Science.gov

Sample records for mesoporous materials co-ce-zr-o

  1. Mesoporous carbon materials

    SciTech Connect

    Dai, Sheng; Wang, Xiqing

    2012-02-14

    The invention is directed to a method for fabricating a mesoporous carbon material, the method comprising subjecting a precursor composition to a curing step followed by a carbonization step, the precursor composition comprising: (i) a templating component comprised of a block copolymer, (ii) a phenolic compound or material, (iii) a crosslinkable aldehyde component, and (iv) at least 0.5 M concentration of a strong acid having a pKa of or less than -2, wherein said carbonization step comprises heating the precursor composition at a carbonizing temperature for sufficient time to convert the precursor composition to a mesoporous carbon material. The invention is also directed to a mesoporous carbon material having an improved thermal stability, preferably produced according to the above method.

  2. Mesoporous carbon materials

    DOEpatents

    Dai, Sheng; Wang, Xiqing

    2013-08-20

    The invention is directed to a method for fabricating a mesoporous carbon material, the method comprising subjecting a precursor composition to a curing step followed by a carbonization step, the precursor composition comprising: (i) a templating component comprised of a block copolymer, (ii) a phenolic compound or material, (iii) a crosslinkable aldehyde component, and (iv) at least 0.5 M concentration of a strong acid having a pKa of or less than -2, wherein said carbonization step comprises heating the precursor composition at a carbonizing temperature for sufficient time to convert the precursor composition to a mesoporous carbon material. The invention is also directed to a mesoporous carbon material having an improved thermal stability, preferably produced according to the above method.

  3. Mesoporous carbon materials

    DOEpatents

    Dai, Sheng; Fulvio, Pasquale Fernando; Mayes, Richard T.; Wang, Xiqing; Sun, Xiao-Guang; Guo, Bingkun

    2014-09-09

    A conductive mesoporous carbon composite comprising conductive carbon nanoparticles contained within a mesoporous carbon matrix, wherein the conductive mesoporous carbon composite possesses at least a portion of mesopores having a pore size of at least 10 nm and up to 50 nm, and wherein the mesopores are either within the mesoporous carbon matrix, or are spacings delineated by surfaces of said conductive carbon nanoparticles when said conductive carbon nanoparticles are fused with each other, or both. Methods for producing the above-described composite, devices incorporating them (e.g., lithium batteries), and methods of using them, are also described.

  4. Engineered monodisperse mesoporous materials

    SciTech Connect

    Saunders, R.S.; Small, J.H.; Lagasse, R.R.; Schroeder, J.L.; Jamison, G.M.

    1997-08-01

    Porous materials technology has developed products with a wide variety of pore sizes ranging from 1 angstrom to 100`s of microns and beyond. Beyond 15{angstrom} it becomes difficult to obtain well ordered, monodisperse pores. In this report the authors describe efforts in making novel porous material having monodisperse, controllable pore sizes spanning the mesoporous range (20--500 {angstrom}). They set forth to achieve this by using unique properties associated with block copolymers--two linear homopolymers attached at their ends. Block copolymers phase separate into monodisperse mesophases. They desired to selectively remove one of the phases and leave the other behind, giving the uniform monodisperse pores. To try to achieve this the authors used ring-opening metathesis polymerization to make the block copolymers. They synthesized a wide variety of monomers and surveyed their polymers by TGA, with the idea that one phase could be made thermally labile while the other phase would be thermally stable. In the precipitated and sol-gel processed materials, they determined by porosimetry measurements that micropores, mesopores, and macropores were created. In the film processed sample there was not much porosity present. They moved to a new system that required much lower thermal treatments to thermally remove over 90% of the labile phase. Film casting followed by thermal treatment and solvent extraction produced the desired monodisperse materials (based solely on SEM results). Modeling using Density Functional Theory was also incorporated into this project. The modeling was able to predict accurately the domain size and spacing vs. molecular weight for a model system, as well as accurate interfacial thicknesses.

  5. Mesoporous materials for antihydrogen production.

    PubMed

    Consolati, Giovanni; Ferragut, Rafael; Galarneau, Anne; Di Renzo, Francesco; Quasso, Fiorenza

    2013-05-01

    Antimatter is barely known by the chemist community and this article has the vocation to explain how antimatter, in particular antihydrogen, can be obtained, as well as to show how mesoporous materials could be used as a further improvement for the production of antimatter at very low temperatures (below 1 K). The first experiments with mesoporous materials highlighted in this review show very promising and exciting results. Mesoporous materials such as mesoporous silicon, mesoporous material films, pellets of MCM-41 and silica aerogel show remarkable features for antihydrogen formation. Yet, the characteristics for the best future mesoporous materials (e.g. pore sizes, pore connectivity, shape, surface chemistry) remain to be clearly identified. For now among the best candidates are pellets of MCM-41 and aerogel with pore sizes between 10 and 30 nm, possessing hydrophobic patches on their surface to avoid ice formation at low temperature. From a fundamental standpoint, antimatter experiments could help to shed light on open issues, such as the apparent asymmetry between matter and antimatter in our universe and the gravitational behaviour of antimatter. To this purpose, basic studies on antimatter are necessary and a convenient production of antimatter is required. It is exactly where mesoporous materials could be very useful. PMID:23250616

  6. Mesoporous Silicate Materials in Sensing

    PubMed Central

    Melde, Brian J.; Johnson, Brandy J.; Charles, Paul T.

    2008-01-01

    Mesoporous silicas, especially those exhibiting ordered pore systems and uniform pore diameters, have shown great potential for sensing applications in recent years. Morphological control grants them versatility in the method of deployment whether as bulk powders, monoliths, thin films, or embedded in coatings. High surface areas and pore sizes greater than 2 nm make them effective as adsorbent coatings for humidity sensors. The pore networks also provide the potential for immobilization of enzymes within the materials. Functionalization of materials by silane grafting or through co-condensation of silicate precursors can be used to provide mesoporous materials with a variety of fluorescent probes as well as surface properties that aid in selective detection of specific analytes. This review will illustrate how mesoporous silicas have been applied to sensing changes in relative humidity, changes in pH, metal cations, toxic industrial compounds, volatile organic compounds, small molecules and ions, nitroenergetic compounds, and biologically relevant molecules.

  7. Mesoporous metal oxide graphene nanocomposite materials

    DOEpatents

    Liu, Jun; Aksay, Ilhan A.; Kou, Rong; Wang, Donghai

    2016-05-24

    A nanocomposite material formed of graphene and a mesoporous metal oxide having a demonstrated specific capacity of more than 200 F/g with particular utility when employed in supercapacitor applications. A method for making these nanocomposite materials by first forming a mixture of graphene, a surfactant, and a metal oxide precursor, precipitating the metal oxide precursor with the surfactant from the mixture to form a mesoporous metal oxide. The mesoporous metal oxide is then deposited onto a surface of the graphene.

  8. Synthesis and characterization of mesoporous materials

    NASA Astrophysics Data System (ADS)

    Cheng, Wei

    Mesoporous materials are highly porous solids with pore sizes in the range of 20 to 500 A and a narrow pore size distribution. Creating a mesoporous morphology in transition metal oxides is expected to increase the kinetics of electrochemical photoelectrochemical processes due to the improved accessibility of electrolyte to electrode. The objective of the dissertation research is to prepare functional mesoporous materials based on transition metal oxides and to determine the effects of the mesoporous structure on the resulting charge transfer, electrochromism, and optical properties. In this dissertation, mesoporous tungsten oxide and niobium oxide were synthesized by incorporating tri-block copolymer surfactant templates into the sol-gel synthesis procedure. Both mesoporous materials have surface areas in the range of 130 m2/g with a narrow pore size distribution centered at ˜45A. Their electrochromic properties were characterized and found to be strongly influenced by the mesoporous morphology. Both mesoporous systems exhibit better electrochemical and optical reversibilities than the analogous sol-gel materials (without using surfactant) and the kinetics of bleaching is substantially faster. Coloration efficiencies for the mesoporous tungsten oxide and niobium oxide films are in the range of 16--37 cm 2/C and 12--16 cm2/C, respectively. Dye sensitized solar cells (DSSC) were fabricated using mesoporous niobium oxide as electrodes. Due to the higher surface area, the mesoporous electrodes have greater dye adsorption and electrolyte penetration compared to sol-gel electrodes, which leads to better electron injection, faster dye regeneration and thus, better cell performance. The mesoporous DSSC exhibits photocurrents of 2.9 mA and fill factors of 0.61. Open circuit voltages of the mesoporous DSSC are in the range of 0.6--0.83V.

  9. Surface-functionalized mesoporous carbon materials

    DOEpatents

    Dai, Sheng; Gorka, Joanna; Mayes, Richard T.

    2016-02-02

    A functionalized mesoporous carbon composition comprising a mesoporous carbon scaffold having mesopores in which polyvinyl polymer grafts are covalently attached, wherein said mesopores have a size of at least 2 nm and up to 50 nm. Also described is a method for producing the functionalized mesoporous composition, wherein a reaction medium comprising a precursor mesoporous carbon, vinyl monomer, initiator, and solvent is subjected to sonication of sufficient power to result in grafting and polymerization of the vinyl monomer into mesopores of the precursor mesoporous carbon. Also described are methods for using the functionalized mesoporous carbon, particularly in extracting metal ions from metal-containing solutions.

  10. The Synthesis of Functional Mesoporous Materials

    SciTech Connect

    Fryxell, Glen E.

    2006-11-01

    The ability to decorate a silica surface with specific ligand fields and/or metal complexes creates powerful new capabilities for catalysis, chemical separations and sensor development. Integrating this with the ability to control the spacing of these complexes across the surface, as well as the symmetry and size of the pore structure, allows the synthetic chemist to hierarchically tailor these structured nanomaterials to specific needs. The next step up the “scale ladder” is provided by the ability to coat these mesoporous materials onto complex shapes, allowing for the intimate integration of these tailored materials into device interfaces. The ability to tailor the pore structure of these mesoporous supports is derived from the surfactant templated synthesis of mesoporous materials, an area which has seen an explosion of activity over the last decade.[1,2] The ability to decorate the surface with the desired functionality requires chemical modification of the oxide interface, most commonly achieved using organosilane self-assembly.[3-6] This manuscript describes recent results from the confluence of these two research areas, with a focus on synthetic manipulation of the morphology and chemistry of the interface, with the ultimate goal of binding metal centers in a chemically useful manner.

