of another orientation is able to inhibit reorientation at this interface more than the Cr present at the other interfaces. Also, we find that substitutional Cr atoms can diffuse from energetically unfavorable to energetically favorable sites within the interlocked 37-interstitial loops conformation with barriers of less than 0.35 eV.

  5. Interstitial pericytes decrease in aged mouse kidneys.

    PubMed

    Stefanska, Ania; Eng, Diana; Kaverina, Natalya; Duffield, Jeremy S; Pippin, Jeffrey W; Rabinovitch, Peter; Shankland, Stuart J

    2015-06-01

    With increasing age, the kidney undergoes characteristic changes in the glomerular and tubulo-interstitial compartments, which are ultimately accompanied by reduced kidney function. Studies have shown age-related loss of peritubular vessels. Normal peritubular vessel tone, function and survival depend on neighboring pericytes. Pericyte detachment leads to vascular damage, which can be accompanied by their differentiation to fibroblasts and myofibroblasts, a state that favors matrix production. To better understand the fate of pericytes in the aged kidney, 27 month-old mice were studied. Compared to 3 month-old young adult mice, aged kidneys showed a substantial decrease in capillaries, identified by CD31 staining, in both cortex and medulla. This was accompanied by a marked decrease in surrounding NG2+ / PDGFRβ+ pericytes. This decrease was more pronounced in the medulla. Capillaries devoid of pericytes were typically dilated in aged mice. Aged kidneys were also characterized by interstitial fibrosis due to increased collagen-I and -III staining. This was accompanied by an increase in the number of pericytes that acquired a pro-fibrotic phenotype, identified by increased PDGFRβ+ / αSMA+ staining. These findings are consistent with the decline in kidney interstitial pericytes as a critical step in the development of changes to the peritubular vasculature with aging, and accompanying fibrosis. PMID:26081073

  6. Interstitial pericytes decrease in aged mouse kidneys

    PubMed Central

    Stefanska, Ania; Eng, Diana; Kaverina, Natalya; Duffield, Jeremy S.; Pippin, Jeffrey W.; Rabinovitch, Peter; Shankland, Stuart J.

    2015-01-01

    With increasing age, the kidney undergoes characteristic changes in the glomerular and tubulo-interstitial compartments, which are ultimately accompanied by reduced kidney function. Studies have shown age-related loss of peritubular vessels. Normal peritubular vessel tone, function and survival depend on neighboring pericytes. Pericyte detachment leads to vascular damage, which can be accompanied by their differentiation to fibroblasts and myofibroblasts, a state that favors matrix production. To better understand the fate of pericytes in the aged kidney, 27 month-old mice were studied. Compared to 3 month-old young adult mice, aged kidneys showed a substantial decrease in capillaries, identified by CD31 staining, in both cortex and medulla. This was accompanied by a marked decrease in surrounding NG2+/PDGFRß+ pericytes. This decrease was more pronounced in the medulla. Capillaries devoid of pericytes were typically dilated in aged mice. Aged kidneys were also characterized by interstitial fibrosis due to increased collagen-I and -III staining. This was accompanied by an increase in the number of pericytes that acquired a pro-fibrotic phenotype, identified by increased PDGFRß+/αSMA+ staining. These findings are consistent with the decline in kidney interstitial pericytes as a critical step in the development of changes to the peritubular vasculature with aging, and accompanying fibrosis. PMID:26081073

  7. Morphological and behavioral differences in the gastropod Trophon geversianus associated to distinct environmental conditions, as revealed by a multidisciplinary approach

    NASA Astrophysics Data System (ADS)

    Márquez, Federico; Nieto Vilela, Rocío Aimé; Lozada, Mariana; Bigatti, Gregorio

    2015-01-01

    The gastropod Trophon geversianus exhibits shell polymorphisms along its distribution in subtidal and intertidal habitats. Our hypothesis is that morphological and behavioral patterns of T. geversianus represent habitat-specific constrains; subsequently we expect an association between shell morphology, attachment behavior, and habitat. In order to test this hypothesis we compared individuals from intertidal and subtidal habitats, at three sites in Golfo Nuevo (Argentina). We analyzed shell morphology using classic morphometric variables, 3D geometric morphometrics and computing tomography scan. The results were complemented with field observations of attachment to substrate and turning time behavior, as well as of the number of shell scars produced by crab predation. Our results showed differences in shell size and shape between intertidal and subtidal-collected individuals. Centroid size, total weight and shell weight, as well as shell density and thickness were significantly lower in intertidal individuals than in subtidal ones. Gastropods from intertidal habitats presented a low-spired shell and an expanded aperture which might allow better attachment to the bottom substrate, while subtidal individuals presented a slender and narrower shell shape. The number of crab scars was significantly higher in shells from subtidal individuals. Observations of the behavior of gastropods placed at the intertidal splash zone showed 100% of attachment to the bottom in the intertidal individuals, while subtidal specimens only attached in average in 32% of the cases. These latter took 12 times longer to re-attach to the bottom when faced up. Phylogenetic analysis of COI gene fragments showed no consistent differences among individuals sampled in both habitats. All these results suggest that T. geversianus has developed two ecomorphs with distinct morphological and behavioral responses to physically stressful conditions registered in north Patagonian intertidals, as opposed to

  8. Diverse Gastropod Hosts of Angiostrongylus cantonensis, the Rat Lungworm, Globally and with a Focus on the Hawaiian Islands

    PubMed Central

    Kim, Jaynee R.; Hayes, Kenneth A.; Yeung, Norine W.; Cowie, Robert H.

    2014-01-01

    Eosinophilic meningitis caused by the parasitic nematode Angiostrongylus cantonensis is an emerging infectious disease with recent outbreaks primarily in tropical and subtropical locations around the world, including Hawaii. Humans contract the disease primarily through ingestion of infected gastropods, the intermediate hosts of Angiostrongylus cantonensis. Effective prevention of the disease and control of the spread of the parasite require a thorough understanding of the parasite's hosts, including their distributions, as well as the human and environmental factors that contribute to transmission. The aim of this study was to screen a large cross section of gastropod species throughout the main Hawaiian Islands to determine which act as hosts of Angiostrongylus cantonensis and to assess the parasite loads in these species. Molecular screening of 7 native and 30 non-native gastropod species revealed the presence of the parasite in 16 species (2 native, 14 non-native). Four of the species tested are newly recorded hosts, two species introduced to Hawaii (Oxychilus alliarius, Cyclotropis sp.) and two native species (Philonesia sp., Tornatellides sp.). Those species testing positive were from a wide diversity of heterobranch taxa as well as two distantly related caenogastropod taxa. Review of the global literature showed that many gastropod species from 34 additional families can also act as hosts. There was a wide range of parasite loads among and within species, with an estimated maximum of 2.8 million larvae in one individual of Laevicaulis alte. This knowledge of the intermediate host range of Angiostrongylus cantonensis and the range of parasite loads will permit more focused efforts to detect, monitor and control the most important hosts, thereby improving disease prevention in Hawaii as well as globally. PMID:24788772

  9. The Mitochondrial Genomes of the Nudibranch Mollusks, Melibe leonina and Tritonia diomedea, and Their Impact on Gastropod Phylogeny

    PubMed Central

    Sevigny, Joseph L.; Kirouac, Lauren E.; Thomas, William Kelley; Ramsdell, Jordan S.; Lawlor, Kayla E.; Sharifi, Osman; Grewal, Simarvir; Baysdorfer, Christopher; Curr, Kenneth; Naimie, Amanda A.; Okamoto, Kazufusa; Murray, James A.; Newcomb, James M.

    2015-01-01

    The phylogenetic relationships among certain groups of gastropods have remained unresolved in recent studies, especially in the diverse subclass Opisthobranchia, where nudibranchs have been poorly represented. Here we present the complete mitochondrial genomes of Melibe leonina and Tritonia diomedea (more recently named T. tetraquetra), two nudibranchs from the unrepresented Cladobranchia group, and report on the resulting phylogenetic analyses. Both genomes coded for the typical thirteen protein-coding genes, twenty-two transfer RNAs, and two ribosomal RNAs seen in other species. The twelve-nucleotide deletion previously reported for the cytochrome oxidase 1 gene in several other Melibe species was further clarified as three separate deletion events. These deletions were not present in any opisthobranchs examined in our study, including the newly sequenced M. leonina or T. diomedea, suggesting that these previously reported deletions may represent more recently divergent taxa. Analysis of the secondary structures for all twenty-two tRNAs of both M. leonina and T. diomedea indicated truncated d arms for the two serine tRNAs, as seen in some other heterobranchs. In addition, the serine 1 tRNA in T. diomedea contained an anticodon not yet reported in any other gastropod. For phylogenetic analysis, we used the thirteen protein-coding genes from the mitochondrial genomes of M. leonina, T. diomedea, and seventy-one other gastropods. Phylogenetic analyses were performed for both the class Gastropoda and the subclass Opisthobranchia. Both Bayesian and maximum likelihood analyses resulted in similar tree topologies. In the Opisthobranchia, the five orders represented in our study were monophyletic (Anaspidea, Cephalaspidea, Notaspidea, Nudibranchia, Sacoglossa). In Gastropoda, two of the three traditional subclasses, Opisthobranchia and Pulmonata, were not monophyletic. In contrast, four of the more recently named gastropod clades (Vetigastropoda, Neritimorpha

  10. The Mitochondrial Genomes of the Nudibranch Mollusks, Melibe leonina and Tritonia diomedea, and Their Impact on Gastropod Phylogeny.

    PubMed

    Sevigny, Joseph L; Kirouac, Lauren E; Thomas, William Kelley; Ramsdell, Jordan S; Lawlor, Kayla E; Sharifi, Osman; Grewal, Simarvir; Baysdorfer, Christopher; Curr, Kenneth; Naimie, Amanda A; Okamoto, Kazufusa; Murray, James A; Newcomb, James M

    2015-01-01

    The phylogenetic relationships among certain groups of gastropods have remained unresolved in recent studies, especially in the diverse subclass Opisthobranchia, where nudibranchs have been poorly represented. Here we present the complete mitochondrial genomes of Melibe leonina and Tritonia diomedea (more recently named T. tetraquetra), two nudibranchs from the unrepresented Cladobranchia group, and report on the resulting phylogenetic analyses. Both genomes coded for the typical thirteen protein-coding genes, twenty-two transfer RNAs, and two ribosomal RNAs seen in other species. The twelve-nucleotide deletion previously reported for the cytochrome oxidase 1 gene in several other Melibe species was further clarified as three separate deletion events. These deletions were not present in any opisthobranchs examined in our study, including the newly sequenced M. leonina or T. diomedea, suggesting that these previously reported deletions may represent more recently divergent taxa. Analysis of the secondary structures for all twenty-two tRNAs of both M. leonina and T. diomedea indicated truncated d arms for the two serine tRNAs, as seen in some other heterobranchs. In addition, the serine 1 tRNA in T. diomedea contained an anticodon not yet reported in any other gastropod. For phylogenetic analysis, we used the thirteen protein-coding genes from the mitochondrial genomes of M. leonina, T. diomedea, and seventy-one other gastropods. Phylogenetic analyses were performed for both the class Gastropoda and the subclass Opisthobranchia. Both Bayesian and maximum likelihood analyses resulted in similar tree topologies. In the Opisthobranchia, the five orders represented in our study were monophyletic (Anaspidea, Cephalaspidea, Notaspidea, Nudibranchia, Sacoglossa). In Gastropoda, two of the three traditional subclasses, Opisthobranchia and Pulmonata, were not monophyletic. In contrast, four of the more recently named gastropod clades (Vetigastropoda, Neritimorpha

  11. Gastropod growth and survival as bioindicators of stress associated with high nutrients in the intertidal of a shallow temperate estuary

    NASA Astrophysics Data System (ADS)

    Marsden, Islay D.; Baharuddin, Nursalwa

    2015-04-01

    The effects of multiple stressors on estuarine organisms are not well understood. Using cage experiments we measured the survival and growth of the pulmonate gastropod Amphibola crenata at five locations which differed contaminant levels. Water nutrients came from a nearby sewage treatment works and the sediment contained low levels of trace metals. Over 6 weeks of exposure, sediment surface chlorophyll levels varied amongst locations. The Chl a values were positively correlated with sediment N and P and trace metals As, Cd, Cu, Pb and Zn. Pulmonate survival depended on location, highest mortality was from a site close to the treatment plant and mortality rate of large individuals decreased significantly with distance away from it. For four locations, medium A. crenata had higher survival than small (juveniles) or adults. Growth rates of small individuals exceeded those for medium and large A. crenata. The mean length increment/week for medium gastropods ranged between 0.49 and 1.11 mm and was negatively correlated with the amount of Chl a in the surface sediment, suggesting the negative effects of eutrophication on gastropod growth. Growth rate of the pulmonate was not correlated with nutrient concentration or trace metal concentrations in the sediment. The dry weight condition index (CI) did not correlate with the growth rate, and for medium individuals, was unaffected by any of the environmental variables. The CI of small individuals was negatively affected by increasing water nutrient levels and the CI of large individuals negatively affected by increasing sediment nutrients and trace metal concentrations. The results from this study suggest that gastropod growth and survival could be used as tools to monitor the effects of changing nutrient levels and recovery from eutrophication within temperate estuaries.

  12. Temporal dynamics of gastropod fauna on subtidal sandy sediments of the Ensenada de Baiona (NW Iberian Peninsula)

    NASA Astrophysics Data System (ADS)

    Moreira, J.; Aldea, C.; Troncoso, J. S.

    2010-12-01

    The temporal variation of the gastropod fauna inhabiting sandy sediments of the Ensenada de Baiona (Galicia, Spain) was studied at three subtidal sites from February 1996 to February 1997 by means of quantitative sampling. A total of 5,463 individuals representing 51 gastropod species and 22 families were found. The family Pyramidellidae was the most diverse in number of species (11 species), followed by Rissoidae and Trochidae (4 species each). The dogwhelk, Nassarius reticulatus, and the rissoid snail, Rissoa parva, were the numerically dominant species at the three studied sites; those and other abundant species showed their greatest densities by the end of summer and the beginning of autumn. In general, univariate measures of the assemblage (number of species, abundance, diversity and evenness) showed variations through time; greater values were recorded between summer and autumn depending on the site. Multivariate analyses done on abundance data showed certain seasonality in the evolution of the assemblage as expected for shallow subtidal sandy sediments at temperate latitudes; those seasonal changes were mostly related to variations in abundance of numerically dominant species. Although the measured sedimentary variables did not show significant correlations with faunal univariate parameters, sediment heterogeneity due to the presence of mats of Zostera marina L. and shells of dead bivalves might explain the differences in composition of the gastropod assemblage among sampling sites.

  13. A cellular and metabolic assessment of the thermal stress responses in the endemic gastropod Benedictia limnaeoides ongurensis from Lake Baikal.

    PubMed

    Axenov-Gribanov, Denis V; Bedulina, Daria S; Shatilina, Zhanna M; Lubyaga, Yulia A; Vereshchagina, Kseniya P; Timofeyev, Maxim A

    2014-01-01

    Our objective was to determine if the Lake Baikal endemic gastropod Benedictia limnaeoides ongurensis, which inhabits in stable cold waters expresses a thermal stress response. We hypothesized that the evolution of this species in the stable cold waters of Lake Baikal resulted in a reduction of its thermal stress-response mechanisms at the biochemical and cellular levels. Contrary to our hypothesis, our results show that exposure to a thermal challenge activates the cellular and biochemical mechanisms of thermal resistance, such as heat shock proteins and antioxidative enzymes, and alters energetic metabolism in B. limnaeoides ongurensis. Thermal stress caused the elevation of heat shock protein 70 and the products of anaerobic glycolysis together with the depletion of glucose and phosphagens in the studied species. Thus, a temperature increase activates the complex biochemical system of stress response and alters the energetic metabolism in this endemic Baikal gastropod. It is concluded that the deepwater Lake Baikal endemic gastropod B. limnaeoides ongurensis retains the ability to activate well-developed biochemical stress-response mechanisms when exposed to a thermal challenge. PMID:24076104

  14. [Community structure of bivalves and gastropods in roots of red mangrove Rhizophora mangle (Rhizophoraceae) in isla Larga, Mochima Bay, Venezuela].

    PubMed

    Acosta Balbas, Vanessa; Betancourt Tineo, Rafael; Prieto Arcas, Antulio

    2014-06-01

    The Rhizophora mangle roots form a complex ecosystem where a wide range of organisms are permanently established, reproduce, and find refuge. In this study, we assessed the diversity of bivalves and gastropods that inhabit red mangrove roots, in isla Larga, Mochima, Venezuela Sucre state. Bimonthly collections were made from January 2007 to May 2008, in four study areas denominated: South, North, East and West. In each area, five mangrove roots were sampled, and the specimens were obtained. We analyzed a total of 180 roots and a total of 35 bivalve species and 25 gastropod species were found. The most abundant bivalves were: Isognomon alatus, Isognomon bicolor, Ostrea equestris, Crassostrea rhizophorae and Brachidontes exustus; among gastropods, the most common where: Littorina angulifera, (Cymatium pileare and Diodora cayenensis. The months with the highest abundances and number of individuals for both groups were January and July 2007, and March 2008. The mangrove ecosystem in isla Larga, presented a number of individuals and species higher than those reported for other regions in Venezuela and the Caribbean. PMID:25102639

  15. Species diversity of planktonic gastropods (Pteropoda and Heteropoda) from six ocean regions based on DNA barcode analysis

    NASA Astrophysics Data System (ADS)

    Jennings, Robert M.; Bucklin, Ann; Ossenbrügger, Holger; Hopcroft, Russell R.

    2010-12-01

    Pteropods and heteropods are two distinct groups of holoplanktonic gastropods whose species and genetic diversity remain poorly understood, despite their ubiquity in the world's oceans. Some species apparently attain near cosmopolitan distributions, implying long-distance dispersal or cryptic species assemblages. We present the first multi-regional and species-rich molecular dataset of holoplanktonic gastropods, comprising DNA barcodes from the mitochondrial cytochrome c oxidase I subunit gene (COI) from 115 individuals of 41 species sampled from six ocean regions across the globe. Molecular analysis and assessment of barcoding utility supported the validity of several morphological subspecies and forms (e.g. of Creseis virgula and Limacina helicina), while others were not supported (e.g. Cavolinia uncinata). Significant genetic variation was observed among conspecific specimens collected in different geographic regions for some species, particularly in euthecosomatous pteropods. Several species of euthecosomes showed no evidence of genetic separation among distant ocean regions. Overall, we suggest some taxonomic revision of the holoplanktonic gastropods will be required, pending a more complete molecular inventory of these groups.

  16. Experimental depletion of different renal interstitial cell populations

    SciTech Connect

    Bohman, S.O.; Sundelin, B.; Forsum, U.; Tribukait, B.

    1988-04-01

    To define different populations of renal interstitial cells and investigate some aspects of their function, we studied the kidneys of normal rats and rats with hereditary diabetes insipidus (DI, Brattleboro) after experimental manipulations expected to alter the number of interstitial cells. DI rats showed an almost complete loss of interstitial cells in their renal papillae after treatment with a high dose of vasopressin. In spite of the lack of interstitial cells, the animals concentrated their urine to the same extent as vasopressin-treated normal rats, indicating that the renomedullary interstitial cells do not have an important function in concentrating the urine. The interstitial cells returned nearly to normal within 1 week off vasopressin treatment, suggesting a rapid turnover rate of these cells. To further distinguish different populations of interstitial cells, we studied the distribution of class II MHC antigen expression in the kidneys of normal and bone-marrow depleted Wistar rats. Normal rats had abundant class II antigen-positive interstitial cells in the renal cortex and outer medulla, but not in the inner medulla (papilla). Six days after 1000 rad whole body irradiation, the stainable cells were almost completely lost, but electron microscopic morphometry showed a virtually unchanged volume density of interstitial cells in the cortex and outer medulla, as well as the inner medulla. Thus, irradiation abolished the expression of the class II antigen but caused no significant depletion of interstitial cells.

  17. Interstitial space and collagen alterations of the developing rat diaphragm

    NASA Technical Reports Server (NTRS)

    Gosselin, L. E.; Martinez, D. A.; Vailas, A. C.; Sieck, G. C.

    1993-01-01

    The effect of growth on the relative interstitial space [%total cross-sectional area (CSA)] and collagen content of the rat diaphragm muscle was examined at postnatal ages of 0, 7, 14, and 21 days as well as in adult males. The proportion of interstitial space relative to total muscle CSA was determined by computerized image analysis of lectin-stained cross sections of diaphragm muscle. To assess collagen content and extent of collagen maturation (i.e., cross-linking), high-pressure liquid chromatography analysis was used to measure hydroxyproline concentration and the nonreducible collagen cross-link hydroxylysylpyridinoline (HP), respectively. At birth, interstitial space accounted for approximately 47% of total diaphragm muscle CSA. During postnatal growth, the relative contribution of interstitial space decreased such that by adulthood the interstitial space accounted for approximately 18% of total muscle CSA. The change in relative interstitial space occurred without a concomitant change in hydroxyproline concentration. However, the concentration of HP markedly increased with age such that the adult diaphragm contained approximately 17 times more HP than at birth. These results indicate that during development the relative CSA occupied by interstitial space decreases as muscle fiber size increases. However, the reduction in relative interstitial space is not associated with a change in collagen concentration. Thus collagen density in the interstitial space may increase with age. It is possible that the observed changes in relative interstitial space and collagen influence the passive length-force properties of the diaphragm.

  18. Constant diversification rates of endemic gastropods in ancient Lake Ohrid: ecosystem resilience likely buffers environmental fluctuations

    NASA Astrophysics Data System (ADS)

    Föller, K.; Stelbrink, B.; Hauffe, T.; Albrecht, C.; Wilke, T.

    2015-08-01

    Ancient lakes represent key ecosystems for endemic freshwater species. This high endemic biodiversity has been shown to be mainly the result of intra-lacustrine diversification. Whereas the principle role of this mode of diversification is generally acknowledged, actual diversification rates in ancient lakes remain little understood. At least four modes are conceivable. Diversification rates may be constant over time, they may fluctuate, rates may be higher in the initial phase of diversification, or there may be a pronounced lag phase between colonization and subsequent diversification. As understanding the tempo of diversification in ancient lake environments may help unrevealing the underlying processes that drive speciation and extinction, we here use the Balkan Lake Ohrid as a model system and the largest species flock in the lake, the non-pyrgulinid Hydrobiidae, as a model taxon to study changes in diversification rates over time together with the respective drivers. Based on phylogenetic, molecular-clock, lineage-through-time plot and diversification-rate analyses we found that this monophyletic group is comparatively old and that it most likely evolved with a constant diversification rate. Preliminary data of the SCOPSCO deep-drilling program do indicate signatures of severe environmental/climatic perturbations in Lake Ohrid. However, so far there is no evidence for the occurrence of catastrophic environmental events. We therefore propose that the rate homogeneity observed in endemic gastropods has been caused by two factors: (i) a potential lack of catastrophic environmental events in Lake Ohrid and/or (ii) a high ecosystem resilience, buffering environmental changes. Parameters potentially contributing to the lake's high ecosystem resilience are its distinct bathymetry, ongoing tectonic activities, and karst hydrology. The current study not only contributes to one of the overall goals of the SCOPSCO deep-drilling program - inferring the driving forces for

  19. Population biology of the gastropod Olivella minuta (Gastropoda, Olividae) on two sheltered beaches in southeastern Brazil

    NASA Astrophysics Data System (ADS)

    Petracco, Marcelo; Camargo, Rita Monteiro; Tardelli, Daniel Teixeira; Turra, Alexander

    2014-10-01

    The structure, dynamics and production of two populations of the olivid gastropod Olivella minuta were analyzed through monthly sampling from November 2009 through October 2011 on two sandy beaches, Pernambuco (very sheltered) and Barequeçaba (sheltered) in São Paulo state (23°48'S), southeastern Brazil. On both beaches, samples were taken along five transects established perpendicular to the waterline. Parameters of the von Bertalanffy growth function were estimated for both populations from monthly length-frequency distributions. The production and turnover ratios were determined using the mass-specific growth rate method. The population on the less-sheltered Barequeçaba Beach was less abundant (120.02 ± 22.60 ind m-1) than on Pernambuco Beach (3295.30 ± 504.86 ind m-1 (±SE)), which we attribute to the greater environmental stability of the latter. Conversely, the mean length, size of the largest individual, and body mass were higher at Barequeçaba than at Pernambuco. The significant differences in the growth of individuals and the mortality rate (Z) between the beaches suggest that density-dependent processes were operating at Pernambuco Beach. The production and P/B ratio at Pernambuco (12.12 g AFDM m-1 year-1 and 1.91 year-1) were higher than at Barequeçaba (0.82 g AFDM m-1 year-1 and 1.06 year-1). The difference in production can be attributed to the higher abundance on Pernambuco, while the higher P/B ratio resulted from the scarcity of smaller individuals in the intertidal zone of Barequeçaba. The P/B ratio estimated for the Pernambuco population is the highest found so far for sandy-beach gastropods. This study reinforces the theory that biological interactions are important regulators of sheltered sandy-beach populations. Future studies with multi-beach sampling are needed to better understand the life-history variations of O. minuta along gradients of degree of exposure of sandy beaches.

  20. Constant diversification rates of endemic gastropods in ancient Lake Ohrid: ecosystem resilience likely buffers environmental fluctuations

    NASA Astrophysics Data System (ADS)

    Föller, K.; Stelbrink, B.; Hauffe, T.; Albrecht, C.; Wilke, T.

    2015-12-01

    Ancient lakes represent key ecosystems for endemic freshwater species. This high endemic biodiversity has been shown to be mainly the result of intra-lacustrine diversification. Whereas the principle role of this mode of diversification is generally acknowledged, actual diversification rates in ancient lakes remain little understood. At least four types are conceivable. Diversification rates may be constant over time, they may fluctuate, rates may be higher in the initial phase of diversification, or there may be a pronounced lag phase between colonization and subsequent diversification. As understanding the tempo of diversification in ancient lake environments may help reveal the underlying processes that drive speciation and extinction, we here use the Balkan Lake Ohrid as a model system and the largest species flock in the lake, the non-pyrgulinid Hydrobiidae, as a model taxon to study changes in diversification rates over time together with the respective drivers. Based on phylogenetic, molecular-clock, lineage-through-time plot, and diversification-rate analyses we found that this potentially monophyletic group is comparatively old and that it most likely evolved with a constant diversification rate. Preliminary data of the SCOPSCO (Scientific Collaboration On Past Speciation Conditions in Lake Ohrid) deep-drilling program do indicate signatures of severe environmental/climatic perturbations in Lake Ohrid. However, so far there is no evidence for the occurrence of catastrophic environmental events. We therefore propose that the constant diversification rate observed in endemic gastropods has been caused by two factors: (i) a potential lack of catastrophic environmental events in Lake Ohrid and/or (ii) a probably high ecosystem resilience, buffering environmental changes. Parameters potentially contributing to the lake's high ecosystem resilience are its distinct bathymetry, ongoing tectonic activities, and karst hydrology. The current study not only

  1. Freshwater gastropods diversity hotspots: three new species from the Uruguay River (South America)

    PubMed Central

    de Lucía, Micaela

    2016-01-01

    Background: The Atlantic Forest is globally one of the priority ecoregions for biodiversity conservation. In Argentina, it is represented by the Paranense Forest, which covers a vast area of Misiones Province between the Paraná and Uruguay rivers. The Uruguay River is a global hotspot of freshwater gastropod diversity, here mainly represented by Tateidae (genus Potamolithus) and to a lesser extent Chilinidae. The family Chilinidae (Gastropoda, Hygrophila) includes 21 species currently recorded in Argentina, and three species in the Uruguay River. The species of Chilinidae occur in quite different types of habitats, but generally in clean oxygenated water recording variable temperature ranges. Highly oxygenated freshwater environments (waterfalls and rapids) are the most vulnerable continental environments. We provide here novel information on three new species of Chilinidae from environments containing waterfalls and rapids in the Uruguay River malacological province of Argentina. Materials and Methods: The specimens were collected in 2010. We analyzed shell, radula, and nervous and reproductive systems, and determined the molecular genetics. The genetic distance was calculated for two mitochondrial markers (cytochrome c oxidase subunit I–COI- and cytochrome b -Cyt b-) for these three new species and the species recorded from the Misionerean, Uruguay River and Lower Paraná-Río de la Plata malacological provinces. In addition, the COI data were analyzed phylogenetically by the neighbor-joining and Bayesian inference techniques. Results: The species described here are different in terms of shell, radula and nervous and reproductive systems, mostly based on the sculpture of the penis sheath. Phylogenetic analyses grouped the three new species with those present in the Lower Paraná-Río de la Plata and Uruguay River malacological provinces. Discussion: Phylogenetic analyses confirm the separation between the Uruguay River and the Misionerean malacological

  2. Amino acid racemization dating of Upper Pleistocene - Holocene terrestrial gastropods from a Mediterranean region (Murcia, SE Spain)

    NASA Astrophysics Data System (ADS)

    Garcia-Mayordomo, Julian; Ortiz, Jose E.; Torres, Trinidad; Insua-Arevalo, Juan M.; Martinez-Diaz, Jose J.; Altolaguirre, Yul; Canales-Fernandez, Maria L.; Martin-Banda, Raquel

    2014-05-01

    The amino acid racemization method has become a widely used geochronological tool for dating Quaternary deposits. The method is based on the fact that living organisms contain only L-amino acids which gradually racemize into D-amino acids after death. Thus, the D/L ratio increases with time after death until it is equal to 1, that is, when equilibrium is reached. Gastropod shells are particularly useful for amino acid racemization dating. Because the amino acid racemization method is not a numerical dating method in isolation, it needs to be calibrated, mainly with radiometric dating methods. The racemization process is genus- and temperature-dependent. In this work we present a preliminary analysis that compares the radiometric age estimated from different dating methods of a number of gastropods recovered in localities from Murcia (Southeastern Spain), with the age obtained through the amino acid racemization method. Taking advantage of recent paleoseismological research in the Murcia region (SE Spain), 28 gastropods specimens were collected from different trenches dug in young Quaternary alluvial deposits. The specimens were subsequently classified and then analyzed according to the standards protocols of the Biomolecular Stratigraphy Laboratory (UPM, Madrid School of Mines). The species found were Otala lactea, Iberus gualterianus, Sphincterochila candidissima and Theba pisana. The D/L ratios of aspartic acid, leucine, phenylalanine and glutamic acid were determined, and the corresponding average age of each specimen was calculated introducing the D/L values in the age calculation algorithm of Torres et al. (1997) for gastropods of central and southern Spain. The racemization age for each locality was then compared to the radiometric age of the deposit where the specimens were collected. To this respect, the samples were classified in different groups considering the reliability on the age control method. The most reliable sample consists only on dates obtained

  3. Respiratory failure due to infliximab induced interstitial lung disease.

    PubMed

    Kakavas, Sotiris; Balis, Evangelos; Lazarou, Vasiliki; Kouvela, Marousa; Tatsis, Georgios

    2013-01-01

    Although poorly understood, interstitial lung disease has been reported as a possible complication of tumor necrosis factor alpha inhibitors. We report a case of interstitial lung disease in a 64-year-old man with psoriasis 3 weeks after the initiation of infliximab treatment. The patient had received two fortnightly infusions of infliximab following a short course of methotrexate. Thoracic computed tomography showed bilateral ground glass and interstitial infiltrates, while the results of microbiology and immunologic workup were negative. Likewise, bronchoalveolar lavage detected neither typical nor atypical pathogens. Infliximab-induced interstitial lung injury was suspected and corticosteroid therapy was administered which resulted in rapid clinical and radiological improvement. This is one of the few reported cases of interstitial lung disease due to infliximab in the psoriasis population. The patient had no pre-existing lung pathology, while his previous exposure to methotrexate was minimal and was not temporally associated with the induction of interstitial lung disease. PMID:23969008

  4. Green Fluorescence of Cytaeis Hydroids Living in Association with Nassarius Gastropods in the Red Sea

    PubMed Central

    Prudkovsky, Andrey A.; Ivanenko, Viatcheslav N.; Nikitin, Mikhail A.; Lukyanov, Konstantin A.; Belousova, Anna; Reimer, James D.; Berumen, Michael L.

    2016-01-01

    Green Fluorescent Proteins (GFPs) have been reported from a wide diversity of medusae, but only a few observations of green fluorescence have been reported for hydroid colonies. In this study, we report on fluorescence displayed by hydroid polyps of the genus Cytaeis Eschscholtz, 1829 (Hydrozoa: Anthoathecata: Filifera) found at night time in the southern Red Sea (Saudi Arabia) living on shells of the gastropod Nassarius margaritifer (Dunker, 1847) (Neogastropoda: Buccinoidea: Nassariidae). We examined the fluorescence of these polyps and compare with previously reported data. Intensive green fluorescence with a spectral peak at 518 nm was detected in the hypostome of the Cytaeis polyps, unlike in previous reports that reported fluorescence either in the basal parts of polyps or in other locations on hydroid colonies. These results suggest that fluorescence may be widespread not only in medusae, but also in polyps, and also suggests that the patterns of fluorescence localization can vary in closely related species. The fluorescence of polyps may be potentially useful for field identification of cryptic species and study of geographical distributions of such hydroids and their hosts. PMID:26840497

  5. Autonomous changes in the swimming direction of sperm in the gastropod Strombus luhuanus.

    PubMed

    Shiba, Kogiku; Shibata, Daisuke; Inaba, Kazuo

    2014-03-15

    The sperm of the gastropod Strombus luhuanus show dimorphism. The eusperm have a nucleus and fertilize the egg, whereas the other type of sperm, parasperm, are anucleate and are thought to assist fertilization. Here we report the autonomous changes in the swimming pattern of S. luhuanus eusperm. In artificial seawater, the eusperm collected from S. luhuanus sperm ducts formed sperm bundles and initially swam backward with asymmetric flagellar waveforms to detach from the bundles. One hour later, the sperm began to swim forward and in a circle. After an additional 1 h incubation, the sperm swam straight, with a change in the flagellar waveforms from asymmetric to symmetric. Spontaneous backward swimming with symmetric waveforms was also observed. The eusperm stored in the female seminal receptacle were motile and showed forward symmetric swimming with spontaneous backward swimming, which appeared necessary for detachment from the wall of receptacle. All of these motility changes were observed in the absence of parasperm, suggesting that these changes autonomously occur in eusperm. Our waveform analysis of these swimming patterns revealed that only the swimming with symmetric waveform showed reverse propagation of the flagellar waveforms. Both types of backward swimming were diminished in Ca(2+)-free seawater and in seawater containing Ni(2+), indicating the regulation of swimming direction by Ca(2+)-dependent signal transduction. PMID:24311809

  6. Details of gastropod phylogeny inferred from 18S rRNA sequences.

    PubMed

    Winnepenninckx, B; Steiner, G; Backeljau, T; De Wachter, R

    1998-02-01

    Some generally accepted viewpoints on the phylogenetic relationships within the molluscan class Gastropoda are reassessed by comparing complete 18S rRNA sequences. Phylogenetic analyses were performed using the neighbor-joining and maximum parsimony methods. The previously suggested basal position of Archaeogastropoda, including Neritimorpha and Vetigastropoda, in the gastropod clade is confirmed. The present study also provides new molecular evidence for the monophyly of both Caenogastropoda and Euthyneura (Pulmonata and Opisthobranchia), making Prosobranchia paraphyletic. The relationships within Caenogastropoda and Euthyneura data turn out to be very unstable on the basis of the present 18S rRNA sequences. The present 18S rRNA data question, but are insufficient to decide on, muricacean (Neogastropoda), neotaenioglossan, pulmonate, or stylommatophoran monophyly. The analyses also focus on two systellommatophoran families, namely, Veronicellidae and Onchidiidae. It is suggested that Systellommatophora are not a monophyletic unit but, due to the lack of stability in the euthyneuran clade, their affinity to either Opisthobranchia or Pulmonata could not be determined. PMID:9479694

  7. Phylogenomics supports Panpulmonata: opisthobranch paraphyly and key evolutionary steps in a major radiation of gastropod molluscs.

    PubMed

    Kocot, Kevin M; Halanych, Kenneth M; Krug, Patrick J

    2013-12-01

    Pulmonates, with over 30,000 described species, represent the largest radiation of non-marine animals outside of Arthropoda. The pulmonate lung was a key evolutionary innovation enabling diversification of terrestrial and freshwater snails and slugs. However, recent studies drew conflicting conclusions about pulmonate monophyly, and support for a sister group is lacking, hindering our understanding of this major animal radiation. Analyses of mitochondrial protein-coding genes recovered a paraphyletic Pulmonata grading into a monophyletic Opisthobranchia, a traditional group of sea slugs long considered sister to pulmonates. Conversely, analyses of datsets dominated by nuclear rDNA indicated Opisthobranchia is paraphyletic with respect to Pulmonata. No study resolved the placement of two key taxa: Sacoglossa, an opisthobranch group including photosynthetic sea slugs, and Siphonarioidea, intertidal limpet-like snails traditionally in Pulmonata. To examine evolutionary relationships at the base of the pulmonate radiation, we performed a phylogenomic analysis of 102 nuclear protein-coding gene regions for 19 gastropods. Opisthobranchia was recovered as paraphyletic with respect to Panpulmonata, a clade in which Sacoglossa was sister to Pulmonata, with Siphonarioidea as the basal pulmonate lineage. Siphonarioideans share a similar gill structure with shelled sacoglossans but lack the contractile pneumostome of pulmonates, suggesting descent from an evolutionary intermediate that facilitated the pulmonate radiation into non-marine habitats. PMID:23850501

  8. Upper Miocene endemic lacustrine gastropod fauna of the Turiec Basin: addressing taxonomic, paleobiogeographic and stratigraphic issues

    NASA Astrophysics Data System (ADS)

    Neubauer, Thomas A.; Harzhauser, Mathias; Pipík, Radovan

    2015-04-01

    The present work displays the first detailed taxonomic study on the freshwater gastropod fauna of the Upper Miocene Lake Turiec. Apart from several mentions of species and genus names in the literature, the mollusc fauna has been poorly studied up to now. Some of the cited genera implied peculiar paleobiogeographic relationships, urging a taxonomic investigation to either prove or revise such arising claims. Variable degrees of preservation, however, limited the possibility to identify all the fossils at species level. The fauna includes at least ten species, of which five turned out to be new to science. Four of those were sufficiently well preserved to be described as new species, namely Viviparus pipiki Neubauer & Harzhauser nov. sp., Melanopsis glaubrechti Neubauer & Harzhauser nov. sp., Tournouerina turiecensis Neubauer & Harzhauser nov. sp., and Radix kovaci Neubauer & Harzhauser nov. sp. Additionally, the new genus Popovicia Neubauer & Harzhauser nov. gen. is introduced for the primary homonym Metohia Popović, 1964 non Absolon, 1927. Most importantly, this taxonomic study revises many of the names cited in the literature and proves most of the alleged paleobiogeographic relationships wrong. The only biogeographic and stratigraphic surprise is the record of Popovicia cf. compressa, a species described from lower Pliocene deposits of the Metohia Basin in Kosovo. The majority of the fauna, however, has only been documented for the Turiec Basin, once more confirming the high degree of its endemicity. The faunal relationships indicate a latest Middle to early Late Pannonian (Middle to Late Tortonian) age, which is in agreement with available age models.

  9. Larval settlement and metamorphosis in a marine gastropod in response to multiple conspecific cues

    PubMed Central

    Koury, Spencer A.

    2016-01-01

    Larvae of the marine gastropod Crepidula fornicata must complete a transition from the plankton, where they are highly dispersed, to an aggregated group of benthic adults. Previous research has shown that selective settlement of larvae on conspecific adults is mediated by a water-borne chemical cue. However, variable experimental conditions have been used to study this cue, and standardization is needed in order to investigate factors that may have weak effects on settlement. In this study, we developed a time-course bioassay based on a full-factorial design with temporal blocking and statistical analysis of larval settlement rates in the lab. We tested this bioassay by examining settlement in the presence of an abiotic cue (KCl), and biotic cues (water conditioned with adult conspecifics and conspecific pedal mucus). Results confirmed settlement in the presence of both KCl and adult-conditioned water, and discovered the induction of settlement by pedal mucus. This optimized, standardized bioassay will be used in future experiments to characterize the complex process of larval settlement in C. fornicata, particularly to measure components of potentially small effect. PMID:27547586

  10. Bacterial diversity and tetrodotoxin analysis in the viscera of the gastropods from Portuguese coast.

    PubMed

    Pratheepa, Vijayakumari; Alex, Anoop; Silva, Marisa; Vasconcelos, Vitor

    2016-09-01

    To trace the pathway of tetrodotoxin (TTX) producing microorganism in the Atlantic coast of Portugal, culture-dependent evaluation of the bacterial isolates from the viscera of the gastropods Monodonta lineata, Gibbula umbilicalis, Nucella lapillus and Patella intermedia, and from the environmental samples (biofilm and surrounding sea water) was carried out. Samples were collected from eight different coastal locations of Northern Portugal. A total of 311 isolates were identified. The observed bacterial diversity was distributed over five different classes (Gammaproteobacteria, Alphaproteobacteria, Flavobacteria, Bacilli and Actinobacteria) with the greatest number of 16S rRNA gene sequence derived from the Gammaproteobacteria (75%). Phylogenetic analysis based on the 16S rRNA gene showed that bacterial isolates were highly diverse and most of which were found in other marine environment. Among the different species isolated, Vibrio was found abundant. Eventhough TTX was not detected (UPLC-MS/MS) in the isolates from this study, PCR screening identified some natural product biosynthesis genes (PKS and NRPS) involved in its assembly. Further PCR screening of the TTX producing two ATCC Vibrio sp. reveals that NRPS might be involved in the biosynthesis of TTX through the incorporation of arginine. PMID:27312988

  11. Biological strategy for the fabrication of highly ordered aragonite helices: the microstructure of the cavolinioidean gastropods.

    PubMed

    Checa, Antonio G; Macías-Sánchez, Elena; Ramírez-Rico, Joaquín

    2016-01-01

    The Cavolinioidea are planktonic gastropods which construct their shells with the so-called aragonitic helical fibrous microstructure, consisting of a highly ordered arrangement of helically coiled interlocking continuous crystalline aragonite fibres. Our study reveals that, despite the high and continuous degree of interlocking between fibres, every fibre has a differentiated organic-rich thin external band, which is never invaded by neighbouring fibres. In this way, fibres avoid extinction. These intra-fibre organic-rich bands appear on the growth surface of the shell as minuscule elevations, which have to be secreted differentially by the outer mantle cells. We propose that, as the shell thickens during mineralization, fibre secretion proceeds by a mechanism of contact recognition and displacement of the tips along circular trajectories by the cells of the outer mantle surface. Given the sizes of the tips, this mechanism has to operate at the subcellular level. Accordingly, the fabrication of the helical microstructure is under strict biological control. This mechanism of fibre-by-fibre fabrication by the mantle cells is unlike that any other shell microstructure. PMID:27181457

  12. Intraspecific Scaling Relationships Between Crawling Speed and Body Size in a Gastropod.

    PubMed

    Hemmert, Heather M; Baltzley, Michael J

    2016-02-01

    Across various modes of locomotion, body size and speed are often correlated both between and within species. Among the gastropods, however, current data are minimal for interspecific and intraspecific scaling relationships. In this study, we tested the relationships between various measurements of body size and crawling speed in the terrestrial snail Cornu aspersum. We also investigated the relationships between crawling speed, muscular wave frequency, and muscular wavelength, because--while these relationships within individuals are well studied--the relationships among individuals are unknown. We recorded snails crawling on both a horizontal and a vertical surface. We found that when they crawled on a horizontal surface, foot length was positively correlated with pedal wavelength and crawling speed, but was not correlated with wave frequency. In comparison, when they crawled on a vertical surface, foot length was positively correlated with wavelength, negatively correlated with wave frequency, and not correlated with crawling speed. Body mass had no correlation with crawling speed when snails were crawling on a horizontal surface, but was negatively correlated with speed when snails crawled on a vertical surface. PMID:26896180

  13. Larval settlement and metamorphosis in a marine gastropod in response to multiple conspecific cues.

    PubMed

    Cahill, Abigail E; Koury, Spencer A

    2016-01-01

    Larvae of the marine gastropod Crepidula fornicata must complete a transition from the plankton, where they are highly dispersed, to an aggregated group of benthic adults. Previous research has shown that selective settlement of larvae on conspecific adults is mediated by a water-borne chemical cue. However, variable experimental conditions have been used to study this cue, and standardization is needed in order to investigate factors that may have weak effects on settlement. In this study, we developed a time-course bioassay based on a full-factorial design with temporal blocking and statistical analysis of larval settlement rates in the lab. We tested this bioassay by examining settlement in the presence of an abiotic cue (KCl), and biotic cues (water conditioned with adult conspecifics and conspecific pedal mucus). Results confirmed settlement in the presence of both KCl and adult-conditioned water, and discovered the induction of settlement by pedal mucus. This optimized, standardized bioassay will be used in future experiments to characterize the complex process of larval settlement in C. fornicata, particularly to measure components of potentially small effect. PMID:27547586

  14. Intertidal coarse woody debris: A spatial subsidy as shelter or feeding habitat for gastropods?

    NASA Astrophysics Data System (ADS)

    Storry, Kristin A.; Weldrick, Christine K.; Mews, Malte; Zimmer, Martin; Jelinski, Dennis E.

    2006-01-01

    Coarse woody debris (CWD) in the intertidal region of rocky shores serves as a potential source of nutrients as well as habitat or refugia from predation, ecologically linking the adjacent marine and terrestrial habitats. In a series of field and laboratory experiments, the affinity of slow-moving motile intertidal gastropods to CWD either as food source or as shelter that increases habitat complexity was tested. In intertidal pools, CWD did not increase colonization by Littorina spp., while it did so in supratidal pools. Habitat complexity, brought about by algal cover and barnacles, was apparently sufficient in intertidal pools without woody debris, while the increase in habitat complexity by CWD increased the attractiveness of supratidal pools with little natural complexity to Littorina spp. Overall, however, comparison of pools containing woody debris and those containing artificial shelter provided evidence for CWD, and/or its biofilm, serving as food source rather than refugium per se. Similarly, Tegula funebralis chose CWD as food source rather than as shelter as indicated by comparison of autoclaved and unmanipulated woody debris. Further, both unfed and fed snails from a site where CWD was present significantly preferred CWD over macroalgae. Among snails from a site without woody debris, fed individuals showed no preference, while unfed snails significantly preferred macroalgae. From this, experience appears to be a factor that mediates the role of CWD. Overall, however, CWD appears to provide supplementary food to snails in the inter- and supratidal zone.

  15. Heavy-tailed distributions in the intermittent motion behaviour of the intertidal gastropod Littorina littorea

    NASA Astrophysics Data System (ADS)

    Seuront, Laurent; Duponchel, Anne-Charlotte; Chapperon, Coraline

    2007-11-01

    The two-dimensional motion behaviour of the common intertidal gastropod Littorina littorea is investigated as a function of the immersion time from three sampling sites on an exposed rocky shore. A total of 90 individuals have been individually marked and tracked over 14 consecutive daylight low tide. Successive displacements show very intermittent behaviour, with a few localised large displacements over a wide range of small displacements. We show that successive displacements are described by flight length l d heavy-tailed distributions with P(ld)∼ld-μ. The very low values of the exponent μ ( μ≈2.22, 2.43 and 2.67) indicate that L. littorea flights fall into the category of super-diffusive processes. These exponents were significantly higher than the special value μ≈2 analytically and theoretically predicted to be the most advantageous in optimising long-term encounter statistics, especially for low-prey-density scenario. As natural selection should favour flexible behaviour, leading to different optimum searching statistics, under different conditions, our results support the idea that the differences in food concentration and distribution encountered at the different sites by L. littorea led to different heavy-tailed distributions observed for the most extreme displacements.

  16. Cadmium and metallothionein turnover in different tissues of the gastropod Littorina littorea.

    PubMed

    Bebianno, M J; Langston, W J

    1998-06-01

    This paper attempts to link the kinetics of Cd and metallothionein turnover in the intertidal marine snail Littorina littorea. The results demonstrate that the turnover of metallothionein is tissue dependent. Metallothionein has an estimated half-life of 69 and 160 days in the gills and kidney, respectively. The half-life could not be calculated for metallothionein in the digestive gland and is probably much longer than the other two tissues. Cadmium elimination from the gill and kidney is considerably slower than the respective metallothioneins (half-life in excess of 300 days) indicating closed cycling of the metal in these tissues. In contrast, cadmium levels in the digestive gland continue to increase during the detoxification period reflecting some remobilization from other tissues. Metallothionein turnover is extremely slow in Littorina when compared with mammals and other bivalve molluscs: even though metallothionein degradation is measurable in some gastropod tissues, the released cadmium may induce de novo metallothionein synthesis to which cadmium becomes resequestered. The slow metallothionein turnover rates and the lack of significant cadmium excretion testify to the relatively stable nature of the cadmium-metallothionein complex in this invertebrate. PMID:18967152

  17. Metabolic mechanisms for anoxia tolerance and freezing survival in the intertidal gastropod, Littorina littorea.

    PubMed

    Storey, Kenneth B; Lant, Benjamin; Anozie, Obiajulu O; Storey, Janet M

    2013-08-01

    The gastropod mollusk, Littorina littorea L., is a common inhabitant of the intertidal zone along rocky coastlines of the north Atlantic. This species has well-developed anoxia tolerance and freeze tolerance and is extensively used as a model for exploring the biochemical adaptations that support these tolerances as well as for toxicological studies aimed at identifying effective biomarkers of aquatic pollution. This article highlights our current understanding of the molecular mechanisms involved in anaerobiosis and freezing survival of periwinkles, particularly with respect to anoxia-induced metabolic rate depression. Analysis of foot muscle and hepatopancreas metabolism includes anoxia-responsive changes in enzyme regulation, signal transduction, gene expression, post-transcriptional regulation of mRNA, control of translation, and cytoprotective strategies including chaperones and antioxidant defenses. New studies describe the regulation of glucose-6-phosphate dehydrogenase by reversible protein phosphorylation, the role of microRNAs in suppressing mRNA translation in the hypometabolic state, modulation of glutathione S-transferase isozyme patterns, and the regulation of the unfolded protein response. PMID:23507570

  18. [NADPH-diaphorase activity in digestive system of gastropod molluscs Achatina fulica and Littorina littorea].

    PubMed

    Zaĭtseva, O V; Kuznetsova, T V; Markosova, T G

    2009-01-01

    Localization and peculiarities of NO-ergic elements were studied for he first time throughout the entire length of digestive tract of the marine gastropod mollusc Achatina fulica (Prosobranchia) and the terrestrial molusc Littorina littorea (Pulmonata) by using histochemical method of detection of NADPH-diaphorase (NADPHd). NO-ergic cells and fibers were revealed in all parts of the mollusc digestive tract beginning from pharynx. An intensive NADPHd activity was found in many intraepithelial cells of the open type and in their processes in intra- and subepithelial nerve plexuses, single subepithelial neurons, granular connective tissue cells, and numerous nerve fibers among muscle elements of he digestive tract wall as well as in nerves innervating the tract. NADPHd was also present in receptor cells of he oral area and in the central A. fulica ganglia participating in innervation of the digestive tract. The digestive tract NO-ergic system ofA. fulica has a more complex organization that that of L. littorea. In the A. fulica pharynx, stomach, and midgut, directly beneath epithelium, there is revealed a complex system of glomerular structures formed by thin NADPHd-positive nerve fibers coming from the side of epithelium. More superficially under the main groups of muscle elements, small agglomerations of NADPHd-positive neurons are seen, which could be considered as primitive, non-formed microganglia. Peculiarities of distribution and a possible functional role of NO-ergic elements in the digestive tract of molluscs are discussed as compared with other invertebrate and vertebrate animals. PMID:19370997

  19. The relationship between sex change and reproductive success in a protandric marine gastropod.

    PubMed

    Brante, Antonio; Quiñones, Adriana; Silva, Francisco

    2016-01-01

    Protandric species switch sex during their lifetime. According to theory, the time (body size) at which sex change occurs is determined by the reproductive success of individuals affected by social interactions as well as by post-copulatory factors. Experimental evidence is biased to few social systems making the exploration of general patterns difficult. We used the protandric marine gastropod Crepidula coquimbensis that partakes in intrabrood sibling cannibalism to test the following hypotheses: 1. Male-male competition for access to females and sibling cannibalism determine male reproductive success; 2. Males with greater access to females and with higher reproductive success will have reduced growth rates and will delay sex change. Artificial aggregations with different social structures were constructed and male reproductive success was estimated by paternity analysis. The results supported our expectations showing that male competitive ability for access to the female, time spent by males in the copulatory position, and sibling cannibalism affect reproductive success and influence time to sex change, with less successful males hastening sex change. Also, males that spent more time in the copulatory position had reduced growth rates. Comparing these results with those reported for other sequential hermaphrodites provides evidence supporting general patterns of sex change in nature. PMID:27385040

  20. Species-specific and transgenerational responses to increasing salinity in sympatric freshwater gastropods

    USGS Publications Warehouse

    Suski, Jamie G.; Salice, Christopher J.; Patino, Reynaldo

    2012-01-01

    Freshwater salinization is a global concern partly attributable to anthropogenic salt contamination. The authors examined the effects of increased salinity (as NaCl, 250-4,000 µS/cm, specific conductance) on two sympatric freshwater gastropods (Helisoma trivolvis and Physa pomillia). Life stage sensitivities were determined by exposing naive eggs or naive juveniles (through adulthood and reproduction). Additionally, progeny eggs from the juvenile-adult exposures were maintained at their respective parental salinities to examine transgenerational effects. Naive H. trivolvis eggs experienced delayed development at specific conductance > 250 µS/cm; reduced survivorship and reproduction were also seen in juvenile H. trivolvis at 4,000 µS/cm. Survival and growth of P. pomilia were not affected by increased salinity following egg or juvenile exposures. Interestingly, the progeny of H. trivolvis exposed to higher salinity may have gained tolerance to increased salinity whereas P. pomilia progeny may have experienced negative transgenerational effects. The present study demonstrates that freshwater snail species vary in their tolerance to salinization and also highlights the importance of multigenerational studies, as stressor impacts may not be readily apparent from shorter term exposures.