  11. Mesoporous silica-titania composed materials.

    PubMed

    Messina, Paula V; Morini, Marcela A; Sierra, María B; Schulz, Pablo C

    2006-08-01

    Titania mesosized particles were obtained by TiCl4 hydrolysis in Aerosol OT/water/n-hexane microemulsion. These particles were incorporated in surfactant templated silica mesoporous materials of MCM-41 and MCM-50 structures. Results depended on the surfactant: hexadecyltrimethylammonium bromide templated materials retained the honeycomb structure with small modifications in their characteristics. The dodecyltrimethylammonium bromide templated material changed from honeycomb to lamellar structure when the titania particles were included, with dramatic changes in the structure characteristics. The didodecyldimethylammonium bromide templated lamellar structure was retained after TIO2 inclusion, with a slight increase in the specific area, pore diameter and pore walls thickness. PMID:16600274

  12. Synthesis and catalytic applications of combined zeolitic/mesoporous materials

    PubMed Central

    Vernimmen, Jarian; Cool, Pegie

    2011-01-01

    Summary In the last decade, research concerning nanoporous siliceous materials has been focused on mesoporous materials with intrinsic zeolitic features. These materials are thought to be superior, because they are able to combine (i) the enhanced diffusion and accessibility for larger molecules and viscous fluids typical of mesoporous materials with (ii) the remarkable stability, catalytic activity and selectivity of zeolites. This review gives an overview of the state of the art concerning combined zeolitic/mesoporous materials. Focus is put on the synthesis and the applications of the combined zeolitic/mesoporous materials. The different synthesis approaches and formation mechanisms leading to these materials are comprehensively discussed and compared. Moreover, Ti-containing nanoporous materials as redox catalysts are discussed to illustrate a potential implementation of combined zeolitic/mesoporous materials. PMID:22259762

  13. The development of chiral nematic mesoporous materials.

    PubMed

    Kelly, Joel A; Giese, Michael; Shopsowitz, Kevin E; Hamad, Wadood Y; MacLachlan, Mark J

    2014-04-15

    Cellulose nanocrystals (CNCs) are obtained from the sulfuric acid-catalyzed hydrolysis of bulk cellulose. The nanocrystals have diameters of ~5-15 nm and lengths of ~100-300 nm (depending on the cellulose source and hydrolysis conditions). This lightweight material has mostly been investigated to reinforce composites and polymers because it has remarkable strength that rivals carbon nanotubes. But CNCs have an additional, less explored property: they organize into a chiral nematic (historically referred to as cholesteric) liquid crystal in water. When dried into a thin solid film, the CNCs retain the helicoidal chiral nematic order and assemble into a layered structure where the CNCs have aligned orientation within each layer, and their orientation rotates through the stack with a characteristic pitch (repeating distance). The cholesteric ordering can act as a 1-D photonic structure, selectively reflecting circularly polarized light that has a wavelength nearly matching the pitch. During CNC self-assembly, it is possible to add sol-gel precursors, such as Si(OMe)4, that undergo hydrolysis and condensation as the solvent evaporates, leading to a chiral nematic silica/CNC composite material. Calcination of the material in air destroys the cellulose template, leaving a high surface area mesoporous silica film that has pore diameters of ~3-10 nm. Importantly, the silica is brilliantly iridescent because the pores in its interior replicate the chiral nematic structure. These films may be useful as optical filters, reflectors, and membranes. In this Account, we describe our recent research into mesoporous films with chiral nematic order. Taking advantage of the chiral nematic order and nanoscale of the CNC templates, new functional materials can be prepared. For example, heating the silica/CNC composites under an inert atmosphere followed by removal of the silica leaves highly ordered, mesoporous carbon films that can be used as supercapacitor electrodes. The composition

  14. Mesoporous silicates: Materials science and biological applications

    NASA Astrophysics Data System (ADS)

    Roggers, Robert Anthony

    This thesis dissertation presents the collective research into the advancement of mesoporous silicate particles as biointerface devices, the development of new materials and the application of these particles as solid supports for heterogeneous catalysis. Mesoporous silica has been utilized in the aforementioned applications due to several reasons; the first being the ability to achieve high surface areas (500 - 1000 m2 g-1) with controlled pore sizes and particle morphology. Another reason for their popularity is their robustness in applications of heterogeneous catalysis and the ability to functionalize the surface with a wide variety of organic functional groups. In the field of biointerface devices, mesoporous silica nanoparticles represent a class of materials that exhibit high biocompatibility. In addition, the ability to functionalize the surfaces (outer surface and pore interiors) allows the particles to be targeted to specific cell types as well as the ability to release many different therapeutic molecules under specific stimuli. A unique particle coating consisting of a chemically cleavable lipid bilayer that allows for the encapsulation of a fluorescent molecule and increases the biocompatibility of the particle has been developed. The lipid bilayer coated mesoporous silica nanoparticle (LB-MSN) was characterized using X-ray diffraction, transmission electron microscopy and nitrogen `sorption isotherms. The finished LB-MSN was then incubated with mammalian cells in order to prove their biocompatibility. Confocal micrographs demonstrate the endocytosis of the particles into the cells. In addition the micrographs also show that the LB-MSNs are separate from the endosomal compartments, however due to the lipophilic nature of the dye used to label the endosome there is some debate regarding this conclusion. The lipid bilayer coating was then applied to a large pore MSN (l-MSN) which had been previously shown to cause lysis of red blood cells (RBCs) at low

  15. Surface functionalized mesoporous material and method of making same

    DOEpatents

    Feng, Xiangdong [West Richland, WA; Liu, Jun [West Richland, WA; Fryxell, Glen E [Kennewick, WA

    2001-12-04

    According to the present invention, an organized assembly of functional molecules with specific interfacial functionality (functional group(s)) is attached to available surfaces including within mesopores of a mesoporous material. The method of the present invention avoids the standard base soak that would digest the walls between the mesopores by boiling the mesoporous material in water for surface preparation then removing all but one or two layers of water molecules on the internal surface of a pore. Suitable functional molecule precursor is then applied to permeate the hydrated pores and the precursor then undergoes condensation to form the functional molecules on the interior surface(s) of the pore(s).

  16. Gated Silica Mesoporous Materials in Sensing Applications.

    PubMed

    Sancenón, Félix; Pascual, Lluís; Oroval, Mar; Aznar, Elena; Martínez-Máñez, Ramón

    2015-08-01

    Silica mesoporous supports (SMSs) have a large specific surface area and volume and are particularly exciting vehicles for delivery applications. Such container-like structures can be loaded with numerous different chemical substances, such as drugs and reporters. Gated systems also contain addressable functions at openings of voids, and cargo delivery can be controlled on-command using chemical, biochemical or physical stimuli. Many of these gated SMSs have been applied for drug delivery. However, fewer examples of their use in sensing protocols have been reported. The approach of applying SMSs in sensing uses another concept-that of loading pores with a reporter and designing a capping mechanism that is selectively opened in the presence of a target analyte, which results in the delivery of the reporter. According to this concept, we provide herein a complete compilation of published examples of probes based on the use of capped SMSs for sensing. Examples for the detection of anions, cations, small molecules and biomolecules are provided. The diverse range of gated silica mesoporous materials presented here highlights their usefulness in recognition protocols. PMID:26491626

  17. Gated Silica Mesoporous Materials in Sensing Applications

    PubMed Central

    Sancenón, Félix; Pascual, Lluís; Oroval, Mar; Aznar, Elena; Martínez-Máñez, Ramón

    2015-01-01

    Silica mesoporous supports (SMSs) have a large specific surface area and volume and are particularly exciting vehicles for delivery applications. Such container-like structures can be loaded with numerous different chemical substances, such as drugs and reporters. Gated systems also contain addressable functions at openings of voids, and cargo delivery can be controlled on-command using chemical, biochemical or physical stimuli. Many of these gated SMSs have been applied for drug delivery. However, fewer examples of their use in sensing protocols have been reported. The approach of applying SMSs in sensing uses another concept—that of loading pores with a reporter and designing a capping mechanism that is selectively opened in the presence of a target analyte, which results in the delivery of the reporter. According to this concept, we provide herein a complete compilation of published examples of probes based on the use of capped SMSs for sensing. Examples for the detection of anions, cations, small molecules and biomolecules are provided. The diverse range of gated silica mesoporous materials presented here highlights their usefulness in recognition protocols. PMID:26491626

  18. Mesoporous silicates: Materials science and biological applications

    NASA Astrophysics Data System (ADS)

    Roggers, Robert Anthony

    This thesis dissertation presents the collective research into the advancement of mesoporous silicate particles as biointerface devices, the development of new materials and the application of these particles as solid supports for heterogeneous catalysis. Mesoporous silica has been utilized in the aforementioned applications due to several reasons; the first being the ability to achieve high surface areas (500 - 1000 m2 g-1) with controlled pore sizes and particle morphology. Another reason for their popularity is their robustness in applications of heterogeneous catalysis and the ability to functionalize the surface with a wide variety of organic functional groups. In the field of biointerface devices, mesoporous silica nanoparticles represent a class of materials that exhibit high biocompatibility. In addition, the ability to functionalize the surfaces (outer surface and pore interiors) allows the particles to be targeted to specific cell types as well as the ability to release many different therapeutic molecules under specific stimuli. A unique particle coating consisting of a chemically cleavable lipid bilayer that allows for the encapsulation of a fluorescent molecule and increases the biocompatibility of the particle has been developed. The lipid bilayer coated mesoporous silica nanoparticle (LB-MSN) was characterized using X-ray diffraction, transmission electron microscopy and nitrogen `sorption isotherms. The finished LB-MSN was then incubated with mammalian cells in order to prove their biocompatibility. Confocal micrographs demonstrate the endocytosis of the particles into the cells. In addition the micrographs also show that the LB-MSNs are separate from the endosomal compartments, however due to the lipophilic nature of the dye used to label the endosome there is some debate regarding this conclusion. The lipid bilayer coating was then applied to a large pore MSN (l-MSN) which had been previously shown to cause lysis of red blood cells (RBCs) at low

  19. Mesoporous silica material TUD-1 as a drug delivery system.

    PubMed

    Heikkilä, T; Salonen, J; Tuura, J; Hamdy, M S; Mul, G; Kumar, N; Salmi, T; Murzin, D Yu; Laitinen, L; Kaukonen, A M; Hirvonen, J; Lehto, V-P

    2007-02-22

    For the first time the feasibility of siliceous mesoporous material TUD-1 (Technische Universiteit Delft) for drug delivery was studied. Model drug, ibuprofen, was adsorbed into TUD-1 mesopores via a soaking procedure. Characterizations with nitrogen adsorption, XRD, TG, HPLC and DSC demonstrated the successful inclusion of ibuprofen into TUD-1 host. The amount of ibuprofen adsorbed into the nanoreservoir of TUD-1 material was higher than reported for other mesoporous silica drug carriers (drug/carrier 49.5 wt.%). Drug release studies in vitro (HBSS buffer pH 5.5) demonstrated a fast and unrestricted liberation of ibuprofen, with 96% released at 210 min of the dissolution assay. The drug dissolution profile of TUD-1 material with the random, foam-like three-dimensional mesopore network and high accessibility to the dissolution medium was found to be much faster (kinetic constant k = 10.7) and more diffusion based (release constant n = 0.64) compared to a mesoporous MCM-41 material with smaller, unidirectional mesopore channels (k = 4.7, n = 0.71). Also, the mesoporous carriers were found to significantly increase the dissolution rate of ibuprofen, when compared to the pure crystalline form of the drug (k = 0.6, n = 0.96). TUD-1 was constituted as a potential drug delivery device with fast release property, with prospective applications in the formulation of poorly soluble drug compounds. PMID:17046183

  20. Mesoporous materials for clean energy technologies.

    PubMed

    Linares, Noemi; Silvestre-Albero, Ana M; Serrano, Elena; Silvestre-Albero, Joaquín; García-Martínez, Javier

    2014-11-21

    Alternative energy technologies are greatly hindered by significant limitations in materials science. From low activity to poor stability, and from mineral scarcity to high cost, the current materials are not able to cope with the significant challenges of clean energy technologies. However, recent advances in the preparation of nanomaterials, porous solids, and nanostructured solids are providing hope in the race for a better, cleaner energy production. The present contribution critically reviews the development and role of mesoporosity in a wide range of technologies, as this provides for critical improvements in accessibility, the dispersion of the active phase and a higher surface area. Relevant examples of the development of mesoporosity by a wide range of techniques are provided, including the preparation of hierarchical structures with pore systems in different scale ranges. Mesoporosity plays a significant role in catalysis, especially in the most challenging processes where bulky molecules, like those obtained from biomass or highly unreactive species, such as CO2 should be transformed into most valuable products. Furthermore, mesoporous materials also play a significant role as electrodes in fuel and solar cells and in thermoelectric devices, technologies which are benefiting from improved accessibility and a better dispersion of materials with controlled porosity. PMID:24699503

  1. Solar hydrogen and solar electricity using mesoporous materials

    NASA Astrophysics Data System (ADS)

    Mahoney, Luther

    The development of cost-effective materials for effective utilization of solar energy is a major challenge for solving the energy problems that face the world. This thesis work relates to the development of mesoporous materials for solar energy applications in the areas of photocatalytic water splitting and the generation of electricity. Mesoporous materials were employed throughout the studies because of their favorable physico-chemical properties such as high surface areas and large porosities. The first project was related to the use of a cubic periodic mesoporous material, MCM-48. The studies showed that chromium loading directly affected the phase of mesoporous silica formed. Furthermore, within the cubic MCM-48 structure, the loading of polychromate species determined the concentration of solar hydrogen produced. In an effort to determine the potential of mesoporous materials, titanium dioxide was prepared using the Evaporation-Induced Self-Assembly (EISA) synthetic method. The aging period directly determined the amount of various phases of titanium dioxide. This method was extended for the preparation of cobalt doped titanium dioxide for solar simulated hydrogen evolution. In another study, metal doped systems were synthesized using the EISA procedure and rhodamine B (RhB) dye sensitized and metal doped titania mesoporous materials were evaluated for visible light hydrogen evolution. The final study employed various mesoporous titanium dioxide materials for N719 dye sensitized solar cell (DSSC) materials for photovoltaic applications. The materials were extensively characterized using powder X-ray diffraction (XRD), nitrogen physisorption, diffuse reflectance spectroscopy (DRS), UV-Vis spectroscopy, Fourier-Transform-Infrared Spectroscopy (FT-IR), Raman spectroscopy, chemisorption, photoluminescence (PL), X-ray photoelectron spectroscopy (XPS), and transmission electron microscopy (TEM). In addition, photoelectrochemical measurements were completed using

  2. Location of laccase in ordered mesoporous materials

    NASA Astrophysics Data System (ADS)

    Mayoral, Álvaro; Gascón, Victoria; Blanco, Rosa M.; Márquez-Álvarez, Carlos; Díaz, Isabel

    2014-11-01

    The functionalization with amine groups was developed on the SBA-15, and its effect in the laccase immobilization was compared with that of a Periodic Mesoporous Aminosilica. A method to encapsulate the laccase in situ has now been developed. In this work, spherical aberration (Cs) corrected scanning transmission electron microscopy combined with high angle annular dark field detector and electron energy loss spectroscopy were applied to identify the exact location of the enzyme in the matrix formed by the ordered mesoporous solids.

  3. Mesoporous carbon/zirconia composites: a potential route to chemically functionalized electrically-conductive mesoporous materials.

    PubMed

    Oh, Jung-Min; Kumbhar, Amar S; Geiculescu, Olt; Creager, Stephen E

    2012-02-14

    Mesoporous nanocomposite materials in which nanoscale zirconia (ZrO(2)) particles are embedded in the carbon skeleton of a templated mesoporous carbon matrix were prepared, and the embedded zirconia sites were used to accomplish chemical functionalization of the interior surfaces of mesopores. These nanocomposite materials offer a unique combination of high porosity (e.g., ∼84% void space), electrical conductivity, and surface tailorability. The ZrO(2)/carbon nanocomposites were characterized by thermogravimetric analysis, nitrogen-adsorption porosimetry, helium pychnometry, powder X-ray diffraction, Raman spectroscopy, scanning electron microscopy, transmission electron microscopy, and X-ray photoelectron spectroscopy. Comparison was made with templated mesoporous carbon samples prepared without addition of ZrO(2). Treatment of the nanocomposites with phenylphosphonic acid was undertaken and shown to result in robust binding of the phosphonic acid to the surface of ZrO(2) particles. Incorporation of nanoscale ZrO(2) surfaces in the mesoporous composite skeleton offers unique promise as a means for anchoring organophosphonates inside of pores through formation of robust covalent Zr-O-P bonds. PMID:22248432

  4. Mesoporous materials for energy conversion and storage devices

    NASA Astrophysics Data System (ADS)

    Li, Wei; Liu, Jun; Zhao, Dongyuan

    2016-06-01

    To meet the growing energy demands in a low-carbon economy, the development of new materials that improve the efficiency of energy conversion and storage systems is essential. Mesoporous materials offer opportunities in energy conversion and storage applications owing to their extraordinarily high surface areas and large pore volumes. These properties may improve the performance of materials in terms of energy and power density, lifetime and stability. In this Review, we summarize the primary methods for preparing mesoporous materials and discuss their applications as electrodes and/or catalysts in solar cells, solar fuel production, rechargeable batteries, supercapacitors and fuel cells. Finally, we outline the research and development challenges of mesoporous materials that need to be overcome to increase their contribution in renewable energy applications.

  5. Location of laccase in ordered mesoporous materials

    SciTech Connect

    Mayoral, Álvaro; Gascón, Victoria; Blanco, Rosa M.; Márquez-Álvarez, Carlos; Díaz, Isabel

    2014-11-01

    The functionalization with amine groups was developed on the SBA-15, and its effect in the laccase immobilization was compared with that of a Periodic Mesoporous Aminosilica. A method to encapsulate the laccase in situ has now been developed. In this work, spherical aberration (C{sub s}) corrected scanning transmission electron microscopy combined with high angle annular dark field detector and electron energy loss spectroscopy were applied to identify the exact location of the enzyme in the matrix formed by the ordered mesoporous solids.

  6. Mesoporous materials used in medicine and environmental applications.

    PubMed

    Gunduz, Oguzhan; Yetmez, Mehmet; Sonmez, Maria; Georgescu, Mihai; Alexandrescu, Laura; Ficai, Anton; Ficai, Denisa; Andronescu, Ecaterina

    2015-01-01

    Mesoporous materials synthesized in the presence of templates, are commonly used for environment and medical applications. Due to the properties it holds, mesoporous silica nanoparticles is an excellent material for use in medical field, biomaterials, active principles delivery systems, enzyme immobilization and imaging. Their structure allows embedding large and small molecules, DNA adsorption and genetic transfer. Using mesoporous silica nanoparticles for delivery of bioactive molecules can protect them against degradation under physiological conditions, allow controlled drugs release and minimize side effects on healthy tissues. Cellular tests performed on mesoporous silica nanoparticles demonstrate that MSN's cytotoxicity is dependent on the size and concentration and suggests the use of larger size nanoparticles is optimal for medical applications. Mesoporous materials possess high biological compatibility, are non-toxic and can be easily modified by functionalizing the surface or inside the pores by grafting or co-condensation method. The structure, composition and pores size of this material can be optimized during synthesis by varying the stoichiometric reactants, reaction conditions, nature of the template's molecules or by functionalization method. PMID:25877095

  7. DEVELOPMENT OF MESOPOROUS MEMBRANE MATERIALS FOR CO2 SEPARATION

    SciTech Connect

    Wei-Heng Shih; Qiang Zhao; Nanlin Wang

    2002-05-01

    Mesoporous and precipitated alumina were synthesized as the base material for CO{sub 2} adsorbent. The porous alumina is doped with Ba to enhance it CO{sub 2} affinity due to the basicity of Ba. it is shown by gas chromatograph (GC) that the addition of Ba enhances the separation CO{sub 2} from N{sub 2}. It was found that mesoporous alumina has larger specific surface area and better selectivity of CO{sub 2} than precipitated alumina. Ba improves the affinity of mesoporous alumina with CO{sub 2}. Phase may play an important role in selective adsorption of CO{sub 2}. It is speculated that mesoporous alumina is more reactive than precipitated alumina creating the xBaO {center_dot} Al{sub 2}O{sub 3} phase that may be more affinity to CO{sub 2} than N{sub 2}. On the other hand, the barium aluminate phase (Ba{sub 3}Al{sub 2}O{sub 6}) in the mesoporous sample does not help the adsorption of CO{sub 2}.

  8. Interactions of Plutonium and Lanthanides with Ordered Mesoporous Materials

    NASA Astrophysics Data System (ADS)

    Parsons-Moss, Tashi

    Ordered mesoporous materials are porous solids with a regular, patterned structure composed of pores between 2 and 50 nm wide. Such materials have attracted much attention in the past twenty years because the chemistry of their synthesis allows control of their unique physicochemical properties, which can be tuned for a variety of applications. Generally, ordered mesoporous materials have very high specific surface areas and pore volumes, and offer unique structures that are neither crystalline nor amorphous. The large tunable interface provided by ordered mesoporous solids may be advantageous in applications involving sequestration, separation, or detection of actinides and lanthanides in solution. However, the fundamental chemical interactions of actinides and lanthanides must be understood before applications can be implemented. This dissertation focuses primarily on the fundamental interactions of plutonium with organically modified mesoporous silica, as well as several different porous carbon materials, both untreated and chemically oxidized. A method for functionalizing mesoporous silica by self assembly and molecular grafting of functional organosilane ligands was optimized for the 2D-hexagonal ordered mesoporous silica known as SBA-15 (Santa Barbara amorphous silica). Four different organically-modified silica materials were synthesized and characterized with several techniques. To confirm that covalent bonds were formed between the silane anchor of the ligand and the silica substrate, functionalized silica samples were analyzed with 29Si nuclear magnetic resonance spectroscopy. Infrared spectroscopy was used in combination with 13C and 31P nuclear magnetic resonance spectroscopy to verify the molecular structures of the ligands after they were synthesized and grafted to the silica. The densities of the functional silane ligands on the silica surface were estimated using thermogravimetric analysis. Batch sorption experiments were conducted with solutions of

  9. Magnetic mesoporous materials for removal of environmental wastes

    SciTech Connect

    Kim, Byoung Chan; Lee, Jinwoo; Um, Wooyong; Kim, Jaeyun; Joo, Jin; Lee, Jin Hyung; Kwak, Ja Hun; Kim, Jae Hyun; Lee, Changha; Lee, Hongshin; Addleman, Raymond S.; Hyeon, Taeghwan; Gu, Man Bock; Kim, Jungbae

    2011-09-15

    We have synthesized two different magnetic mesoporous materials that can be easily separated from aqueous solutions by applying a magnetic field. Synthesized magnetic mesoporous materials, Mag-SBA-15 (magnetic ordered mesoporous silica) and Mag-OMC (magnetic ordered mesoporous carbon), have a high loading capacity of contaminants due to high surface area of the supports and high magnetic activity due to the embedded iron oxide particles. Application of surface-modified Mag-SBA-15 was investigated for the collection of mercury from water. The mercury adsorption using Mag-SBA-15 was rapid during the initial contact time and reached a steady-state condition, with an uptake of approximately 97% after 7 hours. Application of Mag-OMC for collection of organics from water, using fluorescein as an easily trackable model analyte, was explored. The fluorescein was absorbed into Mag-OMC within minutes and the fluorescent intensity of solution was completely disappeared after an hour. In another application, Mag-SBA-15 was used as a host of tyrosinase, and employed as recyclable catalytic scaffolds for tyrosinase-catalyzed biodegradation of catechol. Tyrosinase aggregates in Mag-SBA-15, prepared in a two step process of tyrosinase adsorption and crosslinking, could be used repeatedly for catechol degradation with no serious loss of enzyme activity. Considering these results of cleaning up water from toxic inorganic, organic and biochemical contaminants, magnetic mesoporous materials have a great potential to be employed for the removal of environmental contaminants and potentially for the application in large-scale wastewater treatment plants.