  1. The gastropod Phorcus sauciatus (Koch, 1845) along the north-west Iberian Peninsula: filling historical gaps

    NASA Astrophysics Data System (ADS)

    Rubal, Marcos; Veiga, Puri; Moreira, Juan; Sousa-Pinto, Isabel

    2014-03-01

    The intertidal gastropod Phorcus sauciatus is a subtropical grazer that reaches its northern boundary in the Iberian Peninsula. Distribution of P. sauciatus along the Iberian Peninsula shows, however, gaps in its distribution. The present study was aimed at detecting possible recent changes on the population structure and distribution of P. sauciatus along the north-west Atlantic coast of the Iberian Peninsula. To achieve this aim, we adopted a qualitative sampling design to explore the presence of P. sauciatus along a region within its historical gap of distribution (north Portuguese coast). In addition, a quantitative sampling design was adopted to test hypotheses about the abundance and size structure of P. sauciatus populations among regions with different historical records of its abundance and among shores with different exposure. Results showed that P. sauciatus was present along the north Portuguese coast. However, the abundance and size structure of the newly settled populations were significantly different to those of the historically recorded populations. Moreover, P. sauciatus was able to establish populations at sheltered shores. Considering these results, we propose models for the distribution of P. sauciatus along the Iberian Peninsula, based on effects of sea surface temperature, and to explain the size-frequency of their populations based on their density.

  2. Intracapsular development and dispersal polymorphism in the predatory gastropod Ocenebra erinaceus (Linnaeus 1758)

    NASA Astrophysics Data System (ADS)

    Smith, Kathryn E.; Reed, Adam J.; Thatje, Sven

    2015-09-01

    Intraspecific polymorphism during development, such as poecilogony or dispersal polymorphism, has rarely been observed in the marine environment. The ecological advantages of this bet-hedging strategy, whereby the offspring from one species exhibit multiple developmental modes, include the potential for rapid colonization of new habitats while simultaneously achieving a degree of gene flow between populations. The muricid gastropod, Ocenebra erinaceus, is a common, shallow-water marine predator found across England and France. Historically, O. erinaceus caused significant damage to shellfisheries, but more recently it has been impacted by TBT-induced imposex. Despite the previous attention given to this species, little is known about its encapsulated development. Studying O. erinaceus egg capsules from the Solent, UK, we describe intracapsular development at 15 °C, the in situ temperature at time of oviposition. Within each capsule, all embryos developed; no nurse eggs were present. Development was categorized into eight ontogenetic stages, although not all individuals displayed every stage; embryos hatched as either swimming late-pediveliger larvae or crawling juveniles after 59-69 days, indicating dispersal polymorphism to occur in this species. Swimming late-pediveliger larvae completed metamorphosis within 72 h of hatching. As O. erinaceus continues to recover from TBT pollution, dispersal polymorphism may facilitate a rapid expansion in both population size and range. If this occurs, O. erinaceus has the potential to, once again, become a serious problem for shellfisheries around Europe.

  3. Old fossils–young species: evolutionary history of an endemic gastropod assemblage in Lake Malawi

    PubMed Central

    Schultheiß, Roland; Van Bocxlaer, Bert; Wilke, Thomas; Albrecht, Christian

    2009-01-01

    Studies on environmental changes provide important insights into modes of speciation, into the (adaptive) reoccupation of ecological niches and into species turnover. Against this background, we here examine the history of the gastropod genus Lanistes in the African Rift Lake Malawi, guided by four general evolutionary scenarios, and compare it with patterns reported from other endemic Malawian rift taxa. Based on an integrated approach using a mitochondrial DNA phylogeny and a trait-specific molecular clock in combination with insights from the fossil record and palaeoenvironmental data, we demonstrate that the accumulation of extant molecular diversity in the endemic group did not start before approximately 600 000 years ago from a single lineage. Fossils of the genus from the Malawi Rift, however, are over one million years older. We argue that severe drops in the lake level of Lake Malawi in the Pleistocene offer a potential explanation for this pattern. Our results also challenge previously established phylogenetic relationships within the genus by revealing parallel evolution and providing evidence that the endemic Lanistes species are not restricted to the lake proper but are present throughout the Malawi Rift. PMID:19439440

  4. The relationship between sex change and reproductive success in a protandric marine gastropod

    PubMed Central

    Brante, Antonio; Quiñones, Adriana; Silva, Francisco

    2016-01-01

    Protandric species switch sex during their lifetime. According to theory, the time (body size) at which sex change occurs is determined by the reproductive success of individuals affected by social interactions as well as by post-copulatory factors. Experimental evidence is biased to few social systems making the exploration of general patterns difficult. We used the protandric marine gastropod Crepidula coquimbensis that partakes in intrabrood sibling cannibalism to test the following hypotheses: 1. Male-male competition for access to females and sibling cannibalism determine male reproductive success; 2. Males with greater access to females and with higher reproductive success will have reduced growth rates and will delay sex change. Artificial aggregations with different social structures were constructed and male reproductive success was estimated by paternity analysis. The results supported our expectations showing that male competitive ability for access to the female, time spent by males in the copulatory position, and sibling cannibalism affect reproductive success and influence time to sex change, with less successful males hastening sex change. Also, males that spent more time in the copulatory position had reduced growth rates. Comparing these results with those reported for other sequential hermaphrodites provides evidence supporting general patterns of sex change in nature. PMID:27385040

  5. A Whole Mount In Situ Hybridization Method for the Gastropod Mollusc Lymnaea stagnalis.

    PubMed

    Jackson, Daniel J; Herlitze, Ines; Hohagen, Jennifer

    2016-01-01

    Whole mount in situ hybridization (WMISH) is a technique that allows for the spatial resolution of nucleic acid molecules (often mRNAs) within a 'whole mount' tissue preparation, or developmental stage (such as an embryo or larva) of interest. WMISH is extremely powerful because it can significantly contribute to the functional characterization of complex metazoan genomes, a challenge that is becoming more of a bottleneck with the deluge of next generation sequence data. Despite the conceptual simplicity of the technique much time is often needed to optimize the various parameters inherent to WMISH experiments for novel model systems; subtle differences in the cellular and biochemical properties between tissue types and developmental stages mean that a single WMISH method may not be appropriate for all situations. We have developed a set of WMISH methods for the re-emerging gastropod model Lymnaea stagnalis that generate consistent and clear WMISH signals for a range of genes, and across all developmental stages. These methods include the assignment of larvae of unknown chronological age to an ontogenetic window, the efficient removal of embryos and larvae from their egg capsules, the application of an appropriate Proteinase-K treatment for each ontogenetic window, and hybridization, post-hybridization and immunodetection steps. These methods provide a foundation from which the resulting signal for a given RNA transcript can be further refined with probe specific adjustments (primarily probe concentration and hybridization temperature). PMID:27023483

  6. Tetrodotoxin Poisoning Due to Pufferfish and Gastropods, and Their Intoxication Mechanism

    PubMed Central

    Noguchi, Tamao; Onuki, Kazue; Arakawa, Osamu

    2011-01-01

    Marine pufferfish generally contain a large amount of tetrodotoxin (TTX) in their skin and viscera, and have caused many incidences of food poisoning, especially in Japan. Edible species and body tissues of pufferfish, as well as their allowable fishing areas, are therefore clearly stipulated in Japan, but still 2 to 3 people die every year due to pufferfish poisoning. TTX is originally produced by marine bacteria, and pufferfish are intoxicated through the food chain that starts with the bacteria. Pufferfish become nontoxic when fed TTX-free diets in a closed environment in which there is no possible invasion of TTX-bearing organisms. On the other hand, TTX poisoning due to marine snails has recently spread through Japan, China, Taiwan, and Europe. In addition, TTX poisoning of dogs due to the ingestion of sea slugs was recently reported in New Zealand. TTX in these gastropods also seems to be exogenous; carnivorous large snails are intoxicated by eating toxic starfish, and necrophagous small-to-medium snails, the viscera of dead pufferfish after spawning. Close attention must be paid to the geographic expansion and/or diversification of TTX-bearing organisms, and to the sudden occurrence of other forms of TTX poisoning due to their ingestion. PMID:23724281

  7. Baseline trace metals in gastropod mollusks from the Beagle Channel, Tierra del Fuego (Patagonia, Argentina).

    PubMed

    Conti, Marcelo Enrique; Stripeikis, Jorge; Finoia, Maria Grazia; Tudino, Mabel Beatriz

    2012-05-01

    With the aim to evaluate the mollusk Nacella (P)magellanica as biomonitor of elemental pollution in seawater of the Beagle Channel, more than one hundred individuals of the gastropod were sampled, separated in viscera and muscle, and then examined with respect to the accumulation of Cd, Cr, Cu, Ni, Pb and Zn. Collection was performed in seven strategic locations along 170 km of the coastal area of the Beagle Channel (Tierra del Fuego, Argentina) in two campaigns during 2005 and 2007. Samples of surrounding seawater in the different sites were obtained and tested for the same metals as well. The accumulation capacity of Nacella (P)magellanica and thus its aptitude as biomonitor, was evaluated through the calculus of the preconcentration factors of the metals assayed. A discussion involving the comparison with other mollusks previously tested will be given. Several statistical approaches able to analyze data with environmental purposes were applied. Non parametric univariate tests such as Kruskal-Wallis and Mann-Whitney were carried out to assess the changes of the metal concentrations with time (2005 and 2007) in each location. Multivariate methods (linear discriminant analysis on PCA factors) were also applied to obtain a more reliable site classification. Johnson's probabilistic method was carried out for comparison between different geographical areas. The possibility of employing these results as heavy metals' background levels of seawater from the Beagle Channel will be debated. PMID:22350107

  8. Biokinetics of different-shaped copper oxide nanoparticles in the freshwater gastropod, Potamopyrgus antipodarum

    USGS Publications Warehouse

    Ramskov, Tina; Croteau, Marie-Noele; Forbes, Valery E.; Selck, Henriette

    2015-01-01

    Sediment is recognized as a major environmental sink for contaminants, including engineered nanoparticles (NPs). Consequently, sediment-living organisms are likely to be exposed to NPs. There is evidence that both accumulation and toxicity of metal NPs to sediment-dwellers increase with decreasing particle size, although NP size does not always predict effects. In contrast, not much is known about the influence of particle shape on bioaccumulation and toxicity. Here, we examined the influence of copper oxide (CuO) NP shape (rods, spheres, and platelets) on their bioaccumulation kinetics and toxicity to the sediment-dwelling gastropod, Potamopyrgus antipodarum. The influence of Cu added as CuCl2 (i.e., aqueous Cu treatment) was also examined. Exposure to sediment mixed with aqueous Cu or with different-shaped CuO NPs at an average measured exposure concentration of 207 μg Cu per g dry weight sediment for 14 days did not significantly affect snail mortality. However, growth decreased for snails exposed to sediment amended with CuO NP spheres and platelets. P. antipodarum accumulated Cu from all Cu forms/shapes in significant amounts compared to control snails. In addition, once accumulated, Cu was efficiently retained (i.e., elimination rate constants were generally not significantly different from zero). Consequently, snails are likely to concentrate Cu over time, from both aqueous and NP sources, resulting in a high potential for toxicity.

  9. Green Fluorescence of Cytaeis Hydroids Living in Association with Nassarius Gastropods in the Red Sea.

    PubMed

    Prudkovsky, Andrey A; Ivanenko, Viatcheslav N; Nikitin, Mikhail A; Lukyanov, Konstantin A; Belousova, Anna; Reimer, James D; Berumen, Michael L

    2016-01-01

    Green Fluorescent Proteins (GFPs) have been reported from a wide diversity of medusae, but only a few observations of green fluorescence have been reported for hydroid colonies. In this study, we report on fluorescence displayed by hydroid polyps of the genus Cytaeis Eschscholtz, 1829 (Hydrozoa: Anthoathecata: Filifera) found at night time in the southern Red Sea (Saudi Arabia) living on shells of the gastropod Nassarius margaritifer (Dunker, 1847) (Neogastropoda: Buccinoidea: Nassariidae). We examined the fluorescence of these polyps and compare with previously reported data. Intensive green fluorescence with a spectral peak at 518 nm was detected in the hypostome of the Cytaeis polyps, unlike in previous reports that reported fluorescence either in the basal parts of polyps or in other locations on hydroid colonies. These results suggest that fluorescence may be widespread not only in medusae, but also in polyps, and also suggests that the patterns of fluorescence localization can vary in closely related species. The fluorescence of polyps may be potentially useful for field identification of cryptic species and study of geographical distributions of such hydroids and their hosts. PMID:26840497

  10. AFLPs and Mitochondrial Haplotypes Reveal Local Adaptation to Extreme Thermal Environments in a Freshwater Gastropod

    PubMed Central

    Quintela, María; Johansson, Magnus P.; Kristjánsson, Bjarni K.; Barreiro, Rodolfo; Laurila, Anssi

    2014-01-01

    The way environmental variation shapes neutral and adaptive genetic variation in natural populations is a key issue in evolutionary biology. Genome scans allow the identification of the genetic basis of local adaptation without previous knowledge of genetic variation or traits under selection. Candidate loci for divergent adaptation are expected to show higher FST than neutral loci influenced solely by random genetic drift, migration and mutation. The comparison of spatial patterns of neutral markers and loci under selection may help disentangle the effects of gene flow, genetic drift and selection among populations living in contrasting environments. Using the gastropod Radix balthica as a system, we analyzed 376 AFLP markers and 25 mtDNA COI haplotypes for candidate loci and associations with local adaptation among contrasting thermal environments in Lake Mývatn, a volcanic lake in northern Iceland. We found that 2% of the analysed AFLP markers were under directional selection and 12% of the mitochondrial haplotypes correlated with differing thermal habitats. The genetic networks were concordant for AFLP markers and mitochondrial haplotypes, depicting distinct topologies at neutral and candidate loci. Neutral topologies were characterized by intense gene flow revealed by dense nets with edges connecting contrasting thermal habitats, whereas the connections at candidate loci were mostly restricted to populations within each thermal habitat and the number of edges decreased with temperature. Our results suggest microgeographic adaptation within Lake Mývatn and highlight the utility of genome scans in detecting adaptive divergence. PMID:25007329

  11. Global change and the dynamics of ecological systems: Cretaceous through Oligocene naticid gastropods and their prey

    SciTech Connect

    Kelley, P.H. . Dept. of Geology and Geological Engineering); Hansen, T.A. . Dept. of Geology)

    1993-03-01

    Most studies of global change, particularly events that produced mass extinctions, document extinction and survivorship within taxonomic groups or trophic levels. Studies that consider effects of such events on ecological systems are less common. Global events nevertheless affect interaction of species; to predict the consequences of future global change, one must consider interactions within ecological systems. Vermeij has suggested that escalation involving adaptation to enemies has been a major theme of Phanerozoic life, but that such escalation has proceeded at highly variable rates depending on extrinsic events. He has predicted that escalation should be fostered by climatic warming, marine transgression, and high primary productivity. Mass extinctions involving global cooling, regression, or reduction in productivity should temporarily halt escalation, but rapid rebound may occur because post-crisis assemblages provide the raw material for escalation. A comprehensive survey (40,000 specimens) of naticid gastropod predation in the Coastal Plain Cretaceous through Oligocene supports this hypothesis. Drilling frequencies dropped at the K/T and E/O boundaries, which were marked by decreases in productivity and/or cooling. Drilling recovered very rapidly after these events, and in the Paleocene far exceeded Cretaceous drilling, reaching modern levels. This suggests the K/T extinction produced a major reorganization of the ecosystem. Other indicators of escalation (frequency of incomplete and multiple drillholes), however, do not correspond as neatly to global change. Nevertheless, results suggest that global change may be a major determinant of long-term evolutionary patterns, such as escalation.

  12. Species-specific and transgenerational responses to increasing salinity in sympatric freshwater gastropods.

    PubMed

    Suski, Jamie G; Salice, Christopher J; Patiño, Reynaldo

    2012-11-01

    Freshwater salinization is a global concern partly attributable to anthropogenic salt contamination. The authors examined the effects of increased salinity (as NaCl, 250-4,000 µS/cm, specific conductance) on two sympatric freshwater gastropods (Helisoma trivolvis and Physa pomillia). Life stage sensitivities were determined by exposing naive eggs or naive juveniles (through adulthood and reproduction). Additionally, progeny eggs from the juvenile-adult exposures were maintained at their respective parental salinities to examine transgenerational effects. Naive H. trivolvis eggs experienced delayed development at specific conductance > 250 µS/cm; reduced survivorship and reproduction were also seen in juvenile H. trivolvis at 4,000 µS/cm. Survival and growth of P. pomilia were not affected by increased salinity following egg or juvenile exposures. Interestingly, the progeny of H. trivolvis exposed to higher salinity may have gained tolerance to increased salinity whereas P. pomilia progeny may have experienced negative transgenerational effects. The present study demonstrates that freshwater snail species vary in their tolerance to salinization and also highlights the importance of multigenerational studies, as stressor impacts may not be readily apparent from shorter term exposures. PMID:22865709

  13. Biological strategy for the fabrication of highly ordered aragonite helices: the microstructure of the cavolinioidean gastropods

    PubMed Central

    Checa, Antonio G.; Macías-Sánchez, Elena; Ramírez-Rico, Joaquín

    2016-01-01

    The Cavolinioidea are planktonic gastropods which construct their shells with the so-called aragonitic helical fibrous microstructure, consisting of a highly ordered arrangement of helically coiled interlocking continuous crystalline aragonite fibres. Our study reveals that, despite the high and continuous degree of interlocking between fibres, every fibre has a differentiated organic-rich thin external band, which is never invaded by neighbouring fibres. In this way, fibres avoid extinction. These intra-fibre organic-rich bands appear on the growth surface of the shell as minuscule elevations, which have to be secreted differentially by the outer mantle cells. We propose that, as the shell thickens during mineralization, fibre secretion proceeds by a mechanism of contact recognition and displacement of the tips along circular trajectories by the cells of the outer mantle surface. Given the sizes of the tips, this mechanism has to operate at the subcellular level. Accordingly, the fabrication of the helical microstructure is under strict biological control. This mechanism of fibre-by-fibre fabrication by the mantle cells is unlike that any other shell microstructure. PMID:27181457

  14. Macrophage polarization in interstitial lung diseases

    PubMed Central

    Mierzejewski, Michał; Osińska, Iwona; Domagała-Kulawik, Joanna

    2016-01-01

    The role of bronchoalveolar lavage fluid (BALf) examination in differential diagnosis of interstitial lung diseases (ILD) was established. Currently, functional polarization into M1 (pro-inflammatory) and M2 (anti-inflammatory) subpopulations is emphasized. The aim of our study was to compare the proportion of M1 and M2 in BALf of patients with different ILD. BALf samples were collected from 75 ILD patients: sarcoidosis (SA, 36), hypersensitivity pneumonitis (HP, 10), non-specific interstitial pneumonia (NSIP, 8), idiopathic pulmonary fibrosis (IPF, 6) and other ILD (15). Phenotyping was performed by immunocytochemistry with anti-CD40 and CD163 antibodies (for M1 and M2, respectively). For both, CD40 and CD163, three populations of cells have been specified: small cells with strong (+++), large cells with weak (+) and cells with no (–) reaction. Due to lack of statistically significant differences between patients with HP, NSIP and IPF, they were classified into a common group and compared to the group of patients with sarcoidosis. The median proportion of macrophage population was as follows: for CD40: 61%, 35%, 2% in patients with SA and 49%, 47%, 3% in patients with other ILD and for CD163: 55%, 35%, 5% in SA and 53%, 43%, 1% in ILD patients, respectively. We found a significantly higher proportion of M1 in SA when compared with other ILD. Our study showed no evidence of defined polarization of alveolar macrophages in different types of interstitial lung diseases. However, we emphasized the role of CD40 positive cells in sarcoidosis and the role of CD163 positive cells in fibrotic diffuse lung diseases. PMID:27536201

  15. Intraluminal fibrosis in interstitial lung disorders.

    PubMed Central

    Basset, F.; Ferrans, V. J.; Soler, P.; Takemura, T.; Fukuda, Y.; Crystal, R. G.

    1986-01-01

    The histopathologic and ultrastructural features of intraluminal organizing and fibrotic changes were studied in open lung biopsies and autopsy specimens from 373 patients with interstitial lung disorders, including hypersensitivity pneumonitis (n = 44), idiopathic pulmonary fibrosis (n = 92), collagen-vascular diseases (n = 20), chronic eosinophilic pneumonia (n = 10), pulmonary histiocytosis X (n-90), pulmonary sarcoidosis (n = 62), pneumoconioses (n = 25), Legionnaire's disease (n = 5), drug- and toxin-induced pneumonitis (n = 4), radiation-induced pneumonitis (n = 2), lymphangioleiomyomatosis (n = 11), and chronic organizing pneumonia of unknown cause (n = 8). Three patterns of intraluminal organization and fibrosis were recognized: 1) intraluminal buds, which partially filled the alveoli, alveolar ducts and/or distal bronchioles; 2) obliterative changes, in which loose connective tissue masses obliterated the lumens of alveoli, alveolar ducts or distal bronchioles, and 3) mural incorporation of previously intraluminal connective tissue masses, which fused with alveolar, alveolar ductal, or bronchiolar structures and frequently became reepithelialized. All three patterns had common morphologic features, suggesting that, regardless of their severity, they resulted from a common pathogenetic mechanism, ie, the migration of activated connective tissue cells, through defects in the epithelial lining and its basement membrane, from the interstitial into the intraluminal compartment. Intraluminal buds were observed most frequently in hypersensitivity pneumonitis, chronic eosinophilic pneumonia, and organizing pneumonia of unknown cause. Mural incorporation and, to a lesser extent, obliterative changes were observed in most interstitial disorders and were very prominent in idiopathic pulmonary fibrosis. Mural incorporation and obliterative changes play an important role in pulmonary remodeling, especially when several adjacent alveoli and/or other air spaces are

  16. Idiopathic non-specific interstitial pneumonia.

    PubMed

    Belloli, Elizabeth A; Beckford, Rosemarie; Hadley, Ryan; Flaherty, Kevin R

    2016-02-01

    Non-specific interstitial pneumonia (NSIP) is an interstitial lung disease that may be idiopathic or secondary to connective tissue disease, toxins or numerous other causes. Idiopathic NSIP is a rare diagnosis and requires exclusion of these other possible causes. Patients typically present in mid-adulthood with dyspnoea, cough and often constitutional symptoms including fever and fatigue. The disease has a female predominance, and more than 50% of patients have never smoked. Physical exam features mild hypoxaemia and inspiratory rales. Pulmonary function tests demonstrate restriction and a low diffusing capacity for carbon monoxide. High-resolution computed tomography abnormalities include predominantly lower lobe subpleural reticular changes, traction bronchiectasis and ground-glass opacities; honeycombing is rarely seen. An evaluation of the underlying pathology is necessary for a firm diagnosis. Histologically, alveolar and interstitial mononuclear cell inflammation and fibrosis are seen in a temporally uniform pattern with preserved underlying alveolar architecture. NSIP must be differentiated from other parenchymal lung diseases including idiopathic pulmonary fibrosis and hypersensitivity pneumonitis. A thorough exposure history and assessment for underlying connective tissue diseases are highly important, as positive findings in these categories would likely denote a case of secondary NSIP. A multi-disciplinary discussion that includes pulmonologist(s), radiologist(s) and pathologist(s) assists in reaching a consensus diagnosis and improves diagnostic accuracy. Treatment of idiopathic NSIP, although not well proven, is generally instituted in the form of immunosuppression. Prognosis is favourable compared with idiopathic pulmonary fibrosis, although the diagnosis still carries an attributable mortality. Herein we will summarize the clinical characteristics and management of idiopathic NSIP. PMID:26564810

  17. Desquamative alveolar disease (desquamative interstitial pneumonia): case report 1

    PubMed Central

    Cruz, Edgardo; Rodriguez, Jaime; Lisboa, Carmen; Ferretti, Ricardo

    1969-01-01

    Desquamative interstitial pneumonia is a disease characterized by massive alveolar cell proliferation and desquamation with sparse interstitial involvement. The reported case shows an unusually widespread radiographic reticulo-nodular image and abundant alveolar cells in the sputum. Functional studies reveal the expected diffusion defect with practically normal mechanical properties of the lung, in contrast with interstitial fibrosing lung diseases. On the basis of the pathological findings, especially the behaviour of alveolar cells, the individuality of this disease is discussed. We think that it is different from other diseases classed as varieties of a single disease or as different entities under the names of primary interstitial fibrosis or chronic fibrosing alveolitis. Images PMID:5822250

  18. Karyomegalic interstitial nephropathy following ifosfamide therapy

    PubMed Central

    Jayasurya, R.; Srinivas, B. H.; Ponraj, M.; Haridasan, S.; Parameswaran, S.; Priyamvada, P. S.

    2016-01-01

    Ifosfamide (IFO), an alkylating agent used for the management of solid organ tumors, can cause reversible Fanconi's syndrome and acute kidney injury. Karyomegalic interstitial nephropathy (KIN) is a rare form of chronic tubulointerstitial nephritis, initially described as a familial nephropathy in adults. So far, four cases of KIN have been reported in pediatric and adolescent population following treatment with IFO. We report a 22-year-old man who developed renal dysfunction following IFO therapy for relapsed Hodgkin's lymphoma. Renal biopsy revealed chronic tubulointerstitial nephritis with atypical tubular epithelial cells showing nuclear enlargement and hyperchromasia, consistent with a diagnosis of KIN. The renal function improved following a short course of corticosteroids. PMID:27512305

  19. Interstitial gas effect on vibrated granular columns

    NASA Astrophysics Data System (ADS)

    Pastenes, Javier C.; Géminard, Jean-Christophe; Melo, Francisco

    2014-06-01

    Vibrated granular materials have been intensively used to investigate particle segregation, convection, and heaping. We report on the behavior of a column of heavy grains bouncing on an oscillating solid surface. Measurements indicate that, for weak effects of the interstitial gas, the temporal variations of the pressure at the base of the column are satisfactorily described by considering that the column, despite the observed dilation, behaves like a porous solid. In addition, direct observation of the column dynamics shows that the grains of the upper and lower surfaces are in free fall in the gravitational field and that the dilation is due to a small delay between their takeoff times.

  20. Transplantation stimulates interstitial cell migration in hydra

    SciTech Connect

    Fujisawa, T.; David, C.N.; Bosch, T.C. )

    1990-04-01

    Migration of interstitial cells and nerve cell precursors was analyzed in Hydra magnipapillata and Hydra vulgaris (formerly Hydra attenuata). Axial grafts were made between ({sup 3}H)thymidine-labeled donor and unlabeled host tissue. Migration of labeled cells into the unlabeled half was followed for 4 days. The results indicate that the rate of migration was initially high and then slowed on Days 2-4. Regrafting fresh donor tissue on Days 2-4 maintained high levels of migration. Thus, migration appears to be stimulated by the grafting procedure itself.

  1. Interstitial therapy of perineal and gynecological malignancies

    SciTech Connect

    Martinez, A.; Herstein, P.; Portnuff, J.

    1983-03-01

    Thirty-five patients, 38 to 88 years of age, were treated with 125-Iodine or 192-Iridium interstitial implants at Stanford University Medical Center between July 1974, and December, 1978. There were 25 primary epithelial malignancies, eight extensions from intrapelvic organs and two metastatic tumors (hypernephroma and Hodgkin's disease). The involved sites were: urethra (6 patients); vulva (9 patients); vagina (8 patients); anus (7 patients); cervix (5 patients). Implantation was usually performed to treat evident or microscopic disease in conjunction with external beam pelvic treatment with or without local excision. Computerized implant preplanning was used.125-Iodine seeds were inserted either directly or within absorbable suture Polyglactin 910; 192-Iridium in nylon carriers was placed by suture or transperineal template. Two patients were lost to follow-up leaving 33 patients, 27 of whom are alive and free of local disease from 37 to 76 months. The overall local control rate was 88%, or 29/33 patients. All four local recurrences appeared before 24 months. Minor complications included: 10 patients with transient mucositis, four with superficial ulcers, and one patient with infection at the implanted site. Two major complications occurred: a necrotic rectal ulcer requiring a colostomy and a contracted, painful bladder necessitating a urinary diversion. It is concluded that in selected cases interstitial irradiation provides good local control of perineal and gynecological malignancies with low morbidity in this elderly and quite often fragile group of patients.

  2. Tissue temperature monitoring during interstitial photodynamic therapy

    NASA Astrophysics Data System (ADS)

    Svensson, Jenny; Johansson, Ann; Svanberg, Katarina; Andersson-Engels, Stefan

    2005-04-01

    During δ-aminolevulinic acid (ALA) based Interstitial Photodynamic Therapy (IPDT) a high light fluence rate is present close to the source fibers. This might induce an unintentional tissue temperature increase of importance for the treatment outcome. In a previous study, we have observed, that the absorption in the tissue increases during the treatment. A system to measure the local tissue temperature at the source fibers during IPDT on tissue phantoms is presented. The temperature was measured by acquiring the fluorescence from small Cr3+-doped crystals attached to the tip of the illumination fiber used in an IPDT-system. The fluorescence of the Alexandrite crystal used is temperature dependent. A ratio of the intensity of the fluorescence was formed between two different wavelength bands in the red region. The system was calibrated by immersing the fibers in an Intralipid solution placed in a temperature controlled oven. Measurements were then performed by placing the fibers interstitially in a pork chop as a tissue phantom. Measurements were also performed superficially on skin on a volunteer. A treatment was conducted for 10 minutes, and the fluorescence was measured each minute during the illumination. The fluorescence yielded the temperature at the fiber tip through the calibration curve. The measurements indicate a temperature increase of a few degrees during the simulated treatment.

  3. Interstitial point radiance spectroscopy of turbid media

    NASA Astrophysics Data System (ADS)

    Chin, Lee C. L.; Lloyd, Brendan; Whelan, William M.; Vitkin, I. Alex

    2009-05-01

    We present an optical technique, point radiance spectroscopy, to directly recover chromophore concentrations and the reduced optical scattering coefficient spectrum from continuous wave interstitial point radiance measurements at a single-source-detector separation in turbid, tissuelike media. The method employs a spectral algorithm to fit the relative radiance data, using the P3 approximation, at only two detection angles (0° and 90°). The spectral fitting algorithm is applied to simulated data of relative point fluence and relative point radiance data with added 1% noise and shows that even under realistic experimental conditions, only point radiance information is able to provide quantitative information regarding chromophore concentrations and scattering power at distances greater than two to three mean free paths from the source. Furthermore, experimental measurements in tissue-simulating phantoms demonstrate that dye concentrations and scattering parameters can be recovered to within ˜10%. The developed point radiance technique bridges a technological gap between local surface reflectance and spatially resolved interstitial fluence methods in optical assessment of random media such as biological tissue.

  4. Expansion of Interstitial Telomeric Sequences in Yeast.

    PubMed

    Aksenova, Anna Y; Han, Gil; Shishkin, Alexander A; Volkov, Kirill V; Mirkin, Sergei M

    2015-11-24

    Telomeric repeats located within chromosomes are called interstitial telomeric sequences (ITSs). They are polymorphic in length and are likely hotspots for initiation of chromosomal rearrangements that have been linked to human disease. Using our S. cerevisiae system to study repeat-mediated genome instability, we have previously shown that yeast telomeric (Ytel) repeats induce various gross chromosomal rearrangements (GCR) when their G-rich strands serve as the lagging strand template for replication (G orientation). Here, we show that interstitial Ytel repeats in the opposite C orientation prefer to expand rather than cause GCR. A tract of eight Ytel repeats expands at a rate of 4 × 10(-4) per replication, ranking them among the most expansion-prone DNA microsatellites. A candidate-based genetic analysis implicates both post-replication repair and homologous recombination pathways in the expansion process. We propose a model for Ytel repeat expansions and discuss its applications for genome instability and alternative telomere lengthening (ALT). PMID:26586439

  5. Interstitial Fe in MgO

    SciTech Connect

    Mølholt, T. E. Gislason, H. P.; Ólafsson, S.; Mantovan, R.; Gunnlaugsson, H. P.; Svane, A.; Weyer, G.; Masenda, H.; Naidoo, D.; Bharuth-Ram, K.; Fanciulli, M.; Johnston, K.; Sielemann, R.

    2014-01-14

    Isolated {sup 57}Fe atoms were studied in MgO single-crystals by emission Mössbauer spectroscopy following implantation of {sup 57}Mn decaying to {sup 57}Fe. Four Mössbauer spectral components were found corresponding to different Fe lattice positions and/or charge states. Two components represent Fe atoms substituting Mg as Fe{sup 2+} and Fe{sup 3+}, respectively; a third component is due to Fe in a strongly implantation-induced disturbed region. The fourth component, which is the focus of this paper, can be assigned to Fe at an interstitial site. Comparison of its measured isomer shift with ab initio calculations suggests that the interstitial Fe is located on, or close to, the face of the rock-salt MgO structure. To harmonize such an assignment with the measured near-zero quadrupole interaction a local motion process (cage motion) of the Fe has to be stipulated. The relation of such a local motion as a starting point for long range diffusion is discussed.

  6. Reconstruction of Regional Environments in the Caribbean During the Neogene Using Gastropod Stable Isotope Profiles

    NASA Astrophysics Data System (ADS)

    Robbins, J. A.; Grossman, E. L.; O'Dea, A.; Tao, K.

    2011-12-01

    The closure of the Central American Isthmus (CAI) ca. 3.8-3.6 Ma triggered changes in nearshore environments in the Caribbean, causing changes in marine annual range of temperature (MART), carbonate deposition, and the benthic ecosystem. The associated extinction event began ca. 3-2 Ma, peaking between 2-1 Ma. More than two dozen "faunules", discreet packages of fauna which lived under similar environmental conditions, represent time just prior to, during, and after the uplift of the CAI. Multiple parameters including the amount and types of fauna present in each faunule have been used to estimate factors such as paleodepth, MART, extinction rates, and changes in ecological structure over time. Oxygen and carbon isotope analyses (δ18O and δ13C) of gastropod shells serially-sampled about the spire provide records of seasonal environmental conditions. In the tropics, gastropods that live under conditions of strong seasonal upwelling and freshwater input have a greater range of δ18O values in their profiles compared to those animals that live in non-upwelling waters with little freshwater input. Low δ13C values often represent the isotopically low terrestrial carbon found in river runoff, and may be coupled with low δ18O values during seasonal freshening of marine waters. Preliminary data from Strombus shells representing four faunules ranging in age from before the rise of the isthmus through its completion demonstrate the effectiveness of using these mollusks to study ancient tropical environments. Rio Limoncito (~3 Ma), which is believed to represent water depths of 20-40m based on foraminiferal assemblage, yielded the lowest δ18O values (-0.6±0.4%, representing the warmest temperatures/lowest salinities). The samples from Pueblo Nuevo (~1.6 Ma), with an estimated paleodepth between 50 and 100m, had an average value of 0.4±0.3% and therefore represent cooler waters/higher salinity. A shell from NE Escudo de Veraguas (~3.55 Ma) shows a shift from essentially

  7. Population Genetics of a Trochid Gastropod Broadens Picture of Caribbean Sea Connectivity

    PubMed Central

    Díaz-Ferguson, Edgardo; Haney, Robert; Wares, John; Silliman, Brian

    2010-01-01

    Background Regional genetic connectivity models are critical for successful conservation and management of marine species. Even though rocky shore invertebrates have been used as model systems to understand genetic structure in some marine environments, our understanding of connectivity in Caribbean communities is based overwhelmingly on studies of tropical fishes and corals. In this study, we investigate population connectivity and diversity of Cittarium pica, an abundant rocky shore trochid gastropod that is commercially harvested across its natural range, from the Bahamas to Venezuela. Methodology/Principal Findings We tested for genetic structure using DNA sequence variation at the mitochondrial COI and 16S loci, AMOVA and distance-based methods. We found substantial differentiation among Caribbean sites. Yet, genetic differentiation was associated only with larger geographic scales within the Caribbean, and the pattern of differentiation only partially matched previous assessments of Caribbean connectivity, including those based on larval dispersal from hydrodynamic models. For instance, the Bahamas, considered an independent region by previous hydrodynamic studies, showed strong association with Eastern Caribbean sites in our study. Further, Bonaire (located in the east and close to the meridional division of the Caribbean basin) seems to be isolated from other Eastern sites. Conclusions/Significance The significant genetic structure and observed in C. pica has some commonalities in pattern with more commonly sampled taxa, but presents features, such as the differentiation of Bonaire, that appear unique. Further, the level of differentiation, together with regional patterns of diversity, has important implications for the application of conservation and management strategies in this commercially harvested species. PMID:20844767

  8. Symbiotic association between symbiodinium and the gastropod Strombus gigas: larval acquisition of symbionts.

    PubMed

    García Ramos, Maribel; Banaszak, Anastazia T

    2014-04-01

    The importance of the dinoflagellate Symbiodinium sp. was studied in the early life stages of the gastropod Strombus gigas. This dinoflagellate was not found in the eggs or the gelatinous mass surrounding the eggs of the mollusk; therefore, Symbiodinium is not inherited directly. To determine whether the planktonic veligers can acquire these algae from the environment, they were exposed to freshly isolated Symbiodinium from adult S. gigas (homologous). The optimal stage for Symbiodinium inoculation was found at 48 h post-hatching. Survival and growth rates of veligers and juveniles were higher when inoculated with freshly isolated Symbiodinium in conjunction with daily feeding of Isochrysis spp. Veligers inoculated with Symbiodinium freshly isolated from three host species elicited distinct responses: (1) veligers did not take up Symbiodinium isolated from the hydrozoan Millepora alcicornis suggesting that there is discrimination on contact prior to ingestion, (2) veligers did take up Symbiodinium isolated from the anemone Bartholomea annulata, but the algae did not persist in the host tissue suggesting that selection against this type took place after ingestion or that the algae did not divide in the host, and (3) veligers did take up Symbiodinium isolated from Pterogorgia anceps where it persisted and was associated with metamorphosis of the larvae. In contrast, the Symbiodinium freshly isolated from S. gigas were not associated with metamorphosis and required an inducer such as the red alga Laurencia poitei. These data present a significant advancement for the establishment of a new approach in the aquaculture of this important but declining Caribbean species. PMID:24037186

  9. Conus: First Comprehensive Conservation Red List Assessment of a Marine Gastropod Mollusc Genus

    PubMed Central

    Peters, Howard; O'Leary, Bethan C.; Hawkins, Julie P.; Carpenter, Kent E.; Roberts, Callum M.

    2013-01-01

    Marine molluscs represent an estimated 23% of all extant marine taxa, but research into their conservation status has so far failed to reflect this importance, with minimal inclusion on the authoritative Red List of the International Union for the Conservation of Nature (IUCN). We assessed the status of all 632 valid species of the tropical marine gastropod mollusc, Conus (cone snails), using Red List standards and procedures to lay the groundwork for future decadal monitoring, one of the first fully comprehensive global assessments of a marine taxon. Three-quarters (75.6%) of species were not currently considered at risk of extinction owing to their wide distribution and perceived abundance. However, 6.5% were considered threatened with extinction with a further 4.1% near threatened. Data deficiency prevented 13.8% of species from being categorised although they also possess characteristics that signal concern. Where hotspots of endemism occur, most notably in the Eastern Atlantic, 42.9% of the 98 species from that biogeographical region were classified as threatened or near threatened with extinction. All 14 species included in the highest categories of Critically Endangered and Endangered are endemic to either Cape Verde or Senegal, with each of the three Critically Endangered species restricted to single islands in Cape Verde. Threats to all these species are driven by habitat loss and anthropogenic disturbance, in particular from urban pollution, tourism and coastal development. Our findings show that levels of extinction risk to which cone snails are exposed are of a similar magnitude to those seen in many fully assessed terrestrial taxa. The widely held view that marine species are less at risk is not upheld. PMID:24376693

  10. Surveys of arthropod and gastropod diversity in the geothermal resource subzones, Puna, Hawaii

    SciTech Connect

    Miller, S.E.; Burgett, J.; Bruegmann, M.

    1995-04-01

    The invertebrate surveys reported here were carried out as part of ecological studies funded by the Department of Energy in support of their environmental impact statement (EIS) for the Hawaii Geothermal Project. Currently, preparation of the EIS has been suspended, and all supporting information is being archived and made available to the public. The invertebrate surveys reported here assessed diversity and abundance of the arthropod and gastropod fauna in forested habitat and lava tubes in or near the three geothermal resource subzones. Recommendations for conservation of these organisms are given in this report. Surveys were conducted along three 100-m transect lines at each of the six forested locations. Malaise traps, baited pitfall traps, yellow pan traps, baited sponge lures, and visual examination of vegetation were used to assess invertebrate diversity along each transect line. Three of these locations were adjacent to roads, and three were adjacent to lava flows. Two of these lava-forest locations (Keauohana Forest Reserve and Pu`u O`o) were relatively remote from direct human impacts. The third location (Southeast Kula) was near a low-density residential area. Two lava tubes were surveyed. The forest over one of these tubes (Keokea tube) had recently been burned away. This tube was used to assess the effects of loss of forest habitat on the subterranean fauna. An undisturbed tube (Pahoa tube) was used as a control. Recommendations offered in this report direct geothermal development away from areas of high endemic diversity and abundance, and toward areas where natural Hawaiian biotic communities have already been greatly disturbed. These disturbed areas are mainly found in the lower half of the Kamaili (middle) geothermal subzone and throughout most of the Kapoho (lower) geothermal subzone. These recommendation may also generally apply to other development projects in the Puna District.

  11. Development of cardiovascular function in the marine gastropod Littorina obtusata (Linnaeus).

    PubMed

    Bitterli, Tabitha S; Rundle, Simon D; Spicer, John I

    2012-07-01

    The molluscan cardiovascular system typically incorporates a transient extracardiac structure, the larval heart, early in development, but the functional importance of this structure is unclear. We documented the ontogeny and regulatory ability of the larval heart in relation to two other circulatory structures, the true heart and the velum, in the intertidal gastropod Littorina obtusata. There was a mismatch between the appearance of the larval heart and the velum. Velar lobes appeared early in development (day 4), but the larval heart did not begin beating until day 13. The beating of the larval heart reached a maximum on day 17 and then decreased until the structure itself disappeared (day 24). The true heart began to beat on day 17. Its rate of beating increased as that of the larval heart decreased, possibly suggesting a gradual shift from a larval heart-driven to a true heart-driven circulation. The true heart was not sensitive to acutely declining P(O(2)) shortly after it began to beat, but increased in activity in response to acutely declining P(O(2)) by day 21. Larval heart responses were similar to those of the true heart, with early insensitivity to declining P(O(2)) (day 13) followed by a response by day 15. Increased velum-driven rotational activity under acutely declining P(O(2)) was greatest in early developmental stages. Together, these findings point to cardiovascular function in L. obtusata larvae being the result of a complex interaction between velum, larval and true heart activities, with the functions of the three structures coinciding but their relative importance changing throughout larval development. PMID:22675194

  12. Conus: first comprehensive conservation red list assessment of a marine gastropod mollusc genus.

    PubMed

    Peters, Howard; O'Leary, Bethan C; Hawkins, Julie P; Carpenter, Kent E; Roberts, Callum M

    2013-01-01

    Marine molluscs represent an estimated 23% of all extant marine taxa, but research into their conservation status has so far failed to reflect this importance, with minimal inclusion on the authoritative Red List of the International Union for the Conservation of Nature (IUCN). We assessed the status of all 632 valid species of the tropical marine gastropod mollusc, Conus (cone snails), using Red List standards and procedures to lay the groundwork for future decadal monitoring, one of the first fully comprehensive global assessments of a marine taxon. Three-quarters (75.6%) of species were not currently considered at risk of extinction owing to their wide distribution and perceived abundance. However, 6.5% were considered threatened with extinction with a further 4.1% near threatened. Data deficiency prevented 13.8% of species from being categorised although they also possess characteristics that signal concern. Where hotspots of endemism occur, most notably in the Eastern Atlantic, 42.9% of the 98 species from that biogeographical region were classified as threatened or near threatened with extinction. All 14 species included in the highest categories of Critically Endangered and Endangered are endemic to either Cape Verde or Senegal, with each of the three Critically Endangered species restricted to single islands in Cape Verde. Threats to all these species are driven by habitat loss and anthropogenic disturbance, in particular from urban pollution, tourism and coastal development. Our findings show that levels of extinction risk to which cone snails are exposed are of a similar magnitude to those seen in many fully assessed terrestrial taxa. The widely held view that marine species are less at risk is not upheld. PMID:24376693

  13. Haematopoiesis in molluscs: A review of haemocyte development and function in gastropods, cephalopods and bivalves.

    PubMed

    Pila, E A; Sullivan, J T; Wu, X Z; Fang, J; Rudko, S P; Gordy, M A; Hanington, P C

    2016-05-01

    Haematopoiesis is a process that is responsible for generating sufficient numbers of blood cells in the circulation and in tissues. It is central to maintenance of homeostasis within an animal, and is critical for defense against infection. While haematopoiesis is common to all animals possessing a circulatory system, the specific mechanisms and ultimate products of haematopoietic events vary greatly. Our understanding of this process in non-vertebrate organisms is primarily derived from those species that serve as developmental and immunological models, with sparse investigations having been carried out in other organisms spanning the metazoa. As research into the regulation of immune and blood cell development advances, we have begun to gain insight into haematopoietic events in a wider array of animals, including the molluscs. What began in the early 1900's as observational studies on the morphological characteristics of circulating immune cells has now advanced to mechanistic investigations of the cytokines, growth factors, receptors, signalling pathways, and patterns of gene expression that regulate molluscan haemocyte development. Emerging is a picture of an incredible diversity of developmental processes and outcomes that parallels the biological diversity observed within the different classes of the phylum Mollusca. However, our understanding of haematopoiesis in molluscs stems primarily from the three most-studied classes, the Gastropoda, Cephalopoda and Bivalvia. While these represent perhaps the molluscs of greatest economic and medical importance, the fact that our information is limited to only 3 of the 9 extant classes in the phylum highlights the need for further investigation in this area. In this review, we summarize the existing literature that defines haematopoiesis and its products in gastropods, cephalopods and bivalves. PMID:26592965

  14. The neuronal basis of feeding in the snail, Helisoma, with comparisons to selected gastropods.

    PubMed

    Murphy, A D

    2001-03-01

    Research on identified neurons during the last quarter century was forecast at a conference in 1973 that discussed "neuronal mechanisms of coordination in simple systems." The focus of the conference was on the neuronal control of simple stereotyped behavioral acts. Participants discussing the future of such research called for a comparative approach; emphasis on structure-function interactions; attention to environmental and behavioral context; and the development of new techniques. Significantly, in some cases amazing progress has been made in these areas. Major conclusions of the last quarter century are that so-called simple behaviors and the neural circuitry underlying them tend to be less simple, more flexible, and more highly modulated than originally imagined. However, the comparative approach has, as yet, failed to reach its potential. Molluscan preparations, along with arthropods and annelids, have always been at the forefront of neuroethological studies. Circuitry underlying feeding has been studied in a handful of species of gastropod molluscs. These studies have contributed substantially to our understanding of sensorimotor organization, the hierarchical control of behavior and coordination of multiple behaviors, and the organization and modulation of central pattern generators. However, direct interspecific comparisons of feeding circuitry and potentially homologous neurons have been lacking. This is unfortunate because much of the vast radiation of the class Gastropoda is associated with variations in feeding behaviors and feeding apparatuses, providing ample substrates for comparative studies including the evolution of defined circuitry. Here, the neural organization of feeding in the snail, Helisoma, is examined critically. Possible direct interspecific comparisons of neural circuitry and potentially homologous neurons are made. A universal model for central pattern generators underlying rasping feeding is proposed. Future comparative studies can

  15. Phenotypic differentiation of the Red Sea gastropods in response to the environmental deterioration: Geometric morphometric approach

    NASA Astrophysics Data System (ADS)

    Abdelhady, Ahmed Awad

    2016-03-01

    The negative impacts of degradation in the coastal zone of the Red Sea are becoming well known in upper portions of the trophic web (e.g., humans and fish), but are less well known among the benthic primary consumers. In addition, the degree to which heavy metals are entering the trophic web can be better-quantified using macrobenthos. Two-gastropod genera encompassing Echinolittorina subnodosa and Planaxis sulcatus from three different localities on the Egyptian coast of the Red Sea were examined in order to deduce the impact of environmental deterioration on the morphology of shells. The examined sites include clean pristine, slightly polluted, and markedly polluted rocky shores. Phosphate/lead industry is the main source of pollution in this zone. Because landmarks on the rugose Echinolittorina are difficult to define and to ensure finer resolution of the analyses, a newly 'grid-based' landmarks was implemented. Both Canonical Variate Analysis (CVA) and Thin Plate Spline (TPS) were particularly capable to capture and terrace the minor morphological variations accurately. Two phenotypes portioned among the environmentally different populations were recognized and interpreted as ecotypes with many intermediate forms. The first ecotype has a higher spire and smaller aperture and dominating the pristine site North of Marsa Alam, whereas the second ecotype has a globular shell shape with big aperture and dominating the markedly polluted site. The intermediate forms dominating the slightly polluted site. The shape differences are interpreted as an adaptive differentiation to different metal concentrations. As the morphological variation between the two-ecotypes of both taxa is still minors, and both ecotypes occur together with many intermediate forms, the phenotypic divergence stage has not yet accomplished. The gradational shape change among the investigated populations was positively correlated with index of Pollution (IP). As the human activities were the main

  16. Effect of tidal regime on the thermal tolerance of the marine gastropod Lunella smaragda (Gmelin 1791).

    PubMed

    Mortensen, B J D; Dunphy, B J

    2016-08-01

    The tidal cycle around New Zealand results in spring low tides consistently occurring during the hottest part of the day (mid-afternoon) in north-eastern New Zealand, and during the cooler dawn/dusk periods in the north-west of the country. We hypothesised that due to mid-afternoon spring low tides, intertidal populations residing at north-eastern sites would show greater thermotolerance than their north-west conspecifics. To test this we used the marine gastropod, Lunella smaragda, which were collected from sites on both the East and West coasts of the Auckland region and exposed to an acute heat shock. Thermotolerance was measured as survivorship (LT50), drop down time (time to heat coma) and thermal stability of the anaerobic energy producing enzyme Tauropine dehydrogenase. Furthermore, temperature loggers were deployed at each site so as to record and compare thermal regimes among sites. A strong temperature spike associated with spring low tide was found at all sites, and maximal temperatures of all East coast sites were higher than West coast sites (in some case by up to 10°C). In terms of thermotolerance, mortality of L. smaragda occurred at 42°C leading to 100% mortality at 45°C. However, comparison of LT50 showed snails were equally thermotolerant regardless of site of collection. Similar results were found in TDH thermal stability with animals from all sites showing an approximately 80% decrease in enzyme activity after 10min exposure to 42°C. Whilst drop down times were different among sites these were correlated with animal size as opposed to site of collection. Thus, East coast populations of L. smaragda appear no more thermotolerant than their West coast counterparts. Such a result is concerning as maximal temperatures at East coast sites already exceed the LT50 values of L. smaragda recorded in the lab suggesting these populations have less of a thermal safety margin. PMID:27503732

  17. Microsatellite Evidence for High Frequency of Multiple Paternity in the Marine Gastropod Rapana venosa

    PubMed Central

    Liu, Jin-Xian

    2014-01-01

    Background Inferring of parentage in natural populations is important in understanding the mating systems of a species, which have great effects on its genetic structure and evolution. Muricidae, a large group (approximately 1,600 species) of marine gastropods, are poorly investigated in patterns of multiple paternity and sperm competition based on molecular techniques. The veined Rapa whelk, Rapana venosa, a commercially important muricid species with internal fertilization, is an ideal species to study the occurrence and frequency of multiple paternity and to facilitate understanding of their reproductive strategies. Methodology/Principal Findings We developed five highly polymorphic microsatellites in R. venosa and applied them to identify multiple paternity in 19 broods (1381 embryos) collected from Dandong, China. Multiple paternity was detected in 17 (89.5%) of 19 broods. The number of sires per brood ranged from 1 to 7 (4.3 on average). Of the 17 multiply sired broods, 16 (94.1%) were significantly skewed from equal paternal contributions, and had a dominant sire which was also dominant in each assayed capsule. Conclusions Our results indicate that a high level of multiple paternity occurs in the wild population of R. venosa. Similar patterns of multiple paternity in the 2–6 assayed capsules from each brood imply that fertilization events within the body of a female occur mostly (but not entirely) as random draws from a “well-but-not-perfectly blended sperm pool” of her several mates. Strongly skewed distributions of fertilization success among sires also suggest that sperm competition and/or cryptic female choice might be important for post-copulatory paternity biasing in this species. PMID:24466127

  18. Identifying factors linked to the occurrence of alien gastropods in isolated woodland water bodies

    NASA Astrophysics Data System (ADS)

    Spyra, Aneta; Strzelec, Małgorzata

    2014-03-01

    Biological invasions are a significant component of human-caused global change and is widely regarded as one of the main threats to natural biodiversity. Isolated anthropogenic water bodies created in the areas that are deprived of natural freshwater habitats allow the survival and reproduction of alien species on newly settled sites. They are often small with water level fluctuations causing frequent environmental disturbances. The colonisation success may be the result of the rate of their degradation. The aims of the study were to determine the environmental conditions that affect the existence of alien species of gastropods in this type of aquatic environment and to examine whether the occurrence of non-native species affects the community structure of the native species. This study made it possible to group woodland ponds according to the occurrence of the three invasive species in snail communities and discuss the environmental conditions present in these pond types. Analysis of water properties emphasised the distinctiveness of the selected pond types. In ponds of the Potamopyrgus antipodarum type, we found the highest values of some parameters mainly hardness, conductivity, and content of calcium and chlorides, in contrast with the Physella acuta type, which were characterised by the lowest values except for phosphates and nitrites. In the Ferrissia fragilis type, we found the highest nitrate content. Data on the occurrence of alien species in different water environments play an important role in actions which are taken to prevent new invasions and spread of non-native species as well as to reduce future impacts of invaders.

  19. Gastropod diversification and community structuring processes in ancient Lake Ohrid: a metacommunity speciation perspective

    NASA Astrophysics Data System (ADS)

    Hauffe, T.; Albrecht, C.; Wilke, T.

    2015-09-01

    The Balkan Lake Ohrid is the oldest and most speciose freshwater lacustrine system in Europe. However, it remains unclear whether the diversification of its endemic taxa is mainly driven by neutral processes, environmental factors, or species interactions. This calls for a holistic perspective involving both evolutionary processes and ecological dynamics. Such a unifying framework - the metacommunity speciation model - considers how community assembly affects diversification and vice versa by assessing the relative contribution of the three main community assembly processes, dispersal limitation, environmental filtering, and species interaction. The current study therefore used the species-rich model taxon Gastropoda to assess how extant communities in Lake Ohrid are structured by performing process based metacommunity analyses. Specifically, the study aimed at (i) identifying the relative importance of the three community assembly processes and (ii) to test whether the importance of these individual processes changes gradually with lake depth or whether they are distinctively related to eco-zones. Based on specific simulation steps for each of the three processes, it could be demonstrated that dispersal limitation had the strongest influence on gastropod community structures in Lake Ohrid. However, it was not the exclusive assembly process but acted together with the other two processes - environmental filtering, and species interaction. In fact, the relative importance of the three community assembly processes varied both with lake depth and eco-zones, though the processes were better predicted by the latter. The study thus corroborated the high importance of dispersal limitation for both maintaining species richness in Lake Ohrid (through its impact on community structure) and generating endemic biodiversity (via its influence on diversification processes). However, according to the metacommunity speciation model, the inferred importance of environmental

  20. Dietary preferences of two seagrass inhabiting gastropods: Allochthonous vs autochthonous resources

    NASA Astrophysics Data System (ADS)

    Doropoulos, C.; Hyndes, G. A.; Lavery, P. S.; Tuya, F.

    2009-06-01

    The movement of allochthonous resources between habitats can provide important trophic linkages in marine landscapes. In coastal south-western Australia, the kelp Ecklonia radiata is removed from reefs and accumulates in large quantities in neighbouring seagrass meadows. This study investigated the feeding preferences and grazing rates of two locally abundant gastropods, Pyrene bidentata and Cantharidus lepidus, which exhibit inverse distribution patterns with proximity to reefs in seagrass meadows, to determine whether allochthonous kelp has the potential to contribute to the seagrass food web. Using laboratory choice and no-choice feeding experiments, we tested whether detached kelp is consumed preferentially, and at greater rates, by these two species than autochthonous resources (i.e. seagrass, epiphytic red macroalgae and seagrass periphyton). Both species displayed a preference for macroalgae and seagrass periphyton over seagrass leaves. In choice experiments, neither species displayed any clear preference between kelp (fresh or aged), red macroalgae or periphyton (consumption rates ranged between 0.39 and 3.64 mg ind -1 day -1), but consumption rates were always higher relative to seagrass. In no-choice experiments, P. bidentata displayed minimal consumption of seagrass, but consumed fresh and aged kelp, red macroalgae and seagrass periphyton at similar rates (2.00-7.22 mg ind -1 day -1). In comparison, C. lepidus consumed periphyton at far greater rates than any other food source (3.61 vs 0.33-1.10 mg ind -1 day -1). The results indicate that both P. bidentata and C. lepidus showed a clear preference for macroalgae and periphyton over seagrass, but no consistent preference towards any autochthonous or allochthonous algal resource. Reef-derived kelp therefore has the potential to contribute to the food web of seagrass meadows, and subsidise secondary production.

  1. Molluscs for Sale: Assessment of Freshwater Gastropods and Bivalves in the Ornamental Pet Trade

    PubMed Central

    Tan, Siong Kiat; Wong, Wing Hing; Meier, Rudolf; Chan, Sow-Yan; Tan, Heok Hui; Yeo, Darren C. J.

    2016-01-01

    The ornamental pet trade is often considered a key culprit for conservation problems such as the introduction of invasive species (including infectious diseases) and overharvesting of rare species. Here, we present the first assessment of the biodiversity of freshwater molluscs in the ornamental pet trade in Singapore, one of the most important global hubs of the ornamental aquarium trade, and discuss associated conservation concerns. We recorded freshwater molluscs from ornamental pet shops and major exporters including non-ornamental species (e.g., hitchhikers, molluscs sold as fish feed). We recorded an unexpectedly high diversity—59 species—of freshwater bivalves and gastropods, with the majority (38 species or 64%) being from the Oriental region. In addition to morphological examination, we sequenced the DNA barcode region of mitochondrial CO1 and 16S genes to provide molecular data for the confirmation of the identification and for future re-identification. DNA barcodes were obtained for 50 species, and all but four were separated by > 3% uncorrected pairwise distances. The trade has been considered a main introduction pathway for non-native species to Singapore, and we found that out of 15 species in the trade as well as in the wild in Singapore, 12 are either introduced or of unknown origin, representing almost half of the known non-native freshwater molluscs in Singapore. Particularly prevalent are non-ornamental species: six hitchhikers on aquarium plants and six species sold as fish feed. We found that a quarter of the trade species have a history of introduction, which includes 11 known or potentially invasive species. We conclude that potential overharvesting is difficult to assess because only half of the trade species have been treated by IUCN. Of these, 21 species are of Least Concern and three are Data Deficient. Our checklist, with accompanying DNA barcodes, images, and museum vouchers, provides an important reference library for future

  2. De novo transcriptome assembly of the marine gastropod Reishia clavigera for supporting toxic mechanism studies.

    PubMed

    Ip, Jack C H; Leung, Priscilla T Y; Ho, Kevin K Y; Qiu, J W; Leung, Kenneth M Y

    2016-09-01

    The intertidal whelk Reishia clavigera is commonly used as a biomonitor of chemical contamination in the marine environment along Western Pacific region, and as a model for mechanistic studies of organotin-mediated imposex development. However, limited genomic resources of R. clavigera have restricted its role for the investigation of molecular mechanisms of such endocrine disruptions. This study, therefore, aimed to establish tissue-specific transcriptomes of the digestive gland, gonad, head ganglia, penis and the remaining body part of the male and female R. clavigera. By combining the results, a global transcriptome was obtained. A total of 578,134,720 high-quality filtered reads were obtained using Illumina sequencing. The R. clavigera transcriptome comprised of 38,466 transcripts and 32,798 unigenes with predicted open reading frames. The average length of transcripts was 1,709bp with N50 of 2,236bp. Based on sequence similarity searches against public databases, 28,657 transcripts and 24,403 unigenes had at least one BLAST hit. There were 17,530 transcripts and 14,897 unigenes annotated with at least one Gene Ontology (GO) term. Moreover, 5,776 transcripts and 5,137 unigenes were associated with 333 Kyoto Encyclopaedia of Genes and Genomes (KEGG) pathways. The numbers of unigenes were similar among the five target tissues and between sexes, but tissue-specific expression profiles were revealed by multivariate analyses. Based on the functional annotation, putative steroid hormone-associated unigenes were identified. In particular, we highlighted the presence of steroid hormone receptor homologues that could be the targets for mechanistic studies of the organotin-mediated imposex development in marine gastropods. This newly generated transcriptome assembly of R. clavigera provides a valuable molecular resource for ecotoxicological and environmental genomic studies. PMID:27450239

  3. Ecophenotypic plasticity leads to extraordinary gastropod shells found on the "Roof of the World".

    PubMed

    Clewing, Catharina; Riedel, Frank; Wilke, Thomas; Albrecht, Christian

    2015-07-01

    The often extraordinary shell forms and shapes of gastropods found in palaeolakes, such as the highly diverse Gyraulus fauna of the famous Steinheim Basin, have been puzzling evolutionary biologists for centuries, and there is an ongoing debate whether these aberrant shell forms are indicative of true species (or subspecies) or ecophenotypic morphs. Interestingly, one of the Steinheim Gyraulus morphs - a corkscrew-like open-coiled shell - has a recent analogue in the Lake Bangong drainage system on the western Tibetan Plateau. Therefore, a combination of morphological, molecular, palaeolimnological, and ecological analyses was used in this study to assess whether the extraordinary shell shape in Gyraulus sp. from this drainage system represents a (young) ecophenotypic phenomenon or if it has been genetically fixed over an extended period of time. Our morphological, ecological, and palaeolimnological data suggest that the corkscrew-like specimens remain restricted to a small pond near Lake Bangong with an elevated pH value and that the colonization may have occurred recently. The phylogenetic reconstruction based on two gene fragments shows that these nonplanispiral specimens cluster within the previous described Tibetan Plateau Gyraulus clade N2. A network analysis indicates that some haplotypes are even shared by planispiral and nonplanispiral specimens. Given the ephemerality of the phenomenon, the compact network patterns inferred, the likely young phylogenetic age of the aberrant Gyraulus shells studied, and the ecological peculiarities of the study site, we suggest that the evolution of the aberrant shell forms on the Tibetan Plateau could likely be considered as a rapid ecophenotypic response, possibly induced by ecological stress. This finding may thus have implications for the ongoing debate about the processes that have caused the extraordinary shell diversity in palaeolakes such as the Steinheim Basin. PMID:26306180

  4. Size-dependent concentrations of trace metals in four Mediterranean gastropods.

    PubMed

    Cubadda, F; Conti, M E; Campanella, L

    2001-11-01

    In order to gain more information on the possible use of four gastropod species as metal biomonitors for the Mediterranean area, the influence of body weight upon Cd, Cr, Cu, Pb and Zn concentrations was studied in specimens collected at locations with different degrees of environmental pollution. The selected species were the marine snails Monodonta turbinata Born and Monodonta mutabilis Philippi, and the limpets Patella caerulea L. and Patella lusitanica Gmelin. Significant differences between metal concentrations in individuals from different stations were tested by ANCOVA on log-transformed data with log body weight as covariate. For all species a positive correlation between metal concentrations and body weight was observed, which means that the largest individuals contained the highest levels of metals. The inclusion of body weight as covariate in the statistical analysis explained from 81% to 99% of the metal variability within the organisms and enabled the achievement of improvements in the detection of differences among sites. The four selected species provided a rather univocal picture of bioavailable metal loads at the different stations of the experimental area. Except for Cd, the metal concentrations recorded at the clean stations were found to lie in the range of the lowest values reported in the literature and can be employed as useful background levels which can be referred to for intraspecific comparison within the Mediterranean area. It is concluded that in view of its distribution, unambiguous identification, resistance to pollution and accumulation patterns M. turbinata has considerable potential as a biomonitor of trace metals over the Mediterranean. PMID:11680752

  5. Molluscs for Sale: Assessment of Freshwater Gastropods and Bivalves in the Ornamental Pet Trade.

    PubMed

    Ng, Ting Hui; Tan, Siong Kiat; Wong, Wing Hing; Meier, Rudolf; Chan, Sow-Yan; Tan, Heok Hui; Yeo, Darren C J

    2016-01-01

    The ornamental pet trade is often considered a key culprit for conservation problems such as the introduction of invasive species (including infectious diseases) and overharvesting of rare species. Here, we present the first assessment of the biodiversity of freshwater molluscs in the ornamental pet trade in Singapore, one of the most important global hubs of the ornamental aquarium trade, and discuss associated conservation concerns. We recorded freshwater molluscs from ornamental pet shops and major exporters including non-ornamental species (e.g., hitchhikers, molluscs sold as fish feed). We recorded an unexpectedly high diversity-59 species-of freshwater bivalves and gastropods, with the majority (38 species or 64%) being from the Oriental region. In addition to morphological examination, we sequenced the DNA barcode region of mitochondrial CO1 and 16S genes to provide molecular data for the confirmation of the identification and for future re-identification. DNA barcodes were obtained for 50 species, and all but four were separated by > 3% uncorrected pairwise distances. The trade has been considered a main introduction pathway for non-native species to Singapore, and we found that out of 15 species in the trade as well as in the wild in Singapore, 12 are either introduced or of unknown origin, representing almost half of the known non-native freshwater molluscs in Singapore. Particularly prevalent are non-ornamental species: six hitchhikers on aquarium plants and six species sold as fish feed. We found that a quarter of the trade species have a history of introduction, which includes 11 known or potentially invasive species. We conclude that potential overharvesting is difficult to assess because only half of the trade species have been treated by IUCN. Of these, 21 species are of Least Concern and three are Data Deficient. Our checklist, with accompanying DNA barcodes, images, and museum vouchers, provides an important reference library for future monitoring

  6. Ecophenotypic plasticity leads to extraordinary gastropod shells found on the “Roof of the World”

    PubMed Central

    Clewing, Catharina; Riedel, Frank; Wilke, Thomas; Albrecht, Christian

    2015-01-01

    The often extraordinary shell forms and shapes of gastropods found in palaeolakes, such as the highly diverse Gyraulus fauna of the famous Steinheim Basin, have been puzzling evolutionary biologists for centuries, and there is an ongoing debate whether these aberrant shell forms are indicative of true species (or subspecies) or ecophenotypic morphs. Interestingly, one of the Steinheim Gyraulus morphs – a corkscrew-like open-coiled shell – has a recent analogue in the Lake Bangong drainage system on the western Tibetan Plateau. Therefore, a combination of morphological, molecular, palaeolimnological, and ecological analyses was used in this study to assess whether the extraordinary shell shape in Gyraulus sp. from this drainage system represents a (young) ecophenotypic phenomenon or if it has been genetically fixed over an extended period of time. Our morphological, ecological, and palaeolimnological data suggest that the corkscrew-like specimens remain restricted to a small pond near Lake Bangong with an elevated pH value and that the colonization may have occurred recently. The phylogenetic reconstruction based on two gene fragments shows that these nonplanispiral specimens cluster within the previous described Tibetan Plateau Gyraulus clade N2. A network analysis indicates that some haplotypes are even shared by planispiral and nonplanispiral specimens. Given the ephemerality of the phenomenon, the compact network patterns inferred, the likely young phylogenetic age of the aberrant Gyraulus shells studied, and the ecological peculiarities of the study site, we suggest that the evolution of the aberrant shell forms on the Tibetan Plateau could likely be considered as a rapid ecophenotypic response, possibly induced by ecological stress. This finding may thus have implications for the ongoing debate about the processes that have caused the extraordinary shell diversity in palaeolakes such as the Steinheim Basin. PMID:26306180

  7. Identifying factors linked to the occurrence of alien gastropods in isolated woodland water bodies.

    PubMed

    Spyra, Aneta; Strzelec, Małgorzata

    2014-03-01

    Biological invasions are a significant component of human-caused global change and is widely regarded as one of the main threats to natural biodiversity. Isolated anthropogenic water bodies created in the areas that are deprived of natural freshwater habitats allow the survival and reproduction of alien species on newly settled sites. They are often small with water level fluctuations causing frequent environmental disturbances. The colonisation success may be the result of the rate of their degradation. The aims of the study were to determine the environmental conditions that affect the existence of alien species of gastropods in this type of aquatic environment and to examine whether the occurrence of non-native species affects the community structure of the native species. This study made it possible to group woodland ponds according to the occurrence of the three invasive species in snail communities and discuss the environmental conditions present in these pond types. Analysis of water properties emphasised the distinctiveness of the selected pond types. In ponds of the Potamopyrgus antipodarum type, we found the highest values of some parameters mainly hardness, conductivity, and content of calcium and chlorides, in contrast with the Physella acuta type, which were characterised by the lowest values except for phosphates and nitrites. In the Ferrissia fragilis type, we found the highest nitrate content. Data on the occurrence of alien species in different water environments play an important role in actions which are taken to prevent new invasions and spread of non-native species as well as to reduce future impacts of invaders. PMID:24504533

  8. Interstitial Solutes and Deformation in Nb and Nb Single Crystals

    SciTech Connect

    R. E. Ricker; D. J. Pitchure; and G. R. Myneni

    2006-10-30

    Experiments were conducted on high purity single and polycrystalline niobium to determine the influence of low concentrations of interstitial impurities on mechanical properties and to evaluate the feasibility of using measurements of mechanical properties to detect, identify, and quantify the diffusible interstitial content.

  9. Cold Work Embrittlement of Interstitial-Free Steels

    SciTech Connect

    2005-09-01

    Interstitial-free (IF) steels are defined by their low amounts of solute interstitial elements, such as carbon and nitrogen. During secondary forming, strain can be localized at the grain boundaries of these steels, resulting in secondary cold work embrittlement (CWE).

  10. Free-floating collagen fibers in interstitial mycosis fungoides.

    PubMed

    Ferrara, Gerardo; Crisman, Giuliana; Zalaudek, Iris; Argenziano, Giuseppe; Stefanato, Catherine M

    2010-06-01

    We present a case of interstitial mycosis fungoides showing pseudodovascular clefts with "free-floating" collagen fibers surrounded by neoplastic T lymphocytes. Such a finding further expands the histopathologic spectrum of mycosis fungoides and could be taken into account in its differential diagnosis from granuloma annulare, inflammatory morphea, and interstitial granulomatous drug reaction. PMID:20145533

  11. Cenozoic climate change and diversification on the continental shelf and slope: evolution of gastropod diversity in the family Solariellidae (Trochoidea).

    PubMed

    Williams, S T; Smith, L M; Herbert, D G; Marshall, B A; Warén, A; Kiel, S; Dyal, P; Linse, K; Vilvens, C; Kano, Y

    2013-04-01

    Recent expeditions have revealed high levels of biodiversity in the tropical deep-sea, yet little is known about the age or origin of this biodiversity, and large-scale molecular studies are still few in number. In this study, we had access to the largest number of solariellid gastropods ever collected for molecular studies, including many rare and unusual taxa. We used a Bayesian chronogram of these deep-sea gastropods (1) to test the hypothesis that deep-water communities arose onshore, (2) to determine whether Antarctica acted as a source of diversity for deep-water communities elsewhere and (3) to determine how factors like global climate change have affected evolution on the continental slope. We show that although fossil data suggest that solariellid gastropods likely arose in a shallow, tropical environment, interpretation of the molecular data is equivocal with respect to the origin of the group. On the other hand, the molecular data clearly show that Antarctic species sampled represent a recent invasion, rather than a relictual ancestral lineage. We also show that an abrupt period of global warming during the Palaeocene Eocene Thermal Maximum (PETM) leaves no molecular record of change in diversification rate in solariellids and that the group radiated before the PETM. Conversely, there is a substantial, although not significant increase in the rate of diversification of a major clade approximately 33.7 Mya, coinciding with a period of global cooling at the Eocene-Oligocene transition. Increased nutrients made available by contemporaneous changes to erosion, ocean circulation, tectonic events and upwelling may explain increased diversification, suggesting that food availability may have been a factor limiting exploitation of deep-sea habitats. Tectonic events that shaped diversification in reef-associated taxa and deep-water squat lobsters in central Indo-West Pacific were also probably important in the evolution of solariellids during the Oligo

  12. Spatial variability in the structure of intertidal crab and gastropod assemblages within the Seychelles Archipelago (Indian Ocean)

    NASA Astrophysics Data System (ADS)

    Smale, Dan A.; Barnes, David K. A.; Barnes, Richard S. K.; Smith, David J.; Suggett, David J.

    2012-04-01

    Tropical nearshore ecosystems represent global hotspots of marine biodiversity and endemism but are often poorly understood and impacted by human activities. The Seychelles Archipelago (Western Indian Ocean) sustains a wealth of marine life, much of which is threatened by rapid development associated with tourism and climate change. Six marine parks exist within the Archipelago, but their biodiversity value and ecological health are poorly known, especially with regards to non-fish and coral species. Here we investigate spatial patterns of littoral biodiversity on 6 islands, 5 of which were granitic and within marine parks, including the first surveys of Curieuse and Ile Cocos. Our surveys formed a nested sampling design, to facilitate an examination of variability in species richness, faunal abundance, taxonomic distinctness and assemblage composition at multiple spatial scales, from islands (> 100 s km) to quadrats (metres). We identified (mostly to species) and enumerated two target taxa, brachyuran decapod crustaceans and gastropod molluscs, and recorded over 8300 individuals belonging to over 150 species. Crabs and gastropods exhibited different patterns of spatial variability, as crab assemblages were generally more distinct between islands, while gastropod assemblages were markedly variable at the smallest spatial scales of 'patch' and 'quadrat'. Intertidal biodiversity was greatest on Curieuse Island and least at Desroches, the latter was being the only coral atoll we surveyed and thereby differing in its geological and ecological context. We discuss likely drivers of these biodiversity patterns and highlight urgently-needed research directions. Our assessment of the status of poorly-known invertebrate assemblages across the Seychelles will complement more extensive surveys of coral and fish assemblages and, in doing so, provide a useful baseline for monitoring the effects of key stressors in the region, such as coastal development and climate change.

  13. Cenozoic climate change and diversification on the continental shelf and slope: evolution of gastropod diversity in the family Solariellidae (Trochoidea)

    PubMed Central

    Williams, S T; Smith, L M; Herbert, D G; Marshall, B A; Warén, A; Kiel, S; Dyal, P; Linse, K; Vilvens, C; Kano, Y

    2013-01-01

    Recent expeditions have revealed high levels of biodiversity in the tropical deep-sea, yet little is known about the age or origin of this biodiversity, and large-scale molecular studies are still few in number. In this study, we had access to the largest number of solariellid gastropods ever collected for molecular studies, including many rare and unusual taxa. We used a Bayesian chronogram of these deep-sea gastropods (1) to test the hypothesis that deep-water communities arose onshore, (2) to determine whether Antarctica acted as a source of diversity for deep-water communities elsewhere and (3) to determine how factors like global climate change have affected evolution on the continental slope. We show that although fossil data suggest that solariellid gastropods likely arose in a shallow, tropical environment, interpretation of the molecular data is equivocal with respect to the origin of the group. On the other hand, the molecular data clearly show that Antarctic species sampled represent a recent invasion, rather than a relictual ancestral lineage. We also show that an abrupt period of global warming during the Palaeocene Eocene Thermal Maximum (PETM) leaves no molecular record of change in diversification rate in solariellids and that the group radiated before the PETM. Conversely, there is a substantial, although not significant increase in the rate of diversification of a major clade approximately 33.7 Mya, coinciding with a period of global cooling at the Eocene–Oligocene transition. Increased nutrients made available by contemporaneous changes to erosion, ocean circulation, tectonic events and upwelling may explain increased diversification, suggesting that food availability may have been a factor limiting exploitation of deep-sea habitats. Tectonic events that shaped diversification in reef-associated taxa and deep-water squat lobsters in central Indo-West Pacific were also probably important in the evolution of solariellids during the Oligo

  14. Assembly and annotation of a non-model gastropod (Nerita melanotragus) transcriptome: a comparison of De novo assemblers

    PubMed Central

    2014-01-01

    Background The sequencing, de novo assembly and annotation of transcriptome datasets generated with next generation sequencing (NGS) has enabled biologists to answer genomic questions in non-model species with unprecedented ease. Reliable and accurate de novo assembly and annotation of transcriptomes, however, is a critically important step for transcriptome assemblies generated from short read sequences. Typical benchmarks for assembly and annotation reliability have been performed with model species. To address the reliability and accuracy of de novo transcriptome assembly in non-model species, we generated an RNAseq dataset for an intertidal gastropod mollusc species, Nerita melanotragus, and compared the assembly produced by four different de novo transcriptome assemblers; Velvet, Oases, Geneious and Trinity, for a number of quality metrics and redundancy. Results Transcriptome sequencing on the Ion Torrent PGM™ produced 1,883,624 raw reads with a mean length of 133 base pairs (bp). Both the Trinity and Oases de novo assemblers produced the best assemblies based on all quality metrics including fewer contigs, increased N50 and average contig length and contigs of greater length. Overall the BLAST and annotation success of our assemblies was not high with only 15-19% of contigs assigned a putative function. Conclusions We believe that any improvement in annotation success of gastropod species will require more gastropod genome sequences, but in particular an increase in mollusc protein sequences in public databases. Overall, this paper demonstrates that reliable and accurate de novo transcriptome assemblies can be generated from short read sequencers with the right assembly algorithms. PMID:25084827

  15. Smoking-related idiopathic interstitial pneumonia: A review.

    PubMed

    Margaritopoulos, George A; Harari, Sergio; Caminati, Antonella; Antoniou, Katerina M

    2016-01-01

    For many years, cigarette smoking has been considered as the leading cause of chronic obstructive pulmonary disease and lung cancer. Recently, however, it has also been associated with the development of diffuse interstitial lung diseases. In the latest classification of the major idiopathic interstitial pneumonias (IIP), the term smoking-related IIP has been introduced, including two entities, namely desquamative interstitial pneumonia (DIP) and respiratory bronchiolitis-interstitial lung disease (RB-ILD). Other entities in which smoking has a definite or suggested role include pulmonary Langerhan's cell histiocytosis, smoking-related interstitial fibrosis, combined pulmonary fibrosis and emphysema syndrome and idiopathic pulmonary fibrosis. In this review, we will focus on the mechanisms of smoking-related lung damage and on the clinical aspects of these disorders with the exception of idiopathic pulmonary fibrosis, which will be reviewed elsewhere in this review series. PMID:26138798

  16. Balance point characterization of interstitial fluid volume regulation.

    PubMed

    Dongaonkar, R M; Laine, G A; Stewart, R H; Quick, C M

    2009-07-01

    The individual processes involved in interstitial fluid volume and protein regulation (microvascular filtration, lymphatic return, and interstitial storage) are relatively simple, yet their interaction is exceedingly complex. There is a notable lack of a first-order, algebraic formula that relates interstitial fluid pressure and protein to critical parameters commonly used to characterize the movement of interstitial fluid and protein. Therefore, the purpose of the present study is to develop a simple, transparent, and general algebraic approach that predicts interstitial fluid pressure (P(i)) and protein concentrations (C(i)) that takes into consideration all three processes. Eight standard equations characterizing fluid and protein flux were solved simultaneously to yield algebraic equations for P(i) and C(i) as functions of parameters characterizing microvascular, interstitial, and lymphatic function. Equilibrium values of P(i) and C(i) arise as balance points from the graphical intersection of transmicrovascular and lymph flows (analogous to Guyton's classical cardiac output-venous return curves). This approach goes beyond describing interstitial fluid balance in terms of conservation of mass by introducing the concept of inflow and outflow resistances. Algebraic solutions demonstrate that P(i) and C(i) result from a ratio of the microvascular filtration coefficient (1/inflow resistance) and effective lymphatic resistance (outflow resistance), and P(i) is unaffected by interstitial compliance. These simple algebraic solutions predict P(i) and C(i) that are consistent with reported measurements. The present work therefore presents a simple, transparent, and general balance point characterization of interstitial fluid balance resulting from the interaction of microvascular, interstitial, and lymphatic function. PMID:19420292

  17. Unclassifiable interstitial lung disease: A review.

    PubMed

    Skolnik, Kate; Ryerson, Christopher J

    2016-01-01

    Accurate classification of interstitial lung disease (ILD) requires a multidisciplinary approach that incorporates input from an experienced respirologist, chest radiologist and lung pathologist. Despite a thorough multidisciplinary evaluation, up to 15% of ILD patients have unclassifiable ILD and cannot be given a specific diagnosis. The objectives of this review are to discuss the definition and features of unclassifiable ILD, identify the barriers to ILD classification and outline an approach to management of unclassifiable ILD. Several recent studies have described the characteristics of these patients; however, there are inconsistencies in the definition and terminology of unclassifiable ILD due to limited research in this population. Additional studies are required to determine the appropriate evaluation and management of patients with unclassifiable ILD. PMID:26059704

  18. Pulmonary Vein Stenosis Mimicking Nonspecific Interstitial Pneumonia

    PubMed Central

    Linga, Karthika R.; Khoor, Andras; Phelan, Jonathan A.; Mira-Avendano, Isabel

    2015-01-01

    Pulmonary vein stenosis (PVS) is a known complication after catheter ablation of arrhythmias. Surprisingly, little information is available on its manifestations in the lung. We describe the case of a 39-year-old woman who presented from an outside hospital with worsening shortness of breath after catheter ablation of pulmonary veins for atrial fibrillation. After an initial diagnosis of pneumonia and its nonimprovement with antibiotics, a surgical lung biopsy was done and interpreted as nonspecific interstitial pneumonia (NSIP) with vascular changes consistent with pulmonary arterial hypertension. Later, she was admitted to our institution where a transthoracic echocardiogram (TTE) and subsequent computed tomography (CT) angiogram of the heart showed severe stenosis of all four pulmonary veins. The previous lung biopsy was rereviewed and reinterpreted as severe parenchymal congestion mimicking NSIP. Our case demonstrates that PVS is an underrecognized complication of catheter ablation, and increased awareness among both clinicians and pathologists is necessary to avoid misdiagnosis. PMID:26779359

  19. The multiple faces of leukocyte interstitial migration

    PubMed Central

    Lämmermann, Tim; Germain, Ronald N.

    2014-01-01

    Spatiotemporal control of leukocyte dynamics within tissues is critical for successful innate and adaptive immune responses. Homeostatic trafficking and coordinated infiltration into and within sites of inflammation and infection rely on signaling in response to extracellular cues that in turn controls a variety of intracellular protein networks regulating leukocyte motility, migration, chemotaxis, positioning, and cell–cell interaction. In contrast to mesenchymal cells, leukocytes migrate in an amoeboid fashion by rapid cycles of actin polymerization and actomyosin contraction, and their migration in tissues is generally referred to as low adhesive and nonproteolytic. The interplay of actin network expansion, contraction, and adhesion shapes the exact mode of amoeboid migration, and in this review, we explore how leukocyte subsets potentially harness the same basic biomechanical mechanisms in a cell-type-specific manner. Most of our detailed understanding of these processes derives from in vitro migration studies in three-dimensional gels and confined spaces that mimic geometrical aspects of physiological tissues. We summarize these in vitro results and then critically compare them to data from intravital imaging of leukocyte interstitial migration in mouse tissues. We outline the technical challenges of obtaining conclusive mechanistic results from intravital studies, discuss leukocyte migration strategies in vivo, and present examples of mode switching during physiological interstitial migration. These findings are also placed in the context of leukocyte migration defects in primary immunodeficiencies. This overview of both in vitro and in vivo studies highlights recent progress in understanding the molecular and biophysical mechanisms that shape robust leukocyte migration responses in physiologically complex and heterogeneous environments. PMID:24573488

  20. [Interstitial laser coagulation of benign prostatic hyperplasia].

    PubMed

    Muschter, R; Hessel, S; Hofstetter, A; Keiditsch, E; Rothenberger, K H; Schneede, P; Frank, F

    1993-07-01

    We report on the new method of interstitial laser coagulation for the treatment of benign prostatic hyperplasia (BPH). The procedure is based on the interstitial application of Nd:YAG laser irradiation, delivered through a new light guide system. Such light applicators coagulate constant tissue volumes in a homogeneous manner, as proven by in vitro studies in different tissues, including surgically removed prostate adenoma. The extent of the coagulation is determined by laser power and irradiation time. At 5 W, for example, and during a 10-min period, this zone reached a diameter of up to 20 mm. Temperatures generated in the process were over 100 degrees C, as measured by time/space resolution. These results were confirmed by in vivo studies in canine prostates. In the course of 7 weeks, the coagulated areas formed scars with degeneration and fibrosis, accompanied by marked shrinking. Neighbouring organs were not affected. The method was successfully transferred to clinical practice. The application of the light guides to the lateral lobes was performed percutaneously from the perineum under transrectal ultrasound guidance. The median lobe was punctured transurethrally under direct vision. Twenty-seven patients with an average age of 67.7 years were treated between July 1991 and March 1992. At the time of evaluation 15 patients had a follow-up of more than 2 months. They experienced a mean increase of peak flow rate from 6.6 to 15.2 ml/s and a mean decrease of residual volume from 206 to 38 ml. This was accompanied by a marked lessening of symptoms. The average prostate weight decreased from 63 to 44 g. Sexually active patients did not experience retrograde ejaculation.(ABSTRACT TRUNCATED AT 250 WORDS) PMID:7690498

  1. Comparative studies on extraction of sediment interstitial waters: Discussion and comment on the current state of interstitial water studies

    USGS Publications Warehouse

    Manheim, F. T.

    1974-01-01

    The implication by Murthy and Ferrell (1972)that interstitial water studies are in a confused state is criticized on the basis that the authors have not drawn on a considerable body of data, especially Soviet studies since the 1950's, and results of the Deep Sea Drilling Project. Pressure filtration systems for extracting interstitial waters are currently the methods of choice for marine studies and have achieved substantial reliability and reproducibility. Although gaps and problems remain, many aspects of interstitial composition of marine sediments have been clarified; these include the substantial constancy of composition of interstitial waters in deep sea pelagic deposits, depletion of interstitial cations owing to authigenic mineral formation in more rapidly accumulated (especially terrigenous) sediments, and special phenomena in sediments overlying salt deposits. ?? 1974.

  2. Interstitial Photoacoustic Sensor for the Measurement of Tissue Temperature during Interstitial Laser Phototherapy

    PubMed Central

    Li, Zhifang; Chen, Haiyu; Zhou, Feifan; Li, Hui; Chen, Wei R.

    2015-01-01

    Photothermal therapy is an effective means to induce tumor cell death, since tumor tissue is more sensitive to temperature increases than normal tissue. Biological responses depend on tissue temperature; target tissue temperature needs to be precisely measured and controlled to achieve desired thermal effects. In this work, a unique photoacoustic (PA) sensor is proposed for temperature measurement during interstitial laser phototherapy. A continuous-wave laser light and a pulsed laser light, for photothermal irradiation and photoacoustic temperature measurement, respectively, were delivered to the target tissue through a fiber coupler. During laser irradiation, the PA amplitude was measured. The Grüneisen parameter and the bioheat equation were used to determine the temperature in strategic positions in the target tissue. Our results demonstrate that the interstitial PA amplitude is a linear function of temperature in the range of 22 to 55 °C, as confirmed by thermocouple measurement. Furthermore, by choosing appropriate laser parameters, the maximum temperature surrounding the active diffuse fiber tip in tissue can be controlled in the range of 41 to 55 °C. Thus, this sensor could potentially be used for fast, accurate, and convenient three-dimensional temperature measurement, and for real-time feedback and control of interstitial laser phototherapy in cancer treatment. PMID:25756865

  3. Interstitial photoacoustic sensor for the measurement of tissue temperature during interstitial laser phototherapy.

    PubMed

    Li, Zhifang; Chen, Haiyu; Zhou, Feifan; Li, Hui; Chen, Wei R

    2015-01-01

    Photothermal therapy is an effective means to induce tumor cell death, since tumor tissue is more sensitive to temperature increases than normal tissue. Biological responses depend on tissue temperature; target tissue temperature needs to be precisely measured and controlled to achieve desired thermal effects. In this work, a unique photoacoustic (PA) sensor is proposed for temperature measurement during interstitial laser phototherapy. A continuous-wave laser light and a pulsed laser light, for photothermal irradiation and photoacoustic temperature measurement, respectively, were delivered to the target tissue through a fiber coupler. During laser irradiation, the PA amplitude was measured. The Grüneisen parameter and the bioheat equation were used to determine the temperature in strategic positions in the target tissue. Our results demonstrate that the interstitial PA amplitude is a linear function of temperature in the range of 22 to 55 °C, as confirmed by thermocouple measurement. Furthermore, by choosing appropriate laser parameters, the maximum temperature surrounding the active diffuse fiber tip in tissue can be controlled in the range of 41 to 55 °C. Thus, this sensor could potentially be used for fast, accurate, and convenient three-dimensional temperature measurement, and for real-time feedback and control of interstitial laser phototherapy in cancer treatment. PMID:25756865

  4. Reduced boron diffusion under interstitial injection in fluorine implanted silicon

    SciTech Connect

    Kham, M. N.; Matko, I.; Chenevier, B.; Ashburn, P.

    2007-12-01

    Point defect injection studies are performed to investigate how fluorine implantation influences the diffusion of boron marker layers in both the vacancy-rich and interstitial-rich regions of the fluorine damage profile. A 185 keV, 2.3x10{sup 15} cm{sup -2} F{sup +} implant is made into silicon samples containing multiple boron marker layers and rapid thermal annealing is performed at 1000 deg. C for times of 15-120 s. The boron and fluorine profiles are characterized by secondary ion mass spectroscopy and the defect structures by transmission electron microscopy (TEM). Fluorine implanted samples surprisingly show less boron diffusion under interstitial injection than those under inert anneal. This effect is particularly noticeable for boron marker layers located in the interstitial-rich region of the fluorine damage profile and for short anneal times (15 s). TEM images show a band of dislocation loops around the range of the fluorine implant and the density of dislocation loops is lower under interstitial injection than under inert anneal. It is proposed that interstitial injection accelerates the evolution of interstitial defects into dislocation loops, thereby giving transient enhanced boron diffusion over a shorter period of time. The effect of the fluorine implant on boron diffusion is found to be the opposite for boron marker layers in the interstitial-rich and vacancy-rich regions of the fluorine damage profile. For marker layers in the interstitial-rich region of the fluorine damage profile, the boron diffusion coefficient decreases with anneal time, as is typically seen for transient enhanced diffusion. The boron diffusion under interstitial injection is enhanced by the fluorine implant at short anneal times but suppressed at longer anneal times. It is proposed that this behavior is due to trapping of interstitials at the dislocation loops introduced by the fluorine implant. For boron marker layers in the vacancy-rich region of the fluorine damage profile

  5. Evolution kinetics of interstitial loops in irradiated materials: a phase-field model

    SciTech Connect

    Hu, Shenyang Y.; Henager, Charles H.; Li, Yulan; Gao, Fei; Sun, Xin; Khaleel, Mohammad A.

    2012-01-01

    Interstitial loops are one of the principal evolving defects in irradiated materials. The evolution of interstitial loops, including spatial and size distributions, affects both vacancy and interstitial accumulations in the matrix, hence, void formation and volumetric swelling. In this work, a phase-field model to simulate the growth kinetics of interstitial loops in irradiated materials during aging is developed. The diffusion of vacancies and interstitials and the elastic interaction between interstitial loops and point defects are accounted in the model. The effects of interstitial concentration, chemical potential, and elastic interaction on the growth kinetics and stability of interstitial loops are investigated in two and three dimensions. It is found that the elastic interaction enhances the growth kinetics of interstitial loops. The elastic interaction also affects the stability of a small interstitial loop adjacent to a larger loop. The model predicts linear growth rates for interstitial loops that is in agreement with the previous theoretical predictions and experimental observations.

  6. Regulation of tumor invasion by interstitial fluid flow

    NASA Astrophysics Data System (ADS)

    Shieh, Adrian C.; Swartz, Melody A.

    2011-02-01

    The importance of the tumor microenvironment in cancer progression is undisputed, yet the significance of biophysical forces in the microenvironment remains poorly understood. Interstitial fluid flow is a nearly ubiquitous and physiologically relevant biophysical force that is elevated in tumors because of tumor-associated angiogenesis and lymphangiogenesis, as well as changes in the tumor stroma. Not only does it apply physical forces to cells directly, but interstitial flow also creates gradients of soluble signals in the tumor microenvironment, thus influencing cell behavior and modulating cell-cell interactions. In this paper, we highlight our current understanding of interstitial fluid flow in the context of the tumor, focusing on the physical changes that lead to elevated interstitial flow, how cells sense flow and how they respond to changes in interstitial flow. In particular, we emphasize that interstitial flow can directly promote tumor cell invasion through a mechanism known as autologous chemotaxis, and indirectly support tumor invasion via both biophysical and biochemical cues generated by stromal cells. Thus, interstitial fluid flow demonstrates how important biophysical factors are in cancer, both by modulating cell behavior and coupling biophysical and biochemical signals.

  7. Acute Interstitial Nephritis Following Multiple Asian Giant Hornet Stings

    PubMed Central

    Li, Xiang-Dong; Liu, Zheng; Zhai, Ying; Zhao, Ming; Shen, Hai-Yan; Li, Yi; Zhang, Bo; Liu, Tao

    2015-01-01

    Patient: Male, 42 Final Diagnosis: Acute interstitial nephritis Symptoms: Difficulty breathing • headache • numbness • oliguria Medication: Methylprednisolone Clinical Procedure: Plasma exchange Specialty: Nephrology Objective: Rare disease Background: The Asian giant hornet is the largest wasp species in the world. Its stings can cause acute interstitial nephritis and acute renal failure. From July to October, 2013, Asian giant hornet attacks have killed 42 people and injured 1675 people with their powerful venomous stings in Hanzhong, Ankang, and Shangluo, three cities in the southern part of Shaanxi Province, China. Case Report: We report here a case of a 42-year-old man with acute interstitial nephritis following multiple Asian giant hornet stings. On admission, the patient had difficulty breathing, headache, and numbness in both limbs (arm and leg). He was treated in the Emergency Department and Department of Nephrology with plasma exchange and dialysis within 24 hours after being stung. A kidney biopsy revealed acute interstitial nephritis with interstitial infiltrations of eosinophils and lymphocytes. After intensive treatment, his liver function recovered within 10 days. Along with oral methylprednisolone, his renal function recovered 1 month later. Conclusions: This case shows that acute interstitial nephritis happens several days after being stung. Since the number of deaths in southern Shaanxi province is much higher than other places, our report draws the attention of fellow clinicians to the acute interstitial nephritis following multiple Asian giant hornet stings. PMID:26076055

  8. Trophic plasticity of the gastropod Hydrobia ulvae within an intertidal bay (Roscoff, France): A stable isotope evidence

    NASA Astrophysics Data System (ADS)

    Riera, P.

    2010-01-01

    The study investigated the trophic ecology of the gastropod Hydrobia ulvae in different habitat types within an intertidal bay. The results point out two major trophic pathways involving H.ulvae in this bay. On the one hand, in sandy/muddy sediments Hydrobia derives most of its energy from allochtonous detritus derived from Enteromorpha sp and the total SOM pool. In addition, in these sediments, the phototrophic purple bacteria mats played a substantial trophic role in the diet of Hydrobia. On the other hand, in a Spartina maritima marsh, the gastropod appears firstly dependent of autochtonous detritus derived from this plant. The minor contribution of microphytobenthos to the diet of Hydrobia is consistent with a relatively low presence of epipelic diatoms at the sampling sites. These results provide evidence that the trophic ecology of H.ulvae inhabiting intertidal sediments is quite plastic and does not necessarily rely primarly on microphytobenthos. Consequently, in a single bay, the small spatial scale variability in the origin and availability of detritus have direct implications on the food incorporation by H.ulvae.

  9. Contrasting shell morphology, ingestion and grazing preferences in the neritid gastropod Smaragdia viridis (L.) on two seagrass species

    NASA Astrophysics Data System (ADS)

    Rueda, José L.; Salas, Carmen; Gofas, Serge

    2011-10-01

    The neritid Smaragdia viridis represents the only known native marine mollusc that feeds on seagrass tissues in the European coasts, displaying a strong association with the seagrasses Cymodocea nodosa and Zostera marina in southern Spain. Seasonal dynamics, shell and radular morphology, growth and feeding of this gastropod have been studied in relation to each seagrass species for contrasting trends resulting from a different type of substrate and food source. In both seagrass species, stable populations of this gastropod occur at similar densities and displaying similar growth rates. Nevertheless shells of individuals from C. nodosa are narrower than those from Z. marina and some differences, possibly a consequence of increased wearing on C. nodosa, were noted amongst the radulae. In C. nodosa, a pre-ingestive selection for young epidermal tissues occurs as it was previously observed in Z. marina. The ingestion rate is higher in C. nodosa than in Z. marina but the absorption of ingested tissues is lower in the former. If both seagrasses are present, most individuals ingested preferentially Z. marina rather than C. nodosa, probably due to the lower digestibility of the epidermal tissues in the latter. Seagrass beds, especially those of Z. marina, are suffering a strong regression in southern Spain and the presence of stable populations of this neritid may be restricted to other declining seagrass species in the area.

  10. Environmental and developmental controls of morphological diversity in a thermal spring gastropod from Coahuila, Mexico

    NASA Astrophysics Data System (ADS)

    Roopnarine, P. D.; Tang, C. M.

    2001-12-01

    Isolated thermal springs and associated aquatic environments near Cuatro Ciénegas, in north-central Mexico provide an opportunity to study patterns of evolutionary diversification under extreme conditions. Significant differences in temperature, seasonality, pH, and salinities among other variables may allow for high levels of differentiation and endemism. Biological studies of the unique faunas in this type of environment may serve as analogues for extreme and/or evaporitic environments as targeted by astrobiological research. The endemic hydrobiid gastropod \\textit{Mexipyrgus} is widely distributed in a variety of aquatic environments within the Cuatro Cienégas basin. Original description of this genus by Taylor listed six distinct species reflecting shell and anatomical features. Later revision by Hershler suggests that this diversity be reduced to one single, highly-variable species, based mainly on the morphology of reproductive structures. The systematic conflict emphasizes the need to understand the bases of morphological variation at small scales and in environmentally unusual settings. Shells of \\textit{Mexipyrgus} were collected from six localities and the following species were identified based on Taylor's classification: \\textit{M. carranzae}, \\textit{M. escobedae}, \\textit{M. multilineatus}, and specimens intermediate in character between \\textit{M. carranzae}, \\textit{M. lugoi} and \\textit{M. mojarralis}. All specimens consisted of 4-6 whorls. Shell shape was archived by the digitization of geometrically homologous landmarks on the spire (apex, whorl sutures in apertural view) and aperture. Shell size was calculated as Centroid Size. Data were analyzed using uniform and principal warp analysis of raw landmark coordinates, followed by relative warp analysis of uniform and partial warp scores. Three separate analyses were performed for 4, 5 and 6 whorled specimens. Results indicate two different levels of variation based on individual age

  11. Biodiversity census of Lake St Lucia, iSimangaliso Wetland Park (South Africa): Gastropod molluscs

    PubMed Central

    Perissinotto, Renzo; Miranda, Nelson A.F.; Raw, Jacqueline L.; Peer, Nasreen

    2014-01-01

    Abstract The recent dry phase experienced by the St Lucia estuarine system has led to unprecedented desiccation and hypersaline conditions through most of its surface area. This has changed only recently, at the end of 2011, with the onset of a new wet phase that has already caused a major shift to oligo- and mesohaline conditions. The estuary mouth, however, remains closed to the ocean, making the weak connection recently established between the St Lucia and the Mfolozi estuaries the only conveyance for marine recruitment. As a result, only 10 indigenous and two alien aquatic gastropod species are currently found living in the St Lucia estuarine lake. This is out of a total of 37 species recorded within the system since the earliest survey undertaken in 1924, half of which have not been reported in the literature before. The tick shell, Nassarius kraussianus, which was consistently found in large abundance prior to the recent dry phase, appears to have temporarily disappeared from the system, probably as a result of the extinction of Zostera marine grasses inside the lake. Population explosions of the bubble shell Haminoea natalensis, with its distinct egg masses, were recorded seasonally until 2009, but the species has subsequently not been observed again. A molecular DNA analysis of the various populations previously reported as belonging to the same assimineid species, variably referred to as Assiminea capensis, A. ovata, or A. bifasciata, has revealed that the St Lucia assemblage actually comprises two very distinct taxa, A. cf. capensis and a species provisionally referred to here as “A.” aff. capensis or simply Assimineidae sp. In the mangroves, the climbing whelk Cerithidea decollata is still found in numbers, while ellobiids such as Cassidula labrella, Melampus semiaratus and M. parvulus are present in low abundances and all previously recorded littorinids have disappeared. A number of alien freshwater species have colonized areas of the system that

  12. Marked changes in neuropeptide expression accompany broadcast spawnings in the gastropod Haliotis asinina

    PubMed Central

    2012-01-01

    Introduction A huge diversity of marine species reproduce by synchronously spawning their gametes into the water column. Although this species-specific event typically occurs in a particular season, the precise time and day of spawning often can not be predicted. There is little understanding of how the environment (e.g. water temperature, day length, tidal and lunar cycle) regulates a population’s reproductive physiology to synchronise a spawning event. The Indo-Pacific tropical abalone, Haliotis asinina, has a highly predictable spawning cycle, where individuals release gametes on the evenings of spring high tides on new and full moons during the warmer half of the year. These calculable spawning events uniquely allow for the analysis of the molecular and cellular processes underlying reproduction. Here we characterise neuropeptides produced in H. asinina ganglia that are known in egg-laying molluscs to control vital aspects of reproduction. Results We demonstrate that genes encoding APGWamide, myomodulin, the putative proctolin homologue whitnin, FMRFamide, a schistosomin-like peptide (SLP), a molluscan insulin-related peptide (MIP) and a haliotid growth-associated peptide (HGAP) all are differentially expressed in the anterior ganglia during the two week spawning cycle in both male and female abalone. Each gene has a unique and sex-specific expression profile. Despite these differences, expression levels in most of the genes peak at or within 12 h of the spawning event. In contrast, lowest levels of transcript abundance typically occurs 36 h before and 24 h after spawning, with differences in peak and low expression levels being most pronounced in genes orthologous to known molluscan reproduction neuromodulators. Conclusions Exploiting the predictable semi-lunar spawning cycle of the gastropod H. asinina, we have identified a suite of evolutionarily-conserved, mollusc-specific and rapidly-evolving neuropeptides that appear to contribute to the

  13. Bladder afferent hyperexcitability in bladder pain syndrome/interstitial cystitis

    PubMed Central

    Yoshimura, Naoki; Oguchi, Tomohiko; Yokoyama, Hitoshi; Funahashi, Yasuhito; Yoshikawa, Satoru; Sugino, Yoshio; Kawamorita, Naoki; Kashyap, Mahendra P; Chancellor, Michael B; Tyagi, Pradeep; Ogawa, Teruyuki

    2014-01-01

    Bladder pain syndrome/interstitial cystitis is a disease with lower urinary tract symptoms, such as bladder pain and urinary frequency, which results in seriously impaired quality of life of patients. The extreme pain and urinary frequency are often difficult to treat. Although the etiology of bladder pain syndrome/interstitial cystitis is still not known, there is increasing evidence showing that afferent hyperexcitability as a result of neurogenic bladder inflammation and urothelial dysfunction is important to the pathophysiological basis of symptom development. Further investigation of the pathophysiology will lead to the effective treatment of patients with bladder pain syndrome/interstitial cystitis. PMID:24807488

  14. [Suicide attempt by an interstitial cystitis patient : a case report].