  10. Functionalized mesoporous silica materials for molsidomine adsorption: Thermodynamic study

    SciTech Connect

    Alyoshina, Nonna A.; Parfenyuk, Elena V.

    2013-09-15

    A series of unmodified and organically modified mesoporous silica materials was prepared. The unmodified mesoporous silica was synthesized via sol–gel synthesis in the presence of D-glucose as pore-forming agent. The functionalized by phenyl, aminopropyl and mercaptopropyl groups silica materials were prepared via grafting. The fabricated adsorbent materials were characterized by Fourier transform infrared spectroscopy (FTIR) analysis, N{sub 2} adsorption/desorption and elemental analysis methods. Then their adsorption properties for mesoionic dug molsidomine were investigated at 290–313 K and physiological pH value. Thermodynamic parameters of molsidomine adsorption on the synthesized materials have been calculated. The obtained results showed that the adsorption process of molsidomine on the phenyl modified silica is the most quantitatively and energetically favorable. The unmodified and mercaptopropyl modified silica materials exhibit significantly higher adsorption capacities and energies for molsidomine than the aminopropyl modified sample. The effects are discussed from the viewpoint of nature of specific interactions responsible for the adsorption. - Graphical abstract: Comparative analysis of the thermodynamic characteristics of molsidomine adsorption showed that the adsorption process on mesoporous silica materials is controlled by chemical nature of surface functional groups. Molsidomine adsorption on the phenyl modified silica is the most quantitatively and energetically favorable. Taking into account ambiguous nature of mesoionic compounds, it was found that molsidomine is rather aromatic than dipolar. Display Omitted - Highlights: • Unmodified and organically modified mesoporous silica materials were prepared. • Molsidomine adsorption on the silica materials was studied. • Phenyl modified silica shows the highest adsorption capacity and favorable energy. • Molsidomine exhibits the lowest affinity to aminopropyl modified silica.

  11. Magnetic mesoporous material for the sequestration of algae

    SciTech Connect

    Trewyn, Brian G.; Kandel, Kapil; Slowing, Igor Ivan; Lee, Show-Ling

    2014-09-09

    The present invention provides a magnetic mesoporous nanoparticle that includes a mesoporous silicate nanoparticle and iron oxide. The present invention also provides a method of using magnetic mesoporous nanoparticles to sequester microorganisms from a media.

  12. Fluorescent Functionalized Mesoporous Silica for Radioactive Material Extraction

    SciTech Connect

    Li, Juan; Zhu, Kake; Shang, Jianying; Wang, Donghai; Nie, Zimin; Guo, Ruisong; Liu, Chongxuan; Wang, Zheming; Li, Xiaolin; Liu, Jun

    2012-08-01

    Mesoporous silica with covalently bound salicylic acid molecules incorporated in the structure was synthesized with a one-pot, co-condensation reaction at room temperature. The as-synthesized material has a large surface area, uniform particle size, and an ordered pore structure as determined by characterization with transmission electron microscopy, thermal gravimetric analysis, and infrared spectra, etc. Using the strong fluorescence and metal coordination capability of salicylic acid, functionalized mesoporous silica (FMS) was developed to track and extract radionuclide contaminants, such as uranyl [U(VI)] ions encountered in subsurface environments. Adsorption measurements showed a strong affinity of the FMS toward U(VI) with a Kd value of 105 mL/g, which is four orders of magnitude higher than the adsorption of U(VI) onto most of the sediments in natural environments. The new materials have a potential for synergistic environmental monitoring and remediation of the radionuclide U(VI) from contaminated subsurface environments.

  13. Nanostructured mesoporous materials for lithium-ion battery applications

    NASA Astrophysics Data System (ADS)

    Balaya, P.; Saravanan, K.; Hariharan, S.; Ramar, V.; Lee, H. S.; Kuezma, M.; Devaraj, S.; Nagaraju, D. H.; Ananthanarayanan, K.; Mason, C. W.

    2011-06-01

    The Energy crisis happens to be one of the greatest challenges we are facing today. In this view, much effort has been made in developing new, cost effective, environmentally friendly energy conversion and storage devices. The performance of such devices is fundamentally related to material properties. Hence, innovative materials engineering is important in solving the energy crisis problem. One such innovation in materials engineering is porous materials for energy storage. Porous electrode materials for lithium-ion batteries (LIBs) offer a high degree of electrolyte-electrode wettability, thus enhancing the electrochemical activity within the material. Among the porous materials, mesoporous materials draw special attention, owing to shorter diffusion lengths for Li+ and electronic movement. Nanostructured mesoporous materials also offer better packing density compared to their nanostructured counterparts such as nanopowders, nanowires, nanotubes etc., thus opening a window for developing electrode materials with high volumetric energy densities. This would directly translate into a scenario of building batteries which are much lighter than today's commercial LIBs. In this article, the authors present a simple, soft template approach for preparing both cathode and anode materials with high packing density for LIBs. The impact of porosity on the electrochemical storage performance is highlighted.

  14. Paramagnetic muon states in mesoporous carbon materials

    NASA Astrophysics Data System (ADS)

    Macrae, R. M.; Upchurch, C.; Rose, D. K.; Miyake, Y.; Koda, A.; Lord, J. S.; Shuttleworth, P. S.

    2014-12-01

    We present results of longitudinal field repolarisation measurements carried out at J-PARC and ISIS on the "green" functional carbon materials Starbon 300 and Starbon 800, synthesized using starch as a template and subjected to pyrolysis treatments at different temperatures (300°C and 800°C respectively); pyrolysis at low temperature may be expected to yield a material retaining more of the "hydrophilic" properties of the original starch material in its chemically active voids, while high temperature pyrolysis may be expected to lead to "hydrophobic" voids and a more graphitic material. The hydrophilic material shows a larger repolarising fraction than the hydrophobic material, with a hyperfine constant on the order of 200-300 MHz. This is likely to be a superposition of the repolarisation of multiple radicals. Several candidate and model species are investigated through accompanying density functional theory calculations.

  15. Sol Gel-Derived SBA-16 Mesoporous Material

    PubMed Central

    Rivera-Muñoz, Eric M.; Huirache-Acuña, Rafael

    2010-01-01

    The aim of this article is to review current knowledge related to the synthesis and characterization of sol gel-derived SBA-16 mesoporous silicas, as well as a review of the state of the art in this issue, to take stock of knowledge about current and future applications. The ease of the method of preparation, the orderly structure, size and shape of their pores and control, all these achievable through simple changes in the method of synthesis, makes SBA-16 a very versatile material, potentially applicable in many areas of science and molecular engineering of materials. PMID:20957080

  16. Selective catalysis utilizing bifunctionalized MCM-41 mesoporous materials

    SciTech Connect

    Strosahl, Kasey Jean

    2005-05-01

    Selective catalysis is a field that has been under intense investigation for the last 100 years. The most widely used method involves catalysts with stereochemical selectivity. In this type of catalysis, the catalyst controls which reactants will be transformed into the desired product. The secret to employing this type of catalysis, though, is to design the proper catalyst, which can be difficult. One may spend as much time developing the catalyst as spent separating the various products achieved. Another method of selective catalysis is now being explored. The method involves utilizing a multifunctional mesoporous silica catalyst with a gate-keeping capability. Properly functionalized mesoporous materials with well-defined pore morphology and surface properties can provide an ideal three-dimensional environment for anchoring various homogeneous catalysts. These materials can circumvent the multi-sited two-dimensional nature most heterogeneous systems have without adversely impacting the reactant diffusivity. These single-site nanostructured catalysts with ordered geometrical structure are advantageous in achieving high selectivity and reactivity. Mesoporous materials can be prepared to include pores lined homogeneously with tethered catalysts via co-condensation. Additionally, these materials can be reacted with another (RO){sub 3}Si{approx}Z group by using the traditional grafting method; this group is anchored predominantly at the entrances to the pores rather than inside the pores. Thus, if these {approx}Z groups are chosen properly, they can select certain molecules to enter the pores and be converted to products (Scheme 1). In such multifunctional catalysts, the selectivity depends on the discrimination of the gatekeeper. Gate-keeping MCM-41 materials are at the forefront of catalytic substances.

  17. Introduction of bridging and pendant organic groups into mesoporous alumina materials.

    PubMed

    Grant, Stacy M; Woods, Stephan M; Gericke, Arne; Jaroniec, Mietek

    2011-11-01

    Incorporation of organic functionalities into soft-templated mesoporous alumina was performed via organosilane-assisted evaporation induced self-assembly using aluminum alkoxide precursors and block copolymer templates. This strategy permits one to obtain mesoporous alumina-based materials with tailorable adsorption, surface and structural properties. Isocyanurate, ethane, mercaptopropyl, and ureidopropyl-functionalized mesoporous alumina materials were synthesized with relatively high surface area and large pore volume with uniform and wormhole-like mesopores. The presence of organosilyl groups within these hybrid materials was confirmed by IR or Raman spectroscopy and their concentration was determined by elemental analysis. PMID:21988174

  18. Method for rapidly producing microporous and mesoporous materials

    DOEpatents

    Coronado, P.R.; Poco, J.F.; Hrubesh, L.W.; Hopper, R.W.

    1997-11-11

    An improved, rapid process is provided for making microporous and mesoporous materials, including aerogels and pre-ceramics. A gel or gel precursor is confined in a sealed vessel to prevent structural expansion of the gel during the heating process. This confinement allows the gelation and drying processes to be greatly accelerated, and significantly reduces the time required to produce a dried aerogel compared to conventional methods. Drying may be performed either by subcritical drying with a pressurized fluid to expel the liquid from the gel pores or by supercritical drying. The rates of heating and decompression are significantly higher than for conventional methods. 3 figs.

  19. Method for rapidly producing microporous and mesoporous materials

    DOEpatents

    Coronado, Paul R.; Poco, John F.; Hrubesh, Lawrence W.; Hopper, Robert W.

    1997-01-01

    An improved, rapid process is provided for making microporous and mesoporous materials, including aerogels and pre-ceramics. A gel or gel precursor is confined in a sealed vessel to prevent structural expansion of the gel during the heating process. This confinement allows the gelation and drying processes to be greatly accelerated, and significantly reduces the time required to produce a dried aerogel compared to conventional methods. Drying may be performed either by subcritical drying with a pressurized fluid to expel the liquid from the gel pores or by supercritical drying. The rates of heating and decompression are significantly higher than for conventional methods.