    PubMed

    Suzuki, Takahisa; Otsuka, Atsushi; Kato, Taiki; Furuse, Hiroshi; Ozono, Seiichiro

    2014-11-01

    We report a suicide attempt by an interstitial cystitis patient. A 68-year-old woman consulted several clinics with complaints of urinary frequency and bladder pain, but her symptoms did not improve. She was admitted to our hospital and diagnosed with interstitial cystitis. Hydrodistention was performed, and the urethral catheter removed one day after surgery. The next day, the patient was afraid that her symptoms had not improved and, due to this physical and mental distress, cut her wrist with a razor. Vascular anastomosis and neuroanastomosis were performed accordingly. Eighteen months after hydrodistention, the patient's symptoms of interstitial cystitis have much improved. PMID:25511944

  15. Interstitial lung disease in infancy: A general approach.

    PubMed

    Hines, Erica J; Walsh, Mark; Armes, Jane E; Douglas, Tonia; Chawla, Jasneek

    2016-04-01

    Childhood Interstitial lung disease (chILD) is an umbrella term used to define a broad range of rare, diffuse pulmonary disorders with altered interstitial structure that leads to abnormal gas exchange. Presentation of chILD in infancy can be difficult to differentiate from other common causes of diffuse lung disease. This article aimed at paediatricians provides an overview of interstitial lung disease presenting in infancy and includes key clinical features, a suggested approach to investigation and a summary of management. An overview of three clinical cases has been included to demonstrate the diagnostic approach, characteristic investigation findings and varied clinical outcomes. PMID:27145498

  16. Directional interstitial brachytherapy from simulation to application

    NASA Astrophysics Data System (ADS)

    Lin, Liyong

    Organs at risk (OAR) are sometimes adjacent to or embedded in or overlap with the clinical target volume (CTV) to be treated. The purpose of this PhD study is to develop directionally low energy gamma-emitting interstitial brachytherapy sources. These sources can be applied between OAR to selectively reduce hot spots in the OARs and normal tissues. The reduction of dose over undesired regions can expand patient eligibility or reduce toxicities for the treatment by conventional interstitial brachytherapy. This study covers the development of a directional source from design optimization to construction of the first prototype source. The Monte Carlo code MCNP was used to simulate the radiation transport for the designs of directional sources. We have made a special construction kit to assemble radioactive and gold-shield components precisely into D-shaped titanium containers of the first directional source. Directional sources have a similar dose distribution as conventional sources on the treated side but greatly reduced dose on the shielded side, with a sharp dose gradient between them. A three-dimensional dose deposition kernel for the 125I directional source has been calculated. Treatment plans can use both directional and conventional 125I sources at the same source strength for low-dose-rate (LDR) implants to optimize the dose distributions. For prostate tumors, directional 125I LDR brachytherapy can potentially reduce genitourinary and gastrointestinal toxicities and improve potency preservation for low risk patients. The combination of better dose distribution of directional implants and better therapeutic ratio between tumor response and late reactions enables a novel temporary LDR treatment, as opposed to permanent or high-dose-rate (HDR) brachytherapy for the intermediate risk T2b and high risk T2c tumors. Supplemental external-beam treatments can be shortened with a better brachytherapy boost for T3 tumors. In conclusion, we have successfully finished the

  17. Interstitial rotating shield brachytherapy for prostate cancer

    SciTech Connect

    Adams, Quentin E. Xu, Jinghzu; Breitbach, Elizabeth K.; Li, Xing; Rockey, William R.; Kim, Yusung; Wu, Xiaodong; Flynn, Ryan T.; Enger, Shirin A.

    2014-05-15

    Purpose: To present a novel needle, catheter, and radiation source system for interstitial rotating shield brachytherapy (I-RSBT) of the prostate. I-RSBT is a promising technique for reducing urethra, rectum, and bladder dose relative to conventional interstitial high-dose-rate brachytherapy (HDR-BT). Methods: A wire-mounted 62 GBq{sup 153}Gd source is proposed with an encapsulated diameter of 0.59 mm, active diameter of 0.44 mm, and active length of 10 mm. A concept model I-RSBT needle/catheter pair was constructed using concentric 50 and 75 μm thick nickel-titanium alloy (nitinol) tubes. The needle is 16-gauge (1.651 mm) in outer diameter and the catheter contains a 535 μm thick platinum shield. I-RSBT and conventional HDR-BT treatment plans for a prostate cancer patient were generated based on Monte Carlo dose calculations. In order to minimize urethral dose, urethral dose gradient volumes within 0–5 mm of the urethra surface were allowed to receive doses less than the prescribed dose of 100%. Results: The platinum shield reduced the dose rate on the shielded side of the source at 1 cm off-axis to 6.4% of the dose rate on the unshielded side. For the case considered, for the same minimum dose to the hottest 98% of the clinical target volume (D{sub 98%}), I-RSBT reduced urethral D{sub 0.1cc} below that of conventional HDR-BT by 29%, 33%, 38%, and 44% for urethral dose gradient volumes within 0, 1, 3, and 5 mm of the urethra surface, respectively. Percentages are expressed relative to the prescription dose of 100%. For the case considered, for the same urethral dose gradient volumes, rectum D{sub 1cc} was reduced by 7%, 6%, 6%, and 6%, respectively, and bladder D{sub 1cc} was reduced by 4%, 5%, 5%, and 6%, respectively. Treatment time to deliver 20 Gy with I-RSBT was 154 min with ten 62 GBq {sup 153}Gd sources. Conclusions: For the case considered, the proposed{sup 153}Gd-based I-RSBT system has the potential to lower the urethral dose relative to HDR-BT by 29

  18. The late Silurian-Middle Devonian long-term eustatic cycle as a possible control on the global generic diversity dynamics of bivalves and gastropods

    NASA Astrophysics Data System (ADS)

    Ruban, Dmitry A.

    2013-09-01

    A long-term eustatic cycle (fall and subsequent rise of the global sea level) embraced the late Silurian-Middle Devonian time interval. Potentially, these sea-level changes could drive global biodiversity. The stratigraphic ranges of 204 bivalve genera and 279 gastropod genera included into the famous Sepkoski database allow reconstructing changes in the total diversity and the number of originations and extinctions of these important groups of marine benthic macro- -invertebrates during this interval. None of the recorded parameters coincided with the long-term global sea-level cycle. It cannot be not excluded, however, that the global sea-level changes did not affect the regions favourable for bivalve and gastropod radiation because of regional tectonic mechanisms; neither can it be excluded that the eustatic control persisted together with many other extrinsic and intrinsic controls. Interestingly, the generic diversity of gastropods increased together with a cooling trend, and vice versa. Additionally, the Ludlow, Eifelian, and Givetian biotic crises affected, probably, both fossil groups under study. There was also a coincidence of the relatively high bivalve generic diversity, initial radiation of gastropods and the entire biota, and the diversification of brachiopods with the Early Devonian global sea-level lowstand, and this may be interpreted as evidence of a certain eustatic control on the marine biodiversity.

  19. Bathymetric zonation and diversity gradient of gastropods and bivalves in West Antarctica from the South Shetland Islands to the Bellingshausen Sea

    NASA Astrophysics Data System (ADS)

    Aldea, Cristian; Olabarria, Celia; Troncoso, Jesús S.

    2008-03-01

    Depth-related zonation and diversity patterns are important topics in the study of deep-sea fauna, at both species and assemblage levels. These patterns may be attributed to complex and combined physical and/or biological factors. The lack of information about the West Antarctic deep sea is an important handicap to understanding the global-scale benthic diversity patterns. Detailed studies of the bathymetric distributions and diversity of deep-sea species in the Antarctic are needed to elucidate the factors contributing to global-scale benthic patterns. This study, based on a large data set, examined the bathymetric distribution, patterns of zonation and diversity-depth trends of gastropods and bivalves in West Antarctica, from the South Shetland Islands to the Bellingshausen Sea, a very poorly known area. A total of 647 individuals of gastropods belonging to 82 species and a total of 2934 individuals of bivalves belonging to 52 species were collected. Most gastropods showed discrete depth distributions, whereas most bivalves showed broader depth ranges. Replacement of species with depth was more gradual for bivalves than gastropods. Nevertheless, three bathymetric boundaries could be recognized: (1) a continental shelf zone from 0 to 400 m with a gradual rate of succession, (2) an upper slope zone from 400 to 800 m and (3) a lower slope zone from 800 to 2000 m, extending to 3300 m for bivalves. Diversity patterns were complex for both groups with no significant trends with depth.

  20. Failure of Gallium-67 scintigraphy to identify reliably noninfectious interstitial nephritis: concise communication

    SciTech Connect

    Graham, G.D.; Lundy, M.M.; Moreno, A.J.

    1983-07-01

    Gallium-67 scintigraphy has been reported to be useful in the diagnosis of noninfectious interstitial nephritis. We studied 12 patients with Ga-67 citrate that were diagnosed as having noninfectious interstitial nephritis on renal biopsy. Only seven of the twelve patients with interstitial nephritis on biopsy were scan-positive. Gallium-67 scintigraphy may not reliably identify noninfectious interstitial nephritis.

  1. View of first level from north showing interstitial structural columns ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    View of first level from north showing interstitial structural columns for the Shuttle assemble configuration. - Marshall Space Flight Center, Saturn V Dynamic Test Facility, East Test Area, Huntsville, Madison County, AL

  2. Phenotypic characterization of rare interstitial deletion of chromosome 4

    PubMed Central

    Ismail, Samira; Helmy, Nivine A.; Mahmoud, Wael M.; El-Ruby, Mona O.

    2012-01-01

    Interstitial deletion of the long arm of chromosome 4 is rare. Patients with interstitial deletion of the long arm of chromosome 4 differ from those with terminal deletions. Phenotypes may be variable, depending upon the specific length and location of the deleted portion. Here, we report on a boy exhibiting most of the congenital malformations encountered in terminal 4q syndrome. The conventional karyotyping and Fluorescence in-situ hybridization revealed a de novo interstitial del (4)(q31q32). The current report is a further document highlighting that deletion of segment q31 could be contributing to the expression of most of the phenotype of 4q deletion syndrome. Using array comparative genome hybridization methodology is recommended for investigating further cases with similar segmental interstitial deletions to support and delineate findings and to define genes implicated in the pathogenesis of the disorder.

  3. CT in the diagnosis of interstitial lung disease

    SciTech Connect

    Bergin, C.J.; Mueller, N.L.

    1985-09-01

    The computed tomographic (CT) appearance of interstitial lung disease was assessed in 23 patients with known interstitial disease. These included seven patients with fibrosing alveolitis, six with silicosis, two with hypersensitivity pneumonitis, three with lymphangitic spread of tumor, two with sarcoidosis, one with rheumatoid lung disease, and two with neurofibromatosis. The CT appearance of the interstitial changes in the different disease entities was assessed. Nodules were a prominent CT feature in silicosis, sarcoidosis, and lymphangitic spread of malignancy. Distribution of nodules and associated interlobular septal thickening provided further distinguishing features in these diseases. Reticular densities were the predominant CT change in fibrosing alveolitis, rheumatoid lung disease, and extrinsic allergic alveolitis. CT can be useful in the investigation of selected instances of interstitial pulmonary disease.

  4. Evaluation of the wear properties of high interstitial stainless steels

    SciTech Connect

    Tylczak, J.H.; Rawers, J.C.; Alman, D.E.

    2007-04-01

    Adding carbon to high nitrogen steels increases interstitial concentrations over what can be obtained with nitrogen addition alone. This can results in an increase in hardness, strength, and wear resistance. The alloys produced for this study were all based on commercially available high-nitrogen Fe-18Cr-18Mn stainless steel. This study is the first significant wear study of these new high interstitial nitrogen-carbon stainless steel alloys. Wear tests included: scratch, pin-on-disk abrasion, dry sand/rubber wheel abrasion, impeller impact, and jet erosion. Increasing interstitial concentration increased strength and hardness and improved wear resistance under all test conditions. The results are discussed in terms of overall interstitial alloy concentration.

  5. Complexes of self-interstitials with oxygen atoms in Ge

    SciTech Connect

    Khirunenko, L. I.; Pomozov, Yu. V.; Sosnin, M. G.; Abrosimov, N. V.; Riemann, H.

    2014-02-21

    Interactions of germanium self-interstitials with interstitial oxygen atoms in Ge subjected to irradiation at ∼80 K and subsequently to annealing have been studied. To distinguish the processes involving vacancies and self-interstitials the doping with tin was used. It was shown that absorption lines with maximum at 602, 674, 713 and 803 cm{sup −1} are self-interstitials-related. Two lines at 602 and 674, which develop upon annealing in the temperature range 180–240 K, belong to IO complexes, while the bands at 713 and 803 cm{sup −1}, which emerge after annealing at T>220 K, are associated with I{sub 2}O. It is argued that the annealing of IO occurs by two mechanisms: by dissociation and by diffusion.

  6. Indication for Interstitial Brachytherapy in Carcinoma of the Uterine Cervix

    PubMed Central

    Kumar, P. Pradeep; Taylor, Judith; Scott, Joseph C.; Jacobs, Allan J.; Rojas, John

    1984-01-01

    More than 40 patients with gynecological, genitourinary, and gastrointestinal malignancies, both primary and recurrent but confined to the pelvis, were treated with interstitial irradiation over a four-year period. Interstitial irradiation was the choice of treatment for early carcinoma of the prostate, carcinoma of the anal canal less than T2, recurrent carcinoma of the uterine cervix, and carcinoma of the cervical stump. The authors' experience in treating recurrent carcinoma of the uterine cervix with interstitial irradiation is the basis for the indications for selecting the technique of interstitial irradiation presented. ImagesFigure 1Figure 2Figure 3Figure 4Figure 5Figure 6Figure 7Figure 8Figure 9Figure 10 PMID:6471113

  7. Nonspecific interstitial pneumonia and usual interstitial pneumonia: comparison of the clinicopathologic features and prognosis

    PubMed Central

    Xu, Jinfu; Liu, Jinming; Yi, Xianghua; Sun, Xiwen; Shi, Jingyun

    2014-01-01

    Background Nonspecific interstitial pneumonia (NSIP) has recently been proposed as a histologic type of idiopathic interstitial pneumonia (IIP), but its broad spectrum of clinicopathologic findings and variable prognosis are poorly understood. It is particularly unclear how NSIP and usual interstitial pneumonia (UIP) are related. The present study investigated the clinicopathologic features and prognosis of NSIP, and its differential diagnosis from UIP. Methods The clinicopathologic findings and prognosis in 21 NSIP and 18 UIP patients who underwent surgical or video-assisted thoracoscopic lung biopsy were reviewed. Results NSIP was more frequent in women and showed nonspecific clinical manifestations. High-resolution computed tomography (HRCT) demonstrated ground-glass, net-like, and patchy attenuation in both lungs. Semiquantitative HRCT showed a median fibrosis score of 3 (range, 0 to 7) in NSIP patients and 5 (range, 2 to 7) in UIP patients (P<0.01). On histopathologic examination, NSIP cases were heterogeneous and the findings could be categorized into cellular and fibrosing patterns. The mean age of the NSIP and UIP patients was 48 and 60 years, respectively. The frequencies of fibroblast foci, myogelosis, honeycomb lesions, and pulmonary structural destruction in NSIP and UIP patients were 16.7% and 100% (P<0.001), 22.2% and 85.7% (P<0.05), 16.7% and 92.9% (P<0.001), and 27.8% and 100% (P<0.05), respectively. The responses to glucocorticoid treatment and the prognosis were significantly greater in NSIP than those in UIP. Conclusions NSIP was difficult to be differentiated from UIP by general clinical manifestations, but HRCT can be helpful for this purpose. Definitive diagnosis depends on the results of surgical lung biopsy. PMID:25364525

  8. Optical dosimetry for interstitial photodynamic therapy

    SciTech Connect

    Arnfield, M.R.; Tulip, J.; Chetner, M.; McPhee, M.S. )

    1989-07-01

    An approach to photodynamic treatment of tumors is the interstitial implantation of fiber optic light sources. Dosimetry is critical in identifying regions of low light intensity in the tumor which may prevent tumor cure. We describe a numerical technique for calculating light distributions within tumors, from multiple fiber optic sources. The method was tested using four translucent plastic needles, which were placed in a 0.94 X 0.94 cm grid pattern within excised Dunning R3327-AT rat prostate tumors. A cylindrical diffusing fiber tip, illuminated by 630 nm dye laser light was placed within one needle and a miniature light detector was placed within another. The average penetration depth in the tumor region between the two needles was calculated from the optical power measured by the detector, using a modified diffusion theory. Repeating the procedure for each pair of needles revealed significant variations in penetration depth within individual tumors. Average values of penetration depth, absorption coefficient, scattering coefficient, and mean scattering cosine were 0.282 cm, 0.469 cm-1, 250 cm-1 and 0.964, respectively. Calculated light distributions from four cylindrical sources in tumors gave reasonable agreement with direct light measurements using fiber optic probes.

  9. Suspected acute interstitial nephritis induced by colistin.

    PubMed

    Kallel, Hatem; Hamida, Chokri Ben; Ksibi, Hichem; Bahloul, Mabrouk; Hergafi, Leila; Chaari, Anis; Chelly, Hedi; Bouaziz, Mounir

    2005-01-01

    We describe a 35-year-old male admitted to the intensive care unit (ICU) for acute exacerbation of chronic obstructive pulmonary disease (COPD). He developed ventilator-associated pneumonia caused by multidrug-resistant Pseudomonas aeruginosa and was treated with imipenem and colistin without any renal toxicity. The patient was readmitted to the ICU for a 2nd and a 3rd exacerbation of COPD and was again treated with imipenem and colistin. In both episodes, he developed rapid worsening in renal function, which improved following colistin withdrawal. Use of the Naranjo ADR probability scale indicated a probable relationship between the renal failure and the colistin therapy. In addition, the time course of events suggested that colistin was the cause of acute interstitial nephritis in this patient. We conclude that our patient had a possible acute allergic reaction to colistin since the 1st introduction was not associated with any renal toxicity and renal failure was observed on the 1st day of the 2nd and the 3rd initiation of colistin therapy, respectively. PMID:16013023

  10. Renaissance of laser interstitial thermal ablation.

    PubMed

    Missios, Symeon; Bekelis, Kimon; Barnett, Gene H

    2015-03-01

    Laser interstitial thermal therapy (LITT) is a minimally invasive technique for treating intracranial tumors, originally introduced in 1983. Its use in neurosurgical procedures was historically limited by early technical difficulties related to the monitoring and control of the extent of thermal damage. The development of magnetic resonance thermography and its application to LITT have allowed for real-time thermal imaging and feedback control during laser energy delivery, allowing for precise and accurate provision of tissue hyperthermia. Improvements in laser probe design, surgical stereotactic targeting hardware, and computer monitoring software have accelerated acceptance and clinical utilization of LITT as a neurosurgical treatment alternative. Current commercially available LITT systems have been used for the treatment of neurosurgical soft-tissue lesions, including difficult to access brain tumors, malignant gliomas, and radiosurgery-resistant metastases, as well as for the ablation of such lesions as epileptogenic foci and radiation necrosis. In this review, the authors aim to critically analyze the literature to describe the advent of LITT as a neurosurgical, laser excision tool, including its development, use, indications, and efficacy as it relates to neurosurgical applications. PMID:25727222

  11. Standardising Responsibility? The Significance of Interstitial Spaces.

    PubMed

    Wickson, Fern; Forsberg, Ellen-Marie

    2015-10-01

    Modern society is characterised by rapid technological development that is often socially controversial and plagued by extensive scientific uncertainty concerning its socio-ecological impacts. Within this context, the concept of 'responsible research and innovation' (RRI) is currently rising to prominence in international discourse concerning science and technology governance. As this emerging concept of RRI begins to be enacted through instruments, approaches, and initiatives, it is valuable to explore what it is coming to mean for and in practice. In this paper we draw attention to a realm that is often backgrounded in the current discussions of RRI but which has a highly significant impact on scientific research, innovation and policy-namely, the interstitial space of international standardization. Drawing on the case of nanoscale sciences and technologies to make our argument, we present examples of how international standards are already entangled in the development of RRI and yet, how the process of international standardization itself largely fails to embody the norms proposed as characterizing RRI. We suggest that although current models for RRI provide a promising attempt to make research and innovation more responsive to societal needs, ethical values and environmental challenges, such approaches will need to encompass and address a greater diversity of innovation system agents and spaces if they are to prove successful in their aims. PMID:25344842

  12. Acute interstitial nephritis - a reappraisal and update.

    PubMed

    Raghavan, Rajeev; Eknoyan, Garabed

    2014-09-01

    Acute interstitial nephritis (AIN) is an under recognized and under diagnosed cause of acute kidney injury (AKI). It is estimated to account for 15 - 20% of cases of AKI; it is the reported diagnosis in 2.8% of all kidney biopsies, and 13.5% of biopsies done specifically for acute renal failure. Considerable evidence implicates antigen initiated cell-mediated injury in the pathogenesis of AIN. Drugs account for 70% of all cases, with over 150 different agents incriminated. The remaining cases are due to infections, autoimmune diseases, and rarely idiopathic. The central component of renal injury in AIN is altered tubular function, which usually precedes decrements in filtration rate. The key to early diagnosis is vigilance for the presence of tubular dysfunction in non-oliguric individuals, especially in patients with modest but gradual increments in creatinine level. The utility of urinary biomarkers to diagnose AIN in its early nascent and potentially reversible stage remains to be determined. Prompt recognition, elimination of the offending source of antigen, and use of a limited course of steroid therapy where indicated, will result in complete resolution in ~ 65% of cases, partial resolution in up to 20%, and irreversible damage in the rest. PMID:25079860

  13. Interstitial adenosine concentration is increased by dipyridamole

    SciTech Connect

    Gorman, M.W.; Wangler, R.D.; DeWitt, D.F.; Wang, C.Y.; Bassingthwaighte, J.B.; Sparks, H.V.

    1986-03-01

    The authors used the multiple indicator dilution technique to observe the capillary transport of adenosine (ADO) in isolated guinea pig hearts. Radiolabelled albumin, sucrose and ADO were injected on the arterial side and measured in venous samples collected during the following 20 seconds. Transport parameters calculated from these data include permeability-surface area products (PS) for transendothelial diffusion, endothelial cell (EC) uptake at the lumenal and ablumenal membranes, and EC metabolism. With simultaneous measurements of arterial and venous ADO concentrations and flow, the authors calculated the steady-state interstitial fluid (ISF) ADO concentration. Under control conditions the venous ADO concentration was 7.1 +/- 2.8 nM. The calculated ISF concentration depends on whether they assume the venous ADO comes from the ISF, or directly from ECs. These ISF concentrations are 25 +/- 12 nM and 9.8 +/- 4.0 nM, respectively. During dipyridamole infusion (10 uM) the EC transport parameters became nearly zero. Venous and ISF ADO concentrations increased to 33 +/- 8.9 nM and 169 +/- 42 nM, respectively. The authors conclude that the ISF ADO concentration is 1.5-4 fold higher than the venous concentration at rest, and the ISF concentration increases greatly with dipyridamole.

  14. Interstitial laser photocoagulation of uterine leimyoma

    NASA Astrophysics Data System (ADS)

    Gordon, Alastair D.; Buonaccorsi, Giovanni A.; Patel, Bipin L.; Broadbent, Jeff J.; Thurrell, Wendy; Bown, Stephen G.

    1996-01-01

    Uterine leiomyomas (fibroids) are common benign tumors which may cause heavy or painful periods, may present as a pelvic mass and are associated with infertility. Local excision of symptomatic lesions can be difficult and hazardous, and the alternative is hysterectomy. We are investigating interstitial laser photocoagulation (ILP) as a less invasive alternative. Initial experiments were undertaken on 40 fibroids after surgical removal. One or two bare tipped, precharred fibers from a 25 W semiconductor laser (805 nm) were inserted into the center of the fibroid and treatment delivered with 2 - 10 W for 100 - 1000 sec. Specimens were subsequently sectioned perpendicular to the fiber track. Fibroids are very pale and apart from occasional charred tracts there was little evidence of thermal coagulation macroscopically or after haematoxylon and eosin staining. However, using a diaphorase stain technique we were able to demonstrate ellipsoid zones of devitalized tissue up to 20 mm across (15 mm for single fibers). These results suggest that ILP is producing gentle, uniform coagulation which could lead to resorption of treated areas. With appropriate numbers of treatment sites, this could permit minimally invasive management of clinically significant lesions. Clinical studies have commenced treating fibroids with ILP at the time of surgical excision by myomectomy or hysterectomy.

  15. Immunologic Observations in Canine Interstitial Nephritis

    PubMed Central

    Krohn, Kai; Mero, Matti; Oksanen, Aili; Sandholm, Markus

    1971-01-01

    Immunofluorescence studies in cases of chronic interstitial nephritis (CIN) in the dog demonstrated deposition of canine IgC and C'3 in the thickened capillary walls of the glomeruli and in the mesangium. Eluates obtained from the nephritic kidneys contained antibodies of IgG type and reacted with autologous or homologous nephritic kidneys but not with normal kidneys or with any normal canine tissue. The staining pattern of fluorescein-conjugated eluates was similar to that obtained with anti-canine IgG or anti-canine C'3. The eluates did not contain leptospiral antibodies. The findings indicate that complement-fixing immune complexes are deposited in the damaged glomeruli in CIN. The nature of the antigen involved in these complexes is unknown, but it does not seem to be a component of normal canine tissue and could thus be viral or bacterial. ImagesFig 5Fig 6Fig 7Fig 8Fig 13Fig 14Fig 15Fig 16Fig 9Fig 10Fig 11Fig 12Fig 1Fig 2Fig 3Fig 4 PMID:4106382

  16. Granular Material Flows with Interstitial Fluid Effects

    NASA Technical Reports Server (NTRS)

    Hunt, Melany L.; Brennen, Christopher E.

    2004-01-01

    The research focused on experimental measurements of the rheological properties of liquid-solid and granular flows. In these flows, the viscous effects of the interstitial fluid, the inertia of the fluid and particles, and the collisional interactions of the particles may all contribute to the flow mechanics. These multiphase flows include industrial problems such as coal slurry pipelines, hydraulic fracturing processes, fluidized beds, mining and milling operation, abrasive water jet machining, and polishing and surface erosion technologies. In addition, there are a wide range of geophysical flows such as debris flows, landslides and sediment transport. In extraterrestrial applications, the study of transport of particulate materials is fundamental to the mining and processing of lunar and Martian soils and the transport of atmospheric dust (National Research Council 2000). The recent images from Mars Global Surveyor spacecraft dramatically depict the complex sand and dust flows on Mars, including dune formation and dust avalanches on the slip-face of dune surfaces. These Aeolian features involve a complex interaction of the prevailing winds and deposition or erosion of the sediment layer; these features make a good test bed for the verification of global circulation models of the Martian atmosphere.

  17. Interaction of interstitial photodynamic therapy and interstitial hyperthermia in a rat rhabdomyosarcoma--a pilot study.

    PubMed

    Levendag, P C; Marijnissen, H P; de Ru, V J; Versteeg, J A; van Rhoon, G C; Star, W M

    1988-01-01

    Photodynamic therapy (PDT) involves the activation of photosensitizing drugs by light of appropriate wavelength. The photosensitive agent Hematoporphyrin Derivative (HPD) appears to be preferentially retained in malignant tumors; irradiation of HPD-containing tissue by light of appropriate wavelength (625 nm) and dose leads to (tumor) tissue destruction. The aim of this study is to achieve maximum tumor control probability with minimum normal tissue photosensitivity. In previous work from our laboratory it has been demonstrated that PDT has its fundamental effects on the tumor and normal tissue microcirculation. As it is well established that hyperthermia (HT) has its major effects in less well vascularized areas of the tumor, the combined modality of HT and PDT might prove to be advantageous. Moreover, suppression of sublethal damage repair by HT has been observed. To overcome the problem of poor light penetration into tissues and the high rate of recurrences following PDT with external irradiation, the combined effects of interstitial PDT with interstitial hyperthermia in a new line of animal experiments were studied in our laboratory. An experimental murine tumor (Rhabdomyosarcoma, type R-1) was transplanted in WAG/Rij rats and, after reaching an average diameter of 2 cm, the active component of HPD, that is Photofrin II, was injected intravenously in different dose schedules (5 mg/kg, 10 mg/kg). After 24 or 48 hrs the tumors were implanted with four flexible catheters, through which either light or heat could be applied. Light was obtained from an Argon-Dye laser system tuned to a wavelength of 625 nm at a dose rate of 75-100 mW per fiber to a dose level of 900 Joule from four linear light applicators. Heat (44 degrees C/30') was delivered by four 27 MHz radiofrequency antennas. Dose response relationships for PDT alone, HT alone and PDT combined with HT were established with cure as endpoint. This study showed that these two modalities, in the proper sequence

  18. Connective tissue disease-associated interstitial pneumonia and idiopathic interstitial pneumonia: similarity and difference.

    PubMed

    Bryson, Thomas; Sundaram, Baskaran; Khanna, Dinesh; Kazerooni, Ella A

    2014-02-01

    Interstitial lung diseases (ILDs) are increasingly recognized in patients with systemic diseases. Patients with early ILD changes may be asymptomatic. Features of ILD overlap among systemic diseases and with idiopathic variety. High-resolution computed tomography plays a central role in diagnosing ILDs. Imaging features are often nonspecific. Therapy- and complication-related lung changes would pose difficulty in diagnosing and classifying an ILD. Biology and prognosis of secondary ILDs may differ between different disease-related ILDs and idiopathic variety. Combination of clinical features, serological tests, pulmonary and extrapulmonary imaging findings, and pathology findings may help to diagnose ILDs. PMID:24480141

  19. Interstitial Fluid Colloid Osmotic Pressure in Healthy Children

    PubMed Central

    Guthe, Hans Jørgen Timm; Indrebø, Marianne; Nedrebø, Torbjørn; Norgård, Gunnar; Wiig, Helge; Berg, Ansgar

    2015-01-01

    Objective The colloid osmotic pressure (COP) of plasma and interstitial fluid play important roles in transvascular fluid exchange. COP values for monitoring fluid balance in healthy and sick children have not been established. This study set out to determine reference values of COP in healthy children. Materials and Methods COP in plasma and interstitial fluid harvested from nylon wicks was measured in 99 healthy children from 2 to 10 years of age. Nylon wicks were implanted subcutaneously in arm and leg while patients were sedated and intubated during a minor surgical procedure. COP was analyzed in a colloid osmometer designed for small fluid samples. Results The mean plasma COP in all children was 25.6 ± 3.3 mmHg. Arbitrary division of children in four different age groups, showed no significant difference in plasma or interstitial fluid COP values for patients less than 8 years, whereas patients of 8-10 years had significant higher COP both in plasma and interstitial fluid. There were no gender difference or correlation between COP in interstitial fluid sampled from arm and leg and no significant effect on interstitial COP of gravity. Prolonged implantation time did not affect interstitial COP. Conclusion Plasma and interstitial COP in healthy children are comparable to adults and COP seems to increase with age in children. Knowledge of the interaction between colloid osmotic forces can be helpful in diseases associated with fluid imbalance and may be crucial in deciding different fluid treatment options. Trial Registration ClinicalTrials.gov NCT01044641 PMID:25853713

  20. Interstitial granulomatous dermatitis: rare cutaneous manifestation of rheumatoid arthritis*

    PubMed Central

    Veronez, Isis Suga; Dantas, Fernando Luiz; Valente, Neusa Yuriko; Kakizaki, Priscila; Yasuda, Thaís Helena; Cunha, Thaís do Amaral

    2015-01-01

    Besides being an uncommon clinicopathological entity, interstitial granulomatous dermatitis, also described as interstitial granulomatous dermatitis with arthritis (IGDA), has shown a wide spectrum of clinical manifestations, such as linear and erythematous lesions, papules, plaques and nodules. Histological features include dense dermal histiocytic infiltrate, usually in a palisade configuration, and scattered neutrophils and eosinophils. We describe a middle aged woman with rheumatoid arthritis of difficult management and cutaneous lesions compatible with IGDA. PMID:26131871

  1. Computer Simulations of Interstitial Loop Growth Kinetics in irradiated bcc Fe

    SciTech Connect

    Li, Yulan; Hu, Shenyang Y.; Henager, Charles H.; Deng, Huiqiu; Gao, Fei; Sun, Xin; Khaleel, Mohammad A.

    2012-08-01

    The growth kinetics of (001) [001] interstitial loops in bcc Fe is studied by phase-field modeling. The effect of defect (vacancy/interstitial) concentration, generation, recombination, sink strength, and elastic interaction on the growth kinetics of interstitial loops is systematically simulated. Results show that the elastic interaction between the defects and interstitial loops speeds up the growth kinetics and affects the morphology of the interstitial loops. Linear growth rate, i.e., the loop average radius is linear to time, under both aging and irradiation are predicted, which is in agreement with experimental observation. The results also show that the interstitial loop growth rate, which is directly related to the sink strength of the interstitial loop for interstitials, increases linearly with the initial interstitial concentration during aging while changing logarithmically with the interstitial generation rate under irradiation.

  2. Interstitial fluid flow of alveolar primary septa after pneumonectomy.

    PubMed

    Haber, Shimon; Weisbord, Michal; Mishima, Michiaki; Mentzer, Steve J; Tsuda, Akira

    2016-07-01

    Neoalveolation is known to occur in the remaining lung after pneumonectomy. While compensatory lung growth is a complex process, stretching of the lung tissue appears to be crucial for tissue remodeling. Even a minute shear stress exerted on fibroblasts in the interstitial space is known to trigger cell differentiation into myofibroblast that are essential to building new tissues. We hypothesize that the non-uniform motion of the primary septa due to their heterogeneous mechanical properties under tidal breathing induces a spatially unique interstitial flow and shear stress distribution in the interstitial space. This may in turn trigger pulmonary fibroblast differentiation and neoalveolation. In this study, we developed a theoretical basis for how cyclic motion of the primary septal walls with heterogeneous mechanical properties affects the interstitial flow and shear stress distribution. The velocity field of the interstitial flow was expressed by a Fourier (complex) series and its leading term was considered to induce the basic structure of stress distribution as long as the dominant length scale of heterogeneity is the size of collapsed alveoli. We conclude that the alteration of mechanical properties of the primary septa caused by pneumonectomy can develop a new interstitial flow field, which alters the shear stress distribution. This may trigger the differentiation of resident fibroblasts, which may in turn induce spatially unique neoalveolation in the remaining lung. Our example illustrates that the initial forming of new alveoli about half the size of the original ones. PMID:27049045

  3. Idiopathic interstitial pneumonias: progress in classification, diagnosis, pathogenesis and management.

    PubMed Central

    King, Talmadge E.

    2004-01-01

    The idiopathic interstitial pneumonias are a heterogeneous group of poorly understood diseases with often devastating consequences for those afflicted. Subclassification of the idiopathic interstitial pneumonia based on clinical-radiological-pathological criteria has highlighted important pathogenic, therapeutic and prognostic implications. The most critical distinction is the presence of usual interstitial pneumonia, the histopathological pattern seen in idiopathic pulmonary fibrosis. Idiopathic pulmonary fibrosis has a worse response to therapy and prognosis. New insight into the pathophysiology of usual interstitial pneumonia suggests a distinctly fibroproliferative process, and antifibrotic therapies show promise. While the clinical and radiographic diagnosis of idiopathic interstitial pneumonias can be made confidently in some cases, many patients require surgical lung biopsy to determine their underlying histopathology. A structured, clinical-radiological-pathological approach to the diagnosis of the idiopathic interstitial pneumonias, with particular attention to the identification of idiopathic pulmonary fibrosis, insures proper therapy, enhances prognostication, and allows for further investigation of therapies aimed at distinct pathophysiology. Images Fig. 2 Fig. 4 Fig. 5 Fig. 6 PMID:17060957

  4. A baseline measure of tree and gastropod biodiversity in replanted and natural mangrove stands in malaysia: langkawi island and sungai merbok.

    PubMed

    Hookham, Brenda; Shau-Hwai, Aileen Tan; Dayrat, Benoit; Hintz, William

    2014-08-01

    THE DIVERSITIES OF MANGROVE TREES AND OF THEIR ASSOCIATED GASTROPODS WERE ASSESSED FOR TWO MANGROVE REGIONS ON THE WEST COAST OF PENINSULAR MALAYSIA: Langkawi Island and Sungai Merbok. The mangrove area sampled on Langkawi Island was recently logged and replanted, whereas the area sampled in Sungai Merbok was part of a protected nature reserve. Mangrove and gastropod diversity were assessed in four 50 m(2) (10 × 5 m) sites per region. The species richness (S), Shannon Index (H') and Evenness Index (J') were calculated for each site, and the mean S, H' and J' values were calculated for each region. We report low tree and gastropod S, H' and J' values in all sites from both regions. For Langkawi Island, the mean S, H' and J' values for mangrove trees were S = 2.00±0, H' = 0.44±0.17 and J' = 0.44±0.17; the mean S, H' and J' values for gastropods were S = 4.00±1.63, H' = 0.96±0.41 and J' = 0.49±0.06. In Sungai Merbok, the mean S, H' and J' values for mangrove trees were S = 1.33±0.58, H' = 0.22±0.39 and J' = 0.22 ±0.39; the mean S, H' and J' values for gastropods were S = 4.75±2.22, H' = 1.23±0.63 and J' = 0.55±0.12. This study emphasises the need for baseline biodiversity measures to be established in mangrove ecosystems to track the impacts of anthropogenic disturbances and to inform management and restoration efforts. PMID:25210584

  5. A Baseline Measure of Tree and Gastropod Biodiversity in Replanted and Natural Mangrove Stands in Malaysia: Langkawi Island and Sungai Merbok

    PubMed Central

    Hookham, Brenda; Shau-Hwai, Aileen Tan; Dayrat, Benoit; Hintz, William

    2014-01-01

    The diversities of mangrove trees and of their associated gastropods were assessed for two mangrove regions on the west coast of Peninsular Malaysia: Langkawi Island and Sungai Merbok. The mangrove area sampled on Langkawi Island was recently logged and replanted, whereas the area sampled in Sungai Merbok was part of a protected nature reserve. Mangrove and gastropod diversity were assessed in four 50 m2 (10 × 5 m) sites per region. The species richness (S), Shannon Index (H’) and Evenness Index (J’) were calculated for each site, and the mean S, H’ and J’ values were calculated for each region. We report low tree and gastropod S, H’ and J’ values in all sites from both regions. For Langkawi Island, the mean S, H’ and J’ values for mangrove trees were S = 2.00±0, H’ = 0.44±0.17 and J’ = 0.44±0.17; the mean S, H’ and J’ values for gastropods were S = 4.00±1.63, H’ = 0.96±0.41 and J’ = 0.49±0.06. In Sungai Merbok, the mean S, H’ and J’ values for mangrove trees were S = 1.33±0.58, H’ = 0.22±0.39 and J’ = 0.22 ±0.39; the mean S, H’ and J’ values for gastropods were S = 4.75±2.22, H’ = 1.23±0.63 and J’ = 0.55±0.12. This study emphasises the need for baseline biodiversity measures to be established in mangrove ecosystems to track the impacts of anthropogenic disturbances and to inform management and restoration efforts. PMID:25210584

  6. P/Ca in Gastropod Shells as a Nutrient Proxy in Tropical Marine Environments

    NASA Astrophysics Data System (ADS)

    Grossman, E. L.; Tao, K.; Robbins, J.; O'Dea, A.

    2013-12-01

    Nutrient status and its stability play key roles in the maintenance of marine ecosystems, both in modern and ancient oceans. Modern coral reef communities in the Caribbean are being threatened by anthropogenic input of nutrients whereas one to two million years ago, communities in this same region experienced dramatic overturn of corals and mollusks with the uplift of the Central American Isthmus and subsequent reduction of upwelling-derived nutrients. Thus the ability to record past and present nutrient delivery is paramount for understanding the role of environmental change in controlling past and future biodiversity. To test trace element chemistries in gastropod shells as nutrient proxies, we measured the trace element (Mg, Sr, Ba, Mn, Fe, P, and U ) and stable isotopic (δ18O, δ13C) compositions of 11 modern Conus specimens collected from upwelling and non-upwelling regions in the Caribbean and Pacific coasts of Panama. Four Caribbean shells represent non-upwelling conditions, while seven Pacific shells record conditions of seasonal upwelling (Gulf of Panama) or shoaling of the thermocline (Gulf of Chiriquí). Shells were serially sampled around the spire at 2-3 mm intervals, providing roughly monthly resolution. Shallow-dwelling Pacific specimens show large seasonal range in δ18O (>2‰) reflecting upwelling during the dry season and freshening during the rainy season. In contrast, shallow-dwelling Caribbean specimens show small δ18O range (mostly ≤1‰) indicating limited seasonal upwelling and freshening. For trace element analyses, about 100 μg of carbonate powder was dissolved in 2 ml of 2% HNO3 and analyzed on a high resolution, inductively-coupled plasma mass spectrometer (HR-ICP-MS). Among the wide array of trace elements analyzed, only Sr/Ca shows a significant correlation with upwelling intervals, as indicated by high δ18O. This reflects the positive relationship between Sr/Ca and temperature in Conus shells (Sosdian et al., 2006, G3, Q11023

  7. Interstitial thermotherapy with bipolar electrosurgical devices

    NASA Astrophysics Data System (ADS)

    Desinger, Kai; Stein, Thomas; Boehme, A.; Mack, Martin G.; Mueller, Gerhard J.

    1998-01-01

    In addition to the laser, microwave or other energy sources, interstitial thermotherapy with radio-frequency current (RFITT) in bipolar technique has already been shown in vitro to be a safe and economical alternative energy source with a comparable operating performance. The bipolar technique is, from the technical point of view, completely without risk whereas with monopolar devices, where a neutral electrode has to be applied, an uncontrolled current flow passes through the patient's body. The therapeutical application efficiency of these bipolar RF-needle applicators was evaluated using newly designed high performance flushed and cooled probes (qq 3 mm). These can be used to create large coagulation volumes in tissue such as for the palliative treatment of liver metastases or the therapy of the benign prostate hyperplasia. As a result, the achievable lesion size resulting from these flushed and internally cooled RF- probes could be increased by a factor of three compared to a standard bipolar probe. With these bipolar power RF- applicators, coagulation dimensions of 5 cm length and 4 cm diameter with a power input of 40 watt could be achieved within 20 minutes. No carbonization and electrode tissue adherence was found. Investigations in vitro with adapted RFITT-probes using paramagnetic materials such as titanium alloys and high performance plastic have shown that monitoring under MRI (Siemens Magnetom, 1.5 Tesla), allows visualization of the development of the spatial temperature distribution in tissue using an intermittent diagnostic and therapeutical application. This does not lead to a loss in performance compared to continuous application. A ratio of 1:4 (15 s Thermo Flash MRI, 60 s RF-energy) has shown to be feasible.

  8. [Respiratory bronchiolitis-associated interstitial lung disease (RB-ILD)].

    PubMed

    Goeckenjan, G

    2003-05-01

    Respiratory bronchiolitis-associated interstitial lung disease (RB-ILD) designates interstitial lung changes in smokers, characterized histologically by bronchiolocentric accumulation of pigmented alveolar macrophages and fibrotic or cellular inflammatory changes of pulmonary interstitium. The definition is nearly identical to that of condensate pneumopathy, smoker's pneumopathy or smoker's lung, defined by accumulation of pigmented alveolar macrophages with bland alveoloseptal or peribronchial fibrosis and cellular inflammation of the bronchial wall. In addition to respiratory bronchiolitis, which is found in nearly all smokers, RB-ILD comprises a broad spectrum of varying degrees of the interstitial reaction to the exogenous injury of inhalation smoking with gradual transition to desquamative interstitial pneumonia (DIP). In most cases RB-ILD manifestations are subclinical and detected coincidentally. Radiographic features are reticulonodular and ground glass opacities of the lung. The high resolution computed tomography reveals centrilobular nodules, ground glass opacities, thickening of bronchial walls, and in some cases a reticular pattern. Mild emphysema is frequent. Lung function analysis reveals only minor restrictive or obstructive defects in most cases, often combined with hyperinflation. CO diffusing capacity is slightly to moderately impaired. Pronounced interstitial lung diseases with serious restrictive defects and arterial hypoxemia have been reported infrequently. In differential diagnosis smoking related interstitial lung diseases (DIP, Langerhans cell histiocytosis, idiopathic pulmonary fibrosis) and other interstitial lung diseases have to be excluded. In most cases diagnosis can be achieved by bronchoalveolar lavage and transbronchial lung biopsy. In cases of pronounced interstitial lung disease or assumption of an additional interstitial lung disease besides RB-ILD a thoracoscopic or open lung biopsy can be necessary. RB-ILD has a favourable

  9. Effects of temperature and salinity on emergence of Gynaecotyla adunca cercariae from the intertidal gastropod Ilyanassa obsoleta.

    PubMed

    Koprivnikar, J; Ellis, D; Shim, K C; Forbes, M R

    2014-04-01

    Fluctuating abiotic conditions within intertidal zones have been shown to affect the emergence of free-swimming trematode infectious stages (cercariae) from their gastropod first intermediate hosts, likely reflecting adaptations to maximize transmission in this marine environment. We investigated the influences of temperature (17 and 22 C) and salinity (25, 30, and 35 ppt) on the emergence of marine cercariae (Gynaecotyla adunca) from their mud snail first intermediate host ( Ilyanassa obsoleta ). Cercariae emerged in greater numbers at 22 C and the 2 lowest salinities, with a sharp decrease at the 35 ppt level, but there was no interactive effect. We discuss these patterns of G. adunca emergence as possible adaptations to facilitate transmission to its amphipod second intermediate host ( Corophium volutator ) in conditions common to the Upper Bay of Fundy. PMID:24294898

  10. Assessment of heavy metal contamination in intertidal gastropod and bivalve shells from central Arabian Gulf coastline, Saudi Arabia

    NASA Astrophysics Data System (ADS)

    El-Sorogy, Abdelbaset S.; Youssef, Mohamed

    2015-11-01

    In order to assess pollutants and impact of environmental changes along the Saudi Arabian Gulf coast, forty specimens of gastropod and bivalve shells belonging to Diodora funiculata, Lunella coronata, Cerithium caeruleum, Barbatia parva, Pinctada margaritifera, Amiantis umbonella, Acrosterigma assimile and Asaphis violascens from five localities are selected for Fe, Cu, Pb, Mn, Cd, Se, As, Co, B, Cr, Hg, Mo analysis. The analysis indicated that heavy metal values (except Fe) were less than those recorded in molluscan shells from Gulf of Oman, Red Sea and Indian Ocean. D. funiculate, L. coronata, B. parva and P. margaritifera are good accumulators of Cu, As, Cr. The other species gave a nearly constant concentration in all the studied areas. Al Jubail coast recorded the highest heavy metal concentrations (except Mn at Ras Al-Ghar and Se at Al Jubail industrial city). Heavy metal contamination is mostly attributed to anthropogenic sources, especially effluents from petrochemical industries, sewage and desalination plants.

  11. Mechanism of a plastic phenotypic response: predator-induced shell thickening in the intertidal gastropod Littorina obtusata.

    PubMed

    Brookes, J I; Rochette, Rémy

    2007-05-01

    Phenotypic plasticity has been the object of considerable interest over the past several decades, but in few cases are mechanisms underlying plastic responses well understood. For example, it is unclear whether predator-induced changes in gastropod shell morphology represent an active physiological response or a by-product of reduced feeding. We address this question by manipulating feeding and growth of intertidal snails, Littorina obtusata, using two approaches: (i) exposure to predation cues from green crabs Carcinus maenas and (ii) reduced food availability, and quantifying growth in shell length, shell mass, and body mass, as well as production of faecal material and shell micro-structural characteristics (mineralogy and organic fraction) after 96 days. We demonstrate that L. obtusata actively increases calcification rate in response to predation threat, and that this response entails energetic and developmental costs. That this induced response is not strictly tied to the animal's behaviour should enhance its evolutionary potential. PMID:17465912

  12. [SPECTRAL AND ACID-BASE PROPERTIES OF HEMOLYMPH PLASMA AND ITS FRACTIONS FROM GASTROPOD PULMONATE MOLLUSC ACHATINA FULICA].

    PubMed

    Petrova, T A; Lianguzov, A Yu; Malygina, N M

    2016-01-01

    The set of normal biochemical indicators of the hemolymph plasma of gastropod pulmonate mollusc Achatinafulica is described. Comparative analysis of the whole plasma and its subfractions enriched and depleted of oxygen-carrying protein hemocyanin was performed by spectrophotometry and spectrofluorimetry methods. Individual features of the absorption spectra were analyzed using fourth derivatives. The optimum method for estimating protein concentration was chosen. To characterize acid-base properties of plasma hemolymph and its sub-fractions we calculated buffer capacity, equivalence points and pK values of dominant buffer groups. It is shown that the major role in maintaining the buffer capacity of hemolymph belongs to the bicarbonate system. These results are compared with data for Helix pomatia available in literature. In the future the indicators studied in this work will be used to develop ecotoxicological criteria for the environmental assessment. PMID:27220238

  13. Assembly processes of gastropod community change with horizontal and vertical zonation in ancient Lake Ohrid: a metacommunity speciation perspective

    NASA Astrophysics Data System (ADS)

    Hauffe, Torsten; Albrecht, Christian; Wilke, Thomas

    2016-05-01

    The Balkan Lake Ohrid is the oldest and most diverse freshwater lacustrine system in Europe. However, it remains unclear whether species community composition, as well as the diversification of its endemic taxa, is mainly driven by dispersal limitation, environmental filtering, or species interaction. This calls for a holistic perspective involving both evolutionary processes and ecological dynamics, as provided by the unifying framework of the "metacommunity speciation model".The current study used the species-rich model taxon Gastropoda to assess how extant communities in Lake Ohrid are structured by performing process-based metacommunity analyses. Specifically, the study aimed (1) to identifying the relative importance of the three community assembly processes and (2) to test whether the importance of these individual processes changes gradually with lake depth or discontinuously with eco-zone shifts.Based on automated eco-zone detection and process-specific simulation steps, we demonstrated that dispersal limitation had the strongest influence on gastropod community composition. However, it was not the exclusive assembly process, but acted together with the other two processes - environmental filtering and species interaction. The relative importance of the community assembly processes varied both with lake depth and eco-zones, though the processes were better predicted by the latter.This suggests that environmental characteristics have a pronounced effect on shaping gastropod communities via assembly processes. Moreover, the study corroborated the high importance of dispersal limitation for both maintaining species richness in Lake Ohrid (through its impact on community composition) and generating endemic biodiversity (via its influence on diversification processes). However, according to the metacommunity speciation model, the inferred importance of environmental filtering and biotic interaction also suggests a small but significant influence of ecological

  14. Evolutionary Dynamics in the Southwest Indian Ocean Marine Biodiversity Hotspot: A Perspective from the Rocky Shore Gastropod Genus Nerita

    PubMed Central

    Postaire, Bautisse; Bruggemann, J. Henrich; Magalon, Hélène; Faure, Baptiste

    2014-01-01

    The Southwest Indian Ocean (SWIO) is a striking marine biodiversity hotspot. Coral reefs in this region host a high proportion of endemics compared to total species richness and they are particularly threatened by human activities. The island archipelagos with their diverse marine habitats constitute a natural laboratory for studying diversification processes. Rocky shores in the SWIO region have remained understudied. This habitat presents a high diversity of molluscs, in particular gastropods. To explore the role of climatic and geological factors in lineage diversification within the genus Nerita, we constructed a new phylogeny with an associated chronogram from two mitochondrial genes [cytochrome oxidase sub-unit 1 and 16S rRNA], combining previously published and new data from eight species sampled throughout the region. All species from the SWIO originated less than 20 Ma ago, their closest extant relatives living in the Indo-Australian Archipelago (IAA). Furthermore, the SWIO clades within species with Indo-Pacific distribution ranges are quite recent, less than 5 Ma. These results suggest that the regional diversification of Nerita is closely linked to tectonic events in the SWIO region. The Reunion mantle plume head reached Earth’s surface 67 Ma and has been stable and active since then, generating island archipelagos, some of which are partly below sea level today. Since the Miocene, sea-level fluctuations have intermittently created new rocky shore habitats. These represent ephemeral stepping-stones, which have likely facilitated repeated colonization by intertidal gastropods, like Nerita populations from the IAA, leading to allopatric speciation. This highlights the importance of taking into account past climatic and geological factors when studying diversification of highly dispersive tropical marine species. It also underlines the unique history of the marine biodiversity of the SWIO region. PMID:24736639

  15. Ecosystem Alterations and Species Range Shifts: An Atlantic-Mediterranean Cephalaspidean Gastropod in an Inland Egyptian Lake.