  20. DEVELOPMENT OF MESOPOROUS MEMBRANE MATERIALS FOR CO2 SEPARATION

    SciTech Connect

    Wei-Heng Shih; Tejas Patil; Qiang Zhao

    2003-03-25

    The huge emissions of carbon dioxide from fossil fuel fired power plants and industrial plants over the last century have resulted in an increase of the atmospheric carbon dioxide concentration. Climatological modeling work has predicted severe climate disruption as a result of the trapping of heat due to CO{sub 2}. As an attempt to address this global warming effect, DOE has initiated the Vision 21 concept for future power plants. We first synthesized mesoporous aluminosilicates that have high surface area and parallel pore channels for membrane support materials. Later we synthesized microporous aluminosilicates as the potential thin membrane materials for selective CO{sub 2} adsorption. The pore size is controlled to be less that 1 nm so that the adsorption of CO{sub 2} on the pore wall will block the passage of N{sub 2}. Mesoporous and precipitated alumina were synthesized as the base material for CO{sub 2} adsorbent. The porous alumina is doped with Ba to enhance its CO{sub 2} affinity due to the basicity of Ba. It is shown by gas chromatograph (GC) that the addition of Ba enhances the separation CO{sub 2} from N{sub 2}. It was found that mesoporous alumina has larger specific surface area and better selectivity of CO{sub 2} than precipitated alumina. Ba improves the affinity of mesoporous alumina with CO{sub 2}. Phase may play an important role in selective adsorption of CO{sub 2}. It is speculated that mesoporous alumina is more reactive than precipitated alumina creating the xBaO {center_dot}Al{sub 2}O{sub 3} phase that may be more affinitive to CO{sub 2} than N{sub 2}. On the other hand, the barium aluminates phase (Ba{sub 3}Al{sub 2}O{sub 6}) in the mesoporous sample does not help the adsorption of CO{sub 2}. Microporous aluminosilicate was chosen as a suitable candidate for CO{sub 2}/N{sub 2} separation because the pore size is less than 10 {angstrom}. If a CO{sub 2} adsorbent is added to the microporous silica, the adsorption of CO{sub 2} can block the

  1. Mesoporous silica as carrier of antioxidant for food packaging materials

    NASA Astrophysics Data System (ADS)

    Buonocore, Giovanna Giuliana; Gargiulo, Nicola; Verdolotti, Letizia; Liguori, Barbara; Lavorgna, Marino; Caputo, Domenico

    2014-05-01

    Mesoporous silicas have been long recognized as very promising materials for the preparation of drug delivery systems. In this work SBA-15 mesoporous silica has been functionalized with amino-silane to be used as carrier of antioxidant compound in the preparation of active food packaging materials exhibiting tailored release properties. Active films have been prepared by loading the antioxidant tocopherol, the purely siliceous SBA-15 and the aminofunctionalized SBA-15 loaded with tocopherol into LDPE matrix trough a two-step process (mixing+extrusion). The aim of the present work is the study of the effect of the pore size and of the chemical functionality of the internal walls of the mesophase on the migration of tocopherol from active LDPE polymer films. Moreover, it has been proved that the addition of the active compound do not worsen the properties of the film such as optical characteristic and water vapor permeability, thus leading to the development of a material which could be favorably used mainly, but not exclusively, in the sector of food packaging.

  2. Hydrothermal Synthesis of Meso-porous Materials using Diatomaceous Earth

    NASA Astrophysics Data System (ADS)

    Jing, Z.; Kato, S.; Maeda, H.; Ishida, E. H.

    2007-03-01

    In order to sustain the inherent properties of diatomaceous earth (DE), a low-temperature synthesis of mesoporous material from DE was carried out using a hydrothermal processing technique under saturated steam pressure at 200 °C for 12 h. The experimental results showed that the most important strength-producing constituent in the solidified specimens was tobermorite formed by hydrothermal processing, and the addition of slaked lime was favorable to tobermorite formation. At Ca/Si ratio around 0.83 in the starting material, tobermorite appeared to form readily. A high autoclave curing temperature (200 °C), or a longer curing time (12 h) seemed to accelerate the tobermorite formation, thus leading to a higher strength development.

  3. Mesoporous Carbon-based Materials for Alternative Energy Applications

    NASA Astrophysics Data System (ADS)

    Cross, Kimberly Michelle

    Increasing concerns for the escalating issues activated by the effect of carbon dioxide emissions on the global climate from extensive use of fossil fuels and the limited amount of fossil resources has led to an in-depth search for alternative energy systems, primarily based on nuclear or renewable energy sources. Recent innovations in the production of more efficient devices for energy harvesting, storage, and conversion are based on the incorporation of nanostructured materials into electrochemical systems. The aforementioned nano-electrochemical energy systems hold particular promise for alternative energy transportation related technologies including fuel cells, hydrogen storage, and electrochemical supercapacitors. In each of these devices, nanostructured materials can be used to increase the surface area where the critical chemical reactions occur within the same volume and mass, thereby increasing the energy density, power density, electrical efficiency, and physical robustness of the system. Durable corrosion resistant carbon support materials for fuel cells have been designed by adding conductive low cost carbon materials with chemically robust ceramic materials. Since a strict control of the pore size is mandatory to optimize properties for improved performance, chemical activation agents have been utilized as porogens to tune surface areas, pore size distributions, and composition of carbon-based mesoporous materials. Through the use of evaporative self-assembly methods, both randomly disordered and surfactant-templated, ordered carbon-silica nanocomposites have been synthesized with controlled surface area, pore volume, and pore size ranging from 50-800 m2/g, 0.025-0.75 cm3/g, and 2-10 nm, respectively. Multi-walled carbon nanotubes (MWNTs) ranging from 0.05-1.0 wt. % were added to the aforementioned carbon-silica nanocomposites, which provided an additional increase in surface area and improved conductivity. Initially, a conductivity value of 0.0667 S

  4. Studies on Supercapacitor Electrode Material from Activated Lignin-Derived Mesoporous Carbon

    SciTech Connect

    Saha, Dipendu; Li, Yunchao; Bi, Zhonghe; Chen, Jihua; Keum, Jong Kahk; Hensley, Dale K; Grappe, Hippolyte A.; Meyer III, Harry M; Dai, Sheng; Paranthaman, Mariappan Parans; Naskar, Amit K

    2014-01-01

    We synthesized mesoporous carbon from pre-cross-linked lignin gel impregnated with a surfactant as the pore-forming agent, and then activated the carbon through physical and chemical methods to obtain activated mesoporous carbon. The activated mesoporous carbons exhibited 1.5- to 6-fold increases in porosity with a maximum BET specific surface area of 1148 m2/g and a pore volume of 1.0 cm3/g. Slow physical activation helped retain dominant mesoporosity; however, aggressive chemical activation caused some loss of the mesopore volume fraction. Plots of cyclic voltammetric data with the capacitor electrode made from these carbons showed an almost rectangular curve depicting the behavior of ideal double-layer capacitance. Although the pristine mesoporous carbon exhibited the same range of surface-area-based capacitance as that of other known carbon-based supercapacitors, activation decreased the surface-area-based specific capacitance and increased the gravimetric-specific capacitance of the mesoporous carbons. Surface activation lowered bulk density and electrical conductivity. Warburg impedance as a vertical tail in the lower frequency domain of Nyquist plots supported good supercapacitor behavior for the activated mesoporous carbons. Our work demonstrated that biomass-derived mesoporous carbon materials continue to show potential for use in specific electrochemical applications.

  5. Mixed surfactants-directed the mesoporous silica materials with various morphologies and structures

    SciTech Connect

    Lin Huiming; Qu Fengyu; Wu Xiang; Xue Ming; Zhu Guangshan; Qiu Shilun

    2011-06-15

    A new mixed surfactants system using alkyl carboxylic acids and quaternized poly[bis(2-chloroethyl)ether-alt-1,3-bis[3-(dimethylamino)propyl] urea] (PEPU) as the co-template was used to synthesize mesoporous silica materials with various morphologies and structures, including flakes, regular spheres, nanoparticles, and tube-spheres. The cationic polymer connected the anionic surfactant micelle to the anionic polysilicate species to induce the synthesis of the mesoporous silica materials. The structure and property of the surfactant and the cationic polymer determined the formation of mesoporous silica, and also had a signification influence on the morphology and structure of the final materials. To further explore the possible formation mechanism of these mesoporous materials, zeta potential was utilized to evaluate the interaction between the anionic surfactant and the cationic co-template. In addition, the structure, morphology, and porosity of these materials were characterized by powder X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), and N{sub 2} adsorption-desorption measurements. - Graphical abstract: A new mixed surfactants system using alkyl carboxylic acids and PEPU as the co-template was used to synthesize mesoporous silica materials with various morphologies and structures. Highlights: {yields}A new mixed surfactants system induced the mesoporous silica materials with various morphologies and structure. > It is a development of the type S{sup -}N{sup +}I{sup -} route of the mesoporous formation. > Zeta potential was utilized to evaluate the interaction between the anionic surfactant and the cationic co-template. > The property and amount of surfactant and polymer determined the formation of the mesoporous materials.

  6. Functionalized mesoporous materials for adsorption and release of different drug molecules: A comparative study

    SciTech Connect

    Wang Gang; Otuonye, Amy N.; Blair, Elizabeth A.; Denton, Kelley; Tao Zhimin; Asefa, Tewodros

    2009-07-15

    The adsorption capacity and release properties of mesoporous materials for drug molecules can be improved by functionalizing their surfaces with judiciously chosen organic groups. Functionalized ordered mesoporous materials containing various types of organic groups via a co-condensation synthetic method from 15% organosilane and by post-grafting organosilanes onto a pre-made mesoporous silica were synthesized. Comparative studies of their adsorption and release properties for various model drug molecules were then conducted. Functional groups including 3-aminopropyl, 3-mercaptopropyl, vinyl, and secondary amine groups were used to functionalize the mesoporous materials while rhodamine 6G and ibuprofen were utilized to investigate the materials' relative adsorption and release properties. The self-assembly of the mesoporous materials was carried out in the presence of cetyltrimethylammonium bromide (CTAB) surfactant, which produced MCM-41 type materials with pore diameters of {approx}2.7-3.3 nm and moderate to high surface areas up to {approx}1000 m{sup 2}/g. The different functional groups introduced into the materials dictated their adsorption capacity and release properties. While mercaptopropyl and vinyl functionalized samples showed high adsorption capacity for rhodamine 6G, amine functionalized samples exhibited higher adsorption capacity for ibuprofen. While the diffusional release of ibuprofen was fitted on the Fickian diffusion model, the release of rhodamine 6G followed Super Case-II transport model. - Graphical abstract: The adsorption capacity and release properties of mesoporous materials for various drug molecules are tuned by functionalizing the surfaces of the materials with judiciously chosen organic groups. This work reports comparative studies of the adsorption and release properties of functionalized ordered mesoporous materials containing different hydrophobic and hydrophilic groups that are synthesized via a co-condensation and post

  7. Neutron imaging of ion transport in mesoporous carbon materials.

    PubMed

    Sharma, Ketki; Bilheux, Hassina Z; Walker, Lakeisha M H; Voisin, Sophie; Mayes, Richard T; Kiggans, Jim O; Yiacoumi, Sotira; DePaoli, David W; Dai, Sheng; Tsouris, Costas

    2013-07-28

    Neutron imaging is presented as a tool for quantifying the diffusion of ions inside porous materials, such as carbon electrodes used in the desalination process via capacitive deionization and in electrochemical energy-storage devices. Monolithic mesoporous carbon electrodes of ∼10 nm pore size were synthesized based on a soft-template method. The electrodes were used with an aqueous solution of gadolinium nitrate in an electrochemical flow-through cell designed for neutron imaging studies. Sequences of neutron images were obtained under various conditions of applied potential between the electrodes. The images revealed information on the direction and magnitude of ion transport within the electrodes. From the time-dependent concentration profiles inside the electrodes, the average value of the effective diffusion coefficient for gadolinium ions was estimated to be 2.09 ± 0.17 × 10(-11) m(2) s(-1) at 0 V and 1.42 ± 0.06 × 10(-10) m(2) s(-1) at 1.2 V. The values of the effective diffusion coefficient obtained from neutron imaging experiments can be used to evaluate model predictions of the ion transport rate in capacitive deionization and electrochemical energy-storage devices. PMID:23756558

  8. Applications of mesoporous materials as excipients for innovative drug delivery and formulation.

    PubMed

    Shen, Shou-Cang; Ng, Wai Kiong; Chia, Leonard Sze Onn; Dong, Yuan-Cai; Tan, Reginald Beng Hee

    2013-01-01

    Due to uniquely ordered nanoporous structure and high surface area as well as large pore volume, mesoporous materials have exhibited excellent performance in both controlled drug delivery with sustained release profiles and formulation of poorly aqueoussoluble drugs with enhanced bioavailability. Compared with other bulk excipients, mesoporous materials could achieve a higher loading of active ingredients and a tunable drug release profile, as the high surface density of surface hydroxyl groups offered versatility to be functionalized. With drug molecules stored in nano sized channels, the pore openings could be modified using functional polymers or nano-valves performing as stimuli-responsive release devices and the drug release could be triggered by environmental changes or other external effects. In particular, mesoporous silica nanoparticles (MSN) have attracted much attention for application in functional target drug delivery to the cancer cell. The smart nano-vehicles for drug delivery have showed obvious improvements in the therapeutic efficacy for tumor suppression as compared with conventional sustained release systems, although further progress is still needed for eventual clinical applications. Alternatively, unmodified mesoporous silica also exhibited feasible application for direct formulation of poorly water-soluble drugs to enhance dissolution rate, solubility and thus increase the bioavailability after administration. In summary, mesoporous materials offer great versatility that can be used both for on-demand oral and local drug delivery, and scientists are making great efforts to design and fabricate innovative drug delivery systems based on mesoporous drug carriers. PMID:23470004

  9. Ordered mesoporous ternary mixed oxide materials as potential adsorbent of biomolecules

    NASA Astrophysics Data System (ADS)

    Pal, Nabanita; Bhaumik, Asim

    2012-05-01

    Designing a suitable mesoporous framework material for the selective adsorption or immobilization of biomolecules is a very challenging area of research. Mesoporous ternary Co-Si-Al oxide materials with large mesopore and their nanoscale ordering have been reported. The synthesis of these ternary oxides are accomplished through evaporation induced self-assembly (EISA) method using Pluronic non-ionic surfactant F127 under non-aqueous sol-gel route. N2 sorption study revealed high BET surface areas for these materials. These materials exhibited very efficient and selective adsorption for the essential biomolecules like vitamin C (ascorbic acid), vitamin B6 (pyridoxine) and vitamin B3 (nicotinic acid) from their respective aqueous solutions.

  10. Magnetically responsive ordered mesoporous materials: A burgeoning family of functional composite nanomaterials

    NASA Astrophysics Data System (ADS)

    Deng, Yonghui; Cai, Yue; Sun, Zhenkun; Zhao, Dongyuan

    2011-06-01

    Magnetic mesoporous materials, as a family of novel functional nanomaterials, have attracted increasing attention due to their unique properties. Much work has been done to synthesize these materials and to explore applications in various fields, such as catalysis, separation, hyperthermia, drug delivery, and MR imaging. This Letter reviews the synthesis approaches, which can be grouped into three categories, i.e. sol-gel coating, post-loading, and nanocasting approaches. Emphasis is placed on the elucidation of the design principles, synthesis strategies and the properties-applications relationship of the mesoporous materials.

  11. Self-Assembly Synthesis and Functionalization of Mesoporous Carbon Materials for Energy-Related Applications

    SciTech Connect

    Dai, Sheng

    2009-01-01

    Self-Assembly Synthesis and Functionalization of Mesoporous Carbon Materials for Energy-Related Applications Sheng Dai Chemical Sciences Division, Oak Ridge National Laboratory, Oak Ridge, TN, 37831-6201 Porous carbon materials are ubiquitous in separation, catalysis, and energy storage/conversion. Well-defined mesoporous carbon materials are essential for a number of the aforementioned applications. Ordered porous carbon materials have previously been synthesized using colloidal crystals and presynthesized mesoporous silicas as hard templates. The mesostructures of these carbon materials are connected via ultrathin carbon filaments and can readily collapse under high-temperature conditions. Furthermore, these hard-template methodologies are extremely difficult to adapt to the fabrication of large-scale ordered nanoporous films or monoliths with controlled pore orientations. More recently, my research group at the Oak Ridge National Laboratory and several others around the world have developed alternative methods for synthesis of highly ordered mesoporous carbons via self-assembly. Unlike the mesoporous carbons synthesized via hard-template methods, these mesoporous carbons are highly stable and can be graphitized at high temperature (>2800ᵒC) without significant loss of mesopores. The surface properties of these materials can be further tailored via surface functionalization. This seminar will provide an overview and perspective of the mesoporous carbon materials derived from soft-template synthesis and surface functionalization and their fascinating applications in catalysis, separation, and energy storage devices. Dr. Sheng Dai got his B.S. and M.S. degrees from Zhejiang University in 1984 and 1986, respectively. He subsequently obtained a PhD degree from the University of Tennessee, Knoxville in 1990. He is currently a Senior Staff Scientist and Group Leader of Nanomaterials Group and Center for Nanophase Materials Science of Oak Ridge National Laboratory and

  12. Bio-templated synthesis of highly ordered macro-mesoporous silica material for sustained drug delivery

    NASA Astrophysics Data System (ADS)

    Qu, Fengyu; Lin, Huiming; Wu, Xiang; Li, Xiaofeng; Qiu, Shilun; Zhu, Guangshan

    2010-05-01

    The bimodal porous structured silica materials consisting of macropores with the diameter of 5-20 μm and framework-like mesopores with the diameter of 4.7-6.0 nm were prepared using natural Manchurian ash and mango linin as macropored hard templates and P123 as mesopore soft templates, respectively. The macroporous structures of Manchurian ash and mango linin were replicated with the walls containing highly ordered mesoporous silica as well. As-synthesized dual porous silica was characterized by scanning electron microscope (SEM), powder X-ray diffraction (XRD), transmission electron microscope (TEM) and nitrogen adsorption/desorption, fourier transform IR (FTIR) spectroscopy, and thermo-gravimetric analyzer (TGA). Ibuprofen (Ibu) was employed as a model drug and the release profiles showed that the dual porous material had a sustained drug delivery capability. And such highly ordered dual pore silica materials may have potential applications for bimolecular adsorption/separation and tissue repairing.

  13. Synthesis and catalytic properties of hybrid mesoporous materials assembled from polyhedral and bridged silsesquioxane monomers.

    PubMed

    Díaz, Urbano; García, Teresa; Velty, Alexandra; Corma, Avelino

    2012-07-01

    A family of hybrid mesoporous materials with high temperature stability was obtained by the suitable covalent combination of two types of siloxane precursors. Specifically, cubic T(8) polyhedral oligomeric (POSS) and aryl bridged silsesquioxane monomers (1,4-bis(triethoxysilyl)benzene, BTEB) play the role of nanobuilders. An optimal molar ratio of the two precursors (5-25 mol% of total silicon content from the BTEB disilane) generated a homogenous, highly accessible, and well-defined mesoporous material with hexagonal symmetry and narrow pore-size distribution. Physicochemical, textural, and spectroscopic analysis corroborated the effective integration and preservation of the two different nanoprecursors, thereby confirming the framework of the mesoporous hybrid materials. A post-synthesis amination treatment allowed the effective incorporation of amino groups onto the aryl linkers, thereby obtaining a stable and recyclable basic catalyst for use in C-C bond-formation processes. PMID:22678926

  14. Hierarchically ordered mesoporous Co3O4 materials for high performance Li-ion batteries

    PubMed Central

    Sun, Shijiao; Zhao, Xiangyu; Yang, Meng; Wu, Linlin; Wen, Zhaoyin; Shen, Xiaodong

    2016-01-01

    Highly ordered mesoporous Co3O4 materials have been prepared via a nanocasting route with three-dimensional KIT-6 and two-dimensional SBA-15 ordered mesoporous silicas as templates and Co(NO3)2 · 6H2O as precursor. Through changing the hydrothermal treating temperature of the silica template, ordered mesoporous Co3O4 materials with hierarchical structures have been developed. The larger pores around 10 nm provide an efficient transport for Li ions, while the smaller pores between 3–5 nm offer large electrochemically active areas. Electrochemical impedance analysis proves that the hierarchical structure contributes to a lower charge transfer resistance in the mesoporous Co3O4 electrode than the mono-sized structure. High reversible capacities around 1141 mAh g−1 of the hierarchically mesoporous Co3O4 materials are obtained, implying their potential applications for high performance Li-ion batteries. PMID:26781265

  15. Synthesis of mesoporous silica materials from municipal solid waste incinerator bottom ash.

    PubMed

    Liu, Zhen-Shu; Li, Wen-Kai; Huang, Chun-Yi

    2014-05-01

    Incinerator bottom ash contains a large amount of silica and can hence be used as a silica source for the synthesis of mesoporous silica materials. In this study, the conditions for alkaline fusion to extract silica from incinerator bottom ash were investigated, and the resulting supernatant solution was used as the silica source for synthesizing mesoporous silica materials. The physical and chemical characteristics of the mesoporous silica materials were analyzed using BET, XRD, FTIR, SEM, and solid-state NMR. The results indicated that the BET surface area and pore size distribution of the synthesized silica materials were 992 m2/g and 2-3.8 nm, respectively. The XRD patterns showed that the synthesized materials exhibited a hexagonal pore structure with a smaller order. The NMR spectra of the synthesized materials exhibited three peaks, corresponding to Q(2) [Si(OSi)2(OH)2], Q(3) [Si(OSi)3(OH)], and Q(4) [Si(OSi)4]. The FTIR spectra confirmed the existence of a surface hydroxyl group and the occurrence of symmetric Si-O stretching. Thus, mesoporous silica was successfully synthesized from incinerator bottom ash. Finally, the effectiveness of the synthesized silica in removing heavy metals (Pb2+, Cu2+, Cd2+, and Cr2+) from aqueous solutions was also determined. The results showed that the silica materials synthesized from incinerator bottom ash have potential for use as an adsorbent for the removal of heavy metals from aqueous solutions. PMID:24656468

  16. "Host-guest" chemistry in the synthesis of ordered nonsiliceous mesoporous materials.