    PubMed

    Cruz-Rivera, Edwin; Malaquias, Manuel António E

    2016-01-01

    The eastern Atlantic and Mediterranean marine Cephalaspidea gastropod Haminoea orbignyana was collected from Lake Qarun (Fayoum, Egypt), a landlocked lake that has undergone a shift from freshwater to estuarine conditions in the past 100 years. Species identity was confirmed by both morphological (anatomical dissection and scanning electron microscopy) and molecular methods (COI gene phylogeny). Observations suggested a robust population of H. orbignyana in the lake with a density of ca. 64 individuals/m2 and ca. 105 egg masses/m2 during surveys conducted in the summer of 2013. The vast majority of snails and egg masses were found under rocks. Observations of egg masses in the lab showed a gradual change from whitish to yellow-green as the eggs matured and the release of veliger larvae alone after about a week. Although adult cephalaspideans readily consumed filamentous red and green algae, and cyanobacteria, laboratory trials showed that they consumed significantly more of the red alga Ceramium sp., than of the green alga Cladophora glomerata, with consumption of Oscillatoria margaritifera being similar to those on the two algae. When grown on these resources for 16 days, H. orbignyana maintained their mass on the rhodophyte and cyanobacterium, but not in starvation controls. No cephalaspideans grew over the course of this experiment. Lake Qarun has been periodically restocked with Mediterranean fishes and prawns since the 1920s to maintain local fisheries, which represents a possible route of colonization for H. orbignyana. Yet, based on literature records, it seems more likely that invasion of the lake by this gastropod species has occurred only within the last 20 years. As human activities redistribute species through direct and indirect means, the structure of the community of this inland lake has become unpredictable and the long-term effects of these recent introductions are unknown. PMID:27248835

  16. The use of the marine gastropod, Cellana tramoserica, as a biomonitor of metal contamination in near shore environments.

    PubMed

    Maher, W; Maher, N; Taylor, A; Krikowa, F; Ubrihien, R; Mikac, K M

    2016-07-01

    The use of the marine gastropod, Cellana tramoserica, as a biomonitor of metal exposure was investigated. The factors influencing metal concentrations, such as mass, gender, substrate, shoreline position and temporal variation were examined. Tissue metal concentrations were mostly found to be independent of mass and gender. When metal concentrations were significantly correlated with mass, correlations were low and explained little variability. The underlying substrate and position in the littoral zone had only a small influence on metal concentrations. Variation between individuals, inherent variability due to genetic variability, was the most significant contribution to the overall variation in metal concentrations, resulting in positive skewing of population distributions. The mean metal concentrations varied temporally; metal masses were relatively constant with fluctuations in metal concentrations related to fluctuations in metal body burdens. The populations from a metal-contaminated site had significantly higher tissue Cu, Zn, As and Pb concentrations than the populations from relatively uncontaminated locations. C. tramoserica therefore can be considered to be a net accumulator of metals. A sample number of >10 is required to detect changes of 25 % from the mean concentrations at uncontaminated locations. This species meets the requirements of a suitable biomonitor for metal contaminants in the environment i.e. hardy, sessile, widespread, sufficient tissue mass and a metal accumulator. As the measurement of metal concentrations in C. tramesoria were influenced by substrate and shore position and, sometimes, mass, sites with similar substrates and organisms of similar mass and shoreline position should be chosen for comparison. When comparing metal concentrations in gastropods from different locations, they should be collected over the same period to minimise variability due to mass differences, spawning and other seasonal/temporal effects. PMID:27262969

  17. Ecosystem Alterations and Species Range Shifts: An Atlantic-Mediterranean Cephalaspidean Gastropod in an Inland Egyptian Lake

    PubMed Central

    Malaquias, Manuel António E.

    2016-01-01

    The eastern Atlantic and Mediterranean marine Cephalaspidea gastropod Haminoea orbignyana was collected from Lake Qarun (Fayoum, Egypt), a landlocked lake that has undergone a shift from freshwater to estuarine conditions in the past 100 years. Species identity was confirmed by both morphological (anatomical dissection and scanning electron microscopy) and molecular methods (COI gene phylogeny). Observations suggested a robust population of H. orbignyana in the lake with a density of ca. 64 individuals/m2 and ca. 105 egg masses/m2 during surveys conducted in the summer of 2013. The vast majority of snails and egg masses were found under rocks. Observations of egg masses in the lab showed a gradual change from whitish to yellow-green as the eggs matured and the release of veliger larvae alone after about a week. Although adult cephalaspideans readily consumed filamentous red and green algae, and cyanobacteria, laboratory trials showed that they consumed significantly more of the red alga Ceramium sp., than of the green alga Cladophora glomerata, with consumption of Oscillatoria margaritifera being similar to those on the two algae. When grown on these resources for 16 days, H. orbignyana maintained their mass on the rhodophyte and cyanobacterium, but not in starvation controls. No cephalaspideans grew over the course of this experiment. Lake Qarun has been periodically restocked with Mediterranean fishes and prawns since the 1920s to maintain local fisheries, which represents a possible route of colonization for H. orbignyana. Yet, based on literature records, it seems more likely that invasion of the lake by this gastropod species has occurred only within the last 20 years. As human activities redistribute species through direct and indirect means, the structure of the community of this inland lake has become unpredictable and the long-term effects of these recent introductions are unknown. PMID:27248835

  18. The role of vermetid gastropods in the development of the Florida Middle Ground, northeast Gulf of Mexico

    USGS Publications Warehouse

    Reich, Christopher D.; Poore, Richard Z.; Hickey, Todd D.

    2013-01-01

    The Florida Middle Ground is a complex of north to northwest trending ridges that lie approximately 180 km northwest of Tampa Bay, Florida. The irregular ridges appear on the otherwise gently sloping West Florida shelf and exhibit between 10-15 m of relief. Modern studies interpret the ridges as remnants of a Holocene coral-reef buildup that today provide a hard substrate for growth of a variety of benthic organisms including hydrocorals, scleractinians, alcyonarians, and algae. Recent rotary coring reveals that the core of the eastern ridge of the Florida Middle Ground complex consists of unconsolidated marine calcareous muddy sand that is capped by a boundstone composed primarily of the sessile vermetid gastropod Petaloconchus sp., and overlays a weathered, fossiliferous limestone. Accelerator Mass Spectrometry radiocarbon ages (uncalibrated) on the 3.6-m thick vermetid worm rock indicate that it developed during a sea-level stillstand in the early Holocene (8,225 ±30-8,910 ± 25 yr B.P.). Our observations suggest that the Florida Middle Ground is a remnant of a series of shore parallel bars that formed in the early Holocene and were capped by a 3.6-m thick unit of vermetid gastropods. During a rapid sea-level rise that began ~8,000 yr B.P. the vermetids growth ceased and the worm rock preserved the ridges structure. Diver observations document that the edges of the ridges are currently being eroded and undermined by biological activity and current action, leading to calving of large capstone blocks.

  19. Fossil gastropods from the Indian Upper Siwaliks and their stable carbon and oxygen isotope values indicate presence of cold climatic conditions in the Early Pleistocene.

    NASA Astrophysics Data System (ADS)

    Singh Kotla, Simran

    2016-04-01

    The Early Pleistocene in general is characterized by widespread glaciations in the Northern Hemisphere. Early to Middle Pleistocene freshwater Pinjor Formation (Upper Siwalik) exposed all along the Himalayan Foothills preserves a diverse faunal and floral assemblage. We carried out paleontological (gastropods) and stable isotope (carbon and oxygen isotope) studies of a 6 m thick swamp/pond deposit (that represents ~ 12,000 yrs) of Pinjor Formation, exposed near the Village Nadah, Panchkula (Haryana) and dated to ~ 1.8 Ma (Azzaroli and Napoleon,1982). We have identified four gastropod species in the assemblage, Lymnae sp., Gyraulus sp., Viviparous bengalensis and Hippeutis complantus. The first two are widespread throughout the globe. Lymnae can exist in temperature range of 19 to 24 ° C and occur in Palearctic and Neoartic regions (animalbase.org). Gyraulus occur in Holoarctic region with temperature ranging from 17.8 to 30 ° C (animalbase.org, theaquariumwiki.com), whereas Viviparous bengalensis typically exists in the Oriental region suggesting an overall warm and humid condition (Moore,1997). Hippeutis complantus on the other hand exists in palearctic regions upto 63 ° N (Aplinarska and Cisewka 2006) under cold (6 ° to 23.3 ° C) and dry climatic conditions (Spyra., 2014).The powdered gastropod shell samples were analyzed using Continues Flow Isotope Ratio Mass Spectrometer (CF-IRMS) at the Wadia Institute of Himalayan Geology, Dehradun, India. The δ13C values of gastropod shells fall between -2.56‰ and 6.14‰ VPDB and suggest the dominance of C4 vegetation. The δ18O value of gastropod shell fall between -0.64‰ and -7.80‰ VPDB, suggesting fluctuation of climate between warm and cold conditions . Presence of Hippeutis complantus may suggest the extension of palearctic region up to Panchkula (Haryana, India) in the Early Pleistocene which presently lies in the Oriental Province. Therefore, our results indicate that the overall climatic condition

  20. Characterisation of patients with interstitial pneumonia with autoimmune features.

    PubMed

    Oldham, Justin M; Adegunsoye, Ayodeji; Valenzi, Eleanor; Lee, Cathryn; Witt, Leah; Chen, Lena; Husain, Aliya N; Montner, Steven; Chung, Jonathan H; Cottin, Vincent; Fischer, Aryeh; Noth, Imre; Vij, Rekha; Strek, Mary E

    2016-06-01

    Patients with interstitial lung disease (ILD) may have features of connective tissue disease (CTD), but lack findings diagnostic of a specific CTD. A recent European Respiratory Society/American Thoracic Society research statement proposed criteria for patients with interstitial pneumonia with autoimmune features (IPAF).We applied IPAF criteria to patients with idiopathic interstitial pneumonia and undifferentiated CTD-ILD (UCTD). We then characterised the clinical, serological and morphological features of the IPAF cohort, compared outcomes to other ILD cohorts and validated individual IPAF domains using survival as an endpoint.Of 422 patients, 144 met IPAF criteria. Mean age was 63.2 years with a slight female predominance. IPAF cohort survival was marginally better than patients with idiopathic pulmonary fibrosis, but worse than CTD-ILD. A non-usual interstitial pneumonia pattern was associated with improved survival, as was presence of the clinical domain. A modified IPAF cohort of those meeting the clinical domain and a radiographic or histological feature within the morphological domain displayed survival similar to those with CTD-ILD.IPAF is common among patients with idiopathic interstitial pneumonia and UCTD. Specific IPAF features can identify subgroups with differential survival. Further research is needed to replicate these findings and determine whether patients meeting IPAF criteria benefit from immunosuppressive therapy. PMID:27103387

  1. Interstitial pneumonitis after acetylene welding: a case report.

    PubMed

    Brvar, Miran

    2014-01-01

    Acetylene is a colorless gas commonly used for welding. It acts mainly as a simple asphyxiant. In this paper, however, we present a patient who developed a severe interstitial pneumonitis after acetylene exposure during aluminum welding. A 44-year old man was welding with acetylene, argon and aluminum electrode sticks in a non-ventilated aluminum tank for 2 h. Four hours after welding dyspnea appeared and 22 h later he was admitted at the Emergency Department due to severe respiratory insufficiency with pO2 = 6.7 kPa. Chest X-ray showed diffuse interstitial infiltration. Pulmonary function and gas diffusion tests revealed a severe restriction (55% of predictive volume) and impaired diffusion capacity (47% of predicted capacity). Toxic interstitial pneumonitis was diagnosed and high-dose systemic corticosteroid methylprednisolone and inhalatory corticosteroid fluticasone therapy was started. Computed Tomography (CT) of the lungs showed a diffuse patchy ground-glass opacity with no signs of small airway disease associated with interstitial pneumonitis. Corticosteroid therapy was continued for the next 8 weeks gradually reducing the doses. The patient's follow-up did not show any deterioration of respiratory function. In conclusion, acetylene welding might result in severe toxic interstitial pneumonitis that improves after an early systemic and inhalatory corticosteroid therapy. PMID:24658888

  2. Hermansky-Pudlak syndrome type 4 with interstitial pneumonia.

    PubMed

    Sakata, Yoshihiko; Kawamura, Kodai; Ichikado, Kazuya; Suga, Moritaka; Yoshioka, Masakazu

    2013-01-01

    Hermansky-Pudlak syndrome (HPS) is an autosomal recessive disorder characterized by oculocutaneous albinism, bleeding tendency, and lysosomal accumulation of ceroid-like material, with occasional development of interstitial pneumonia (IP). Nine genetically distinct subtypes of HPS are known in humans; IP develops primarily in types 1 and 4. Most reported cases of HPS with IP are type 1, and there are no published reports of type 4 in Japanese individuals. A 58-year-old man with congenital oculocutaneous albinism and progressive dyspnea for 1 month was admitted to our hospital. We administered high-dose corticosteroids on the basis of a diagnosis of acute exacerbation of interstitial pneumonia. Respiratory symptoms and the findings of high-resolution computed tomography (CT) showed improvement. He was diagnosed with HPS type 4 with interstitial pneumonia on the basis of gene analysis. He has been receiving pirfenidone for 1 year and his condition is stable. This is the first report on the use of pirfenidone for HPS with IP caused by a novel mutation in the HPS4 gene. We conclude that HPS should be suspected in patients with albinism and interstitial pneumonia. High-dose corticosteroid treatment may be useful in cases of acute exacerbation of interstitial pneumonia due to HPS-4, and pirfenidone may be useful and well tolerated in patients with HPS-4. PMID:26029628

  3. Lymphangiogenesis and Lesion Heterogeneity in Interstitial Lung Diseases

    PubMed Central

    Yamashita, Masahiro

    2015-01-01

    The lymphatic system has several physiological roles, including fluid homeostasis and the activation of adaptive immunity by fluid drainage and cell transport. Lymphangiogenesis occurs in adult tissues during various pathologic conditions. In addition, lymphangiogenesis is closely linked to capillary angiogenesis, and the balanced interrelationship between capillary angiogenesis and lymphangiogenesis is essential for maintaining homeostasis in tissues. Recently, an increasing body of information regarding the biology of lymphatic endothelial cells has allowed us to immunohistochemically characterize lymphangiogenesis in several lung diseases. Particular interest has been given to the interstitial lung diseases. Idiopathic interstitial pneumonias (IIPs) are characterized by heterogeneity in pathologic changes and lesions, as typified by idiopathic pulmonary fibrosis/usual interstitial pneumonia. In IIPs, lymphangiogenesis is likely to have different types of localized functions within each disorder, corresponding to the heterogeneity of lesions in terms of inflammation and fibrosis. These functions include inhibitory absorption of interstitial fluid and small molecules and maturation of fibrosis by excessive interstitial fluid drainage, caused by an unbalanced relationship between capillary angiogenesis and lymphangiogenesis and trafficking of antigen-presenting cells and induction of fibrogenesis via CCL21 and CCR7 signals. Better understanding for regional functions of lymphangiogenesis might provide new treatment strategies tailored to lesion heterogeneity in these complicated diseases. PMID:26823655

  4. Interstitial integrals in the multiple-scattering model

    SciTech Connect

    Swanson, J.R.; Dill, D.

    1982-08-15

    We present an efficient method for the evaluation of integrals involving multiple-scattering wave functions over the interstitial region. Transformation of the multicenter interstitial wave functions to a single center representation followed by a geometric projection reduces the integrals to products of analytic angular integrals and numerical radial integrals. The projection function, which has the value 1 in the interstitial region and 0 elsewhere, has a closed-form partial-wave expansion. The method is tested by comparing its results with exact normalization and dipole integrals; the differences are 2% at worst and typically less than 1%. By providing an efficient means of calculating Coulomb integrals, the method allows treatment of electron correlations using a multiple scattering basis set.

  5. Interstitial carbon formation in irradiated copper-doped silicon

    SciTech Connect

    Yarykin, N. A.; Weber, J.

    2015-06-15

    The influence of a copper impurity on the spectrum of defects induced in p-Si crystals containing a low oxygen concentration by irradiation with electrons with an energy of 5 MeV at room temperature is studied by deep-level transient spectroscopy. It is found that interstitial carbon atoms (C{sub i}) which are the dominant defects in irradiated samples free of copper are unobservable immediately after irradiation, if the concentration of mobile interstitial copper atoms (Cu{sub i}) is higher than the concentration of radiation defects. This phenomenon is attributed to the formation of (Cu{sub i}, C{sub i}) complexes, which do not introduce levels into the lower half of the band gap. It is shown that these complexes dissociate upon annealing at temperatures of 300–340 K and, thus, bring about the appearance of interstitial carbon.

  6. Improvement in idiopathic nonspecific interstitial pneumonia after smoking cessation.

    PubMed

    Shinohara, Tsutomu; Kadota, Naoki; Hino, Hiroyuki; Naruse, Keishi; Ohtsuki, Yuji; Ogushi, Fumitaka

    2015-01-01

    Although cigarette smoking has been recognized as a risk factor for the development of several interstitial lung diseases, the relationship between smoking and nonspecific interstitial pneumonia (NSIP) has not yet been fully elucidated. We here present a case of fibrotic NSIP with mild emphysema in an elderly male with normal pulmonary function, whose symptoms, serum KL-6 level, and high-resolution computed tomography findings of interstitial changes markedly improved without medication following the cessation of smoking. Our case suggests that smoking may be an etiological factor in some patients with NSIP and that early smoking cessation before a clinically detectable decline in pulmonary function may be critical for smokers with idiopathic NSIP. PMID:26029566

  7. Successful alectinib treatment after crizotinib-induced interstitial lung disease.

    PubMed

    Fujiuchi, Satoru; Fujita, Yuka; Sasaki, Takaaki; Ohsaki, Yoshinobu

    2016-05-01

    A 70-year-old woman with lung adenocarcinoma, harbouring anaplastic lymphoma kinase gene rearrangement, was treated with crizotinib as third-line chemotherapy. After 2 months, crizotinib was discontinued because of the development of crizotinib-induced interstitial lung disease (ILD). Steroid treatment was then introduced and tapered off. Following complete resolution of the interstitial shadow, cytotoxic chemotherapy was initiated, and continued for over 2 years, until new intrapulmonary lesions developed. Although there was a risk of drug-induced interstitial pneumonia, alectinib was initiated as the fifth-line therapy, without steroid supplementation, as there was no alternative treatment. No recurrence of ILD was noted at 10 months. To our knowledge, this is the first report of successful alectinib treatment after the development of crizotinib-induced ILD without the use of prednisolone. PMID:27516885

  8. Successful alectinib treatment after crizotinib‐induced interstitial lung disease

    PubMed Central

    Fujita, Yuka; Sasaki, Takaaki; Ohsaki, Yoshinobu

    2016-01-01

    Abstract A 70‐year‐old woman with lung adenocarcinoma, harbouring anaplastic lymphoma kinase gene rearrangement, was treated with crizotinib as third‐line chemotherapy. After 2 months, crizotinib was discontinued because of the development of crizotinib‐induced interstitial lung disease (ILD). Steroid treatment was then introduced and tapered off. Following complete resolution of the interstitial shadow, cytotoxic chemotherapy was initiated, and continued for over 2 years, until new intrapulmonary lesions developed. Although there was a risk of drug‐induced interstitial pneumonia, alectinib was initiated as the fifth‐line therapy, without steroid supplementation, as there was no alternative treatment. No recurrence of ILD was noted at 10 months. To our knowledge, this is the first report of successful alectinib treatment after the development of crizotinib‐induced ILD without the use of prednisolone. PMID:27516885

  9. Improvement in idiopathic nonspecific interstitial pneumonia after smoking cessation

    PubMed Central

    Shinohara, Tsutomu; Kadota, Naoki; Hino, Hiroyuki; Naruse, Keishi; Ohtsuki, Yuji; Ogushi, Fumitaka

    2014-01-01

    Although cigarette smoking has been recognized as a risk factor for the development of several interstitial lung diseases, the relationship between smoking and nonspecific interstitial pneumonia (NSIP) has not yet been fully elucidated. We here present a case of fibrotic NSIP with mild emphysema in an elderly male with normal pulmonary function, whose symptoms, serum KL-6 level, and high-resolution computed tomography findings of interstitial changes markedly improved without medication following the cessation of smoking. Our case suggests that smoking may be an etiological factor in some patients with NSIP and that early smoking cessation before a clinically detectable decline in pulmonary function may be critical for smokers with idiopathic NSIP. PMID:26029566

  10. Ulcerative colitis and steroid-responsive, diffuse interstitial lung disease

    SciTech Connect

    Balestra, D.J.; Balestra, S.T.; Wasson, J.H.

    1988-07-01

    The authors describe a patient with ulcerative colitis and extracolonic manifestations in whom diffuse interstitial pulmonary disease developed that was responsive to glucocorticoid therapy one year after total proctocolectomy. The patient presented in December 1983 with a subacute course marked by cough and progressive exertional dyspnea, abnormal chest examination results, and a chest roentgenogram that revealed diffuse interstitital and alveolar infiltrates. A transbronchial biopsy specimen revealed a polymorphic interstitial infiltrate, mild interstitial fibrosis without apparent intraluminal fibrosis, and no vasculitis, granulomas, or significant eosinophilic infiltration. Within one week of the initiation of daily high-dose steroid therapy, the patient's symptoms dramatically improved; chest roentgenogram and forced vital capacity (60%) improved at a slower rate. All three measures deteriorated when alternate-day prednisone therapy was started but once again improved until the patient was totally asymptomatic, chest roentgenograms were normal, and forced vital capacity was 80% of the predicted value 2 1/2 years later.

  11. The lipid geochemistry of interstitial waters of recent marine sediments

    SciTech Connect

    Saliot, A.; Brault, M.; Boussuge, C. )

    1988-04-01

    To elucidate the nature of biogeochemical processes occurring at the water-sediment interface, the authors have analyzed fatty acids, n-alkanes and sterols contained in interstitial waters collected from oxic and anoxic marine sediments in the eastern and western intertropical Atlantic Ocean and in the Arabian Sea. Lipid concentrations in interstitial waters vary widely and are generally much higher than concentrations encountered in the overlying sea water. Higher concentrations in interstitial water are observed in environments favorable for organic input and preservation of the organic matter in the water column and in the surficial sediment. The analysis of biogeochemical markers in the various media of occurrence of the organic matter such as sea water, suspended particles, settling particles and sediment is discussed in terms of differences existing between these media and bio-transformations of the organic matter at the water-sediment interface.

  12. Effect of amlodipine on mouse renal interstitial fibrosis.

    PubMed

    Honma, Shigeyoshi; Nakamura, Kazuki; Shinohara, Masahiro; Mitazaki, Satoru; Abe, Sumiko; Yoshida, Makoto

    2016-06-01

    Unilateral ureteral obstruction (UUO) is a well-established method to study interstitial fibrosis of the kidney. In this study, we investigated the effects of a calcium channel blocker, amlodipine, on UUO-induced renal interstitial fibrosis in mice. UUO significantly increased the fibrotic area in the obstructed kidney, but this change was inhibited by amlodipine (6.7mg/kg/day in drinking water). mRNA expression of heat shock protein (HSP) 47 and type IV collagen was increased in the kidneys of UUO mice. Amlodipine reduced the expression of both HSP47 and type IV collagen mRNAs. Phosphorylation of c-jun-N-terminal kinase (JNK) was significantly increased by UUO, but the change was inhibited by amlodipine. Collectively, these results suggest that amlodipine may inhibit the expression of HSP47 and type IV collagen by reducing phosphorylation of JNK and ameliorating the renal interstitial fibrosis induced by UUO. PMID:27029240

  13. Hermansky-Pudlak syndrome with nonspecific interstitial pneumonia.

    PubMed

    Furuhashi, Kazuki; Enomoto, Noriyuki; Fujisawa, Tomoyuki; Hashimoto, Dai; Inui, Naoki; Nakamura, Yutaro; Suda, Takafumi

    2014-01-01

    We herein report a case of Hermansky-Pudlak syndrome (HPS) with nonspecific interstitial pneumonia (NSIP). A 58-year-old Japanese woman presented with oculocutaneous albinism and dyspnea on exertion. A high resolution computed tomography scan showed areas of reticular and ground glass opacity in the lungs, and a surgical lung biopsy revealed fibrotic NSIP. Foamy type 2 pneumocytes and the absence of dense granules in platelets were also observed, consistent with a diagnosis of HPS. Ultimately, a genetic analysis revealed a mutation in the HPS1 gene. The interstitial pneumonia progressed despite treatment with prednisolone, cyclosporine A and pirfenidone. In this report, we discuss the pathological lung features and treatment of HPS associated with interstitial pneumonia. PMID:24583434

  14. Regional extravascular and interstitial lung water in normal dogs

    SciTech Connect

    Snashall, P.D.; Keyes, S.J.; Morgan, B.; Jones, B.; Murphy, K.

    1980-10-01

    The regional distribution of pulmonary extravascular and interstitial water was measured to examine the possibility that regional differences in microvascular pressure or tissue stress may cause regional differences in lung water. Chloralose-anesthetized dogs were traced in an upright or supine position and injected with 51Cr-labeled albumin to equilibrate with plasma. The data revealed that regional extravascular and interstitial water were constant throughout the lungs in both groups and that there were no significant differences between upright and supine dogs. There were no significant differences in hematocrit between slices. It appears that gravity and body position have no measurable effect on either the total size of the extravascular and interstitial compartments or their regional distribution.

  15. Differential fitness of allelic isozymes in the marine gastropods Littorina punctata and Littorina neritoides, exposed to the environmental stress of the combined effects of cadmium and mercury pollution

    NASA Astrophysics Data System (ADS)

    Lavie, Batia; Nevo, Eviatar

    1987-07-01

    The present study tested the separate and the interactive pollution effects of cadmium and mercury on the electrophoretically detected allelic isozyme frequencies of the enzyme phosphoglucose isomerase for two species of littoral marine gastropods — Littorina punctata and L. neritoides — and the enzyme amino peptidase for L. neritoides. Our results indicate differential survivorship of allelic isozyme genotypes specific for each type of pollutant and for their interaction, as well as trends common to all pollutants. Theoretically the results reflect the adaptive nature of at least some allozymic genotypes in these marine gastropods and seem inconsistent with the neutral theory of allozyme polymorphisms. Practically, the results reinforce earlier conclusions that changes in the frequency of allelic isozymes may be used as a genetic monitor of pollution.

  16. Acute interstitial nephritis following kudzu root juice ingestion.

    PubMed

    Jung, Jae Myun; Kwon, Soon Hyo; Noh, Hyunjin; Han, Dong Cheol; Jeon, Jin Seok; Jin, So Young

    2013-10-01

    Recently, the use of herbal remedies and complementary and alternative medicine has increased globally. Kudzu root (Pueraria lobata) is a plant commonly used in traditional medicine to promote health. A middle-aged woman consumed kudzu root juice to promote health and well-being for 10 days. Subsequently, she developed anorexia, epigastric discomfort and azotemia. These symptoms improved rapidly within several days after discontinuation of the suspected offending agent and conservative treatment. Acute interstitial nephritis was diagnosed by renal biopsy. To our knowledge, this is the first case report describing acute interstitial nephritis following the ingestion of kudzu root juice. PMID:24060140

  17. Diffusion of zinc vacancies and interstitials in zinc oxide

    NASA Astrophysics Data System (ADS)

    Erhart, Paul; Albe, Karsten

    2006-05-01

    The self-diffusion coefficient of zinc in ZnO is derived as a function of the chemical potential and Fermi level from first-principles calculations. Density functional calculations in combination with the climbing image-nudged elastic band method are used in order to determine migration barriers for vacancy, interstitial, and interstitialcy jumps. Zinc interstitials preferentially diffuse to second nearest neighbor positions. They become mobile at temperatures as low as 90-130K and therefore allow for rapid defect annealing. Under predominantly oxygen-rich and n-type conditions self-diffusion occurs via a vacancy mechanism.

  18. Ectrodactyly and proximal/intermediate interstitial deletion 7q

    SciTech Connect

    McElveen, C.; Carvajal, M.V.; Moscatello, D.

    1995-03-13

    We report on an individual with severe mental retardation, seizures, microcephaly, unusual face, scoliosis, and cleft feet and cleft right hand. The chromosomal study showed a proximal interstitial deletion 7q (q11.23q22). From our review of the literature, 11 patients have been reported with ectrodactyly (split hand/split foot malformation) and proximal/intermediate interstitial deletions or rearrangements of 7q. The critical segment for ectrodactyly seems to be located between 7q21.2 and 7q22.1. This malformation is present in 41% of the patients whose deletion involves the critical segment. 37 refs., 3 figs., 1 tab.

  19. Association Between Interstitial Lung Abnormalities and All-Cause Mortality

    PubMed Central

    Putman, Rachel K.; Hatabu, Hiroto; Araki, Tetsuro; Gudmundsson, Gunnar; Gao, Wei; Nishino, Mizuki; Okajima, Yuka; Dupuis, Josée; Latourelle, Jeanne C.; Cho, Michael H.; El-Chemaly, Souheil; Coxson, Harvey O.; Celli, Bartolome R.; Fernandez, Isis E.; Zazueta, Oscar E.; Ross, James C.; Harmouche, Rola; Estépar, Raúl San José; Diaz, Alejandro A.; Sigurdsson, Sigurdur; Gudmundsson, Elías F.; Eiríksdottír, Gudny; Aspelund, Thor; Budoff, Matthew J.; Kinney, Gregory L.; Hokanson, John E.; Williams, Michelle C; Murchison, John T.; MacNee, William; Hoffmann, Udo; O’Donnell, Christopher J.; Launer, Lenore J.; Harrris, Tamara B.; Gudnason, Vilmundur; Silverman, Edwin K.; O’Connor, George T.; Washko, George R.; Rosas, Ivan O.; Hunninghake, Gary M.

    2016-01-01

    IMPORTANCE Interstitial lung abnormalities have been associated with decreased six-minute walk distance, diffusion capacity for carbon monoxide and total lung capacity; however to our knowledge, an association with mortality has not been previously investigated. OBJECTIVE To investigate whether interstitial lung abnormalities are associated with increased mortality. DESIGN, SETTING, POPULATION Prospective cohort studies of 2633 participants from the Framingham Heart Study (FHS) (CT scans obtained 9/08–3/11), 5320 from the Age Gene/Environment Susceptibility (AGES)-Reykjavik (recruited 1/02–2/06), 2068 from COPDGene (recruited 11/07–4/10), and 1670 from the Evaluation of COPD Longitudinally to Identify Predictive Surrogate End-points (ECLIPSE) (between 12/05–12/06). EXPOSURES Interstitial lung abnormality status as determined by chest CT evaluation. MAIN OUTCOMES AND MEASURES All cause mortality over approximately 3 to 9 year median follow up time. Cause-of-death information was also examined in the AGES-Reykjavik cohort. RESULTS Interstitial lung abnormalities were present in 177 (7%) of the participants from FHS, 378 (7%) from AGES-Reykjavik, 156 (8%) from COPDGene, and in 157 (9%) from ECLIPSE. Over median follow-up times of ~3–9 years there were more deaths (and a greater absolute rate of mortality) among those with interstitial lung abnormalities compared to those without interstitial lung abnormalities in each cohort; 7% compared to 1% in FHS (6% difference, 95% confidence interval [CI] 2%, 10%), 56% compared to 33% in AGES-Reykjavik (23% difference, 95% CI 18%, 28%), 16% compared to 11% in COPDGene (5% difference, 95% CI −1%, 11%) and 11% compared to 5% in ECLIPSE (6% difference, 95% CI 1%, 11%). After adjustment for covariates, interstitial lung abnormalities were associated with an increase in the risk of death in the FHS (HR=2.7, 95% CI, 1.1–65, P=0.030), AGES-Reykjavik (HR 1.3, 95% CI 1.2–1.4, P<0.001), COPDGene (HR=1.8, 95% CI, 1.1, 2

  20. An evaluation of Mesodon and other larger terrestrial gastropod shells for dating late Holocene and historic alluvium in the Midwestern USA

    NASA Astrophysics Data System (ADS)

    Rakovan, Monica T.; Rech, Jason A.; Pigati, Jeffrey S.; Nekola, Jeffrey C.; Wiles, Gregory C.

    2013-07-01

    Understanding the history of stream erosion and changes in channel morphology is important for managing and restoring unstable streams. One of the significant challenges in this type of research is establishing accurate dating of late Holocene and historic alluvium. Here we evaluate the potential of using 14C dating and amino acid racemization (AAR) to date large terrestrial gastropod shells that are often preserved within alluvial sediments. Many terrestrial gastropods incorporate old carbon from limestone or other carbonate rocks into their shells and therefore are unsuitable for radiocarbon dating. Recent studies, however, have shown that some taxa avoid this 'limestone problem' and can yield reliable 14C ages. In this study, we measured the 14C activity of specimens for the genera Mesodon, Ventridens, and Allogona collected live and from alluvial sequences dated independently by dendrochronology, 14C dating of wood, and/or 137Cs analyses. Mesodon zaletus contained old carbon in similar concentrations (up to ~ 30%) found in previous studies of other large taxa and should be avoided for 14C dating when possible. In contrast, shells of Ventridens ligera and Allogona profunda showed minimal limestone effects and therefore may be suitable for dating late Holocene alluvium. These results highlight the importance of taxonomic identification of gastropod taxa prior to their use for 14C dating and demonstrate that shell fragments that are not identifiable should be avoided. We also measured d/l ratios (n = 17) of aspartic and glutamic acid from eight different taxa of terrestrial gastropods recovered from four late Holocene and historic stratigraphic sequences. Average d/l ratios of aspartic and glutamic acid from historic sediments < 300 years old are lower in shells from younger stratigraphic units, indicating that AAR can be used to differentiate between multiple historic stratigraphic units.

  1. An evaluation of Mesodon and other larger terrestrial gastropod shells for dating late Holocene and historic alluvium in the Midwestern USA

    USGS Publications Warehouse

    Rakovan, Monica T.; Rech, Jason A.; Pigati, Jeffery S.; Nekola, Jeffery C.; Wiles, Gregory C.

    2013-01-01

    Understanding the history of stream erosion and changes in channel morphology is important for managing and restoring unstable streams. One of the significant challenges in this type of research is establishing accurate dating of late Holocene and historic alluvium. Here we evaluate the potential of using 14C dating and amino acid racemization (AAR) to date large terrestrial gastropod shells that are often preserved within alluvial sediments. Many terrestrial gastropods incorporate old carbon from limestone or other carbonate rocks into their shells and therefore are unsuitable for radiocarbon dating. Recent studies, however, have shown that some taxa avoid this ‘limestone problem’ and can yield reliable 14C ages. In this study, we measured the 14C activity of specimens for the genera Mesodon, Ventridens, and Allogona collected live and from alluvial sequences dated independently by dendrochronology, 14C dating of wood, and/or 137Cs analyses. Mesodon zaletus contained old carbon in similar concentrations (up to ~ 30%) found in previous studies of other large taxa and should be avoided for 14C dating when possible. In contrast, shells of Ventridens ligera and Allogona profunda showed minimal limestone effects and therefore may be suitable for dating late Holocene alluvium. These results highlight the importance of taxonomic identification of gastropod taxa prior to their use for 14C dating and demonstrate that shell fragments that are not identifiable should be avoided. We also measured d/l ratios (n = 17) of aspartic and glutamic acid from eight different taxa of terrestrial gastropods recovered from four late Holocene and historic stratigraphic sequences. Average d/l ratios of aspartic and glutamic acid from historic sediments < 300 years old are lower in shells from younger stratigraphic units, indicating that AAR can be used to differentiate between multiple historic stratigraphic units.

  2. Evaluation of anelastic evidence for interstitial solute binding in bcc metals

    SciTech Connect

    Cost, J.R.; Stanley, J.T.

    1985-01-01

    A Direct Spectrum Analysis (DSA) technique has been applied to key internal friction and elastic after-effect data which are involved in the controversy over the existance of interstitial clustering in the refractory metals. It is found that at relatively high interstitial solute concentrations some of the Snoek peak broadening is due to relaxations that are distinct from the main relaxation. This finding supports the view that interstitial solutes have an interaction that produces clusters of interstitials.

  3. Iodine 125 interstitial irradiation for localized prostate cancer.

    PubMed Central

    Kumar, P. P.; Good, R. R.; Bartone, F. F.

    1990-01-01

    We present the technique, complications, and 5-year results of transperineal percutaneous template permanent interstitial iodine 125 endocurietherapy of localized prostate cancer in 85 treated patients. The 5-year outcome appears similar to that of external beam radiation therapy or radical surgery, but the iatrogenic mortality, morbidity, treatment time, and hospitalization are significantly reduced. Images Figure 1 Figure 2 Figure 3 PMID:2319613

  4. Parasitic infestation of lung: An unusual cause of interstitial pneumonitis

    PubMed Central

    Shah, Parth; Kate, Arvind H; Nester, Nora; Patole, Kamlakar; Leuppi, Joerg D; Chhajed, Prashant N

    2016-01-01

    Parasite infections are increasing worldwide due to increasing migration and traveling. Parasitic infections can affect lungs and present as a focal or diffuse lung diseases. High index of suspicion and detailed history are most important. We present a case of interstitial pneumonitis caused by parasite infestation, which was diagnosed on transbronchial lung biopsy. PMID:27051117

  5. Near-infrared fiber delivery systems for interstitial photothermal therapy

    NASA Astrophysics Data System (ADS)

    Slatkine, Michael; Mead, Douglass S.; Konwitz, Eli; Rosenberg, Zvi

    1995-05-01

    Interstitial photothermal coagulation has long been recognized as a potential important, minimally invasive modality for treating a variety of pathologic conditions. We present two different technologies for interstitial photothermal coagulation of tissue with infrared lasers: An optical fiber with a radially symmetric diffusing tip for deep coagulation, and a flat bare fiber for the coagulation of thin and long lesions by longitudinally moving the fiber while lasing in concert. Urology and Gynecology Fibers: The fibers are 600 microns diameter with 20 - 40 mm frosted distal tips protected by a smooth transparent cover. When used with a Neodymium:YAG (Nd:YAG) laser, the active fiber surface diffuses optical radiation in a radial pattern, delivering up to 40 W power, and thus providing consistent and uniform interstitial photothermal therapy. Coagulation depth ranges from 4 to 15 mm. Animal studies in the United States and clinical studies in Europe have demonstrated the feasibility of using these fibers to treat benign prostatic hyperplasia and endometrial coagulation. Rhinology Fiber: The fiber is an 800 micron diameter flat fiber operated at 8 W power level while being interstitially pushed and pulled along its axis. A long and thin coagulated zone is produced. The fiber is routinely used for the shrinking of hypertrophic turbinates without surrounding and bone mucusal damage in ambulatory environments.

  6. Simulation of the interstitial system of exposed sandy beaches

    NASA Astrophysics Data System (ADS)

    McLachlan, Anton; Dye, Arthur; Harty, Beryl

    1981-03-01

    A sand column system with tidal rather than continuous seawater inputs was developed for laboratory simulation of interstitial conditions on exposed sandy beaches. Adjustment of flow volume and rate and permanent water table depth allow simulation of various parts of the intertidal zone by 50 cm sand columns. As oxygen consumption by the interstitial fauna is directly proportional to flow rate, it is critical to obtain the correct flow rates to simulate field conditions. A 4-month experiment with five columns was conducted. During the latter 2 months high amino acid levels were added to the columns. Rates of oxygen consumption, oxidation of organic nitrogen and nitrate production by the columns are described. On average about one-third of the organic nitrogen was oxidized and 2 μmol NO 3-N1 -1 generated by the columns without amino acid addition. This activity could only account for 60% of the oxygen uptake. Meiofauna, protozoans and bacteria segregated vertically in the columns and meiofauna numbers dropped, but protozoan and bacterial numbers increased, especially after amino acid addition. Calculated interstitial respiration, based on individual rates in the literature, was too high and indicates experimental overestimation. It is concluded that much refinement is still needed to improve our under-standing of interstitial metabolism.

  7. Iodine 125 interstitial irradiation for localized prostate cancer

    SciTech Connect

    Kumar, P.P.; Good, R.R.; Bartone, F.F. )

    1990-03-01

    We present the technique, complications, and 5-year results of transperineal percutaneous template permanent interstitial iodine 125 endocurietherapy of localized prostate cancer in 85 treated patients. The 5-year outcome appears similar to that of external beam radiation therapy or radical surgery, but the iatrogenic mortality, morbidity, treatment time, and hospitalization are significantly reduced.

  8. Tumor interstitial fluid - a treasure trove of cancer biomarkers.

    PubMed

    Gromov, Pavel; Gromova, Irina; Olsen, Charlotta J; Timmermans-Wielenga, Vera; Talman, Mai-Lis; Serizawa, Reza R; Moreira, José M A

    2013-11-01

    Tumor interstitial fluid (TIF) is a proximal fluid that, in addition to the set of blood soluble phase-borne proteins, holds a subset of aberrantly externalized components, mainly proteins, released by tumor cells and tumor microenvironment through various mechanisms, which include classical secretion, non-classical secretion, secretion via exosomes and membrane protein shedding. Consequently, the interstitial aqueous phase of solid tumors is a highly promising resource for the discovery of molecules associated with pathological changes in tissues. Firstly, it allows one to delve deeper into the regulatory mechanisms and functions of secretion-related processes in tumor development. Secondly, the anomalous secretion of molecules that is innate to tumors and the tumor microenvironment, being associated with cancer progression, offers a valuable source for biomarker discovery and possible targets for therapeutic intervention. Here we provide an overview of the features of tumor-associated interstitial fluids, based on recent and updated information obtained mainly from our studies of breast cancer. Data from the study of interstitial fluids recovered from several other types of cancer are also discussed. This article is a part of a Special Issue entitled: The Updated Secretome. PMID:23416532

  9. Lumbar Tuberculosis Associated with Membranous Nephropathy and Interstitial Nephritis▿

    PubMed Central

    Yuan, Quan; Sun, Li; Feng, Jiangmin; Liu, Nan; Jiang, Yi; Ma, Jianfei; Wang, Lining

    2010-01-01

    Tuberculosis is a common disease worldwide. However, it now is clear that tuberculosis can affect the kidney more insidiously. We describe a case of lumbar tuberculosis associated with simultaneous membranous nephropathy and interstitial nephritis, in which recovery of renal function occurred after treatment with steroids in addition to antituberculosis agents. PMID:20375238

  10. Localized interstitial granuloma annulare induced by subcutaneous injections for desensitization.

    PubMed

    Spring, Philipp; Vernez, Maxime; Maniu, Christa-Maria; Hohl, Daniel

    2013-06-01

    We describe a patient with interstitial granuloma annulare associated with subcutaneous injection therapy (SIT) for desensitization to a type I allergy. Asymptomatic, erythematous, violaceous annular patches were located at the injection sites on both her arms. Medical history revealed perennial rhinoconjonctivitis treated with SIT (Phostal Stallergen® cat 100% and D. pteronyssinus/D.farinae 50%:50%). PMID:24011321

  11. Antioxidants induce apoptosis of rat ovarian theca-interstitial cells.

    PubMed

    Rzepczynska, Izabela J; Foyouzi, Nastaran; Piotrowski, Piotr C; Celik-Ozenci, Ciler; Cress, Amanda; Duleba, Antoni J

    2011-01-01

    Regulation of growth of ovarian theca-interstitial tissues is essential for normal ovarian development and function. Reactive oxygen species are involved in modulation of signal transduction pathways, including regulation of tissue growth and apoptosis. Previously, we have demonstrated that antioxidants inhibit proliferation of theca-interstitial cells. This report evaluates the effects of antioxidants on apoptosis of rat theca-interstitial cells. The cells were cultured in chemically defined media without or with vitamin E succinate and ebselen. Apoptosis was evaluated by cytochemical assessment of nuclear morphology, activity of executioner caspases 3 and 7, and determination of staining with annexin V in combination with propidium iodide. Both tested antioxidants induced significant morphological changes consistent with apoptosis, including chromatin condensation, nuclear shrinkage, and pyknosis. Antioxidants also induced other hallmarks of apoptosis including increased activity of caspases 3/7 as well as increased staining with annexin V. The present findings demonstrate that antioxidants with distinctly different mechanisms of action induce a series of events consistent with the process of apoptosis in ovarian mesenchyme. These observations may be of translational-clinical relevance, providing mechanistic support for the use of antioxidants in the treatment of PCOS, a condition associated with excessive growth and activity of theca-interstitial cells. PMID:20844276

  12. Interstitial fluid flow: simulation of mechanical environment of cells in the interosseous membrane

    NASA Astrophysics Data System (ADS)

    Yao, Wei; Ding, Guang-Hong

    2011-08-01

    In vitro experiments have shown that subtle fluid flow environment plays a significant role in living biological tissues, while there is no in vivo practical dynamical measurement of the interstitial fluid flow velocity. On the basis of a new finding that capillaries and collagen fibrils in the interosseous membrane form a parallel array, we set up a porous media model simulating the flow field with FLUENT software, studied the shear stress on interstitial cells' surface due to the interstitial fluid flow, and analyzed the effect of flow on protein space distribution around the cells. The numerical simulation results show that the parallel nature of capillaries could lead to directional interstitial fluid flow in the direction of capillaries. Interstitial fluid flow would induce shear stress on the membrane of interstitial cells, up to 30 Pa or so, which reaches or exceeds the threshold values of cells' biological response observed in vitro. Interstitial fluid flow would induce nonuniform spacial distribution of secretion protein of mast cells. Shear tress on cells could be affected by capillary parameters such as the distance between the adjacent capillaries, blood pressure and the permeability coefficient of capillary's wall. The interstitial pressure and the interstitial porosity could also affect the shear stress on cells. In conclusion, numerical simulation provides an effective way for in vivo dynamic interstitial velocity research, helps to set up the vivid subtle interstitial flow environment of cells, and is beneficial to understanding the physiological functions of interstitial fluid flow.

  13. Microdefects and self-interstitial diffusion in crystalline silicon

    SciTech Connect

    Knowlton, W.B.

    1998-05-01

    In this thesis, a study is presented of D-defects and self-interstitial diffusion in silicon using Li ion (Li{sup +}) drifting in an electric field and transmission electron microscopy (TEM). Obstruction of Li{sup +} drifting has been found in wafers from certain but not all FZ p-type Si. Incomplete Li{sup +} drifting always occurs in the central region of the wafers. This work established that interstitial oxygen is not responsible for hindering Li{sup +} drifting. TEM was performed on a samples from the partially Li{sup +} drifted area and compared to regions without D-defects. Precipitates were found only in the region containing D-defects that had partially Li{sup +} drifted. This result indicates D-defects are responsible for the precipitation that halts the Li{sup +} drift process. Nitrogen (N) doping has been shown to eliminate D-defects as measured by conventional techniques. Li{sup +} drifting and D-defects provide a useful means to study Si self-interstitial diffusion. The process modeling program SUPREM-IV was used to simulate the results of Si self-interstitial diffusion obtained from Li{sup +} drifting experiments. Anomalous results from the Si self-interstitial diffusion experiments forced a re-examination of the possibility of thermal dissociation of D-defects. Thermal annealing experiments that were performed support this possibility. A review of the current literature illustrates the need for more research on the effects of thermal processing on FZ Si to understand the dissolution kinetics of D-defects.

  14. Distribution of body fluids: local mechanisms guarding interstitial fluid volume.

    PubMed

    Aukland, K

    1984-01-01

    The plasma volume is determined by fluid influx through drinking and outflux by renal excretion. Both fluxes are regulated according to plasma volume and composition through arterial pressure, osmoreceptors and vascular stretch receptors. As to the remaining part of the extracellular volume, the interstitial space, there is no evidence that its volume (IFV), pressure or composition are sensed in such a way as to influence water intake or excretion. Nevertheless, IFV is clearly regulated, often pari passu with the regulation of plasma volume. However, there are many exceptions to parallel changes of the two compartments, indicating the existence of automatic, local mechanisms guarding the net transfer of fluid between plasma and interstitium. Thus, a rise in arterial and/or venous pressure, tending to increase capillary pressure and net filtration, is counteracted by changes in the "Starling forces": hydrostatic and colloid osmotic pressures of capillary blood and interstitial fluid. These "oedemapreventing mechanisms" (A. C. Guyton) may be listed as follows: Vascular mechanisms, modifying capillary pressure or interstitial fluid pressure (IFP). Increased transmural vascular pressure elicits precapillary constriction and thereby reduces the rise in capillary pressure. Counteracts formation of leg oedema in orthostasis. Venous expansion transmits pressure to the interstitium in encapsulated organs (brain, bone marrow, rat tail). Mechanisms secondary to increased net filtration, A rise in IFV will increase IFP, and thereby oppose further filtration. Favoured by lowcompliant interstitium. Reduction of interstitial COP through dilution and/or washout of interstitial proteins. A new steady state depends on increased lymph flow. Increased lymph flow permits a rise in net capillary filtration pressure. Low blood flow and high filtration fraction will increase local capillary COP. PMID:6399307

  15. The spatial scale of genetic subdivision in populations of Ifremeria nautilei, a hydrothermal-vent gastropod from the southwest Pacific

    PubMed Central

    2011-01-01

    Background Deep-sea hydrothermal vents provide patchy, ephemeral habitats for specialized communities of animals that depend on chemoautotrophic primary production. Unlike eastern Pacific hydrothermal vents, where population structure has been studied at large (thousands of kilometres) and small (hundreds of meters) spatial scales, population structure of western Pacific vents has received limited attention. This study addresses the scale at which genetic differentiation occurs among populations of a western Pacific vent-restricted gastropod, Ifremeria nautilei. Results We used mitochondrial and DNA microsatellite markers to infer patterns of gene flow and population subdivision. A nested sampling strategy was employed to compare genetic diversity in discrete patches of Ifremeria nautilei separated by a few meters within a single vent field to distances as great as several thousand kilometres between back-arc basins that encompass the known range of the species. No genetic subdivisions were detected among patches, mounds, or sites within Manus Basin. Although I. nautilei from Lau and North Fiji Basins (~1000 km apart) also exhibited no evidence for genetic subdivision, these populations were genetically distinct from the Manus Basin population. Conclusions An unknown process that restricts contemporary gene flow isolates the Manus Basin population of Ifremeria nautilei from widespread populations that occupy the North Fiji and Lau Basins. A robust understanding of the genetic structure of hydrothermal vent populations at multiple spatial scales defines natural conservation units and can help minimize loss of genetic diversity in situations where human activities are proposed and managed. PMID:22192622

  16. [Evolutionary regularities of somatic polyploidy expansion in salivary glands of gastropod mollusks. V. Subclasses Opisthobranchia and Pulmonata].

    PubMed

    Anisimov, A P; Ziumchenko, N E

    2012-01-01

    Salivary glands of 25 species of euthyneural gastropod mollusks (Opisthobranchia and Pulmonata) have been investigated by means of histochemical methods and DNA cytophotometry in nuclei of cells. The cells of three basic types are distinguished in glandular epithelim: granular cells (with glicoproteid granular inclusions), mucocytes-I (with sulfatic acid mucopolysaccharides) and mucocytes-II (with neutral and acid nonsulfatic polysaccharides and proteins) and so the epithelial ciliated cells and cells of the ducts. It was shown that glandular cells of salivary glands of all discovered mollusks' species are polyploid in different degree. The highest ploidy level estimated by means of DNA content in most of species is 64-128c. The giant polyploidy, attained to 4096c, is discovered in cells of salivary glands of Tritonia diomedea. The functional conditionality connected with features of feeding of different mollusk species and phylogenetic tendencies of expansion of somatic polyploidy in class Gastropoda are discussed. In comparison with allogenic, facultative and small polyploidy manifestation in Prosobranchia the obligatory polyploidization of high degree revealed in cells of salivary glands of Opisthobranchia and Pulmonata is consider to be the original cytological arogenesis. The probable causes of such differences are conneted with euthyneural type of organization of central nervous system and giant polyploidy of neurons in Opisthobranchia and Pulmonata mollusks. The causes, mechanisms and significance of such correlations are unclear for the present. PMID:22590930

  17. [Toxicity and toxin profile of scavenging and carnivorous gastropods from the coastal waters of Okinawa Prefecture, Japan].

    PubMed

    Taniyama, Shigeto; Takatani, Tomohiro; Sorimachi, Taiki; Sagara, Takefumi; Kubo, Hirofumi; Oshiro, Naomasa; Ono, Kaname; Xiao, Ning; Tachibana, Katsuyasu; Arakawa, Osamu

    2013-01-01

    From January to June 2009, a total of 64 gastropod specimens of 15 species were collected from the coastal waters of Okinawa Prefecture, Japan, and examined for toxicity by means of mouse bioassay. Among the specimens tested, 5 species, Nassarius glans, Nassariuscoronatus, Olivaannulata, Oliva concavospira and Zeuxis sp., were toxic. The toxicity scores of N. glans were very high; 39.6-461 MU/g in muscle, and 98.6-189 MU/g in viscera including digestive gland, followed by Zeuxis sp. (12.7 MU/g in whole body), N. coronatus (5.64-11.1 MU/g in whole body), O. annulata (10.8 MU/g in the whole body), O. concavospira (6.65 MU/g in the muscle). Liquid chromatography/mass spectrometry (LC-MS) revealed that the major toxic component was tetrodotoxin (TTX), which accounting for 13-82% of the total toxicity. As for the remaining toxicity in the case of N. glans, 4,9-anhydroTTX, 4-epiTTX and 11-oxoTTX were contributors. Moreover, Niotha albescens showed no toxicity (less than 10 MU/g) in mouse bioassay, but TTX (5.08 MU/g) was detected by LC-MS. Paralytic shellfish poison was not detected in any of the specimens by high-performance liquid chromatography with fluorometric detection (HPLC-FLD). PMID:23470873

  18. The isotopic aspects of the calcification of the reef builder gastropod Dendropoma petreaum - can vermetids serve as paleoceanographic proxy?

    NASA Astrophysics Data System (ADS)

    Sisma-Ventura, G.; Shemesh, A.

    2009-04-01

    The vermetid reef builder Dendropoma petraeum - a sessile irregular-coiled gastropods that develop dense aggregations on the abrasion platform edges and grow at Mean Sea Level, can serve as an archive of environmental conditions such as sea surface temperature and salinity provided that it deposits the calcitic skeleton in isotopic equilibrium. The large distribution of vermetid reefs in subtropical waters and across the Mediterranean allows their use as paleo-markers in areas that are void of corals for paleo-climate reconstruction. We studied the isotopic composition of vermetids retrieved from the coast of the Levantine Basin of the Mediterranean Sea. The δ18O of the calcitic shell of living vermetids indicate that skeletal deposition occurs under isotopic equilibrium and faithfully record the temperature and surface water δ18O during spring and summer. High-resolution δ18O and δ13C records obtained from several cores were used to reconstruct variations in the Levantine basin sea surface temperature, hydrology and productivity during the past 500 years. The correlation with global climatic events will be discussed.

  19. Genetic divergence of peripherally disjunct populations of the gastropod Batillariella estuarina in the Houtman Abrolhos Islands, Western Australia.

    PubMed

    Pudovskis, M S; Johnson, M S; Black, R

    2001-11-01

    Geographically disjunct populations are unusual in marine species, but the Houtman Abrolhos Islands, Western Australia, provide opportunities to study highly disjunct peripheral isolates of several species. The intertidal snail Batillariella estuarina occurs in isolated tidal ponds in the Abrolhos Islands, where it is at its northern limit, disjunct from mainland populations by 600-900 km. The species is thus disjunct both geographically and among the peripherally isolated populations in the Abrolhos Islands. Comparisons of allozymes at 11 polymorphic loci were made among populations from 10 ponds in the Abrolhos Islands and six sites from relatively continuous tidal flats at Albany, 900 km away, the nearest major set of populations. Among all 16 populations, subdivision was high (FST = 0.455). Although there were subtle differences between the geographical regions, the large majority of divergence occurred among the isolated ponds in the Abrolhos (FST = 0.441), and divergence on the tidal flats at Albany was only moderate (FST = 0.085). Characteristic of peripheral isolates, the pond populations have less polymorphism and fewer alleles than the more connected populations at Albany. Combined with evidence of genetic divergence in the gastropods Bembicium vittatum and Austrocochlea constricta, which have very similar geographical distributions to that of B. estuarina, these results indicate the potential evolutionary significance of peripherally isolated marine populations in the unusual habitats of the Abrolhos Islands. PMID:11883876

  20. A molecular phylogeny of aquatic gastropods provides a new perspective on biogeographic history of the Snake River Region.

    PubMed

    Hershler, Robert; Liu, Hsiu-Ping

    2004-09-01

    Mitochondrial DNA sequences of aquatic gastropods of the subgenus Pyrgulopsis (Natricola) were analyzed to test a commonly accepted hypothesis concerning the early history of the Snake River in the northwestern US. Distributions of Natricola and other regional biota were previously used to infer that the Snake River flowed to the Pacific through southeastern Oregon and northern California during the Neogene prior to its capture by the Columbia River in the late Pliocene (2 Ma). A molecular phylogeny based on partial sequences of COI and NDI (1149 bp) indicates that the Natricola clade is restricted to the modern Snake-Columbia River Basin and the Oregon Lakes region whereas northern California populations previously assigned to this subgenus belong to other lineages. The Natricola clade is not deeply subdivided into Oregon Lakes and Snake River Basin units consistent with late Pliocene fragmentation of the hypothesized paleodrainage, but instead is shallowly structured and contains multiple transitions among these two geographic areas. The strongly supported sister relationship between Natricola and a species from northwest Nevada (P. imperialis) is consistent with a recent proposal that the ancestral Snake River did not flow through southeast Oregon but instead flowed south to the Humboldt River. Within the context of this hypothesis, the multiple transitions between the Snake River Basin and the Oregon Lakes region that occurred within Natricola may be attributed to a late Pleistocene connection between these areas that was unrelated to the early course of the Snake River. PMID:15288067

  1. Effects of Low Salinity on Adult Behavior and Larval Performance in the Intertidal Gastropod Crepipatella peruviana (Calyptraeidae)

    PubMed Central

    Montory, Jaime A.; Pechenik, Jan A.; Diederich, Casey M.; Chaparro, Oscar R.

    2014-01-01

    Shallow-water coastal areas suffer frequent reductions in salinity due to heavy rains, potentially stressing the organisms found there, particularly the early stages of development (including pelagic larvae). Individual adults and newly hatched larvae of the gastropod Crepipatella peruviana were exposed to different levels of salinity stress (32(control), 25, 20 or 15), to quantify the immediate effects of exposure to low salinities on adult and larval behavior and on the physiological performance of the larvae. For adults we recorded the threshold salinity that initiates brood chamber isolation. For larvae, we measured the impact of reduced salinity on velar surface area, velum activity, swimming velocity, clearance rate (CR), oxygen consumption (OCR), and mortality (LC50); we also documented the impact of salinity discontinuities on the vertical distribution of veliger larvae in the water column. The results indicate that adults will completely isolate themselves from the external environment by clamping firmly against the substrate at salinities ≤24. Moreover, the newly hatched larvae showed increased mortality at lower salinities, while survivors showed decreased velum activity, decreased exposed velum surface area, and decreased mean swimming velocity. The clearance rates and oxygen consumption rates of stressed larvae were significantly lower than those of control individuals. Finally, salinity discontinuities affected the vertical distribution of larvae in the water column. Although adults can protect their embryos from low salinity stress until hatching, salinities <24 clearly affect survival, physiology and behavior in early larval life, which will substantially affect the fitness of the species under declining ambient salinities. PMID:25077484

  2. Differences in the timing of cardio-respiratory development determine whether marine gastropod embryos survive or die in hypoxia.

    PubMed

    Rudin-Bitterli, Tabitha S; Spicer, John I; Rundle, Simon D

    2016-04-01

    Physiological plasticity of early developmental stages is a key way by which organisms can survive and adapt to environmental change. We investigated developmental plasticity of aspects of the cardio-respiratory physiology of encapsulated embryos of a marine gastropod, Littorina obtusata, surviving exposure to moderate hypoxia (PO2 =8 kPa) and compared the development of these survivors with that of individuals that died before hatching. Individuals surviving hypoxia exhibited a slower rate of development and altered ontogeny of cardio-respiratory structure and function compared with normoxic controls (PO2 >20 kPa). The onset and development of the larval and adult hearts were delayed in chronological time in hypoxia, but both organs appeared earlier in developmental time and cardiac activity rates were greater. The velum, a transient, 'larval' organ thought to play a role in gas exchange, was larger in hypoxia but developed more slowly (in chronological time), and velar cilia-driven, rotational activity was lower. Despite these effects of hypoxia, 38% of individuals survived to hatching. Compared with those embryos that died during development, these surviving embryos had advanced expression of adult structures, i.e. a significantly earlier occurrence and greater activity of their adult heart and larger shells. In contrast, embryos that died retained larval cardio-respiratory features (the velum and larval heart) for longer in chronological time. Surviving embryos came from eggs with significantly higher albumen provisioning than those that died, suggesting an energetic component for advanced development of adult traits. PMID:26896537

  3. Influences of population density on polyandry and patterns of sperm usage in the marine gastropod Rapana venosa

    PubMed Central

    Xue, Dong-Xiu; Zhang, Tao; Liu, Jin-Xian

    2016-01-01

    Polyandry is a common mating strategy in animals, with potential for sexual selection to continue post-copulation through sperm competition and/or cryptic female choice. Few studies have investigated the influences of population density on polyandry and sperm usage, and paternity distribution in successive broods of marine invertebrates. The marine gastropod Rapana venosa is ideal for investigating how population density influences the frequency of polyandry and elucidating patterns of sperm usage. Two different population density (12 ind/m3 and 36 ind/m3) treatments with two replications were set to observe reproductive behaviors. Five microsatellite markers were used to identify the frequency of multiple paternity and determine paternal contributions to progeny arrays in 120 egg masses. All of the mean mating frequency, mean number of sires and mean egg-laying frequency were higher at high population density treatment relative to low population density treatment, indicating population density is an important factor affecting polyandry. The last sperm donors achieved high proportions of paternity in 74.77% of egg masses, which supported the “last male sperm precedence” hypothesis. In addition, high variance in reproductive success among R. venosa males were detected, which might have an important influence on effective population size. PMID:26996441

  4. Mid-Holocene paleoceanographic conditions in the Limfjord region from gastropod (Littorina littorea) oxygen and carbon isotopes

    NASA Astrophysics Data System (ADS)

    Burman, J.; Schmitz, B.

    2003-04-01

    Stable oxygen and carbon isotope intrashell transects of common intertidal gastropods Littorina littorea have been used to reconstruct environmental conditions in the Limfjord region during the mid-Holocene (late Atlantic time). The subfossil specimens studied are from the excavated Stone Age Kitchenmidden in Ertebølle, northern Denmark, dated between 5970±95 to 5070±90 B.P. In addition recent specimens were studied from different coastal localities within the Limfjord, along a salinity gradient from the west to east. These modern shells were used as control samples, in order to construct an oceanographic model for the Limfjord, in which the seasonal isotopic range from the Littorina subfossils could be interpreted. The coastal marine climate in the Ertebølle region during the mid-Holocene indicates summer-SST close to 22^oC and 4-5 ppm reduced salinity compared to fully marine conditions. The mid-Holocene central Limfjord can be described as a coastal area, which experienced similar salinity conditions (c. 30.5 PSU) that prevail in the western part (Odden area) today. In terms of summer-SST as compared with a 10-year average (1989-1998) for the Limfjord region, temperatures were 2-3^oC above recent climatic settings. These results point towards a mid-Holocene Limfjord in contact with the North Sea/Skagerrak with possibly more pronounced water exchange with the North Sea than today.

  5. Freezing and anoxia stresses induce expression of metallothionein in the foot muscle and hepatopancreas of the marine gastropod Littorina littorea.

    PubMed

    English, Tamara E; Storey, Kenneth B

    2003-07-01

    Differential screening of cDNA libraries constructed from the foot muscle of marine snails Littorina littorea revealed several cDNAs that are upregulated during anoxia or freezing exposures, environmental stresses that are naturally endured by this species. One full-length clone of 1196 nucleotides (GenBank accession number AY034179) hybridized with a 1200-nucleotide band on northern blots and encoded a 100-amino-acid protein that was identified as belonging to the metallothionein (MT) family. L. littorea MT shared 45% and 56% identity with the copper- and cadmium-binding MT isoforms, respectively, from another gastropod, Helix pomatia and 43-47% identity with marine bivalve MTs. The L. littorea sequence included the mollusc-specific C-terminal motif Cys-X-Cys-X(3)-Cys-Thr-Gly-X(3)-Cys-X-Cys-X(3)-Cys-X-Cys-Lys that identifies it as a family 2 (mollusc) MT. Northern blot analysis showed that L. littorea MT was upregulated in both foot muscle and hepatopancreas in response to both freezing and anoxia stresses; within 1 h of the beginning of the stress transcript levels rose 2.5- to sixfold of control levels, reaching maximal levels at 12 or 24 h. After 24 h recovery from either stress, transcript levels were reduced again in three cases but remained elevated in hepatopancreas from anoxia-treated snails. Upregulation of MT during environmental stress could serve one or more possible roles, including a function in antioxidant defense. PMID:12796465

  6. Oceanography in northwestern Europe during the last interglacial from intrashell δ 18O ranges in Littorina littorea gastropods

    NASA Astrophysics Data System (ADS)

    Burman, Johan; Påsse, Tore

    2008-07-01

    Coastal sea-surface temperature (SST) and sea-surface salinity (SSS), including seasonality, in northwest (NW) Europe during the early phase of the Eemian interglacial ca. 125 ka ago were reconstructed from Littorina littorea (common periwinkle) gastropods. The results were based on intra-annual δ 18O analyses in recent and fossil shells, mainly originating from the sea of Kattegat (Sweden) and the English Channel (United Kingdom), and confined to intertidal settings. The Eemian L. littorea shells indicated annual SSTs in the range 8-18°C for the English Channel and 8-26°C for Kattegat. All specimens from the Eemian sites experienced summer SSTs of ca. 1-3°C above recent conditions. The estimated winter SST in the English Channel during the Eemian was comparable to modern measurements of ca. 8°C. However, the Kattegat region displayed Eemian winter SST approximately 8°C warmer than today, and similar to conditions in the western English Channel. The recent-fossil isotope analogue approach indicated high SSS above 35 practical salinity units (psu) for a channel south of England in full contact with the North Atlantic Ocean during the last interglacial. In addition, the Kattegat shells indicated a SSS of ca. 29 psu, which points out a North Sea affinity for this region during the Eemian.

  7. Identification of a granulin-like transcript expressed during anoxic exposure and translated during aerobic recovery in a marine gastropod.

    PubMed

    Larade, Kevin; Storey, Kenneth B

    2008-02-29

    A novel transcript encoding a cysteine-rich granulin-like peptide (l-grn) was identified in the hepatopancreas of the marine intertidal gastropod, Littorina littorea, an anoxia-tolerant species. Experimental exposure of snails to anoxia induced a gradual accumulation of l-grn transcripts over time, with expression regulated in vitro through elements responsive to second messengers of protein kinases A, C and G. Translation of this transcript was analyzed by examining l-grn association with ribosomes during normoxia, anoxia, and aerobic recovery. Transcripts of l-grn were associated with polysomes during normoxia, moved into the monosome fractions under anoxia, but shifted back to the polysomal fractions during aerobic recovery. Western blotting confirmed this with a granulin-like protein detected under normoxic conditions, but not during anoxia exposure. A significant increase in the precursor protein and peptide (L-GRN) was observed during the aerobic recovery period. The accumulation of l-grn transcripts during anoxic exposure and subsequent translation following the return to aerobic conditions may be a response to oxidant damage that occurs during re-oxygenation. Overall, the data show that the l-grn gene is anoxia-responsive in this species and may have pro-survival functions during the recovery period. PMID:18187271

  8. Effect of parasitism by the pyramidellid gastropod Boonea impressa on the net productivity of oysters ( Crassostrea virginica)

    NASA Astrophysics Data System (ADS)

    White, M. E.; Powell, E. N.; Ray, S. M.

    1988-04-01

    The effect of an ectoparasitic gastropod, Boonea (= Odostomia) impressa, on the energy bidget of its host, the American oyster, Crassostrea virginica, was examined. A model was developed from laboratory and field data, as well as from equations developed by Powell and Stanton (1985). The model predicted that net productivity by large (7 cm length) oysters parasitized by 10 and 30 large (6 mm length) snails would be reduced by 21% and 63%, respectively. In contrast, net productivity in small (3 cm length) oysters would be reduced 25% by only 3 snails. Small oysters would have a negative energy balance when parasitized by 10 snails. The predicted reduction in growth was compared with measured growth in small and large oysters parasitized at abundances typical of Texas oyster reefs. Control oysters (no parasites) gained more shell weight than parasitized oysters. In four-week experiments conducted during the spring and fall, small control oysters gained 86% and 75% more weight than highly parasitized oysters. Large control oysters had 29% and 88% more shell deposition. Snail parasitism produced 75% mortality in small, highly parasitized oysters in the summer. In typical field populations in Texas bays, a minimal estimate of 4-12% of the energy otherwise available to the oyster for growth and reproduction is consumed by Boonea impressa.

  9. Influences of population density on polyandry and patterns of sperm usage in the marine gastropod Rapana venosa.

    PubMed

    Xue, Dong-Xiu; Zhang, Tao; Liu, Jin-Xian

    2016-01-01

    Polyandry is a common mating strategy in animals, with potential for sexual selection to continue post-copulation through sperm competition and/or cryptic female choice. Few studies have investigated the influences of population density on polyandry and sperm usage, and paternity distribution in successive broods of marine invertebrates. The marine gastropod Rapana venosa is ideal for investigating how population density influences the frequency of polyandry and elucidating patterns of sperm usage. Two different population density (12 ind/m(3) and 36 ind/m(3)) treatments with two replications were set to observe reproductive behaviors. Five microsatellite markers were used to identify the frequency of multiple paternity and determine paternal contributions to progeny arrays in 120 egg masses. All of the mean mating frequency, mean number of sires and mean egg-laying frequency were higher at high population density treatment relative to low population density treatment, indicating population density is an important factor affecting polyandry. The last sperm donors achieved high proportions of paternity in 74.77% of egg masses, which supported the "last male sperm precedence" hypothesis. In addition, high variance in reproductive success among R. venosa males were detected, which might have an important influence on effective population size. PMID:26996441

  10. Interstitial nephritis caused by HIV infection by itself: a case report

    PubMed Central

    Doi, Asako; Iwata, Kentaro; Hara, Shigeo; Imai, Yukihiro; Hasuike, Toshikazu; Nishioka, Hiroaki

    2016-01-01

    Interstitial nephritis is a common cause of renal dysfunction. It is primarily caused by drugs, infections, or autoimmune disorders. Patients with human immunodeficiency virus (HIV) infection can develop interstitial nephritis, although it typically occurs because of the aforementioned etiologies and not as a direct consequence of HIV infection. Interstitial lesions may occur in patients with HIV-associated nephropathy (HIVAN). However, interstitial nephritis without the glomerular injuries characteristic of HIVAN, and without the risk factors described earlier, is very rare. Here, we describe a rare case of interstitial nephritis that was likely caused directly by HIV infection and not by other etiologies. PMID:27621665

  11. Key Role of the Cation Interstitial Structure in the Radiation Resistance of Pyrochlores

    SciTech Connect

    Chartier, Alain; Catillon, Gilles; Crocombette, Jean-Paul

    2009-04-17

    The annealing of the B cation interstitial is shown to drive the thermokinetic of the response to irradiations of A{sub 2}B{sub 2}O{sub 7} pyrochlores. Molecular dynamics simulations evidenced that the annealing of interstitials created by irradiations depends upon the nature of B. As the coordination number of B decreases, the dumbbell interstitial is stabilized at the expense of the isolated interstitial. Unlike the isolated interstitials, the recombination of the dumbbells is thermally activated and hindered at low temperatures. The occurrence of dumbbells drives the structure towards the amorphous state.

  12. Interstitial nephritis caused by HIV infection by itself: a case report.

    PubMed

    Doi, Asako; Iwata, Kentaro; Hara, Shigeo; Imai, Yukihiro; Hasuike, Toshikazu; Nishioka, Hiroaki

    2016-01-01

    Interstitial nephritis is a common cause of renal dysfunction. It is primarily caused by drugs, infections, or autoimmune disorders. Patients with human immunodeficiency virus (HIV) infection can develop interstitial nephritis, although it typically occurs because of the aforementioned etiologies and not as a direct consequence of HIV infection. Interstitial lesions may occur in patients with HIV-associated nephropathy (HIVAN). However, interstitial nephritis without the glomerular injuries characteristic of HIVAN, and without the risk factors described earlier, is very rare. Here, we describe a rare case of interstitial nephritis that was likely caused directly by HIV infection and not by other etiologies. PMID:27621665

  13. Increased bladder permeability in interstitial cystitis/painful bladder syndrome

    PubMed Central

    Greenwood-Van Meerveld, Beverley; Wisniewski, Amy B.; VanGordon, Samuel; Lin, HsuehKung; Kropp, Bradley P.; Towner, Rheal A.

    2015-01-01

    The definition of interstitial cystitis (IC) has evolved over the years from being a well-defined entity characterized by diagnostic lesion (Hunner’s ulcer) in the urothelium to a clinical diagnosis by exclusion [painful bladder syndrome (PBS)]. Although the etiology is unknown, a central theme has been an association with increased permeability of the bladder. This article reviews the evidence for increased permeability being important to the symptoms of interstitial cystitis/painful bladder syndrome (IC/PBS) and in treating the disorder. Recent work showing cross-communication among visceral organs is also reviewed to provide a basis for understanding IC/PBS as a systemic disorder of a complex, interconnected system consisting of the bladder, bowel and other organs, nerves, cytokine-responding cells and the nervous system. PMID:26751576

  14. MRI contrast agent concentration and tumor interstitial fluid pressure.

    PubMed

    Liu, L J; Schlesinger, M

    2016-10-01

    The present work describes the relationship between tumor interstitial fluid pressure (TIFP) and the concentration of contrast agent for dynamic contrast-enhanced magnetic resonance imaging (DCE-MRI). We predict the spatial distribution of TIFP based on that of contrast agent concentration. We also discuss the cases for estimating tumor interstitial volume fraction (void fraction or porosity of porous medium), ve, and contrast volume transfer constant, K(trans), by measuring the ratio of contrast agent concentration in tissue to that in plasma. A linear fluid velocity distribution may reflect a quadratic function of TIFP distribution and lead to a practical method for TIFP estimation. To calculate TIFP, the parameters or variables should preferably be measured along the direction of the linear fluid velocity (this is in the same direction as the gray value distribution of the image, which is also linear). This method may simplify the calculation for estimating TIFP. PMID:27343032

  15. Connective Tissue Disease-Associated Interstitial Lung Diseases: Unresolved Issues.

    PubMed

    Aparicio, Irene Jarana; Lee, Joyce S

    2016-06-01

    Interstitial lung disease (ILD) complicating connective tissue disorders, such as scleroderma and rheumatoid arthritis, is associated with significant morbidity and mortality. Progress has been made in our understanding of these collective diseases; however, there are still many unanswered questions. In this review, we describe the current views on epidemiology, clinical presentation, treatment, and prognosis in patients with connective tissue disease (CTD)-associated ILD. We also highlight several areas that remain unresolved and in need of further investigation, including interstitial pneumonia with autoimmune features, histopathologic phenotype, and pharmacologic management. A multidisciplinary and multidimensional approach to diagnosis, management, and investigation of CTD-associated ILD patients is essential to advance our understanding of the epidemiology and pathobiology of this challenging group of diseases. PMID:27231868

  16. Significance of granulomatous inflammation in usual interstitial pneumonia.

    PubMed

    Tomic, Rade; Kim, Hyun J; Perlman, David M; Bors, Melinda; Allen, Tadashi; Ritter, Jon; Dincer, H Erhan; Bhargava, Maneesh

    2015-01-01

    Sarcoidosis is a systemic granulomatous disease of unclear etiology with characteristic pulmonary lesions. We describe 2 unique cases of sarcoidosis where after approximately 20 years of clinical quiescence, patients developed interstitial opacities on chest CT scan and an increase in shortness of breath. With lack of therapeutic response to a course of prednisone, both patients underwent a surgical lung biopsy that revealed a pattern consistent with Usual Interstitial Pneumonia (UIP) with honeycombing and fibroblastic foci. Postoperatively, the course of the disease was consistent with what would be expected in Idiopathic Pulmonary Fibrosis. Ultimately the disease progressed with one patient needed lung transplantation and the other requiring high-flow oxygen supplementation. In conclusion, we present two patients in whom a diagnosis of sarcoidosis preceded the diagnosis of UIP by 20 years or more. The subsequent course of disease in both patients was consistent with Idiopathic Pulmonary Fibrosis. PMID:26278696

  17. Lung Cancer and Interstitial Lung Diseases: A Systematic Review

    PubMed Central

    Archontogeorgis, Kostas; Steiropoulos, Paschalis; Tzouvelekis, Argyris; Nena, Evangelia; Bouros, Demosthenes

    2012-01-01

    Interstitial lung diseases (ILDs) represent a heterogeneous group of more than two hundred diseases of either known or unknown etiology with different pathogenesis and prognosis. Lung cancer, which is the major cause of cancer death in the developed countries, is mainly attributed to cigarette smoking and exposure to inhaled carcinogens. Different studies suggest a link between ILDs and lung cancer, through different pathogenetic mechanisms, such as inflammation, coagulation, dysregulated apoptosis, focal hypoxia, activation, and accumulation of myofibroblasts as well as extracellular matrix accumulation. This paper reviews current evidence on the association between lung cancer and interstitial lung diseases such as idiopathic pulmonary fibrosis, sarcoidosis, systemic sclerosis, dermatomyositis/polymyositis, rheumatoid arthritis, systemic lupus erythematosus, and pneumoconiosis. PMID:22900168

  18. DFT STUDY REVISES INTERSTITIAL CONFIGURATIONS IN HCP Zr

    SciTech Connect

    Samolyuk, German D; Golubov, Stanislav I; Osetskiy, Yury N; Stoller, Roger E

    2012-06-01

    Analysis of experimental result on microstructure evolution in irradiated Zr and alloys has demonstrated that available knowledge on self-interstitial defects in Zr is in contradiction. We therefore have initiated an extensive theoretical and modeling program to clarify this issue. In this report we present first ab initio calculations results of single SIA configurations in Zr. We demonstrate importance of simulations cell size, applied exchange-correlation functional and simulated c/a ratio. The results obtained demonstrate clearly that the most stable configurations are in basal plane and provide some evidences for enhanced interstitial transport along basal planes. The results obtained will be used in generation a new interatomic potential for Zr to be used in large-scale atomistic modeling of mechanisms relevant for radiation-induced microstructure evolution.

  19. Interstitially implanted I125 for prostate cancer using transrectal ultrasound

    SciTech Connect

    Greenburg, S.; Petersen, J.; Hansen-Peters, I.; Baylinson, W. )

    1990-11-01

    Prostate cancer is the third leading cause of death from cancer among men in the United States. Traditional treatments for prostate cancer are prostatectomy, external beam irradiation, and interstitial implantation of Iodine125 (I125) via laparotomy. These treatments are associated with significant morbidity and limitations. Based on experience with I125 interstitial implantation by transrectal ultrasound guidance for early-stage prostate cancer, it seems that this newer method of treatment has greater accuracy of placement and distribution of the isotope and has had few reported complications. The need for a surgical incision has been eliminated. Hospitalization time also has been decreased, creating the need for ambulatory and inpatient nurses to understand the importance of their respective roles in providing coordinated quality care for these patients. Nurses in these departments must have knowledge of the procedure, radiation safety, and common side effects related to the implant.

  20. Observation of interstitial molecular hydrogen in clathrate hydrates.

    PubMed

    Grim, R Gary; Barnes, Brian C; Lafond, Patrick G; Kockelmann, Winfred A; Keen, David A; Soper, Alan K; Hiratsuka, Masaki; Yasuoka, Kenji; Koh, Carolyn A; Sum, Amadeu K

    2014-09-26

    The current knowledge and description of guest molecules within clathrate hydrates only accounts for occupancy within regular polyhedral water cages. Experimental measurements and simulations, examining the tert-butylamine + H2 + H2O hydrate system, now suggest that H2 can also be incorporated within hydrate crystal structures by occupying interstitial sites, that is, locations other than the interior of regular polyhedral water cages. Specifically, H2 is found within the shared heptagonal faces of the large (4(3)5(9)6(2)7(3)) cage and in cavities formed from the disruption of smaller (4(4)5(4)) water cages. The ability of H2 to occupy these interstitial sites and fluctuate position in the crystal lattice demonstrates the dynamic behavior of H2 in solids and reveals new insight into guest-guest and guest-host interactions in clathrate hydrates, with potential implications in increasing overall energy storage properties. PMID:25139731

  1. Contaminated marine sediments: Water column and interstitial toxic effects

    SciTech Connect

    Burgess, R.M.; McKinney, R.A. ); Schweitzer, K.A. ); Phelps, D.K. )

    1993-01-01

    The toxicity that contaminated sediments may introduce into the water column has not been measured extensively. In order to quantify this potential toxicity, the seawater overlying two uncontaminated and three contaminated marine sediments was evaluated in the laboratory with the sea urchin Arbacia punctulata fertilization test. Concentration of polychlorinated biphenyls (PCBs) and copper, as representative contaminants, were also measured. To characterize sources of toxicity, samples were chemically manipulated using reversed-phase chromatography, cation exchange, and chelation. Water column toxicity and contaminant concentrations were higher in the suspended exposures than in bedded exposures. Interstitial water toxicity and contaminant concentrations were generally greater than either bedded or suspended exposures. Chemical manipulation indicated that the observed toxicity in water column exposures was probably caused by metallic and/or nonionic organic contaminants. Conversely, manipulation of interstitial water did not result in significantly reduced toxicity, suggesting that other toxicants such as ammonia and hydrogen sulfide may be active.

  2. Contaminated marine sediments: Water column and interstitial toxic effects

    SciTech Connect

    Burgess, R.M.; Schweitzer, K.A.; McKinney, R.A.; Phelps, D.K.

    1993-01-01

    The toxicity that contaminated sediments may introduce into the water column has not been measured extensively. In order to quantify this potential toxicity, the seawater overlying two uncontaminated and three contaminated marine sediments was evaluated in the laboratory with the sea urchin Arbacia punctulata fertilization test. Concentrations of polychlorinated biphenyls (PCBs) and copper, as representative contaminants, were also measured. To characterize sources of toxicity, samples were chemically manipulated using reversed-phase chromatography, cation exchange, and chelation. Water column toxicity and contaminant concentrations were higher in the suspended exposures than in bedded exposures. Interstitial water toxicity and contaminant concentrations were generally greater than either bedded or suspended exposures. Chemical manipulation indicated that the observed toxicity in water column exposures was probably caused by metallic and/or nonionic organic contaminants. Conversely, manipulation of interstitial waters did not result in significantly reduced toxicity, suggesting that other toxicants such as ammonia and hydrogen sulfide may be active.

  3. [Interstitial granulomatous dermatitis without arthritis: successful therapy with hydroxychloroquine].

    PubMed

    Gerbing, Eva Kristina; Metze, Dieter; Luger, Thomas A; Ständer, Sonja

    2003-02-01

    Interstitial granulomatous dermatitis is a rare entity characterized by cutaneous linear strands (the "rope sign") and rheumatoid arthritis. In the past years, 12 other cases have been described with variable cutaneous symptoms. All showed similar histological features, resembling those of granuloma annulare or 'palisaded neutrophilic and granulomatous dermatitis', suggesting a wide spectrum for a single entity. A 60-year-old patient presented with erythematous patches with an indurated, violaceous border resembling the "rope sign" on both flanks. The histological investigation revealed dense diffuse interstitial inflammatory infiltrates composed of eosinophils, neutrophils, lymphocytes, macrophages and multinucleated giant cells in the superficial and deep dermis. In the deep dermis, prominent eosinophilic degenerated collagen fibres with surrounding macrophages ('floating sign') occurred. In contrast to most previously described patients, our patient did not have arthralgias. The skin findings cleared following therapy with hydroxychloroquine. PMID:16285183

  4. Interstitial Cystitis: Characterization and Management of an Enigmatic Urologic Syndrome

    PubMed Central

    Nickel, J. Curtis

    2002-01-01

    The enigmatic urologic condition known as interstitial cystitis has an estimated prevalence of 0.01% to 0.50% of the female population. Its etiology is unknown but may involve microbiologic, immunologic, mucosal, neurogenic, and/or other, as yet undefined, agents. There is no gold standard for the diagnosis of interstitial cystitis; rather, it is a diagnosis of exclusion. It is impossible to provide a purely evidence-based treatment strategy, but review of available evidence suggests that conservative supportive therapy (including diet modification); oral treatment with pentosan polysulfate, amitriptyline, hydroxyzine, or cimetidine; and intravesical treatments with heparinoids, dimethyl sulfoxide, alkalized lidocaine, or bacille Calmette-Guérin may be effective in some patients. PMID:16985667

  5. Interstitial Lung Disease with ANCA-associated Vasculitis

    PubMed Central

    Katsumata, Yasuhiro; Kawaguchi, Yasushi; Yamanaka, Hisashi

    2015-01-01

    The association between interstitial lung disease (ILD) and anti-neutrophil cytoplasmic antibody (ANCA)-associated vasculitis (AAV), particularly microscopic polyangiitis (MPA), has been described in a number of case reports and case series reports in the last 2 decades. In addition, patients with pulmonary fibrosis and ANCA positivity but without other manifestations of systemic vasculitis have also been reported. Pulmonary fibrosis was clinically manifested at the time of diagnosis in the majority of AAV patients that developed this condition. Moreover, ANCA-positive conversion occurs in patients initially diagnosed with idiopathic pulmonary fibrosis, and as a result, other manifestations of systemic vasculitis develop in some of these patients. There is significant predominance of myeloperoxidase (MPO)-ANCA and MPA in patients with AAV and ILD. Radiological and pathological findings generally demonstrate usual interstitial pneumonia (pattern) in the lungs of these patients. In most studies, AAV patients with ILD have a worse prognosis than those without it. PMID:26448696

  6. Gastroesophageal Reflux Disease in Children with Interstitial Lung Disease.

    PubMed

    Dziekiewicz, M A; Karolewska-Bochenek, K; Dembiński, Ł; Gawronska, A; Krenke, K; Lange, J; Banasiuk, M; Kuchar, E; Kulus, M; Albrecht, P; Banaszkiewicz, A

    2016-01-01

    Gastroesophageal reflux disease is common in adult patients with interstitial lung disease. However, no data currently exist regarding the prevalence and characteristics of the disease in pediatric patients with interstitial lung disease. The aim of the present study was to prospectively assess the incidence of gastroesophageal reflux disease and characterize its features in children with interstitial lung disease. Gastroesophageal reflux disease was established based on 24 h pH-impedance monitoring (MII-pH). Gastroesophageal reflux episodes (GERs) were classified according to widely recognized criteria as acid, weakly acid, weakly alkaline, or proximal. Eighteen consecutive patients (15 boys, aged 0.2-11.6 years) were enrolled in the study. Gastroesophageal reflux disease was diagnosed in a half (9/18) of children. A thousand GERs were detected by MII-pH (median 53.5; IQR 39.0-75.5). Of these, 585 (58.5 %) episodes were acidic, 407 (40.7 %) were weakly acidic, and eight (0.8 %) were weakly alkaline. There were 637 (63.7 %) proximal GERs. The patients in whom gastroesophageal reflux disease was diagnosed had a significantly higher number of proximal and total GERs. We conclude that the prevalence of gastroesophageal reflux disease in children with interstitial lung disease is high; thus, the disease should be considered regardless of presenting clinical symptoms. A high frequency of non-acid and proximal GERs makes the MII-pH method a preferable choice for the detection of reflux episodes in this patient population. PMID:27068927

  7. A case of DIPNECH presenting as usual interstitial pneumonia.

    PubMed

    Chatterjee, Kshitij; Kamimoto, Jorge Jo; Dunn, Andrew; Mittadodla, Enchala; Joshi, Manish

    2016-01-01

    Diffuse idiopathic pulmonary neuroendocrine cell hyperplasia (DIPNECH) is a rare disease that is classically described as presenting with cough, dyspnea, and wheezing in non-smoker middle aged females. Pulmonary function tests commonly demonstrate an obstructive pattern and CT of chest usually reveals diffuse air trapping with mosaic pattern. We present a case of patient with DIPNECH manifesting with restrictive pattern and as usual interstitial pneumonia on imaging. PMID:27238180

  8. Computerized Tomography: Its Role in Interstitial Brachytherapy of Pelvic Malignancies

    PubMed Central

    Kumar, P. Pradeep; Taylor, Judith; Jones, E.O.; McAnulty, Bruce

    1986-01-01

    The advantages of computerized tomography (CT) in the treatment planning of external beam radiation therapy have been shown in several studies. The authors extended the use of CT to the interstitial brachytherapy treatment planning of pelvic malignancies. CT was found to be invaluable in localizing pelvic tumors, selecting implant techniques, and checking the accuracy of the implant. ImagesFigure 1Figure 2Figure 3Figure 4Figure 5 PMID:3950985

  9. An atypical case of fulminant interstitial pneumonitis induced by carbamazepine.

    PubMed

    Narita, Hideyuki; Ozawa, Takuro; Nishiyama, Takahisa; Matsumoto, Shohei; Watanabe, Seigo; Isshiki, Atsushi

    2009-01-01

    Carbamazepine is a therapeutic anticonvulsant, used to manage pain. We often use it to treat trigeminal and post-herpes zoster neuralgias. Interstitial pneumonitis (IP) is a known adverse consequence of using carbamazepine, with bronchiolitis obliterans and organizing pneumonitis. (BOOP) drug-induced IP as typical examples. Here we described a patient with post-herpes zoster neuralgia, who suffered from drug-induced acute IP that differed from cases typically induced by carbamazepine. PMID:19149523

  10. A case of vildagliptin-induced interstitial pneumonia

    PubMed Central

    Kuse, Naoyuki; Abe, Shinji; Kuribayashi, Hidehiko; Inomata, Minoru; Saito, Hitoshi; Fukuda, Yuh; Gemma, Akihiko

    2016-01-01

    A 65-year-old Japanese male with type 2 diabetes mellitus was admitted to our hospital with a productive cough and worsening dyspnea. He had started receiving vildagliptin, which is one of the dipeptideylpeptidase-4 (DPP-4) inhibitors, several days before the appearance of his symptoms. Laboratory findings revealed markedly elevated levels of immunoglobulin E and Krebs von den Lungen-6. Chest computed tomography revealed ground-glass opacity with irregular reticulation throughout both lungs. Biopsy specimens by transbronchial lung biopsy showed subacute interstitial pneumonia and an organizing pneumonia pattern with acute alveolar injury. The drug lymphocyte stimulation test showed a positive result for vildagliptin. Withdrawal of vildagliptin and administration of glucocorticoid treatment improved his respiratory condition and radiological findings. Therefore, we diagnosed the patient with vildagliptin-induced interstitial pneumonia based on both his clinical course and pathological findings. Interstitial pneumonia as a side effect of vildagliptin is rare. It may be necessary to monitor the respiratory condition of patients upon administration of DPP-4 inhibitors until further evidence is obtained. PMID:27144110

  11. Unusual gestational choriocarcinoma arising in an interstitial pregnancy

    PubMed Central

    Meddeb, Sawsen; Rhim, Mohamed Salah; Zarrouk, Wissal; Bibi, Mohamed; Yacoubi, Mohamed Tahar; Khairi, Hedi

    2014-01-01

    INTRODUCTION Choriocarcinoma is a highly malignant trophoblastic neoplasm. Its association with ectopic pregnancy is very rare and usually with aggressive behavior. PRESENTATION OF CASE We report a new case arising in an interstitial pregnancy occurring in a 46-year-old woman. The patient was admitted for severe pelvic pain and abundant metrorrhagia. One month ago, she had had a laparoscopic resection of an interstitial pregnancy subsequent to failure of chemotherapy by methotrexate. The raise of serum βhCG level and the hyperechoic intrauterine mass were in favor of gestational trophoblastic disease. Urgent laparotomy was performed for circulatory collapse. Hysterectomy was done. Histological examination revealed a choriocarcinoma. The patient underwent chemotherapy. Two years later, neither metastasis nor recurrence was detected. DISCUSSION Clinical diagnosis of primary interstitial choriocarcinoma is difficult, since it is rare and manifesting by non-specific abnormal vaginal bleeding. Imaging findings are also not helpful in ectopic location. The frequency of metastasis is related to the delayed diagnosis. Serial measurement of βhCG level was the most useful marker of diagnosis and follow up. Histopathological examination remains the only tool of the precise diagnosis. Choriocarcinoma has a very good prognosis even in advanced stages, since it is very chemosensitive. CONCLUSION The current trend of the treatment of ectopic pregnancy by conservative surgery requires adequate monitoring of βhCG and careful examination of pathologic specimens to avoid misdiagnosis of ectopic gestational trophoblastic disease. PMID:25290382

  12. The interstitial fraction of diffusivity of common dopants in Si

    NASA Astrophysics Data System (ADS)

    Gossmann, H.-J.; Haynes, T. E.; Stolk, P. A.; Jacobson, D. C.; Gilmer, G. H.; Poate, J. M.; Luftman, H. S.; Mogi, T. K.; Thompson, M. O.

    1997-12-01

    The relative contributions of interstitials and vacancies to diffusion of a dopant A in silicon are specified by the interstitial fraction of diffusivity, fA. Accurate knowledge of fA is required for predictive simulations of Si processing during which the point defect population is perturbed, such as transient enhanced diffusion. While experimental determination of fA is traditionally based on an underdetermined system of equations, we show here that it is actually possible to derive expressions that give meaningful bounds on fA without any further assumptions but that of local equilibrium. By employing a pair of dopants under the same point-defect perturbance, and by utilizing perturbances very far from equilibrium, we obtain experimentally fSb⩽0.012 and fB⩾0.98 at temperatures of ˜800 °C, which are the strictest bounds reported to date. Our results are in agreement with a theoretical expectation that a substitutional dopant in Si should either be a pure vacancy, or a pure interstitial(cy) diffuser.

  13. A case of vildagliptin-induced interstitial pneumonia.

    PubMed

    Kuse, Naoyuki; Abe, Shinji; Kuribayashi, Hidehiko; Inomata, Minoru; Saito, Hitoshi; Fukuda, Yuh; Gemma, Akihiko

    2016-01-01

    A 65-year-old Japanese male with type 2 diabetes mellitus was admitted to our hospital with a productive cough and worsening dyspnea. He had started receiving vildagliptin, which is one of the dipeptideylpeptidase-4 (DPP-4) inhibitors, several days before the appearance of his symptoms. Laboratory findings revealed markedly elevated levels of immunoglobulin E and Krebs von den Lungen-6. Chest computed tomography revealed ground-glass opacity with irregular reticulation throughout both lungs. Biopsy specimens by transbronchial lung biopsy showed subacute interstitial pneumonia and an organizing pneumonia pattern with acute alveolar injury. The drug lymphocyte stimulation test showed a positive result for vildagliptin. Withdrawal of vildagliptin and administration of glucocorticoid treatment improved his respiratory condition and radiological findings. Therefore, we diagnosed the patient with vildagliptin-induced interstitial pneumonia based on both his clinical course and pathological findings. Interstitial pneumonia as a side effect of vildagliptin is rare. It may be necessary to monitor the respiratory condition of patients upon administration of DPP-4 inhibitors until further evidence is obtained. PMID:27144110

  14. Outcome Measures for Clinical Trials in Interstitial Lung Diseases

    PubMed Central

    Lammi, Matthew R.; Baughman, Robert P.; Birring, Surinder S.; Russell, Anne-Marie; Ryu, Jay H.; Scholand, Marybeth; Distler, Oliver; LeSage, Daphne; Sarver, Catherine; Antoniou, Katerina; Highland, Kristin B.; Kowal-Bielecka, Otylia; Lasky, Joseph A.; Wells, Athol U.; Saketkoo, Lesley Ann

    2015-01-01

    The chronic fibrosing idiopathic interstitial pneumonias (IIPs) are a group of heterogeneous pulmonary parenchymal disorders described by radiologic and histological patterns termed usual interstitial pneumonia (UIP) and non-specific interstitial pneumonia (NSIP). These include idiopathic pulmonary fibrosis (IPF) and those related to connective tissue disease (CTD) and are associated with substantial morbidity and mortality. Beyond the importance of establishing an appropriate diagnosis, designing optimal clinical trials for IIPs has been fraught with difficulties in consistency of clinical endpoints making power analyses, and the establishment of efficacy and interpretation of results across trials challenging. Preliminary recommendations, developed by rigorous consensus methods, proposed a minimum set of outcome measures, a ‘core set’, to be incorporated into future clinical trials (Saketkoo et al, THORAX. 2014.). This paper sets out to examine the candidate instruments for each domain (Dyspnea, Cough, Health Related Quality of Life, Imaging, Lung Physiology and Function, Mortality). Candidate measures that were not selected as well as measures that were not available for examination at the time of the consensus process will also be discussed. PMID:27019654

  15. Interstitial pneumonitis after bone marrow transplantation. Assessment of risk factors

    SciTech Connect

    Weiner, R.S.; Bortin, M.M.; Gale, R.P.; Gluckman, E.; Kay, H.E.; Kolb, H.J.; Hartz, A.J.; Rimm, A.A.

    1986-02-01

    Data from 932 patients with leukemia who received bone marrow transplants were analyzed to determine factors associated with an increased risk of developing interstitial pneumonitis. Interstitial pneumonitis developed in 268 patients for a 2-year actuarial incidence of 35 +/- 4% (SD) and with a mortality rate of 24%. Six factors were associated with an increased risk: use of methotrexate rather than cyclosporine after transplantation (relative risk, 2.3; p less than 0.0002); older age (relative risk, 2.1; p less than 0.0001); presence of severe graft-versus-host disease (relative risk, 1.9; p less than 0.003); long interval from diagnosis to transplantation (relative risk, 1.6; p less than 0.002); performance ratings before transplantation of less than 100% (relative risk, 2.1; p less than 0.0001); and high dose-rates of irradiation in patients given methotrexate after transplantation (relative risk, 3.2; p less than 0.03). The risk of developing interstitial pneumonitis ranged from 8% in patients with none of these adverse risk factors to 94% in patients with all six. These findings may help to identify patients at high risk for this complication.

  16. Assessment of Host-Associated Genetic Differentiation among Phenotypically Divergent Populations of a Coral-Eating Gastropod across the Caribbean

    PubMed Central

    Johnston, Lyza; Miller, Margaret W.; Baums, Iliana B.

    2012-01-01

    Host-associated adaptation is emerging as a potential driver of population differentiation and speciation for marine organisms with major implications for ecosystem structure and function. Coralliophila abbreviata are corallivorous gastropods that live and feed on most of the reef-building corals in the tropical western Atlantic and Caribbean. Populations of C. abbreviata associated with the threatened acroporid corals, Acropora palmata and A. cervicornis, display different behavioral, morphological, demographic, and life-history characteristics than those that inhabit other coral host taxa, indicating that host-specific selective forces may be acting on C. abbreviata. Here, we used newly developed polymorphic microsatellite loci and mitochondrial cytochrome b sequence data to assess the population genetic structure, connectivity, and demographic history of C. abbreviata populations from three coral host taxa (A. palmata, Montastraea spp., Mycetophyllia spp.) and six geographic locations across the Caribbean. Analysis of molecular variance provided some evidence of weak and possibly geographically variable host-associated differentiation but no evidence of differentiation among sampling locations or major oceanographic regions, suggesting high gene flow across the Caribbean. Phylogenetic network and Bayesian clustering analyses supported a hypothesis of a single panmictic population as individuals failed to cluster by host or sampling location. Demographic analyses consistently supported a scenario of population expansion during the Pleistocene, a time of major carbonate reef development in the region. Although further study is needed to fully elucidate the interactive effects of host-associated selection and high gene flow in this system, our results have implications for local and regional community interactions and impact of predation on declining coral populations. PMID:23133600

  17. Stable isotopic evidence of salinity change: Influence on the evolution of melanopsid gastropods in the late miocene pannonian basin

    SciTech Connect

    Geary, D.H.; Rich, J.; Valley, J.W.; Baker, K. )

    1989-11-01

    The radiation of the gastropod Melanopsis in the Pannonian basin of eastern and central Europe provides an excellent case study of the tempo and mechanisms of evolutionary diversification. We analyzed the carbon and oxygen isotopic ratios of melanopsid shells from before, during, and after the radiation in order to provide a more detailed paleoenvironmental frame-work in which to interpret the morphological changes observed. The authors samples fall into two groups: those from before and during the radiation (late Sarmatian and Pannonian stages) form a tight cluster; a second, more scattered group of points represents samples from after the radiation (Pontian Stage). The late Sarmatian-Pannonian samples have higher ratios of both isotopes (means of {minus}2.11 for {delta}{sup 18}O, and 1.27 for {delta}{sup 13}C) than do the succeeding Pontian Stage samples ({minus}4.16 for {minus}2.22, respectively). We interpret this shift as indicative of a basinwide drop in salinity, an interpretation supported by paleofaunal evidence. Our isotopic data refine the environmental scenario in two important ways. The tight cluster of late Sarmatian-Pannonian data indicates that the shallow waters of the basin were relatively uniform and relatively stable with respect to salinity, rather than locally variable or steadily changing across this time interval. The shift to fresher water in the Pontian Stage coincides with the extinction of two widespread and abundant melanopsid species, but several species go extinct earlier than the salinity drop, and two species pass through it seemingly unaffected.

  18. Developmental analysis reveals labial and subradular ganglia and the primary framework of the nervous system in nudibranch gastropods.