    PubMed

    Wan, Ying; Yang, Haifeng; Zhao, Dongyuan

    2006-07-01

    On the basis of the consideration of "host-guest" chemistry, the interactions between guest molecules are highlighted in the synthesis of nonsiliceous mesoporous materials by the "soft-template" and "hard-template" approaches. A generalized "acid-base pair" concept is utilized in selecting appropriate guest molecules to prepare highly ordered mesoporous metal oxides, phosphates, and borates with diversified structures. Mesoscopically ordered polymer and carbon frameworks with uniformly large pore sizes are derived from the self-assembly of an organic surfactant with an organic guest. Properly building the guest unit and decorating the host are important in replicating ordered nonsiliceous single-crystal nanoarrays. Outlooks on the potential possibilities for synthesizing ordered mesoporous nonsiliceous materials are presented as well. PMID:16846206

  17. Evaluation of thermoporometry for characterization of mesoporous materials.

    PubMed

    Yamamoto, Takuji; Endo, Akira; Inagi, Yuki; Ohmori, Takao; Nakaiwa, Masaru

    2005-04-15

    The accuracy of thermoporometry (TPM) in terms of the characterization of SBA-15 is examined based on a model that classifies the water in the mesopores into two different types: freezable pore water, which can form cylindrical ice crystals, and nonfreezable pore water, which cannot undergo a phase transition during a differential scanning calorimetry (DSC) measurement. Applying the empirical relationship between the sizes of the ice crystals formed in the mesopores and the solidification temperature of the freezable pore water to a thermogram (a recording of the heat flux during the solidification of the freezable pore water) yielded a size distribution of the ice crystals. The size of the ice crystals increased slightly with repetitive freezing, indicating that the mesopores were enlarged by formation of the ice crystals. Adding the thickness, t(nf), of the nonfreezable pore water layer to the ice crystal-size distribution calculated from the thermogram allowed for the determination of the porous properties of SBA-15. The porous properties attained from TPM experiments were compared with the results attained through the combination of Ar gas adsorption experiments and nonlocal density functional theory (NLDFT) analysis. The porous properties determined by TPM were confirmed to be quite sensitive to the t(nf) value. PMID:15780301

  18. Mixed surfactants-directed the mesoporous silica materials with various morphologies and structures

    NASA Astrophysics Data System (ADS)

    Lin, Huiming; Qu, Fengyu; Wu, Xiang; Xue, Ming; Zhu, Guangshan; Qiu, Shilun

    2011-06-01

    A new mixed surfactants system using alkyl carboxylic acids and quaternized poly[bis(2-chloroethyl)ether-alt-1,3-bis[3-(dimethylamino)propyl] urea] (PEPU) as the co-template was used to synthesize mesoporous silica materials with various morphologies and structures, including flakes, regular spheres, nanoparticles, and tube-spheres. The cationic polymer connected the anionic surfactant micelle to the anionic polysilicate species to induce the synthesis of the mesoporous silica materials. The structure and property of the surfactant and the cationic polymer determined the formation of mesoporous silica, and also had a signification influence on the morphology and structure of the final materials. To further explore the possible formation mechanism of these mesoporous materials, zeta potential was utilized to evaluate the interaction between the anionic surfactant and the cationic co-template. In addition, the structure, morphology, and porosity of these materials were characterized by powder X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), and N 2 adsorption-desorption measurements.

  19. Adsorption of Methyl Blue on Mesoporous Materials Using Rice Husk Ash as Silica Source.

    PubMed

    Nguyen, Nhat Thien; Chen, Shiao-shing; Nguyen, Nguyen Cong; Nguyen, Hau Thi; Tsai, Hsiao Hsin; Chang, Chang Tang

    2016-04-01

    It is recognized that recycling and reuse of waste can result in significant savings in materials and energy. In this research, the adsorption of methyl blue (MB) using waste rice husk ash (Rha) and mesoporous silica materials made from Rha (R-MCM) were analyzed. Mesoporous silica materials were synthesized using cetyltrimethyl ammonium bromide (CTAB) as a cationic surfactant and Rha as the silica source. The prepared samples were characterized by Brunnaur-Emmet-Teller (BET) adsorption isotherm analyzer and transmission electron microscope (TEM) analysis. The results showed the surface area of R-MCM materials was 1347 m2g-1 and the pore volume was 0.906 cm3g-1. TEM analysis showed that the mesoporous materials generally exhibited ordered hexagonal arrays of mesopores with a uniform pore size. The effects on adsorption performance under different initial dye concentrations, different pH values and different dosages of adsorbent were also studied. Both Langmuir and Freundlich adsorption models were applied to describe the equilibrium isotherms. The results show that the maximum removal efficiency of MB more than 99%. PMID:27451772

  20. Importance of Micropore-Mesopore Interfaces in Carbon Dioxide Capture by Carbon-Based Materials.

    PubMed

    Durá, Gema; Budarin, Vitaliy L; Castro-Osma, José A; Shuttleworth, Peter S; Quek, Sophie C Z; Clark, James H; North, Michael

    2016-08-01

    Mesoporous carbonaceous materials (Starbons®) derived from low-value/waste bio-resources separate CO2 from CO2 /N2 mixtures. Compared to Norit activated charcoal (AC), Starbons® have much lower microporosities (8-32 % versus 73 %) yet adsorb up to 65 % more CO2 . The presence of interconnected micropores and mesopores is responsible for the enhanced CO2 adsorption. The Starbons® also showed three-four times higher selectivity for CO2 adsorption rather than N2 adsorption compared to AC. PMID:27336368

  1. Use of silicate crystallite mesoporous material as catalyst support for Fischer Tropsch reaction

    NASA Astrophysics Data System (ADS)

    Iwasaki, T.; Reinikainen, M.; Onodera, Y.; Hayashi, H.; Ebina, T.; Nagase, T.; Torii, K.; Kataja, K.; Chatterjee, A.

    1998-06-01

    Novel uniform mesoporous materials (silicate crystallite mesoporous material, SCMM) were synthesized by hydrothermal treatment of Si, Mg and/or Al containing hydroxide precipitates, along with quaternary ammonium salt, and were applied as catalyst support for Fischer-Tropsch reaction. SCMM is composed of aggregates of homogeneous layer silicate crystallites, as identified by X-ray diffraction (XRD) patterns and transmission electron microscopy (TEM) photographs which are structurally analogous to smectite clay. The mesopore of SCMM corresponds to interparticle space of disk-shaped crystallites (6-25 nm in diameter) aggregated by edge-to-face bonding. Two kinds of SCMM with variable negative charge locations were used as support materials of Co-catalysts for hydrogenation of CO. Conversion of CO was high on SCMM compared with that of silica gel. Furthermore, the main products obtained were hydrocarbons. In case of SCMM type with negative charge near the surface, olefins and branched hydrocarbons were efficiently produced in CO conversion reaction; where as another SCMM type having negative charge at the middle of crystallite platelets produced mainly normal hydrocarbons for the same reaction. This may be due to the role of the negative charge of SCMM which affects the chemical state of Co-catalyst supported on SCMM. The function of SCMM as compared to other mesoporous materials is better in terms of homogeneous and site-specific distribution of negative charge, which is further helpful in controlling the surface phenomenon as confirmed by the existence of linear CO species adsorbed on Co.

  2. Validity of the t-plot method to assess microporosity in hierarchical micro/mesoporous materials.

    PubMed

    Galarneau, Anne; Villemot, François; Rodriguez, Jeremy; Fajula, François; Coasne, Benoit

    2014-11-11

    The t-plot method is a well-known technique which allows determining the micro- and/or mesoporous volumes and the specific surface area of a sample by comparison with a reference adsorption isotherm of a nonporous material having the same surface chemistry. In this paper, the validity of the t-plot method is discussed in the case of hierarchical porous materials exhibiting both micro- and mesoporosities. Different hierarchical zeolites with MCM-41 type ordered mesoporosity are prepared using pseudomorphic transformation. For comparison, we also consider simple mechanical mixtures of microporous and mesoporous materials. We first show an intrinsic failure of the t-plot method; this method does not describe the fact that, for a given surface chemistry and pressure, the thickness of the film adsorbed in micropores or small mesopores (< 10σ, σ being the diameter of the adsorbate) increases with decreasing the pore size (curvature effect). We further show that such an effect, which arises from the fact that the surface area and, hence, the free energy of the curved gas/liquid interface decreases with increasing the film thickness, is captured using the simple thermodynamical model by Derjaguin. The effect of such a drawback on the ability of the t-plot method to estimate the micro- and mesoporous volumes of hierarchical samples is then discussed, and an abacus is given to correct the underestimated microporous volume by the t-plot method. PMID:25232908

  3. Tubular structured hierarchical mesoporous titania material derived from natural cellulosic substances and application as photocatalyst for degradation of methylene blue

    SciTech Connect

    Huang, Haiqing; Liu, Xiaoyan; Huang, Jianguo

    2011-11-15

    Graphical abstract: Bio-inspired, tubular structured hierarchical mesoporous titania material with high photocatalytic activity under UV light was fabricated employing natural cellulosic substance (cotton) as hard template and cetyltrimethylammonium bromide (CTAB) surfactant as soft template using a one-pot sol-gel method. Highlights: {yields} Tubular structured mesoporous titania material was fabricated by sol-gel method. {yields} The titania material faithfully recorded the hierarchical structure of the template substrate (cotton). {yields} The titania material exhibited high photocatalytic activity in decomposition of methylene blue. -- Abstract: Bio-inspired, tubular structured hierarchical mesoporous titania material was designed and fabricated employing natural cellulosic substance (cotton) as hard template and cetyltrimethylammonium bromide (CTAB) surfactant as soft template by one-pot sol-gel method. The tubular structured hierarchical mesoporous titania material processes large specific surface area (40.23 m{sup 2}/g) and shows high photocatalytic activity in the photodegradation of methylene blue under UV light irradiation.

  4. Experimental and theoretical investigation of a mesoporous KxWO3 material having superior mechanical strength

    NASA Astrophysics Data System (ADS)

    Dey, Sonal; Anderson, Sean T.; Mayanovic, Robert A.; Sakidja, Ridwan; Landskron, Kai; Kokoszka, Berenika; Mandal, Manik; Wang, Zhongwu

    2016-01-01

    Mesoporous materials with tailored properties hold great promise for energy harvesting and industrial applications. We have synthesized a novel tungsten bronze mesoporous material (KxWO3; x ~ 0.07) having inverse FDU-12 type pore symmetry and a crystalline framework. In situ small angle X-ray scattering (SAXS) measurements of the mesoporous K0.07WO3 show persistence of a highly ordered meso-scale pore structure to high pressure conditions (~18.5 GPa) and a material with remarkable mechanical strength despite having ~35% porosity. Pressure dependent in situ SAXS measurements reveal a bulk modulus κ = 44 +/- 4 GPa for the mesoporous KxWO3 which is comparable to the corresponding value for the bulk monoclinic WO3 (γ-WO3). Evidence from middle angle (MAXS) and wide angle X-ray scattering (WAXS), high-resolution transmission electron microscopy (HR-TEM) and Raman spectroscopy shows that the presence of potassium leads to the formation of a K-bearing orthorhombic tungsten bronze (OTB) phase within a monoclinic WO3 host structure. Our ab initio molecular dynamics calculations show that the formation of the OTB phase provides superior strength to the mesoporous K0.07WO3.Mesoporous materials with tailored properties hold great promise for energy harvesting and industrial applications. We have synthesized a novel tungsten bronze mesoporous material (KxWO3; x ~ 0.07) having inverse FDU-12 type pore symmetry and a crystalline framework. In situ small angle X-ray scattering (SAXS) measurements of the mesoporous K0.07WO3 show persistence of a highly ordered meso-scale pore structure to high pressure conditions (~18.5 GPa) and a material with remarkable mechanical strength despite having ~35% porosity. Pressure dependent in situ SAXS measurements reveal a bulk modulus κ = 44 +/- 4 GPa for the mesoporous KxWO3 which is comparable to the corresponding value for the bulk monoclinic WO3 (γ-WO3). Evidence from middle angle (MAXS) and wide angle X-ray scattering (WAXS), high