    PubMed

    Page, L R

    1993-11-01

    Previous ultrastructural observations on late stage larvae of dorid nudibranchs (Gastropoda, Opisthobranchia) revealed two pairs of ganglia within the base of the foot that do not have obvious counterparts in existing descriptions of other gastropod larvae [Chia and Koss (1989). Cell Tiss. Res. 256:17-26.] One of these ganglionic pairs has been implicated in the initiation of settlement preceding metamorphosis [Arkett et al. (1989). Biol. Bull. 176:155-160.] By examining neurogenesis in sequential larval stages, I have found that the pattern of connectives and commissures associated with these enigmatic ganglia is comparable to patterns found in less consolidated adult nervous systems of chitons, monoplacophorans, and archaeogastropods. These comparative data suggest that the two pairs of ganglia in dorid nudibranch larvae are homologues of labial and subradular ganglia. The labial ganglia become incorporated into the cerebral ganglia at metamorphosis. In an attempt to integrate anatomical and developmental observations with behavioral and neurophysiological results, I suggest that receptor cells of the larval labial ganglia may become postmetamorphic primary mechanoreceptors of the oral tube, which have central cell bodies within the "cerebral" ganglia and which help coordinate feeding. Results of this study also address a larger evolutionary issue by questioning the traditional model of an ancestral molluscan nervous system that consists of four longitudinal nerve cords that arise from separate sites along a circumesophageal nerve ring. This pattern results from secondary connections in nudibranchs and possibly other molluscs. The primary condition of a single axon bundle emerging from each cerebral ganglion is more similar to the developing nervous system in polychaete annelids than what has been recognized previously. PMID:8283184

  19. Gastropod arginine kinases from Cellana grata and Aplysia kurodai. Isolation and cDNA-derived amino acid sequences.

    PubMed

    Suzuki, T; Inoue, N; Higashi, T; Mizobuchi, R; Sugimura, N; Yokouchi, K; Furukohri, T

    2000-12-01

    Arginine kinase (AK) was isolated from the radular muscle of the gastropod molluscs Cellana grata (subclass Prosobranchia) and Aplysia kurodai (subclass Opisthobranchia), respectively, by ammonium sulfate fractionation, Sephadex G-75 gel filtration and DEAE-ion exchange chromatography. The denatured relative molecular mass values were estimated to be 40 kDa by sodium dodecyl sulfate-polyacrylamide gel electrophoresis. The isolated enzyme from Aplysia gave a Km value of 0.6 mM for arginine and a Vmax value of 13 micromole Pi min(-1) mg protein(-1) for the forward reaction. These values are comparable to other molluscan AKs. The cDNAs encoding Cellana and Aplysia AKs were amplified by polymerase chain reaction, and the nucleotide sequences of 1,608 and 1,239 bp, respectively, were determined. The open reading frame for Cellana AK is 1044 nucleotides in length and encodes a protein with 347 amino acid residues, and that for A. kurodai is 1077 nucleotides and 354 residues. The cDNA-derived amino acid sequences were validated by chemical sequencing of internal lysyl endopeptidase peptides. The amino acid sequences of Cellana and Aplysia AKs showed the highest percent identity (66-73%) with those of the abalone Nordotis and turbanshell Battilus belonging to the same class Gastropoda. These AK sequences still have a strong homology (63-71%) with that of the chiton Liolophura (class Polyplacophora), which is believed to be one of the most primitive molluscs. On the other hand, these AK sequences are less homologous (55-57%) with that of the clam Pseudocardium (class Bivalvia), suggesting that the biological position of the class Polyplacophora should be reconsidered. PMID:11281267

  20. Application of community phylogenetic approaches to understand gene expression: differential exploration of venom gene space in predatory marine gastropods

    PubMed Central

    2014-01-01

    Background Predatory marine gastropods of the genus Conus exhibit substantial variation in venom composition both within and among species. Apart from mechanisms associated with extensive turnover of gene families and rapid evolution of genes that encode venom components (‘conotoxins’), the evolution of distinct conotoxin expression patterns is an additional source of variation that may drive interspecific differences in the utilization of species’ ‘venom gene space’. To determine the evolution of expression patterns of venom genes of Conus species, we evaluated the expression of A-superfamily conotoxin genes of a set of closely related Conus species by comparing recovered transcripts of A-superfamily genes that were previously identified from the genomes of these species. We modified community phylogenetics approaches to incorporate phylogenetic history and disparity of genes and their expression profiles to determine patterns of venom gene space utilization. Results Less than half of the A-superfamily gene repertoire of these species is expressed, and only a few orthologous genes are coexpressed among species. Species exhibit substantially distinct expression strategies, with some expressing sets of closely related loci (‘under-dispersed’ expression of available genes) while others express sets of more disparate genes (‘over-dispersed’ expression). In addition, expressed genes show higher dN/dS values than either unexpressed or ancestral genes; this implies that expression exposes genes to selection and facilitates rapid evolution of these genes. Few recent lineage-specific gene duplicates are expressed simultaneously, suggesting that expression divergence among redundant gene copies may be established shortly after gene duplication. Conclusions Our study demonstrates that venom gene space is explored differentially by Conus species, a process that effectively permits the independent and rapid evolution of venoms in these species. PMID:24903151

  1. Historical and recent processes shaping the geographic range of a rocky intertidal gastropod: phylogeography, ecology, and habitat availability

    PubMed Central

    Fenberg, Phillip B; Posbic, Karine; Hellberg, Michael E

    2014-01-01

    Factors shaping the geographic range of a species can be identified when phylogeographic patterns are combined with data on contemporary and historical geographic distribution, range-wide abundance, habitat/food availability, and through comparisons with codistributed taxa. Here, we evaluate range dynamism and phylogeography of the rocky intertidal gastropod Mexacanthina lugubris lugubris across its geographic range – the Pacific coast of the Baja peninsula and southern California. We sequenced mitochondrial DNA (CO1) from ten populations and compliment these data with museum records, habitat availability and range-wide field surveys of the distribution and abundance of M. l. lugubris and its primary prey (the barnacle Chthamalus fissus). The geographic range of M. l. lugubris can be characterized by three different events in its history: an old sundering in the mid-peninsular region of Baja (∼ 417,000 years ago) and more recent northern range expansion and southern range contraction. The mid-peninsular break is shared with many terrestrial and marine species, although M. l. lugubris represents the first mollusc to show it. This common break is often attributed to a hypothesized ancient seaway bisecting the peninsula, but for M. l. lugubris it may result from large habitat gaps in the southern clade. Northern clade populations, particularly near the historical northern limit (prior to the 1970s), have high local abundances and reside in a region with plentiful food and habitat – which makes its northern range conducive to expansion. The observed southern range contraction may result from the opposite scenario, with little food or habitat nearby. Our study highlights the importance of taking an integrative approach to understanding the processes that shape the geographic range of a species via combining range-wide phylogeography data with temporal geographic distributions and spatial patterns of habitat/food availability. PMID:25473477

  2. The reef builder gastropod Dendropoma petreaum - A proxy of short and long term climatic events in the Eastern Mediterranean

    NASA Astrophysics Data System (ADS)

    Sisma-Ventura, Guy; Guzner, Barak; Yam, Ruth; Fine, Maoz; Shemesh, Aldo

    2009-08-01

    High-resolution δ 18O and δ 13C records obtained from seven cores were drilled from ledges of the reef builder gastropod Dendropomapetreaum and used to reconstruct variations in the Levantine basin sea surface temperature, hydrology and productivity during the past 500 years. The δ 18O of the aragonite shell of living D . petreaum indicate that skeletal deposition occurs under isotopic equilibrium and faithfully record the temperature and surface water δ 18O during summer and autumn. The mean down core δ 18O record clearly captures global and local climatic events, such as the Little Ice Age (LIA) and the recent warming of surface waters in the Eastern Mediterranean. Comparison to the Western Mediterranean vermetid δ 18O record reveals changes in the freshwater/evaporation budgets of the two basins during cold and warm periods. The Eastern basin had lower surface temperatures and excess evaporation during the LIA and experienced a relatively larger warming and/or a decrease in freshwater/evaporation during the past 70 years. The D . petraeum δ 13C is strongly related to δ 13C of dissolved inorganic carbon and to the primary productivity of the surface water. The mean down core δ 13C record exhibits enrichment during the LIA maximum and a strong depletion trend during the last century. The LIA δ 13C enrichment is attributed to an increase in primary production and high nutrient levels which resulted from increased vertical mixing and upwelling. The last century δ 13C depletion is mostly related to the increased anthropogenic emissions of 13C depleted carbon dioxide and to a certain decrease in primary production. The data indicate that D. petraeum isotopic signatures are unique proxies for last 500 years high-resolution reconstruction of paleo-oceanographic environments in the Mediterranean and potentially in the sub-tropical Atlantic regions.

  3. Live coral cover may provide resilience to damage from the vermetid gastropod Dendropoma maximum by preventing larval settlement

    NASA Astrophysics Data System (ADS)

    Phillips, N. E.; Shima, J. S.; Osenberg, C. W.

    2014-12-01

    Dendropoma maximum is a vermetid gastropod (a sessile tube-forming snail) commonly associated with living corals throughout shallow-water reefs of the Indo-Pacific. Recent work suggests that, once established, this species can adversely affect growth and survival of corals. Here, we test the hypotheses that disturbances to live coral substrates (e.g., creation of bare patches) facilitate successful larval settlement and subsequent population growth of D. maximum, and conversely, that live coral inhibits D. maximum settlement. In the shallow lagoon of Moorea, French Polynesia, we selected patch reefs where D. maximum was either present or absent (to evaluate potential effects of resident adult conspecifics on recruitment) and established focal quadrats on each reef. In each quadrat, we either experimentally removed 50 % of live coral cover or left the quadrat with 100 % live coral cover. In addition, we deployed units of bare substrate (coral rubble) to each reef. We conducted a census of deployed substrates and quadrats after 6 months and found that D. maximum settled irrespective of resident vermetid populations, and only onto nonliving surfaces (i.e., cleared patches in quadrats, coral rubble, and marine epoxy). In laboratory experiments, we exposed larvae of D. maximum to live coral and found species-specific effects on survival of D. maximum larvae. Porites lobata and Pocillopora sp. killed larvae of D. maximum, Porites rus caused weaker mortality, and Millepora sp. had no effect on larval survival. Collectively, these results suggest that D. maximum requires disturbances that create bare patches to successfully settle onto reefs, and that a high cover of living corals contributes resilience to reefs by limiting settlement opportunities of a species known to reduce coral growth and survival.

  4. Functional Authentication of a Novel Gastropod Gonadotropin-Releasing Hormone Receptor Reveals Unusual Features and Evolutionary Insight.

    PubMed

    Kavanaugh, Scott I; Tsai, Pei-San

    2016-01-01

    A gonadotropin-releasing hormone (GnRH)-like molecule was previously identified in a gastropod, Aplysia californica, and named ap-GnRH. In this study, we cloned the full-length cDNA of a putative ap-GnRH receptor (ap-GnRHR) and functionally authenticated this receptor as a bona fide ap-GnRHR. This receptor contains two potential translation start sites, each accompanied by a Kozak sequence, suggesting the translation of a long and a short form of the receptor is possible. The putative ap-GnRHR maintains the conserved structural motifs of GnRHR-like receptors and shares 45% sequence identity with the octopus GnRHR. The expression of the putative ap-GnRHR short form is ubiquitous in all tissues examined, whereas the long form is only expressed in parts of the central nervous system, osphradium, small hermaphroditic duct, and ovotestis. The cDNA encoding the long or the short receptor was transfected into the Drosophila S2 cell line and subject to a radioreceptor assay using 125I-labeled ap-GnRH as the radioligand. Further, the transfected cells were treated with various concentrations of ap-GnRH and measured for the accumulation of cAMP and inositol monophosphate (IP1). Radioreceptor assay revealed that only the long receptor bound specifically to the radioligand. Further, only the long receptor responded to ap-GnRH with an increased accumulation of IP1, but not cAMP. Our studies show that despite the more prevalent expression of the short receptor, only the long receptor is the functional ap-GnRHR. Importantly, this is only the second report on the authentication of a protostome GnRHR, and based on the function and the phylogenetic grouping of ap-GnRHR, we suggest that this receptor is more similar to protostome corazonin receptors than chordate GnRHRs. PMID:27467252

  5. Functional Authentication of a Novel Gastropod Gonadotropin-Releasing Hormone Receptor Reveals Unusual Features and Evolutionary Insight

    PubMed Central

    Kavanaugh, Scott I.

    2016-01-01

    A gonadotropin-releasing hormone (GnRH)-like molecule was previously identified in a gastropod, Aplysia californica, and named ap-GnRH. In this study, we cloned the full-length cDNA of a putative ap-GnRH receptor (ap-GnRHR) and functionally authenticated this receptor as a bona fide ap-GnRHR. This receptor contains two potential translation start sites, each accompanied by a Kozak sequence, suggesting the translation of a long and a short form of the receptor is possible. The putative ap-GnRHR maintains the conserved structural motifs of GnRHR-like receptors and shares 45% sequence identity with the octopus GnRHR. The expression of the putative ap-GnRHR short form is ubiquitous in all tissues examined, whereas the long form is only expressed in parts of the central nervous system, osphradium, small hermaphroditic duct, and ovotestis. The cDNA encoding the long or the short receptor was transfected into the Drosophila S2 cell line and subject to a radioreceptor assay using 125I-labeled ap-GnRH as the radioligand. Further, the transfected cells were treated with various concentrations of ap-GnRH and measured for the accumulation of cAMP and inositol monophosphate (IP1). Radioreceptor assay revealed that only the long receptor bound specifically to the radioligand. Further, only the long receptor responded to ap-GnRH with an increased accumulation of IP1, but not cAMP. Our studies show that despite the more prevalent expression of the short receptor, only the long receptor is the functional ap-GnRHR. Importantly, this is only the second report on the authentication of a protostome GnRHR, and based on the function and the phylogenetic grouping of ap-GnRHR, we suggest that this receptor is more similar to protostome corazonin receptors than chordate GnRHRs. PMID:27467252

  6. Proteomic Analysis of the Reproductive Organs of the Hermaphroditic Gastropod Lymnaea stagnalis Exposed to Different Endocrine Disrupting Chemicals

    PubMed Central

    Giusti, Arnaud; Leprince, Pierre; Mazzucchelli, Gabriel; Thomé, Jean-Pierre; Lagadic, Laurent; Ducrot, Virginie; Joaquim-Justo, Célia

    2013-01-01

    Many studies have reported perturbations of mollusc reproduction following exposure to low concentrations (ng/L range) of endocrine disrupting chemicals (EDCs). However, the mechanisms of action of these molecules on molluscs are still poorly understood. Investigation of the modifications of protein expression in organisms exposed to chemicals using proteomic methods can provide a broader and more comprehensive understanding of adverse impacts of pollution on organisms than conventional biochemical biomarkers (e.g., heat-shock proteins, metallothioneins, GST, EROD). In this study we have investigated the impacts of four chemicals, which exhibit different endocrine disrupting properties in vertebrates, on the proteome of the hermaphroditic freshwater pulmonate gastropod Lymnaea stagnalis after 21 days of exposure. Testosterone, tributyltin, chlordecone and cyproterone acetate were chosen as tested compounds as they can induce adverse effects on the reproduction of this snail. The 2D-DIGE method was used to identify proteins whose expression was affected by these compounds. In addition to modifying the expression of proteins involved in the structure and function of the cytoskeleton, chemicals had impacts on the expression of proteins involved in the reproduction of L. stagnalis. Exposure to 19.2 µg/L of chlordecone increased the abundance of ovipostatin, a peptide transmitted during mating through seminal fluid, which reduces oviposition in this species. The expression of yolk ferritin, the vitellogenin equivalent in L. stagnalis, was reduced after exposure to 94.2 ng Sn/L of tributyltin. The identification of yolk ferritin and the modification of its expression in snails exposed to chemicals were refined using western blot analysis. Our results showed that the tested compounds influenced the abundance of yolk ferritin in the reproductive organs. Alteration in proteins involved in reproductive pathways (e.g., ovipostatin and yolk ferritin) could constitute relevant

  7. Demographic responses to multi-generation cadmium exposure in two strains of the freshwater gastropod, Biomphalaria glabrata.

    SciTech Connect

    Salice, Christopher J.; Miller, Thomas J.; Roesijadi, Guritno

    2008-08-20

    A life table response experiment (LTRE) was used to quantify the population-level effects of continuous, multi-generation cadmium exposure on two strains of the freshwater gastropod, Biomphalaria glabrata; the parasite resistant BS90 and parasite susceptible NMRI strains. Snails were exposed to waterborne cadmium for three consecutive generations. Survival, growth and reproduction were measured empirically and incorporated into a stage-based, deterministic population model. Cadmium significantly affected hatching success, time to maturity and juvenile and adult survival in both strains. There were significant effects of generation on fecundity, hatching success time to maturity and juvenile survival in NMRI and time to maturity and adult survival in BS90. Cadmium significantly affected the population growth rate, lambda (λ), in BS90. Cadmium, generation and the cadmium x generation interaction had significant effects on λ in NMRI. At the high cadmium exposure, λ for NMRI showed a decrease from generation 1 to generation 2 followed by and increase from generation 2 to 3. Lambda in high cadmium BS90 steadily decreased over the three generations while NMRI at this same concentration was similar to the controls. The results indicated that strain-specific differences in response to multi-generation cadmium exposure are evident in B. glabrata. Moreover, effects seen in the first generation are not necessarily indicative of effects in subsequent generations. Changes in λ over the course of the three-generation exposure suggest that acclimation and/or adaptation to cadmium may have occurred, particularly in NMRI at the high cadmium exposure level.

  8. Freshwater Biogeography and Limnological Evolution of the Tibetan Plateau - Insights from a Plateau-Wide Distributed Gastropod Taxon (Radix spp.)

    PubMed Central

    von Oheimb, Parm Viktor; Albrecht, Christian; Riedel, Frank; Du, Lina; Yang, Junxing; Aldridge, David C.; Bößneck, Ulrich; Zhang, Hucai; Wilke, Thomas

    2011-01-01

    Background The Tibetan Plateau is not only the highest and largest plateau on earth; it is also home to numerous freshwater lakes potentially harbouring endemic faunal elements. As it remains largely unknown whether these lakes have continuously existed during the Last Glacial Maximum (LGM), questions arise as to whether taxa have been able to exist on the plateau since before the latest Pleistocene, from where and how often the plateau was colonized, and by which mechanisms organisms conquered remote high altitude lentic freshwater systems. In this study, species of the plateau-wide distributed freshwater gastropod genus Radix are used to answer these biogeographical questions. Methodology/Principal Findings Based on a broad spatial sampling of Radix spp. on the Tibetan Plateau, and phylogenetic analyses of mtDNA sequence data, three probably endemic and one widespread major Radix clade could be identified on the plateau. Two of the endemic clades show a remarkably high genetic diversity, indicating a relatively great phylogenetic age. Phylogeographical analyses of individuals belonging to the most widely distributed clade indicate that intra-plateau distribution cannot be explained by drainage-related dispersal alone. Conclusions/Significance Our study reveals that Radix spp. persisted throughout the LGM on the Tibetan Plateau. Therefore, we assume the continuous existence of suitable water bodies during that time. The extant Radix diversity on the plateau might have been caused by multiple colonization events combined with a relatively long intra-plateau evolution. At least one colonization event has a Palaearctic origin. In contrast to freshwater fishes, passive dispersal, probably by water birds, might be an important mechanism for conquering remote areas on the plateau. Patterns found in Radix spp. are shared with some terrestrial plateau taxa, indicating that Radix may be a suitable model taxon for inferring general patterns of biotic origin, dispersal and

  9. Adult exposure to the synthetic hormone 17α-ethynylestradiol affects offspring of the gastropods Nassarius burchardi and Nassarius jonasii.

    PubMed

    Borysko, Larissa; Ross, Pauline M

    2014-05-01

    The aim of this study was to determine whether adult exposure to endocrine disrupting compounds affects offspring using trans-generational testing. Adult estuarine dwelling gastropods Nassarius burchardi and Nassarius jonasii were exposed to the synthetic estrogen 17α-ethynylestradiol (EE2) to determine the effects on the development and survival of their offspring. Adults were maintained in synthetic seawater controls and EE2 treatments (0.005, 0.05, 0.5, 50µg/L) over a sixteen week period. Egg capsules were collected from the adults following four, ten and sixteen weeks of adult exposure and transferred to different EE2 exposure scenarios. Treatment concentrations were selected to represent changes in EE2 exposure that could occur over different periods in an organism's lifecycle. Egg capsules laid by adults were therefore transferred to control or EE2 treatments (0.005, 0.05, 0.5, 5, 50, 500µg/L) to develop until hatching. The percentage of egg capsules with unviable eggs and abnormalities, number of days for hatching to occur and hatching success were measured. The veliger larvae that hatched from egg capsules following two, eight and fourteen weeks of adult exposure to EE2 and controls were used in 96h acute toxicity tests with controls and EE2 treatments at concentrations of 0.5, 5, 50, 500, 1250, 2500, 4000µg/L. Exposure of adult N. burchardi and N. jonasii to EE2 affected the percentage of egg capsules with unviable eggs, the development and hatching success of embryos and survival of veligers. These toxicity tests produced a complex set of results with different responses in developing eggs and veliger larvae to the adult EE2 treatments and length of adult exposure. This study demonstrates the importance of trans-generational testing and adult exposure scenarios in toxicity investigations. PMID:24462525

  10. [Effects mangrove conversion to pasture on density and shell size of two gastropods in the Turbo River Delta (Urabá Gulf, Caribbean coast of Colombia)].

    PubMed

    Blanco, Juan F; Castaño, María C

    2012-12-01

    Mangrove deforestation is widespread in the Greater Caribbean but its impact on macrobenthos has not been evaluated to date. In order to assess the impact of mangrove conversion to pasture, densities and shell sizes of two dominant gastropods (Neritina virginea and Melampus coffeus) were compared among four mangrove types: 1) Rhizophora mangle-dominated fringing mangroves, 2) Avicennia germinans-dominated basin mangroves, 3) Mixed-species basin mangroves, and 4) A. germinans- basin mangroves converted to pastures, in the Turbo River Delta (Urabá Gulf, Colombia). Mangrove types were polygon-delimited with satellite images and color aerial photographs were taken in 2009. Various (n<5) polygons per mangrove type were sampled in January, July and December 2009, and a total (n<20) 0.025m2-quadrats were randomly placed along each polygon. Forest structure variables, pore-water physicochemical variables and sediment-grain metrics were measured in the four mangrove types. Mean density and size of both gastropod species were measured. The results showed that the mean density and size of both species were significantly greater in R. mangle-fringing mangroves. N. virginea density decreased gradually towards the A. germinans-basin mangroves seemly related to the diadromous life-history. This species nearly disappeared in the neighboring pastures because individuals were constrained to a few remaining flooded areas. In the pastures, M. coffeus individuals were clumped in the remaining A. germinans trees due to its climbing behavior as a pulmonate. We hypothesize that the decline of these two gastropods was related to physical microhabitat (e.g. trees, prop roots, and seedlings) degradation, and alteration of soil properties (e.g. temperature, pH, organic matter content). Finally, we also hypothesize that the local extinction of N. virginea due to clear-cutting may exert strong negative effects on the ecosystem function because it is a dominant omnivore. PMID:23342523

  11. Phylogenetic analysis of euthyneuran gastropods from sea to land mainly based on comparative mitogenomic of four species of Onchidiidae (Mollusca: Gastropoda: Pulmonata).

    PubMed

    Sun, Bian Na; Wei, Luan Luan; Shen, He Ding; Wu, Hong Xi; Wang, Dong Feng

    2016-09-01

    We generated complete mitochondrial genome sequences data for 4 genera (Onchidium, Platevindex, Paraoncidium and Peronia) in Onchidiidae to construct a phylogenetic tree in conjunction with other 9 existing data among gastropods. The topology showed that the taxa clustered into two main groups of four species, one of which included Onchidium struma and the Platevindex mortoni, the other Paraoncidium reevesii and Peronia verruculata. The process in Pulmonata from sea to land in accordance with the evolution of respiratory organs from branchial gills to pulmonary cavity has been shown. This will also constitute a framework for phylogeny evolution analysis, systematic classfication of Onchidiidae and other euthyneurans (pulmonates and opisthobranchs). PMID:25648917

  12. Renal failure due to granulomatous interstitial nephritis in native and allograft renal biopsies: experience from a tertiary care hospital.

    PubMed

    Gupta, Pallav; Rana, D S; Bhalla, A K; Gupta, Ashwini; Malik, Manish; Gupta, Anurag; Bhargava, Vinant

    2014-10-01

    Granulomatous interstitial nephritis is a rare cause of renal failure in both native and allograft renal biopsies. Drugs and sarcoidosis are the commonest causes of granulomatous interstitial nephritis as reported in Western countries. Unlike the west, tuberculosis is the commonest cause of granulomatous interstitial nephritis in Indian subcontinent. The etiological factors, clinical course, glomerular and tubulointerstitial changes associated with granulomatous interstitial nephritis have been analyzed in the present study along with the outcome in patients with granulomatous interstitial nephritis. PMID:25155448

  13. Analysis of Dissolved Organic Nutrients in the Interstitial Water of Natural Biofilms.

    PubMed

    Tsuchiya, Yuki; Eda, Shima; Kiriyama, Chiho; Asada, Tomoya; Morisaki, Hisao

    2016-07-01

    In biofilms, the matrix of extracellular polymeric substances (EPSs) retains water in the interstitial region of the EPS. This interstitial water is the ambient environment for microorganisms in the biofilms. The nutrient condition in the interstitial water may affect microbial activity in the biofilms. In the present study, we measured the concentrations of dissolved organic nutrients, i.e., saccharides and proteins, contained in the interstitial water of biofilms formed on the stones. We also analyzed the molecular weight distribution, chemical species, and availability to bacteria of some saccharides in the interstitial water. Colorimetric assays showed that the concentrations of saccharides and proteins in the biofilm interstitial water were significantly higher (ca. 750 times) than those in the surrounding lake waters (p < 0.05). Chromatographic analyses demonstrated that the saccharides in the interstitial waters were mainly of low molecular-weight saccharides such as glucose and maltose, while proteins in the interstitial water were high molecular-weight proteins (over 7000 Da). Bacterial growth and production of EPS occurred simultaneously with the decrease in the low molecular-weight saccharide concentrations when a small portion of biofilm suspension was inoculated to the collected interstitial water, suggesting that the dissolved saccharides in the interstitial water support bacterial growth and formation of biofilms. PMID:26961802

  14. LETTER TO THE EDITOR: Ab initio calculation of the local vibrational modes of the interstitial boron interstitial oxygen defect in Si

    NASA Astrophysics Data System (ADS)

    Carvalho, A.; Jones, R.; Coutinho, J.; Briddon, P. R.

    2005-05-01

    The first stage in the anneal of interstitial boron below room temperature in Czochralski-grown Si (Cz-Si) is the formation of the interstitial boron-oxygen (BiOi) defect. First principles modelling show that this defect has a structure similar to the interstitial carbon-oxygen complex. However, whereas the latter defect has been characterized by local vibrational mode infra-red spectroscopy, there is no information on the local vibrational modes of BiOi even though the defect is known to be a dominant interstitial boron defect in irradiated Cz-Si. Here, we carry out density functional calculations to determine its vibrational modes and respective isotope shifts, concluding that it possesses six local vibrational modes. As in the case of CiOi, we find an oxygen-related vibrational mode with frequency far below the 1136 cm-1 of the oxygen interstitial, characteristic of the three-fold coordinated oxygen.

  15. Clinical Features of Idiopathic Interstitial Pneumonia with Systemic Sclerosis-Related Autoantibody in Comparison with Interstitial Pneumonia with Systemic Sclerosis

    PubMed Central

    Yamakawa, Hideaki; Hagiwara, Eri; Kitamura, Hideya; Yamanaka, Yumie; Ikeda, Satoshi; Sekine, Akimasa; Baba, Tomohisa; Iso, Shinichiro; Okudela, Koji; Iwasawa, Tae; Takemura, Tamiko; Kuwano, Kazuyoshi; Ogura, Takashi

    2016-01-01

    Background Patients with idiopathic interstitial pneumonias sometimes have a few features of connective tissue disease (CTD) and yet do not fulfil the diagnostic criteria for any specific CTD. Objective This study was conducted to elucidate the characteristics, prognosis, and disease behavior in patients with interstitial lung disease (ILD) associated with systemic sclerosis (SSc)-related autoantibodies. Methods We retrospectively analyzed medical records of 72 ILD patients: 40 patients with SSc (SSc-ILD) and 32 patients with SSc-related autoantibody-positive ILD but not with CTD (ScAb-ILD), indicating lung-dominant CTD with SSc-related autoantibody. Results Patients with SSc-ILD were predominantly females and non-smokers, and most had nonspecific interstitial pneumonia confirmed by high-resolution computed tomography (HRCT) and pathological analysis. However, about half of the patients with ScAb-ILD were male and current or ex-smokers. On HRCT analysis, honeycombing was more predominant in patients with ScAb-ILD than with SSc-ILD. Pathological analysis showed the severity of vascular intimal or medial thickening in the SSc-ILD patients to be significantly higher than that in the ScAb-ILD patients. Survival curves showed that the patients with ScAb-ILD had a significantly poorer outcome than those with SSc-ILD. Conclusion Data from this study suggest that lung-dominant CTD with SSc-related autoantibody is a different disease entity from SSc-ILD. PMID:27564852

  16. Rare idiopathic interstitial pneumonias: LIP and PPFE and rare histologic patterns of interstitial pneumonias: AFOP and BPIP.

    PubMed

    Kokosi, Maria A; Nicholson, Andrew G; Hansell, David M; Wells, Athol U

    2016-05-01

    In the 2013 reclassification of the idiopathic interstitial pneumonias (IIPs), two rare IIPs (idiopathic lymphoid interstitial pneumonia (LIP), idiopathic pleuroparenchymal fibroelastosis (IPPFE)) and two rare histologic patterns (acute fibrinous and organizing pneumonia (AFOP), bronchiolocentric pattern of interstitial pneumonia (BPIP)) are described. All these entities are rare with small series published to date, mostly containing primary and secondary forms of disease. LIP is histologically characterized by diffuse polyclonal lymphoid cell infiltrate surrounding the airways and expanding the interstitium. Thin-walled cysts and diffuse ground glass are considered the typical radiologic features. The clinical course is highly variable with corticosteroid responsiveness evident in approximately half of cases. IPPFE is defined histologically by coexisting upper lobe pleural and intra-alveolar fibrosis with elastosis. Dense subpleural irregular fibrosis and consolidation are the cardinal radiologic features. A history of recurrent lower respiratory tract infection is frequent. Responses to immunomodulation have not been reported and the rate of progression appears to be highly variable. AFOP is a rare histologic pattern lying within the spectrum of acute/subacute lung injury, characterized by organizing pneumonia and intra-alveolar fibrin deposition without hyaline membranes. BPIP is characterized histologically by fibrosis and/or inflammation confined to the alveolar interstitium around bronchovascular bundles, overlapping with peribronchial metaplasia and fibrosis in some series. Currently, AFOP and BPIP are both best viewed as histological entities rather than true clinical disorders, in the absence of characteristic associated imaging patterns and clinical features. PMID:26627191

  17. Quantitative analysis of interstitial mast cells in AA and AL renal amyloidosis.

    PubMed

    Danilewicz, Marian; Wagrowska-Danilewicz, Małgorzata

    2002-01-01

    Eighteen renal biopsy specimens obtained from patients with AA-type renal amyloidosis (AA) and 11 from patients with AL-type renal amyloidosis (AL), for whom both light and electron microscopy as well as immunofluorescence microscopy and full clinical data were available, were examined quantitatively. The cases were selected on the basis of immunohistochemical studies. As a control, we used 10 biopsy specimens from the kidneys removed because of trauma. Morphometric investigations were carried out by a computer image analysis system to find an answer to the question of whether mast cells can correlate with tubulointerstitial fibrosis in AA and AL renal amyloidosis, and to examine the relationship between mast cells and interstitial alpha-smooth muscle actin (alpha-SMA) expression and interstitial infiltrates. The morphometric study revealed that the mean values of the interstitial tryptase-positive cells, expression of alpha-SMA, interstitial volume, CD68+, CD45RB+, CD43+ and CD20+ cells were increased in AA as compared with the AL group, most of them significantly. Most of these parameters were also significantly increased in both AA and AL patients as compared with the control group. In both the AA group and the AL group, there existed some significant positive correlations between interstitial tryptase-positive cells and interstitial expression of alpha-SMA, interstitial volume and CD68+ cells. Interestingly, in AA cases, but not in AL cases, we noted a significant relationship between interstitial tryptase-positive cells and CD43+ cells. Our findings demonstrate that mast cells belong to the constitutive cell types in the interstitium in renal amyloidosis, in particular in amyloid type A. In addition, in both the AA group and the AL group, the significant positive correlations between interstitial mast cell count and relative interstitial volume and interstitial expression of alpha-SMA suggest that these cells play a role in the development of interstitial

  18. The locomotion of marine and terrestrial gastropods: can the acceleration of the ventral pedal waves contribute to the generation of net propulsive forces?

    NASA Astrophysics Data System (ADS)

    Del Alamo, Juan C.; Rodroguez-Rodriguez, Javier; Lai, Janice; Lasheras, Juan C.

    2008-11-01

    Marine and terrestrial gastropods move by gliding over a ventral foot that is lubricated by secreted mucus (terrestrial) or simply by water (marine). The rim of the ventral foot generates suction forces that keep the animal adhered to the substrate. The central part of the foot produces a net propulsive force by generating trains of pedal waves through periodic muscle contractions. Recent experiments show that, in some gastropods, these pedal waves become faster and longer as they move forward, suggesting a mechanism for the generation of net propulsive forces by building a pressure difference across consecutive waves. We have investigated the efficiency of this mechanism through a theoretical analysis of a two-dimensional lubrication layer between a train of waves of slowly varying length and speed, and a flat, rigid, impermeable surface. The inhomogeneity of the speed and length of the pedal waves has been modeled through multiple-scale asymptotics. We have considered a Newtonian fluid to separate the effect of this inhomogeneity from the viscoelastic propulsion reported in previous works.

  19. Evolution of Pulmonate Gastropod Mitochondrial Genomes: Comparisons of Gene Organizations of Euhadra, Cepaea and Albinaria and Implications of Unusual Trna Secondary Structures

    PubMed Central

    Yamazaki, N.; Ueshima, R.; Terrett, J. A.; Yokobori, S. I.; Kaifu, M.; Segawa, R.; Kobayashi, T.; Numachi, K. I.; Ueda, T.; Nishikawa, K.; Watanabe, K.; Thomas, R. H.

    1997-01-01

    Complete gene organizations of the mitochondrial genomes of three pulmonate gastropods, Euhadra herklotsi, Cepaea nemoralis and Albinaria coerulea, permit comparisons of their gene organizations. Euhadra and Cepaea are classified in the same superfamily, Helicoidea, yet they show several differences in the order of tRNA and protein coding genes. Albinaria is distantly related to the other two genera but shares the same gene order in one part of its mitochondrial genome with Euhadra and in another part with Cepaea. Despite their small size (14.1-14.5 kbp), these snail mtDNAs encode 13 protein genes, two rRNA genes and at least 22 tRNA genes. These genomes exhibit several unusual or unique features compared to other published metazoan mitochondrial genomes, including those of other molluscs. Several tRNAs predicted from the DNA sequences possess bizarre structures lacking either the T stem or the D stem, similar to the situation seen in nematode mt-tRNAs. The acceptor stems of many tRNAs show a considerable number of mismatched basepairs, indicating that the RNA editing process recently demonstrated in Euhadra is widespread in the pulmonate gastropods. Strong selection acting on mitochondrial genomes of these animals would have resulted in frequent occurrence of the mismatched basepairs in regions of overlapping genes. PMID:9055084

  20. On the Origin of Large Interstitial Clusters in Displacement Cascades

    SciTech Connect

    Andrew, Calder F; Barashev, Aleksandr; Bacon, David J; Osetskiy, Yury N

    2010-01-01

    Displacement cascades with wide ranges of primary knock-on atom (PKA) energy and mass in iron were simulated using molecular dynamics. New visualisation techniques are introduced to show how the shock-front dynamics and internal structure of a cascade develop over time. These reveal that the nature of the final damage is determined early on in the cascade process. We define a zone (termed 'spaghetti') in which atoms are moved to new lattice sites and show how it is created by a supersonic shock-front expanding from the primary recoil event. A large cluster of self-interstitial atoms can form on the periphery of the spaghetti if a hypersonic recoil creates damage with a supersonic shock ahead of the main supersonic front. When the two fronts meet, the main one injects atoms into the low-density core of the other: these become interstitial atoms during the rapid recovery of the surrounding crystal. The hypersonic recoil occurs in less than 0.1 ps after the primary recoil and the interstitial cluster is formed before the onset of the thermal spike phase of the cascade process. The corresponding number of vacancies is then formed in the spaghetti core as the crystal cools, i.e. at times one to two orders of magnitude longer. By using the spaghetti zone to define cascade volume, the energy density of a cascade is shown to be almost independent of the PKA mass. This throws into doubt the conventional energy-density interpretation of an increased defect yield with increasing PKA mass in ion irradiation.

  1. Dose rate constant and energy spectrum of interstitial brachytherapy sources.

    PubMed

    Chen, Z; Nath, R

    2001-01-01

    In the past two years, several new manufacturers have begun to market low-energy interstitial brachytherapy seeds containing 125I and 103Pd. Parallel to this development, the National Institute of Standards and Technology (NIST) has implemented a modification to the air-kerma strength (S(K)) standard for 125I seeds and has also established an S(K) standard for 103Pd seeds. These events have generated a considerable number of investigations on the determination of the dose rate constants (inverted V) of interstitial brachytherapy seeds. The aim of this work is to study the general properties underlying the determination of dose rate constant and to develop a simple method for a quick and accurate estimation of dose rate constant. As the dose rate constant of clinical seeds is defined at a fixed reference point, we postulated that dose rate constant may be calculated by treating the seed as an effective point source when the seed's source strength is specified in S(K) and its source characteristics are specified by the photon energy spectrum measured in air at the reference point. Using a semi-analytic approach, an analytic expression for dose rate constant was derived for point sources with known photon energy spectra. This approach enabled a systematic study of dose rate constant as a function of energy. Using the measured energy spectra, the calculated dose rate constant for 125I model 6711 and 6702 seeds and for 192Ir seed agreed with the AAPM recommended values within +/-1%. For the 103Pd model 200 seed, the agreement was 5% with a recently measured value (within the +/-7% experimental uncertainty) and was within 1% with the Monte Carlo simulations. The analytic expression for dose rate constant proposed here can be evaluated using a programmable calculator or a simple spreadsheet and it provides an efficient method for checking the measured dose rate constant for any interstitial brachytherapy seed once the energy spectrum of the seed is known. PMID:11213926

  2. On the origin of large interstitial clusters in displacement cascades

    NASA Astrophysics Data System (ADS)

    Calder, A. F.; Bacon, D. J.; Barashev, A. V.; Osetsky, Yu. N.

    2010-03-01

    Displacement cascades with wide ranges of primary knock-on atom (PKA) energy and mass in iron were simulated using molecular dynamics. New visualisation techniques are introduced to show how the shock-front dynamics and internal structure of a cascade develop over time. These reveal that the nature of the final damage is determined early on in the cascade process. We define a zone (termed 'spaghetti') in which atoms are moved to new lattice sites and show how it is created by a supersonic shock-front expanding from the primary recoil event. A large cluster of self-interstitial atoms can form on the periphery of the spaghetti if a hypersonic recoil creates damage with a supersonic shock ahead of the main supersonic front. When the two fronts meet, the main one injects atoms into the low-density core of the other: these become interstitial atoms during the rapid recovery of the surrounding crystal. The hypersonic recoil occurs in less than 0.1 ps after the primary recoil and the interstitial cluster is formed before the onset of the thermal spike phase of the cascade process. The corresponding number of vacancies is then formed in the spaghetti core as the crystal cools, i.e. at times one to two orders of magnitude longer. By using the spaghetti zone to define cascade volume, the energy density of a cascade is shown to be almost independent of the PKA mass. This throws into doubt the conventional energy-density interpretation of an increased defect yield with increasing PKA mass in ion irradiation.

  3. [Drepanocytosis and diffuse interstitial pulmonary fibrosis (author's transl)].

    PubMed

    Raison, J; Krivitzky, A; Bentata-Pessayre, M; Volter, F; Delzant, G

    1981-01-01

    Respiratory disorders in homozygous drepanocytosis and double SC heterozygosis are mainly dependent on two factors : repeated infections with, more particularly, pneumococcus or mycoplasma, and epidoses of occlusion of the pulmonary circulation. Mutual reinforcement of these two factors occurs, in so far as the relative hypoxia of an infected lung increases the risk of falciform and thrombosis formation in the pulmonary arterioles. The particular physical and chemical properties of the drepanocyte red cell, and the anaemia, themselves lead to parallel disturbances in pulmonary circulation function and gas exchanges. Possible development of respiratory insufficiency is generally, therefore, the result of chronic pulmonary arterial hypertension. However, the results of respiratory function tests are often fairly analogous to those observed in moderate interstitial fibrosis : reduction in vital capacity, alveolo-capillary block, reduction in CO diffusion space, a shunt effect, and diminished pulmonary compliance. This problem is discussed in relation to findings of diffuse interstitial fibrosis in a 34-year-old man with double SC heterozygosis, who had numerous episodes of bone, abdominal, and pulmonary microinfarcts. The presence of a diffuse interstitial pulmonary fibrosis, evoked by radiological criteria and respiratory function tests and confirmed by transbronchial biopsy, no other aetiology being established, raises the question of the possible genesis of the fibrosis from repeated episodes of microvascular occlusion. Many factors may therefore be involved in the formation of fibrosis of this type, not only the pulmonary artery obstruction from the microthrombi but also the macrophagic perivascular inflammatory response related to the presence of foci of infarction and precipitation of pathological intravascular material. PMID:7337330

  4. A retired shipyard worker with rapidly progressive pulmonary interstitial fibrosis.

    PubMed Central

    Moy, E V; Hu, H; Christiani, D C

    1999-01-01

    We present a case of progressive interstitial fibrosis in a retired shipyard worker who was exposed to asbestos during the postwar era of the late 1940s and 1950s, when asbestos exposures in the workplace were not regulated. Forty years later, at 63 years of age, the patient presented with restrictive lung disease. The patient was diagnosed with asbestos-related pleural disease and parenchymal asbestosis. He remained stable for the next 7 years, but then he began to manifest rapid clinical progression, which raised the possibility of an unusual variant of asbestosis, a concomitant interstitial process, or an unrelated disease. Lung biopsy was not undertaken because of the patient's low pulmonary reserve and limited treatment options. An empiric trial of oral steroids was initiated, but his pulmonary status continued to deteriorate and he died of pulmonary failure at 72 years of age. Many diseases result in pulmonary interstitial fibrosis. Ideally, open lung biopsy should be performed, but this procedure inevitably causes complications in many patients with end-stage restrictive lung disease. Furthermore, while the presence of asbestos bodies in tissue sections is a sensitive and specific marker of asbestos exposure, neither this finding nor any other charge is a marker indicative of asbestosis or the severity of asbestosis. With the enactment of the Asbestos Standard in the United States, asbestos exposures have been decreasing in this country. However, industries that produce asbestos products and wastes continue to expand in developing countries. Prevention of asbestos-related lung disease should be a global endeavor, and asbestos exposures should be regulated in both developed and developing countries. Images Figure 1 Figure 2 Figure 3 Figure 4 PMID:10090713

  5. Interstitial cells of Cajal mediate mechanosensitive responses in the stomach

    NASA Astrophysics Data System (ADS)

    Won, Kyung-Jong; Sanders, Kenton M.; Ward, Sean M.

    2005-10-01

    Changes in motor activity are a basic response to filling of smooth muscle organs. Responses to gastric filling, for example, are thought to be regulated by neural reflexes. Here, we demonstrate a previously uncharacterized aspect of stretch-dependent responses in visceral smooth muscles that is mediated by mechanosensitive interstitial cells of Cajal. Length ramps were applied to the murine antral muscles while recording intracellular electrical activity and isometric force. Stretching muscles by an average of 27 ± 1% of resting length resulted in 5 mN of force. Increasing length caused membrane depolarization and increased slow-wave frequency. The responses were dependent on the rate of stretch. Stretch-dependent responses were not inhibited by neuronal antagonists or nifedipine. Increases in slow-wave frequency, but not membrane depolarization, were inhibited by reducing external Ca2+ (100 μM) and by Ni2+ (250 μM). Responses to stretch were inhibited by indomethacin (1 μM) and were absent in cyclooxygenase II-deficient mice, suggesting that cyclooxygenase II-derived eicosanoids may mediate these responses. Dual microelectrode impalements of muscle cells within the corpus and antrum showed that stretch-induced changes in slow-wave frequency uncoupled proximal-to-distal propagation of slow waves. This uncoupling could interfere with gastric peristalsis and impede gastric emptying. Stretch of antral muscles of W/WV mice, which lack intramuscular interstitial cells of Cajal, did not affect membrane depolarization or slow-wave frequency. These data demonstrate a previously uncharacterized nonneural stretch reflex in gastric muscles and provide physiological evidence demonstrating a mechanosensitive role for interstitial cells of Cajal in smooth muscle tissues. gastric compliance | pacemaker | stretch | slow waves | propagation

  6. Cleavage pattern and fate map of the mesentoblast, 4d, in the gastropod Crepidula: a hallmark of spiralian development

    PubMed Central

    2012-01-01

    Background Animals with a spiral cleavage program, such as mollusks and annelids, make up the majority of the superphylum Lophotrochozoa. The great diversity of larval and adult body plans in this group emerges from this highly conserved developmental program. The 4d micromere is one of the most conserved aspects of spiralian development. Unlike the preceding pattern of spiral divisions, cleavages within the 4d teloblastic sublineages are bilateral, representing a critical transition towards constructing the bilaterian body plan. These cells give rise to the visceral mesoderm in virtually all spiralians examined and in many species they also contribute to the endodermal intestine. Hence, the 4d lineage is an ideal one for studying the evolution and diversification of the bipotential endomesodermal germ layer in protostomes at the level of individual cells. Little is known of how division patterns are controlled or how mesodermal and endodermal sublineages diverge in spiralians. Detailed modern fate maps for 4d exist in only a few species of clitellate annelids, specifically in glossiphoniid leeches and the sludge worm Tubifex. We investigated the 4d lineage in the gastropod Crepidula fornicata, an established model system for spiralian biology, and in a closely related direct-developing species, C. convexa. Results High-resolution cell lineage tracing techniques were used to study the 4d lineage of C. fornicata and C. convexa. We present a new nomenclature to name the progeny of 4d, and report the fate map for the sublineages up through the birth of the first five pairs of teloblast daughter cells (when 28 cells are present in the 4d sublineage), and describe each clone’s behavior during gastrulation and later stages as these undergo differentiation. We identify the precise origin of the intestine, two cells of the larval kidney complex, the larval retractor muscles and the presumptive germ cells, among others. Other tissues that arise later in the 4d lineage

  7. A Novel Toll-Like Receptor (TLR) Influences Compatibility between the Gastropod Biomphalaria glabrata, and the Digenean Trematode Schistosoma mansoni

    PubMed Central

    Pila, Emmanuel A.; Tarrabain, Mahmoud; Kabore, Alethe L.; Hanington, Patrick C.

    2016-01-01

    shed S. mansoni cercariae 1-week before the susceptible controls. Our results represent the first functional characterization of a gastropod TLR, and demonstrate that BgTLR is an important snail immune receptor that is capable of influencing infection outcome following S. mansoni challenge. PMID:27015424

  8. A Novel Toll-Like Receptor (TLR) Influences Compatibility between the Gastropod Biomphalaria glabrata, and the Digenean Trematode Schistosoma mansoni.

    PubMed

    Pila, Emmanuel A; Tarrabain, Mahmoud; Kabore, Alethe L; Hanington, Patrick C

    2016-03-01

    shed S. mansoni cercariae 1-week before the susceptible controls. Our results represent the first functional characterization of a gastropod TLR, and demonstrate that BgTLR is an important snail immune receptor that is capable of influencing infection outcome following S. mansoni challenge. PMID:27015424

  9. First-principles calculations for interstitial Fe impurities in hcp Sc, Y, Ti, and Zr

    NASA Astrophysics Data System (ADS)

    Frota-Pessôa, S.; de Mello, L. A.; Petrilli, H. M.; Klautau, A. B.

    1993-12-01

    We have determined the electronic structure around interstitial Fe impurities in hcp Sc, Y, Ti, and Zr. The self-consistent calculations take lattice relaxation into account and were performed using the recently developed real space linear muffin-tin orbital scheme. This is the first time that such realistic calculations have been performed for isolated interstitial impurities in metals. In agreement with experiments, interstitial Fe was found to be nonmagnetic in these hosts; the calculated isomer shifts on both interstitial and substitutional Fe sites are also in excellent agreement with experiments.

  10. Ruptured Interstitial Ectopic Pregnancy at 18 Weeks Gestation Diagnosed by MRI: A Case Report

    PubMed Central

    Hamouda, Ehab SM; Littooij, Annemieke S; Thia, Edwin WH; Ong, Chiou L

    2013-01-01

    Ectopic pregnancy in the interstitial part of the fallopian tube is a rare event, associated with a high rate of complications due to delayed diagnosis. Rupture of such pregnancy often results in catastrophic hemorrhage. Several reports highlighted the role of magnetic resonance imaging in establishing the diagnosis of interstitial pregnancy, but magnetic resonance imaging findings of a ruptured advanced interstitial ectopic pregnancy have not been published before. The authors therefore present characteristic findings on magnetic resonance imaging of a ruptured interstitial ectopic pregnancy which had reached 18 weeks, in a 25-year-old woman who presented with acute abdominal pain. PMID:24421921

  11. Effect of Interstitial Media on Segregation in Vertically Vibrated Granular Mixtures

    NASA Astrophysics Data System (ADS)

    Yuan, Xiao-Xian; Li, Liang-Sheng; Wen, Ping-Ping; Shi, Qing-Fan; Zheng, Ning

    2013-01-01

    Vertically vibrated segregation behaviors of binary granular mixtures with different interstitial media are experimentally investigated. To study the role of interstitial media on the segregation, two types of interstitial fluids are adopted and the resulting phase diagrams are compared. The water-immersed granular mixture exhibits two kinds of complete segregation behaviors: Brazil nut effect and sandwich patterns, at least the latter is absent in the same air-immersed mixture. Additionally, the segregation extent is improved remarkably for the water-immersed mixture. The experimental observation further confirms that the effect of interstitial media on the relative motion of grains is one of the predominant mechanisms for granular segregation.

  12. Exchange of deeply trapped and interstitial hydrogen in silicon

    SciTech Connect

    Tuttle, B.; Van de Walle, C.G.; Adams, J.B.

    1999-02-01

    Using {ital ab initio} density-functional calculations, we examine possible exchange mechanisms between an interstitial hydrogen atom and a deeply bound H at a silicon-hydrogen bond. We determine a low-energy pathway for exchange, which involves an intermediate, metastable {equivalent_to}SiH{sub 2} complex with both hydrogen atoms strongly bound to the silicon atom. The energy barrier for the exchange process is E{sub ex}{lt}0.2 eV, consistent with observations of hydrogen-deuterium exchange in a-Si:H(D) films. {copyright} {ital 1999} {ital The American Physical Society}

  13. Rovibrational states of interstitial H2 in Si

    NASA Astrophysics Data System (ADS)

    Koch, S.; Lavrov, E. V.; Weber, J.

    2011-06-01

    Rovibrational Q(J) transitions of the interstitial H2 molecule in Si have been investigated by Raman scattering in the temperature range 90-388 K. In accordance with an earlier suggestion [M. Hiller, E. V. Lavrov, and J. Weber, Phys. Rev. BPRBMDO1098-012110.1103/PhysRevB.74.235214 74, 235214 (2006)], it is shown that the Q(2) transition of para hydrogen couples to the TAX phonon of Si and appears in the Raman spectra at temperatures above 200 K. The results presented also indicate that the rotational J=3 state of ortho hydrogen is resonantly coupled to the OΓ phonon.

  14. Gallium scanning in lymphoid interstitial pneumonitis of children with AIDS

    SciTech Connect

    Schiff, R.G.; Kabat, L.; Kamani, N.

    1987-12-01

    Lymphoid interstitial pneumonitis (LIP) is a frequent pulmonary complication in the child with the acquired immune deficiency syndrome (AIDS) and human immunodeficiency virus (HIV) infection. We report the gallium scan findings in two children with AIDS and LIP. Gallium scintigraphy in both children demonstrated increased radionuclide concentration throughout the lungs, a pattern indistinguishable scintigraphically from that of Pneumocystis carinii pneumonia (PCP). This should alert nuclear medicine practitioners and referring physicians to another cause of diffusely increased gallium uptake in the lungs of patients with AIDS.

  15. Ulcerative colitis: ultrastructure of interstitial cells in myenteric plexus.

    PubMed

    Rumessen, J J; Vanderwinden, J-M; Horn, T

    2010-10-01

    Interstitial cells of Cajal (ICC) are key regulatory cells in the gut. In the colon of patients with severe ulcerative colitis (UC), myenteric ICC had myoid ultrastructural features and were in close contact with nerve terminals. In all patients as opposed to controls, some ICC profiles showed degenerative changes, such as lipid droplets and irregular vacuoles. Nerve terminals often appeared swollen and empty. Glial cells, muscle cells, and fibroblast-like cells (FLC) showed no alterations. FLC enclosed macrophages (MLC), which were in close contact with naked axon terminals. The organization and cytological changes may be of pathophysiological significance in patients with UC. PMID:20568987

  16. VPF and interstitial fluid pressure in brain oedema.

    PubMed

    Sirovskiy, E; Kornienko, V; Moshkin, A; Amcheslavskiy, V; Ingorokva, G; Glazman, L

    1990-01-01

    Monitoring of VFP and local brain interstitial fluid pressure was performed in 169 patients after removal of hemispheric gliomas, basal and subtentorial tumours. On the basis of CT-data 97% of the patients had postoperative oedema of various severity and spreading. The location of the tumour determined both the degree and severity of oedema as well as VFP and ISFP. Different mechanisms of oedema formation may be involved depending on localization of the tumour. Thus, we can propose a hypothesis of the mechanisms of oedema development in neurosurgical pathology. PMID:2089955

  17. Respiratory and lower limb muscle function in interstitial lung disease.

    PubMed

    Panagiotou, Marios; Polychronopoulos, Vlasis; Strange, Charlie

    2016-05-01

    Growing evidence suggests that respiratory and limb muscle function may be impaired in patients with interstitial lung disease (ILD). Importantly, muscle dysfunction could promote dyspnoea, fatigue and functional limitation all of which are cardinal features of ILD. This article examines the risk factors for skeletal muscle dysfunction in ILD, reviews the current evidence on overall respiratory and limb muscle function and focuses on the occurrence and implications of skeletal muscle dysfunction in ILD. Research limitations and pathways to address the current knowledge gaps are highlighted. PMID:26768011

  18. Granulomatous Interstitial Nephritis Presenting as Hypercalcemia and Nephrolithiasis

    PubMed Central

    Sharmeen, Saika; Kalkan, Esra; Yi, Chunhui; Smith, Steven D.

    2016-01-01

    We report a case of acute kidney injury as the initial manifestation of sarcoidosis. A 55-year-old male was sent from his primary care physician's office with incidental lab findings significant for hypercalcemia and acute kidney injury with past medical history significant for nephrolithiasis. Initial treatment with intravenous hydration did not improve his condition. The renal biopsy subsequently revealed granulomatous interstitial nephritis (GIN). Treatment with the appropriate dose of glucocorticoids improved both the hypercalcemia and renal function. Our case demonstrates that renal limited GIN due to sarcoidosis, although a rare entity, can cause severe acute kidney injury and progressive renal failure unless promptly diagnosed and treated. PMID:26904327

  19. Laparoscopic Management of Heterotopic Interstitial Pregnancy with Subsequent Term Delivery.

    PubMed

    Kwon, Yong-Soon; Lee, Sang-Hun; Im, Kyong Shil; Ro, Jae Hun

    2015-01-01

    A 35 year-old woman at 7-week gestational age was referred to our hospital. The patient was diagnosed with the heterotopic interstitial pregnancy by transvaginal ultrasonogra- phy after receiving in vitro fertilization (IVF) and embryo transfer. Laparoscopic excision and curettage was successfully performed at 8.4-gestational age under general anesthesia and the patient was discharged 2 days after operation without any post-operative complications. The woman had normal antenatal follow-up and deliv- ered a healthy baby at term by cesarean section. PMID:26246887

  20. Idiopathic granulomatous interstitial nephritis responsive to mycophenolate mofetil therapy.

    PubMed

    Leeaphorn, Napat; Stokes, Michael B; Ungprasert, Patompong; Lecates, William

    2014-04-01

    Granulomatous interstitial nephritis (GIN) is a rare histologic disease. Various causes have been reported in the literature, including drugs, sarcoidosis, and infections. Other incidents have no discernible cause and are identified as idiopathic. We report a 68-year-old white man who presented with acute kidney injury and was given a diagnosis of idiopathic GIN. Mycophenolate mofetil treatment was elected because of steroid toxicity. He responded well to mycophenolate mofetil and has been in remission for more than 3 years. To our knowledge, this is the first report of successful treatment with mycophenolate mofetil of an adult patient with idiopathic GIN. PMID:24315767

  1. Levetiracetam-induced severe acute granulomatous interstitial nephritis.

    PubMed

    Chau, Katrina; Yong, Jim; Ismail, Kasim; Griffith, Neil; Liu, Michael; Makris, Angela

    2012-06-01

    Granulomatous interstitial nephritis (GIN) is an uncommon cause of renal failure, which may be caused by drugs. Levetiracetam is an increasingly used anti-epileptic medication that is not known to cause renal toxicity in adults. To our knowledge, levetiracetam has not previously been reported as a cause of GIN. We report the case of a 69-year-old woman who developed haemodialysis-requiring acute renal failure after commencement of treatment with levetiracetam, which was shown to be GIN by renal biopsy. She made a complete recovery with cessation of levetiracetam and treatment with steroids. PMID:26069773

  2. Recent Treatments of Interstitial Lung Disease with Systemic Sclerosis

    PubMed Central

    Yasuoka, Hidekata

    2015-01-01

    Systemic sclerosis (SSc) is a disorder characterized by immune dysfunction, microvascular injury, and fibrosis. Organ involvement in patients with SSc is variable; however, pulmonary involvement occurs in up to 90% of patients with SSc. Interstitial lung disease (ILD) is a major cause of mortality and, thus, a major determinant in the prognosis of patients with SSc. This review summarizes current findings about the characteristics of ILD in patients with SSc, selection of patients with SSc-ILD who are candidates for the treatment, and current treatment options. PMID:26819563

  3. Dose optimization in gynecological 3D image based interstitial brachytherapy using martinez universal perineal interstitial template (MUPIT) -an institutional experience

    PubMed Central

    Sharma, Pramod Kumar; Sharma, Praveen Kumar; Swamidas, Jamema V; Mahantshetty, Umesh; Deshpande, D. D.; Manjhi, Jayanand; Rai, D V

    2014-01-01

    The aim of this study was to evaluate the dose optimization in 3D image based gynecological interstitial brachytherapy using Martinez Universal Perineal Interstitial Template (MUPIT). Axial CT image data set of 20 patients of gynecological cancer who underwent external radiotherapy and high dose rate (HDR) interstitial brachytherapy using MUPIT was employed to delineate clinical target volume (CTV) and organs at risk (OARs). Geometrical and graphical optimization were done for optimum CTV coverage and sparing of OARs. Coverage Index (CI), dose homogeneity index (DHI), overdose index (OI), dose non-uniformity ratio (DNR), external volume index (EI), conformity index (COIN) and dose volume parameters recommended by GEC-ESTRO were evaluated. The mean CTV, bladder and rectum volume were 137 ± 47cc, 106 ± 41cc and 50 ± 25cc, respectively. Mean CI, DHI and DNR were 0.86 ± 0.03, 0.69 ± 0.11 and 0.31 ± 0.09, while the mean OI, EI, and COIN were 0.08 ± 0.03, 0.07 ± 0.05 and 0.79 ± 0.05, respectively. The estimated mean CTV D90 was 76 ± 11Gy and D100 was 63 ± 9Gy. The different dosimetric parameters of bladder D2cc, D1cc and D0.1cc were 76 ± 11Gy, 81 ± 14Gy, and 98 ± 21Gy and of rectum/recto-sigmoid were 80 ± 17Gy, 85 ± 13Gy, and 124 ± 37Gy, respectively. Dose optimization yields superior coverage with optimal values of indices. Emerging data on 3D image based brachytherapy with reporting and clinical correlation of DVH parameters outcome is enterprizing and provides definite assistance in improving the quality of brachytherapy implants. DVH parameter for urethra in gynecological implants needs to be defined further. PMID:25190999

  4. Auscultation of Velcro Crackles is Associated With Usual Interstitial Pneumonia.

    PubMed

    Sellarés, Jacobo; Hernández-González, Fernanda; Lucena, Carmen M; Paradela, Marina; Brito-Zerón, Pilar; Prieto-González, Sergio; Benegas, Mariana; Cuerpo, Sandra; Espinosa, Gerard; Ramírez, José; Sánchez, Marcelo; Xaubet, Antoni

    2016-02-01

    Auscultation of Velcro crackles has been proposed as a key finding in physical lung examination in patients with interstitial lung diseases (ILDs), especially in idiopathic pulmonary fibrosis (IPF). However, no studies have been carried out to assess the association of Velcro crackles with other clinical variables.We evaluated a cohort of 132 patients, prospectively and consecutively included in our ILD diagnostic program at a tertiary referral center. All patients were auscultated during the physical examination. The patients were divided into 2 groups: "presence" or "nonpresence" of bilateral Velcro crackles.Of all patients assessed, 83 (63%) presented Velcro crackles in the respiratory auscultation. Patients with Velcro crackles usually had more frequently cough and dyspnea at the moment of diagnosis. Forced vital capacity (P = 0.002) and lung diffusion capacity for carbon monoxide (P = 0.04) was lower in these patients. The ILD-GAP index was higher in the group with Velcro crackles (P = 0.01). All patients with usual interstitial pneumonia (UIP) in high-resolution computed tomography and all patients with final IPF diagnosis presented Velcro crackles. In multivariate analysis, the presence of Velcro crackles was independently associated with an UIP pattern.In patients suspected of having ILD, the auscultation of Velcro crackles was associated with UIP, a possibility which must be taken into consideration in early ILD detection in primary care. PMID:26844464

  5. Interstitially stabilized phases in the zirconium-nickel system

    SciTech Connect

    MacKay, R.A.

    1993-07-01

    Addition of nonmetal interstitial atoms to Zr-Ni compounds has resulted in several new phases. A single-crystal x-ray study was carried out for Zr{sub 3}NiO. Zr{sub 4}Ni{sub 2}O is a high- temperature phase, forming in samples annealed at 1250 C. Huekel band calculations led to prediction and confirmation of additional phases in more electron rich systems. Other phases studied by XRD are Zr{sub 6}Ni{sub 4}Ti{sub 2}O{sub 0.6}, Nb{sub 6}Ni{sub 6}O, and Nb{sub 6}Ni{sub 4}Ta{sub 2}O{sub 2}. Phases identified by powder diffraction are Nb{sub 4}Ni{sub 2}O, Zr{sub 4}Cu{sub 2}O, and Zr{sub 6}Co{sub 4}Ti{sub 2}O. New Zr kappa phases in space group P6s{sub 3}/mmc were found: Zr{sub 9}Mo{sub 4}SO{sub x} and Zr{sub 9}W{sub 4}(S,Ni)O{sub 3}. A new structure type was discovered with Zr{sub 6}Ni{sub 6}TiSiO{sub 1.8}. In all these interstitially stabilized phases, O is coordinated in Zr octahedral; there are no Ni-O interactions.

  6. Asbestosis and environmental causes of usual interstitial pneumonia

    PubMed Central

    Gulati, Mridu; Redlich, Carrie A.

    2015-01-01

    Purpose of review Recent epidemiologic investigations suggest that occupational and environmental exposures contribute to the overall burden of idiopathic pulmonary fibrosis (IPF). This article explores the epidemiologic and clinical challenges to establishing exposure associations, the current literature regarding exposure disease relationships and the diagnostic work-up of IPF and asbestosis patients. Recent findings IPF patients demonstrate a histopathologic pattern of usual interstitial pneumonia. In the absence of a known cause or association, a usual interstitial pneumonia pattern leads to an IPF diagnosis, which is a progressive and often terminal fibrotic lung disease. It has long been recognized that asbestos exposure can cause pathologic and radiographic changes indistinguishable from IPF. Several epidemiologic studies, primarily case control in design, have found that a number of other exposures that can increase risk of developing IPF include cigarette smoke, wood dust, metal dust, sand/silica and agricultural exposures. Lung mineralogic analyses have provided additional support to causal associations. Genetic variation may explain differences in disease susceptibility among the population. Summary An accumulating body of literature suggests that occupational and environmental exposure can contribute to the development of IPF. The impact of exposure on the pathogenesis and clinical course of disease requires further study. PMID:25621562

  7. Heterogeneity of Ovarian Theca and Interstitial Gland Cells in Mice

    PubMed Central

    Miyabayashi, Kanako; Tokunaga, Kaori; Otake, Hiroyuki; Baba, Takashi; Shima, Yuichi; Morohashi, Ken-ichirou

    2015-01-01

    It has been established that two developmentally and functionally distinct cell types emerge within the mammalian testis and adrenal gland throughout life. Fetal and adult types of steroidogenic cells (i.e., testicular Leydig cells and adrenocortical cells) develop in the prenatal and postnatal period, respectively. Although the ovary synthesizes steroids postnatally, the presence of fetal-type steroidogenic cells has not been described. We had previously established transgenic mouse lines in which fetal Leydig cells were labeled with an EGFP reporter gene by the FLE (fetal Leydig enhancer) of the Ad4BP/SF-1 (Nr5a1) gene. In the present study, we examined the reporter gene expression in females and found that the reporter gene is turned on in postnatal ovaries. A comparison of the expressions of the EGFP and marker genes revealed that EGFP is expressed in not all but rather a proportion of steroidogenic theca and in interstitial gland cells in the ovary. This finding was further supported by experiments using BAC transgenic mice in which reporter gene expression recapitulated endogenous Ad4BP/SF-1 gene expression. In conclusion, our observations from this study strongly suggest that ovarian theca and interstitial gland cells in mice consist of at least two cell types. PMID:26039146

  8. [Severe interstitial lung disease from pathologic gastroesophageal reflux in children].

    PubMed

    Ahrens, P; Weimer, B; Hofmann, D

    1999-07-01

    Interstitial lung diseases comprise a heterogeneous group of pulmonary conditions that cause restrictive lung disease of poor prognosis, especially if growth failure, pulmonary hypertension and fibrosis appears. We report on the case of a girl of 11 years of age who suffered from severe nonallergic asthma in early childhood and who developed severe interstitial pulmonary disease caused by gastro-oesophageal reflux at the age of 8 years. This diagnosis was established by lung biopsy, bronchoalveolar lavage and a high amount of lipid-laden alveolar macrophages, 2-level pH measurement and oesophageal biopsy. Because therapy with oral and inhaled steroids failed and Omeprazol showed benificial effects, hemifundoplication according to THAL was performed. At present the lung function is clearly normal and there is no need of any medicaments. Following the history, we can assume the pathological gastro-oesophageal reflux to be the cause of the disease. It is important to state that there were no typical symptoms at any time pointing to gastro-oesophageal reflux disease. The development of pulmonary disease by pathological reflux is very often caused by "silent aspiration". Very typically there are no symptoms such as vomiting, heartburn and pain but only signs of chronic lung disease. PMID:10444954

  9. Allergic Interstitial Nephritis Manifesting as a Striated Nephrogram

    PubMed Central

    Moinuddin, Irfan; Bracamonte, Erika; Thajudeen, Bijin; Sussman, Amy; Madhrira, Machaiah; Costello, James

    2015-01-01

    Allergic interstitial nephritis (AIN) is an underdiagnosed cause of acute kidney injury (AKI). Guidelines suggest that AIN should be suspected in a patient who presents with an elevated serum creatinine and a urinalysis that shows white cells, white cell casts, or eosinophiluria. Drug-induced AIN is suspected if AKI is temporally related to the initiation of a new drug. However, patients with bland sediment and normal urinalysis can also have AIN. Currently, a definitive diagnosis of AIN is made by renal biopsy which is invasive and fraught with risks such as bleeding, infection, and hematoma. Additionally, it is frequently unclear when a kidney biopsy should be undertaken. We describe a biopsy proven case of allergic interstitial nephritis which manifested on contrast enhanced Magnetic Resonance Imaging (MRI) as a striated nephrogram. Newer and more stable macrocyclic gadolinium contrast agents have a well-demonstrated safety profile. Additionally, in the presentation of AKI, gadolinium contrast agents are safe to administer in patients who demonstrate good urine output and a downtrending creatinine. We propose that the differential for a striated nephrogram may include AIN. In cases in which the suspicion for AIN is high, this diagnostic consideration may be further characterized by contrast enhanced MRI. PMID:26664405

  10. The Role of Interstitial Fluid Pressurization in Articular Cartilage Lubrication

    PubMed Central

    Ateshian, Gerard A.

    2009-01-01

    Over the last two decades, considerable progress has been reported in the field of cartilage mechanics that impacts our understanding of the role of interstitial fluid pressurization on cartilage lubrication. Theoretical and experimental studies have demonstrated that the interstitial fluid of cartilage pressurizes considerably under loading, potentially supporting most of the applied load under various transient or steady-state conditions. The fraction of the total load supported by fluid pressurization has been called the fluid load support. Experimental studies have demonstrated that the friction coefficient of cartilage correlates negatively with this variable, achieving remarkably low values when the fluid load support is greatest. A theoretical framework that embodies this relationship has been validated against experiments, predicting and explaining various outcomes, and demonstrating that a low friction coefficient can be maintained for prolonged loading durations under normal physiological function. This paper reviews salient aspects of this topic, as well as its implications for improving our understanding of boundary lubrication by molecular species in synovial fluid and the cartilage superficial zone. Effects of cartilage degeneration on its frictional response are also reviewed. PMID:19464689

  11. Estimation of Tumor Interstitial Fluid Pressure (TIFP) Noninvasively.

    PubMed

    Liu, Long Jian; Brown, Stephen L; Ewing, James R; Ala, Brigitte D; Schneider, Kenneth M; Schlesinger, Mordechay

    2016-01-01

    Tumor interstitial fluid pressure (TIFP), is a physiological parameter with demonstrated predictive value for a tumor's aggressiveness, drug delivery, as well as response to treatments such as radiotherapy and chemotherapy. Despite its utility, measurement of TIFP has been limited by the need for invasive procedures. In this work, the theoretical basis for approaching the absolute value of TIFP and the experimental method for noninvasively measuring TIFP are presented. Given specific boundary and continuity conditions, we convert theoretical variables into measurable variables by applying MRI technology. The work shows that TIFP in the central region of the tumor can be estimated by an analysis of the variation of tissue fluid motion in the tumor rim and surrounding tissue. It is determined from three noninvasive measurable parameters: i) an estimate of the velocity of the tumor interstitial fluid at the tumor surface, which is maximal, ii) a measurement of the distance from the tumor surface to where the tumor exudates are absorbed (or normalized), and iii) an estimate of the hydraulic conductivity of the interstitium through which the tumor exudate travels. We experimentally show that the fluid flow within the tumor rim is not uniform, even for a round shaped tumor, and demonstrate the procedures for the noninvasive measurement of TIFP. PMID:27467886

  12. Hyperfine interactions at nitrogen interstitial defects in diamond

    NASA Astrophysics Data System (ADS)

    Atumi, M. K.; Goss, J. P.; Briddon, P. R.; Shrif, F. E.; Rayson, M. J.

    2013-02-01

    Diamond has many extreme physical properties and it can be used in a wide range of applications. In particular it is a highly effective particle detection material, where radiation damage is an important consideration. The WAR9 and WAR10 are electron paramagnetic resonance centres seen in irradiated, nitrogen-containing diamond. These S = 1/2 defects have C2v and C1h symmetry, respectively, and the experimental spectra have been interpreted as arising from nitrogen split-interstitial centres. Based upon the experimental and theoretical understanding of interstitial nitrogen defect structures, the AIMPRO density functional code has been used to assess the assignments for the structures of WAR9 and WAR10. Although the calculated hyperfine interaction tensors are consistent with the measured values for WAR9, the thermal stability renders the assignment problematic. The model for the WAR10 centre yields principal directions of the hyperfine tensor at variance with observation. Alternative models for both centres are discussed in this paper, but no convincing structures have been found.

  13. Probe for Sampling of Interstitial Fluid From Bone

    NASA Technical Reports Server (NTRS)

    Janle, Elsa M.

    2004-01-01

    An apparatus characterized as both a membrane probe and a bone ultrafiltration probe has been developed to enable in vivo sampling of interstitial fluid in bone. The probe makes it possible to measure the concentration of calcium and other constituents of the fluid that may be relevant to bone physiology. The probe could be especially helpful in experimental studies of microgravitational bone loss and of terrestrial bone-loss disease states, including osteoporosis. The probe can be implanted in the bone tissue of a living animal and can be used to extract samples of the interstitial bone fluid from time to time during a long-term study. The probe includes three 12-cm-long polyacrylonitrile fibers configured in a loop form and attached to polyurethane tubing [inside diameter 0.025 in. (0.64 mm), outside diameter 0.040 in. (1 mm)]; the attachment is made by use of a 1-cm-long connecting piece of polyurethane tubing [inside diameter 0.035 0.003 in. (0.89 0.08 mm), outside diameter 0.060 0.003 in. (1.52 0.08 mm)]. At the distal end, a 2-cm-long piece of polyurethane tubing of the same inner and outer diameters serves as a connector to a hub. A 1-cm long piece of expanded poly (tetrafluoroethylene) tubing over the joint between the fibers and the connecting tubing serves as a tissue-in-growth site.

  14. Bone tissue engineering: the role of interstitial fluid flow

    NASA Technical Reports Server (NTRS)

    Hillsley, M. V.; Frangos, J. A.

    1994-01-01

    It is well established that vascularization is required for effective bone healing. This implies that blood flow and interstitial fluid (ISF) flow are required for healing and maintenance of bone. The fact that changes in bone blood flow and ISF flow are associated with changes in bone remodeling and formation support this theory. ISF flow in bone results from transcortical pressure gradients produced by vascular and hydrostatic pressure, and mechanical loading. Conditions observed to alter flow rates include increases in venous pressure in hypertension, fluid shifts occurring in bedrest and microgravity, increases in vascularization during the injury-healing response, and mechanical compression and bending of bone during exercise. These conditions also induce changes in bone remodeling. Previously, we hypothesized that interstitial fluid flow in bone, and in particular fluid shear stress, serves to mediate signal transduction in mechanical loading- and injury-induced remodeling. In addition, we proposed that a lack or decrease of ISF flow results in the bone loss observed in disuse and microgravity. The purpose of this article is to review ISF flow in bone and its role in osteogenesis.

  15. Quantifying melting and mobilistaion of interstitial melts in crystal mushes

    NASA Astrophysics Data System (ADS)

    Veksler, Ilya; Dobson, Katherine; Hess, Kai-Uwe; Ertel-Ingrisch, Werner; Humphreys, Madeleine

    2015-04-01

    The deformation of crystals mushes and separation of melts and crystals in is critical to understanding the development of physical and chemical heterogeneity in magma chambers and has been invoked as an eruption trigger mechanism. Here we investigate the behaviour of the melt in the well characterised, classic crystal mush system of the Skaergaard intrusion by combining experimental petrology and the non-destructive 3D imaging methods. Starting materials for partial melting experiments were four samples from the upper Middle Zone of the Layered Series. Cylinders, 15 mm in diameter and 20 mm in length, were drilled out of the rock samples, placed in alumina crucibles and held for 5 days in electric furnaces at atmospheric pressure and 1050-1100 °C. Redox conditions set by the CO-CO2 gas mixture were kept close to those of the FMQ buffer. We then use spatially registered 3D x-ray computed tomography images, collected before and after the experiment, to determine the volume and distribution of the crystal framework and interstitial phases, and the volume, distribution and connectivity the interstitial phases that undergo melting and extraction while at elevated temperature. Image analysis has allowed us to quantify these physical changes with high spatial resolution. Our work is a first step towards quantitative understanding of the melt mobilisation and migration processes operating in notionally locked crystal rich magmatic systems.

  16. Estimation of Tumor Interstitial Fluid Pressure (TIFP) Noninvasively

    PubMed Central

    Liu, Long Jian; Brown, Stephen L.; Ewing, James R.; Ala, Brigitte D.; Schneider, Kenneth M.

    2016-01-01

    Tumor interstitial fluid pressure (TIFP), is a physiological parameter with demonstrated predictive value for a tumor’s aggressiveness, drug delivery, as well as response to treatments such as radiotherapy and chemotherapy. Despite its utility, measurement of TIFP has been limited by the need for invasive procedures. In this work, the theoretical basis for approaching the absolute value of TIFP and the experimental method for noninvasively measuring TIFP are presented. Given specific boundary and continuity conditions, we convert theoretical variables into measurable variables by applying MRI technology. The work shows that TIFP in the central region of the tumor can be estimated by an analysis of the variation of tissue fluid motion in the tumor rim and surrounding tissue. It is determined from three noninvasive measurable parameters: i) an estimate of the velocity of the tumor interstitial fluid at the tumor surface, which is maximal, ii) a measurement of the distance from the tumor surface to where the tumor exudates are absorbed (or normalized), and iii) an estimate of the hydraulic conductivity of the interstitium through which the tumor exudate travels. We experimentally show that the fluid flow within the tumor rim is not uniform, even for a round shaped tumor, and demonstrate the procedures for the noninvasive measurement of TIFP. PMID:27467886

  17. [Chronic interstitial lung disease in children: Diagnostic approach and management].

    PubMed

    Fuger, M; Clair, M-P; El Ayoun Ibrahim, N; L'Excellent, S; Nizery, L; O'Neill, C; Tabone, L; Truffinet, O; Yakovleff, C; de Blic, J

    2016-05-01

    Chronic interstitial lung disease (ILD) in children is a heterogeneous group of rare lung disorders characterized by an inflammatory process of the alveolar wall and the pulmonary interstitium that induces gas exchange disorders. The diagnostic approach to an ILD involves three essential steps: recognizing the ILD, appreciating the impact, and identifying the cause. The spectrum of clinical findings depends to a large extent on age. In the newborn, the beginning is often abrupt (neonatal respiratory distress), whereas there is a more gradual onset in infants (failure to thrive, tachypnea, indrawing of the respiratory muscles). In older children, the onset is insidious and the diagnosis can only be made at an advanced stage of the disease. The diagnosis is based on noninvasive methods (clinical history, respiratory function tests, chest X-ray, and high-resolution CT scan) and invasive techniques (bronchoalveolar lavage, transbronchial biopsy, video-assisted thoracoscopic biopsy, and open lung biopsy). The treatment of interstitial lung disease in children depends on the nature of the underlying pathology. The most common therapeutic approach involves the use of corticosteroids and immunosuppressive agents for their anti-inflammatory and antifibrotic effects. Children with ILD also need support therapy (oxygen therapy, nutritional support, treatment of pulmonary arterial hypertension, vaccination). Lung transplantation is discussed in patients with severe respiratory failure. PMID:27021883

  18. Interstitial lung disease induced by alectinib (CH5424802/RO5424802).

    PubMed

    Ikeda, Satoshi; Yoshioka, Hiroshige; Arita, Machiko; Sakai, Takahiro; Sone, Naoyuki; Nishiyama, Akihiro; Niwa, Takashi; Hotta, Machiko; Tanaka, Tomohiro; Ishida, Tadashi

    2015-02-01

    A 75-year-old woman with anaplastic lymphoma kinase (ALK)-rearranged Stage IV lung adenocarcinoma was administered the selective anaplastic lymphoma kinase inhibitor, alectinib, as a third-line treatment in a Phase 1-2 study. On the 102nd day, chest computed tomography showed diffuse ground glass opacities. Laboratory data revealed high serum levels of KL-6, SP-D and lactate dehydrogenase without any clinical symptoms. There was no evidence of infection. Marked lymphocytosis was seen in bronchoalveolar lavage fluid analysis, and transbronchial lung biopsy showed mild thickening of alveolar septa and lymphocyte infiltration. Interstitial lung disease was judged to be related to alectinib based on improvements in imaging findings and serum biomarkers after discontinuation of alectinib. To our knowledge, this is the first reported case of alectinib-induced interstitial lung disease. Alectinib is a promising drug for ALK-rearranged non-small cell lung cancer. Clinical trials of this selective anaplastic lymphoma kinase inhibitor will facilitate the meticulous elucidation of its long-term safety profile. PMID:25398579

  19. Auscultation of Velcro Crackles is Associated With Usual Interstitial Pneumonia

    PubMed Central

    Sellarés, Jacobo; Hernández-González, Fernanda; Lucena, Carmen Mª; Paradela, Marina; Brito-Zerón, Pilar; Prieto-González, Sergio; Benegas, Mariana; Cuerpo, Sandra; Espinosa, Gerard; Ramírez, José; Sánchez, Marcelo; Xaubet, Antoni

    2016-01-01

    Abstract Auscultation of Velcro crackles has been proposed as a key finding in physical lung examination in patients with interstitial lung diseases (ILDs), especially in idiopathic pulmonary fibrosis (IPF). However, no studies have been carried out to assess the association of Velcro crackles with other clinical variables. We evaluated a cohort of 132 patients, prospectively and consecutively included in our ILD diagnostic program at a tertiary referral center. All patients were auscultated during the physical examination. The patients were divided into 2 groups: “presence” or “nonpresence” of bilateral Velcro crackles. Of all patients assessed, 83 (63%) presented Velcro crackles in the respiratory auscultation. Patients with Velcro crackles usually had more frequently cough and dyspnea at the moment of diagnosis. Forced vital capacity (P = 0.002) and lung diffusion capacity for carbon monoxide (P = 0.04) was lower in these patients. The ILD-GAP index was higher in the group with Velcro crackles (P = 0.01). All patients with usual interstitial pneumonia (UIP) in high-resolution computed tomography and all patients with final IPF diagnosis presented Velcro crackles. In multivariate analysis, the presence of Velcro crackles was independently associated with an UIP pattern. In patients suspected of having ILD, the auscultation of Velcro crackles was associated with UIP, a possibility which must be taken into consideration in early ILD detection in primary care. PMID:26844464

  20. Tumor Interstitial Fluid Formation, Characterization, and Clinical Implications.

    PubMed

    Wagner, Marek; Wiig, Helge

    2015-01-01

    The interstitium, situated between the blood and lymph vessels and the cells, consists of a solid or matrix phase and a fluid phase representing the tissue microenvironment. In the present review, we focus on the interstitial fluid phase of solid tumors, the tumor interstitial fluid (TIF), i.e., the fluid bathing the tumor and stroma cells, also including immune cells. This is a component of the internal milieu of a solid tumor that has attracted regained attention. Access to this space may provide important insight into tumor development and therapy response. TIF is formed by transcapillary filtration, and since this fluid is not readily available we discuss available techniques for TIF isolation, results from subsequent characterization and implications of recent findings with respect to fluid filtration and uptake of macromolecular therapeutic agents. There appear to be local gradients in signaling substances from neoplastic tissue to plasma that may provide new understanding of tumor biology. The development of sensitive proteomic technologies has made TIF a valuable source for tumor specific proteins and biomarker candidates. Potential biomarkers will appear locally in high concentrations in tumors and may eventually be found diluted in the plasma. Access to TIF that reliably reflects the local tumor microenvironment enables identification of substances that can be used in early detection and monitoring of disease. PMID:26075182

  1. Interstitial precipitation in Fe-Cr-Al alloys

    NASA Astrophysics Data System (ADS)

    Spear, W. S.; Polonis, D. H.

    1994-06-01

    Two separate stages of precipitation have been identified during the aging of ternary Fel8Cr3Al and Fel8Cr5Al alloys at temperatures in the vicinity of 475 °C. The first stage involves the formation of interstitial precipitates resulting from C and N impurities; the second and slower stage is the formation of the Cr-rich α' phase. Transmission electron microscopy (TEM) results show that carbonitride precipitation occurs preferentially at dislocations, stacking faults, and grain boundaries, and also uniformly through the matrix. Aging for times in excess of 400 hours at 475 °C promotes coarsening of the heterogeneous precipitates and dissolution of the uniformly distributed matrix particles. A resistometric analysis shows that the kinetics of the initial stages of precipitation can be described by a (time)2/3 relation. This kinetic behavior is explained in terms of stress-assisted diffusion in the highly stressed matrix resulting from coherency strains accompanying carbonitride precipitation. Experimental values of the activation energy for the first stage reaction correlate closely with those reported for the interstitial diffusion of C and N in alpha iron.

  2. Energetics of Oxygen Interstitials in Cr and V

    NASA Technical Reports Server (NTRS)

    Good, Brian S.; Copland, Evan

    2005-01-01

    Dissolved oxygen in group IIIA-VA (Nb, Ti, Zr, Y) based alloys is a fundamental problem, affecting both mechanical properties and oxidation resistance, yet details of the phenomenon are poorly understood. In these alloys, oxygen is more stable dissolved in the metal than as an oxide-compound. In contrast, alloys based on Ni, Fe, Al and Cr exhibit almost no oxygen solubility. To improve the performance of Nb and Ti based alloys it is necessary to understand the differences in oxygen solubility between these two groups of metals. As a first step we considered the energetics of interstitial oxygen in alpha-V and alpha-Cr. Both of these metals have a BCC structure, yet the oxygen solubility in V is much higher than that in Cr. We obtain total energies, densities of states and population analyses using the CASTEP plane-wave pseudopotential density functional computer code. The differences in the energetics and electronic structures of the two materials, particularly the partial densities of states associated with the interstitial oxygen, are discussed.

  3. Rutin ameliorates kidney interstitial fibrosis in rats with obstructive nephropathy.

    PubMed

    Wang, Bin; Liu, Ding; Zhu, Qiu-Hua; Li, Min; Chen, Hua; Guo, Ying; Fan, Li-Pei; Yue, Liang-Sheng; Li, Liu-Yang; Zhao, Ming

    2016-06-01

    Rutin reportedly conveys many beneficial effects, including renoprotection; however, it has not yet been demonstrated to have a renoprotective effect against obstructive nephropathy. The present study is the first to show a protective effect of rutin against obstructive renal injury induced by unilateral ureteral obstruction (UUO). A total of 24 male Wistar rats were randomly divided into four groups of six rats each, including vehicle- or rutin-treated sham operated groups, and vehicle- or rutin-treated UUO groups. Rats received daily oral gavage of rutin (100mg/kg) for 2weeks. All rats were euthanized on postoperative day 14. Histological findings showed that rutin administration significantly reduced renal interstitial injury and suppressed interstitial collagen deposits in UUO rats. Moreover, rutin decreased macrophage infiltration, proinflammatory cytokine expression and phosphorylation of nuclear factor-κB p65. Furthermore, rutin inhibited extracellular matrix accumulation by reducing expression of type I/III collagen and fibronectin. Rutin also prevented the epithelial-mesenchymal transition processes of renal tubular cells by decreasing α-smooth muscle actin expression and retaining E-cadherin expression. These effects of rutin were in parallel with the reductions in Smad3 activity and pivotal to the fibrogenic potential of TGF-β1. Taken together, the renoprotective effects of rutin in obstructive nephropathy were likely due to anti-inflammatory effects and inhibition of TGF-β1/Smad3 signaling. PMID:27035719

  4. Surface and interstitial transition barriers in rutile (110) surface growth

    NASA Astrophysics Data System (ADS)

    Sanville, E. J.; Vernon, L. J.; Kenny, S. D.; Smith, R.; Moghaddam, Y.; Browne, C.; Mulheran, P.

    2009-12-01

    We present calculated surface and interstitial transition barriers for Ti, O, O2 , TiO, and TiO2 atoms and clusters at the rutile (110) surface. Defect structures involving these small clusters, including adcluster and interstitial binding sites, were calculated by energy minimization using density-functional theory (DFT). Transition energies between these defect sites were calculated using the NEB method. Additionally, a modified SMB-Q charge equilibration empirical potential and a fixed-charge empirical potential were used for a comparison of the transition energy barriers. Barriers of 1.2-3.5 eV were found for all studied small cluster transitions upon the surface except for transitions involving O2 . By contrast, the O2 diffusion barriers along the [001] direction upon the surface are only 0.13 eV. The QEq charge equilibration model gave mixed agreement with the DFT calculations, with the barriers ranging between 0.8 and 5.8 eV.

  5. Heterogeneity of ovarian theca and interstitial gland cells in mice.

    PubMed

    Miyabayashi, Kanako; Tokunaga, Kaori; Otake, Hiroyuki; Baba, Takashi; Shima, Yuichi; Morohashi, Ken-Ichirou

    2015-01-01

    It has been established that two developmentally and functionally distinct cell types emerge within the mammalian testis and adrenal gland throughout life. Fetal and adult types of steroidogenic cells (i.e., testicular Leydig cells and adrenocortical cells) develop in the prenatal and postnatal period, respectively. Although the ovary synthesizes steroids postnatally, the presence of fetal-type steroidogenic cells has not been described. We had previously established transgenic mouse lines in which fetal Leydig cells were labeled with an EGFP reporter gene by the FLE (fetal Leydig enhancer) of the Ad4BP/SF-1 (Nr5a1) gene. In the present study, we examined the reporter gene expression in females and found that the reporter gene is turned on in postnatal ovaries. A comparison of the expressions of the EGFP and marker genes revealed that EGFP is expressed in not all but rather a proportion of steroidogenic theca and in interstitial gland cells in the ovary. This finding was further supported by experiments using BAC transgenic mice in which reporter gene expression recapitulated endogenous Ad4BP/SF-1 gene expression. In conclusion, our observations from this study strongly suggest that ovarian theca and interstitial gland cells in mice consist of at least two cell types. PMID:26039146

  6. Proteomic analysis in usual and nonspecific interstitial pneumonia.

    PubMed

    Ohara, Ichiyo; Aida, Shinsuke; Shimazaki, Hideyuki; Kobayashi, Hideo; Tsuda, Hitoshi; Toda, Tosifusa; Nakanishi, Kuniaki; Tamai, Seiichi

    2014-03-01

    Differentiating nonspecific interstitial pneumonia (NSIP) from usual interstitial pneumonia (UIP) is important for the determination of both treatment and prognosis. Using two-dimensional fluorescence difference gel electrophoresis (2D-DIGE), we examined 8 UIPs, 8 NSIPs, and 30 normal lung tissues. Comparisons with control in 2D-DIGE showed that (a) in UIP, nine protein spots were significantly upregulated and seven were significantly downregulated, (b) in NSIP, four protein spots were significantly upregulated and nine were significantly downregulated. The detected proteins were analyzed by MALDI-TOF mass spectrometry, allowing qualitative differences in vimentin subtypes to be characterized. One vimentin subtype was upregulated in UIP, while another one was downregulated in NSIP (vs. control). These different characteristics were partially supported by the results of Western blot analysis. Our immunohistochemistry revealed vimentin expression within fibroblasts (a) in fibroblastic foci in UIP and (b) in fibrotic alveolar walls in NSIP. Differences in vimentin subtypes may provide useful biomarkers for separating NSIP from UIP, alongside differences in histological characteristics. PMID:24048960

  7. Nonspecific Interstitial Pneumonia: What Is the Optimal Approach to Management?

    PubMed

    Tomassetti, Sara; Ryu, Jay H; Piciucchi, Sara; Chilosi, Marco; Poletti, Venerino

    2016-06-01

    We reviewed current aspects of the clinical and pathogenic profile of nonspecific interstitial pneumonia (NSIP), to better elucidate the complex issue of management and treatment options for NSIP patients. Recent findings suggest that idiopathic NSIP is a complex clinical entity with a disease spectrum that includes at least three different phenotypes: NSIP associated with autoimmune features, emphysema, and familial interstitial lung disease. This distinction, based mainly on clinical findings, may be of critical importance when it comes to making a decision on patients' management. This hypothesis warrants further studies. Currently, two major radiologic-pathologic different profiles have been well established. First, the "inflammatory type" characterized by prominent lymphocytic inflammation both on biopsy and bronchoalveolar lavage (BAL), and high-resolution computed tomography (HRCT) with mixed NSIP/organizing pneumonia pattern that tends to have a better response to corticosteroid and immunosuppressive treatment. Second, the "highly fibrotic" subgroup that shows prominent reticular changes and traction bronchiectasis by HRCT, high fibrotic background on biopsy, and no lymphocytosis on BAL. The latter fibrotic NSIP is the subgroup with less potential to respond to immunosuppressive treatment and a marginal risk to evolve into "full-blown idiopathic pulmonary fibrosis." The management of patients with fibrotic, progressive, and immunosuppressive treatment, refractory NSIP remains uncertain, and further studies are needed to address the role of antifibrotic drug in this settings. Oxygen therapy, pulmonary rehabilitation, and lung transplantation are of importance in the current management of severe, progressive, and refractory NSIP patients. PMID:27231862

  8. Genetics of Interstitial Lung Disease: Vol de Nuit (Night Flight)

    PubMed Central

    Furukawa, Hiroshi; Oka, Shomi; Shimada, Kota; Tsuchiya, Naoyuki; Tohma, Shigeto

    2015-01-01

    Interstitial lung disease (ILD) is a chronic, progressive fibrotic lung disease with a dismal prognosis. ILD of unknown etiology is referred to as idiopathic interstitial pneumonia (IIP), which is sporadic in the majority of cases. ILD is frequently accompanied by rheumatoid arthritis (RA), systemic sclerosis (SSc), polymyositis/dermatomyositis (PM/DM), and other autoimmune diseases, and is referred to as collagen vascular disease-associated ILD (CVD-ILD). Susceptibility to ILD is influenced by genetic and environmental factors. Recent advances in radiographic imaging techniques such as high-resolution computed tomography (CT) scanning as well as high-throughput genomic analyses have provided insights into the genetics of ILD. These studies have repeatedly revealed an association between IIP (sporadic and familial) and a single nucleotide polymorphism (SNP) in the promoter region of the mucin 5B (MUC5B). HLA-DRB1*11 alleles have been reported to correlate with ILD in European patients with SSc, whereas in Japanese patients with RA, the HLA-DR2 serological group was identified. The aim of this review is to describe the genetic background of sporadic IIP, CVD-ILD, drug-induced-ILD (DI-ILD), pneumoconiosis, and hypersensitivity pneumonitis. The genetics of ILD is still in progress. However, this information will enhance the understanding of the pathogenesis of ILD and aid the identification of novel therapeutic targets for personalized medicine in future. PMID:26056507

  9. CD34+ fibroblast-like cells in the interstitial infiltrates in glomerulonephritis - an immunohistochemical observation.

    PubMed

    Gluhovschi, Cristina; Potencz, Elena; Lazar, Elena; Petrica, Ligia; Bozdog, Gheorghe; Gadalean, Florica; Bob, Flaviu; Gluhovschi, Adrian; Cioca, Daniel; Velciov, Silvia

    2012-12-01

    CD34 cells in the interstitial infiltrates in glomerulonephritis (GN) could be the turning point between regenerative processes and interstitial fibrosis. The aim of our study was to assess the presence of CD34+ cells in the interstitial infiltrates in GN. A cross-sectional study of 33 patients with glomerulonephritis, mean age: 43.3 ±11.31 years, 20 male and 13 female, was conducted. Conventional stains, as well as immunohistochemistry for the CD34 antigen were employed on kidney biopsies. Strength of immunohistochemical reaction was assessed semi-quantitatively. Regarding the percentage of cases with CD34+ cells in the interstitial infiltrates out of 33 patients: cells of interstitial infiltrates were 27.3% positive. The percentage of cases showing CD34+ cells at the level of interstitial infiltrates was: 44.4% in FSGS, 14.3% in membranoproliferative GN, 28.6% in membranous nephropathy, 20% in mesangial proliferative GN, 0% in minimal change disease, and 50% in crescentic GN. With the exception of minimal change disease, CD34+ cells were found in the interstitial infiltrates in all histopathological forms of GN. Some of these cells were spindle-shaped fibroblast-like cells. As inflammation in the tubulointerstitial compartment either resolves or proceeds to fibrosis, aims at reversing this process will benefit from analyses of the interstitial infiltrates harboring CD34+ cells. PMID:23359197

  10. Patients With Chronic Pelvic Pain: Endometriosis or Interstitial Cystitis/Painful Bladder Syndrome?

    PubMed Central

    2007-01-01

    Background: Endometriosis and interstitial cystitis/painful bladder syndrome share similar symptoms. Interstitial cystitis was once considered rare, but it is now recognized as more common than previously thought. This review examines evidence that patients presenting with symptoms typically attributed to endometriosis or with unresolved pelvic pain after treatment for endometriosis may, in fact, have interstitial cystitis, and suggests approaches for appropriate diagnosis. Methods: A MedLine search using “chronic pelvic pain,” “endometriosis,” “interstitial cystitis,” and “bladder origin pain” as key words was performed for the most recent English-language articles. Additional references were obtained through cross-referencing the bibliography cited in each publication. Discussion: The symptoms of endometriosis and inter-stitial cystitis frequently overlap, and these 2 conditions may even coexist in the same patient. In cases of unresolved endometriosis and persistent pelvic pain, patients may have interstitial cystitis. A variety of tools are available to aid in identifying interstitial cystitis. Conclusion: Gynecologists should be alert to the possible presence of interstitial cystitis in patients who present with chronic pelvic pain typical of endometriosis. PMID:17761077

  11. [A Case of Gastric Cancer Associated with Sjögren's Syndrome and Interstitial Pneumonia].

    PubMed

    Ido, Mirai; Mishima, Hideyuki; Kimura, Kengo; Iwata, Tsutomu; Kiyota, Yoshiharu; Komaya, Kenichi; Saito, Takuya; Ohashi, Norifumi; Arikawa, Takashi; Ishiguro, Seiji; Komatsu, Shunichiro; Miyachi, Masahiko; Sano, Tsuyoshi

    2015-11-01

    A 77-year-old man presented with poor appetite and dyspnea. A gastroendoscopy showed an advanced gastric cancer and a CT scan demonstrated diffuse interstitial infiltrative shadows in both lungs. Laboratory data showed high level of anti-SSA and anti-SSB antibodies, suggestive of interstitial pneumonia associated with Sjögren's syndrome. Although the levels of KL-6 and SP-D, markers of interstitial pneumonia, decreased after steroid and immunosuppressive therapy, the CT findings of interstitial pneumonia showed no remarkable change. Surgery was performed 2 months after the administration of prednisolone since the respiratory function had improved, allowing the administration of general anesthesia. A CT scan revealed remarkable improvement of the lung lesions after the surgery. Therefore, it is likely that Sjögren's syndrome and interstitial pneumonia manifested as paraneoplastic syndromes in the presented case. PMID:26805235

  12. REVERSED-PHASE SEPARATION OF ESTUARINE INTERSTITIAL WATER FRACTIONS AND THE CONSEQUENCES OF C18 RETENTION OF ORGANIC MATTER

    EPA Science Inventory

    Data are presented on the application of the reversed-phase separation technique for the determination of dissolved organic compounds in estuarine interstitial water. hirty-seven neutral, nonpolar organic compounds were equilibrated with interstitial water, extracted by emulsion-...

  13. Comparison of sample preparation methods, validation of an UPLC-MS/MS procedure for the quantification of tetrodotoxin present in marine gastropods and analysis of pufferfish.

    PubMed

    Nzoughet, Judith Kouassi; Campbell, Katrina; Barnes, Paul; Cooper, Kevin M; Chevallier, Olivier P; Elliott, Christopher T

    2013-02-15

    Tetrodotoxin (TTX) is one of the most potent marine neurotoxins reported. The global distribution of this toxin is spreading with the European Atlantic coastline now being affected. Climate change and increasing pollution have been suggested as underlying causes for this. In the present study, two different sample preparation techniques were used to extract TTX from Trumpet shells and pufferfish samples. Both extraction procedures (accelerated solvent extraction (ASE) and a simple solvent extraction) were shown to provide good recoveries (80-92%). A UPLC-MS/MS method was developed for the analysis of TTX and validated following the guidelines contained in the Commission Decision 2002/657/EC for chemical contaminant analysis. The performance of this procedure was demonstrated to be fit for purpose. This study is the first report on the use of ASE as a mean for TTX extraction, the use of UPLC-MS/MS for TTX analysis, and the validation of this method for TTX in gastropods. PMID:23194566

  14. Low Power Interstitial Laser Hyperthermia - Potential For Clinical Use

    NASA Astrophysics Data System (ADS)

    Steger, Adrian C.; Lees, William R.; Bown, S. G.

    1989-06-01

    The use of single fibre for interstitial low power laser hyperthermia (1-2 W) is associated with the development of a lesion of thermal necrosis measuring 1.4-1.8 cm in liver, pancreas and prostate. These lesions heal safely and can be well visualised with ultrasound. The use of a multiple fibre (4) system has enabled the production of larger lesions in all these organs which take a longer time to heal than single fibre lesions, but do so safely. Again, ultrasound enables these lesions to be studied in their creation and in their resolution. Following this experimental work early clinical application to a variety of otherwise untreatable tumours (breast, skin, pancreas and liver) has been carried out. This has resulted in a partial response in all treated and complete response in a smaller number of cases. The method appears to be safe and practical for the treatment of some tumours.

  15. Thermoseeds for interstitial magnetic hyperthermia: from bioceramics to nanoparticles

    NASA Astrophysics Data System (ADS)

    Baeza, A.; Arcos, D.; Vallet-Regí, M.

    2013-12-01

    The development of magnetic materials for interstitial hyperthermia treatment of cancer is an ever evolving research field which provides new alternatives to antitumoral therapies. The development of biocompatible magnetic materials has resulted in new biomaterials with multifunctional properties, which are able to adapt to the complex scenario of tumoral processes. Once implanted or injected in the body, magnetic materials can behave as thermoseeds under the effect of AC magnetic fields. Magnetic bioceramics aimed to treat bone tumors and magnetic nanoparticles are among the most studied thermoseeds, and supply different solutions for the different scenarios in cancerous processes. This paper reviews some of the biomaterials used for bone cancer treatment and skeletal reinforcing, as well as the more complex topic of magnetic nanoparticles for intracellular targeting and hyperthermia.

  16. Complementary and Alternative Therapies as Treatment Approaches for Interstitial Cystitis

    PubMed Central

    Whitmore, Kristene E

    2002-01-01

    The management of interstitial cystitis (IC) is predominantly the reduction of the symptoms of frequency, urgency, and pain. Multimodal treatment approaches for IC are helpful in customizing therapy for individual patients. Complementary and alternative therapies are a quintessential addition to the therapeutic armamentarium and frequently include dietary modification, nutraceuticals, bladder training, neuromodulation, stress reduction, and sex therapy. Dietary modification involves elimination of bladder irritants, fluid regulation, and a bowel regimen. Nutraceuticals studied for the treatment of IC include calcium glycerophosphate, L-arginine, mucopolysaccharides, bioflavinoids, and Chinese herbs. Bladder training is effective after pain reduction. The neuromodulation of high-tone pelvic-floor muscle dysfunction is achieved with physical therapy and acupuncture. Stress reduction and sex therapy are best administered by a qualified stress manager and sex therapist. Multimodal, nonconventional management may add efficacy to the treatment of IC. PMID:16986031

  17. Interstitial hyperthermia of experimental brain tumor using implant heating system.

    PubMed

    Kobayashi, T; Tanaka, T; Kida, Y; Matsui, M; Ikeda, T

    1989-07-01

    New experimental system of induction hyperthermia for brain tumor using ferromagnetic implant with low Curie point has been developed. The metal implant is cylindrical needle and made of Fe-Pt alloy with low Curie point suitable for hyperthermia (50-60 degrees C). Induction coil and generator which produce maximum power of 200W and variable frequency of 100-500kHz, yielding magnetic power of 16.7Oe, have been developed. Interstitial hyperthermia was made on rat brain tumor model (T9 gliosarcoma) by this system. Significant effects of single hyperthermia (45 degrees C for 30 minutes) were observed by the extension of life span and morphological changes of the tumor. PMID:2778493

  18. Syndrome of proximal interstitial deletion 4p15

    SciTech Connect

    Fryns, J.P.

    1995-09-11

    In this journal, Chitayat et al. reported on 2 boys and a girl with interstitial deletion in the short arm of chromosome 4, including p15.2p15.33. All 3 patients had a characteristic face distinct from that of Wolf-Hirschhorn syndrome and multiple minor congenital anomalies. One patient had a congenitally enlarged penis. The authors noted that all had normal growth, and all had moderate psychomotor retardation (patient 1, developmental age of 4-6 years at age 9 years; patient 2, mental age 6 years at age 25 years; and patient 3, global delay with hypotonia, difficulties in both gross and fine motor development, and persistent delay in language skills). 5 refs., 1 fig.

  19. Vibrational Lifetime of Interstitial Oxygen in Crystalline Silicon

    NASA Astrophysics Data System (ADS)

    Sun, Baozhou; Fraser, Andrew; Lüpke, Gunter

    2003-03-01

    - The lifetime of the asymmetric stretch mode of interstitial oxygen in crystalline Si is measured directly by transient bleaching spectroscopy. The 1136-cm-1 mode has an extremely long lifetime, T1 = 229 ps at 10 K. The lifetime shows surprisingly strong temperature dependence, decreasing by more than two orders in magnitude between 50 and 180 K. The dominating decay channel involves a high number of low-frequency modes of 142 +/- 20 cm-1 corresponding to transverse acoustic phonons or pseudolocalized modes of Oi. This work was supported in part by NSF through grant DMR-00-76027, ONR through grant N00014-01-1-0770, and the Thomas F. and Kate Miller Jeffress Memorial Trust through grant J-545.

  20. Is Interstitial Cells of Cajal–opathy Present in Gastroparesis?

    PubMed Central

    Bashashati, Mohammad; McCallum, Richard W

    2015-01-01

    Gastroparesis (GP), defined as delayed gastric emptying in the absence of any mechanical obstruction, is a challenging clinical condition, mainly because of limited treatment options. Studies in animal models of delayed gastric emptying as well as patients with gastroparesis revealed depletion or ultrastructural changes of interstitial cells of Cajal (ICC) in the gastric tissue, recently termed ICC-opathy. ICC are the pacemakers of the gastrointestinal tract and are involved in the transmission of the neuronal signaling to the smooth muscles. Therefore, lack of ICC could be one explanation of delayed gastric emptying in gastroparetic patients. How frequently ICC changes are observed in gastroparesis is not yet clear. In this review, the data on gastric ICC counts and morphology in animal models and patients with gastroparesis are discussed. PMID:26424037