  5. TOWARDS A NEW CLASS OF MESOPOROUS MATERIALS FOR APPLICATIONS IN PETROLEUM REFINING

    SciTech Connect

    Conrad Ingram; Mark Mitchell

    2005-03-21

    This project focuses on the synthesis of mesoporous aluminophosphates, silicates and aluminosilicates as catalysts for applications in the conversion of large petroleum feedstock compounds to useful middle distillates and naphtha transportation fuels. Summarized herein is our research progress from September 1, 2003, to August 31, 2004. In previous reports it was demonstrated that mesoporous aluminophosphates with neutral framework (containing Al, P and O) could be synthesized, but their thermal stabilities were limited. In general, the materials' pore structure collapsed when calcined at 500-550 C in air or extracted in ethanol/HCl mixture to remove the surfactants, which were used as synthesis templates. New methods to improve the thermal stability of the materials needed to be explored. It was conceived that by adding divalent metals cations, such as Mg and Co, not only that the acid sites would be created by balancing the negatively charged framework (balanced by H{sup +}), but the thermal stability of the materials would be improved. In addition, methods to facilitate the interaction of hydrocarbon substrates with acid sites within the mesoporous are also needed. One concept towards improving this was to incorporate organic functional groups within or attached to the otherwise purely inorganic aluminophosphate (containing Co or Mg) or aluminosilicate pore walls of the mesopores. In the last report we detailed that mesoporous organosilicates were synthesized using block copolymer under acid conditions containing silica and phenylene (-C{sub 6}H{sub 4}-). Materials prepared with phenylene group among the silica pore walls was found to be thermally stable up to 550 C which is almost 100 C higher than the temperature used for the mild hydrocracking of petroleum. It was also highlighted that this area was the subject of recent intense research activities by other researchers. Building on precedence of the last report and on the results of other researchers, we

  6. N-heptane adsorption and desorption in mesoporous materials

    NASA Astrophysics Data System (ADS)

    Zaleski, R.; Gorgol, M.; Błazewicz, A.; Kierys, A.; Goworek, J.

    2015-06-01

    Positron Annihilation Lifetime Spectroscopy (PALS) was used for an in situ monitoring of adsorption and desorption processes. The disordered and ordered porous silica as well as the porous polymer were used as adsorbents, while an adsorbate in all the cases was n-heptane. The lifetimes and particularly the intensities of the ortho-positronium(o-Ps) components depend strongly on the adsorbate pressure. The analysis of these dependencies allows us to identify several processes, which are taking place during sorption. At low pressure, an island-like growth of the first layers of the adsorbate on the silica, in a contrary to a swelling of the polymer, is observed. A size of the pores, which remain empty, is estimated at the subsequent stages of the adsorbate condensation and evaporation. The adsorbate thrusting into micropores is deduced at p/p0 > 0.6 whilst the mesopores are still not completely filled.

  7. Nanocasting of Periodic Mesoporous Materials as an Effective Strategy to Prepare Mixed Phases of Titania.

    PubMed

    Mahoney, Luther; Rasalingam, Shivatharsiny; Wu, Chia-Ming; Koodali, Ranjit T

    2015-01-01

    Mesoporous titanium dioxide materials were prepared using a nanocasting technique involving silica SBA-15 as the hard-template. At an optimal loading of titanium precursor, the hexagonal periodic array of pores in SBA-15 was retained. The phases of titanium dioxide could be easily varied by the number of impregnation cycles and the nature of titanium alkoxide employed. Low number of impregnation cycles produced mixed phases of anatase and TiO₂(B). The mesoporous TiO₂ materials were tested for solar hydrogen production, and the material consisting of 98% anatase and 2% TiO₂(B) exhibited the highest yield of hydrogen from the photocatalytic splitting of water. The periodicity of the pores was an important factor that influenced the photocatalytic activity. This study indicates that mixed phases of titania containing ordered array of pores can be prepared by using the nanocasting strategy. PMID:26670222

  8. Mesoporous materials derived from synthetic organo-clays as novel hydrodesulfurization catalysts

    SciTech Connect

    Carrado, K.A.; Marshall, C.L.; Brenner, J.R.

    1996-12-31

    Various pore size distributions are found for synthetic organo-clay complexes from which the organic portion has been removed via calcination. The clays are prepared by hydrothermal crystallization of gels containing silica, magnesium hydroxide, lithium fluoride, and an organic of choice. The organic serves to impart long-range structural order to the inorganic network that does not disappear upon its removal. Mesoporous materials are prepared from a host of organic modifiers. For example, pore diameters of 40-50{Angstrom} result from tetraethyl ammonium and celluloses, and polydimethyl diallyl ammonium imparts diameters of about 110{Angstrom} on average. These materials have begun to be explored as hydrodesulfurization (HDS) catalyst supports. Preliminary results show performance commensurate with commercial catalysts for the mesoporous materials when a model oil feed is used (1% dibenzothiophene in hexadecane). The target application is HDS of an actual heavy crude oil from California.

  9. CuO nanoparticles encapsulated inside Al-MCM-41 mesoporous materials via direct synthetic route

    NASA Astrophysics Data System (ADS)

    Huo, Chengli; Ouyang, Jing; Yang, Huaming

    2014-01-01

    Highly ordered aluminum-containing mesoporous silica (Al-MCM-41) was prepared using attapulgite clay mineral as a Si and Al source. Mesoporous complexes embedded with CuO nanoparticles were subsequently prepared using various copper sources and different copper loadings in a direct synthetic route. The resulting CuO/Al-MCM-41 composite possessed p6mm hexagonally symmetry, well-developed mesoporosity, and relatively high BET surface area. In comparison to pure silica, these mesoporous materials embedded with CuO nanoparticles exhibited smaller pore diameter, thicker pore wall, and enhanced thermal stability. Long-range order in the aforementioned samples was observed for copper weight percentages as high as 30%. Furthermore, a significant blue shift of the absorption edge for the samples was observed when compared with that of bulk CuO. H2-TPR measurements showed that the direct-synthesized CuO/Al-MCM-41 exhibited remarkable redox properties compared to the post-synthesized samples, and most of the CuO nanoparticles were encapsulated within the mesoporous structures. The possible interaction between CuO and Al-MCM-41 was also investigated.

  10. CuO nanoparticles encapsulated inside Al-MCM-41 mesoporous materials via direct synthetic route

    PubMed Central

    Huo, Chengli; Ouyang, Jing; Yang, Huaming

    2014-01-01

    Highly ordered aluminum-containing mesoporous silica (Al-MCM-41) was prepared using attapulgite clay mineral as a Si and Al source. Mesoporous complexes embedded with CuO nanoparticles were subsequently prepared using various copper sources and different copper loadings in a direct synthetic route. The resulting CuO/Al-MCM-41 composite possessed p6mm hexagonally symmetry, well-developed mesoporosity, and relatively high BET surface area. In comparison to pure silica, these mesoporous materials embedded with CuO nanoparticles exhibited smaller pore diameter, thicker pore wall, and enhanced thermal stability. Long-range order in the aforementioned samples was observed for copper weight percentages as high as 30%. Furthermore, a significant blue shift of the absorption edge for the samples was observed when compared with that of bulk CuO. H2-TPR measurements showed that the direct-synthesized CuO/Al-MCM-41 exhibited remarkable redox properties compared to the post-synthesized samples, and most of the CuO nanoparticles were encapsulated within the mesoporous structures. The possible interaction between CuO and Al-MCM-41 was also investigated. PMID:24419589

  11. Selective opening of nanoscopic capped mesoporous inorganic materials with nerve agent simulants; an application to design chromo-fluorogenic probes.

    PubMed

    Candel, Inmaculada; Bernardos, Andrea; Climent, Estela; Marcos, M Dolores; Martínez-Máñez, Ramón; Sancenón, Félix; Soto, Juan; Costero, Ana; Gil, Salvador; Parra, Margarita

    2011-08-01

    A hybrid nanoscopic capped mesoporous material, that is selectively opened in the presence of nerve agent simulants, has been prepared and used as a probe for the chromo-fluorogenic detection of these chemicals. PMID:21691625

  12. Synthesis of mesoporous silica materials from municipal solid waste incinerator bottom ash

    SciTech Connect

    Liu, Zhen-Shu Li, Wen-Kai; Huang, Chun-Yi

    2014-05-01

    Highlights: • The optimal alkaline agent for the extraction of silica from bottom ash was Na{sub 2}CO{sub 3}. • The pore sizes for the mesoporous silica synthesized from bottom ash were 2–3.8 nm. • The synthesized materials exhibited a hexagonal pore structure with a smaller order. • The materials have potential for the removal of heavy metals from aqueous solutions. - Abstract: Incinerator bottom ash contains a large amount of silica and can hence be used as a silica source for the synthesis of mesoporous silica materials. In this study, the conditions for alkaline fusion to extract silica from incinerator bottom ash were investigated, and the resulting supernatant solution was used as the silica source for synthesizing mesoporous silica materials. The physical and chemical characteristics of the mesoporous silica materials were analyzed using BET, XRD, FTIR, SEM, and solid-state NMR. The results indicated that the BET surface area and pore size distribution of the synthesized silica materials were 992 m{sup 2}/g and 2–3.8 nm, respectively. The XRD patterns showed that the synthesized materials exhibited a hexagonal pore structure with a smaller order. The NMR spectra of the synthesized materials exhibited three peaks, corresponding to Q{sup 2} [Si(OSi){sub 2}(OH){sub 2}], Q{sup 3} [Si(OSi){sub 3}(OH)], and Q{sup 4} [Si(OSi){sub 4}]. The FTIR spectra confirmed the existence of a surface hydroxyl group and the occurrence of symmetric Si–O stretching. Thus, mesoporous silica was successfully synthesized from incinerator bottom ash. Finally, the effectiveness of the synthesized silica in removing heavy metals (Pb{sup 2+}, Cu{sup 2+}, Cd{sup 2+}, and Cr{sup 2+}) from aqueous solutions was also determined. The results showed that the silica materials synthesized from incinerator bottom ash have potential for use as an adsorbent for the removal of heavy metals from aqueous solutions.

  13. Multifunctional mesoporous silica catalyst

    DOEpatents

    Lin, Victor Shang-Yi; Tsai, Chih-Hsiang; Chen, Hung-Ting; Pruski, Marek; Kobayashi, Takeshi

    2015-03-31

    The present invention provides bifunctional silica mesoporous materials, including mesoporous silica nanoparticles ("MSN"), having pores modified with diarylammonium triflate and perfluoroaryl moieties, that are useful for the acid-catalyzed esterification of organic acids with organic alcohols.

  14. Mesoporous carbon -Cr2O3 composite as an anode material for lithium ion batteries

    SciTech Connect

    Guo, Bingkun; Chi, Miaofang; Sun, Xiao-Guang; Dai, Sheng

    2012-01-01

    Mesoporous carbon-Cr2O3 (M-C-Cr2O3) composite was prepared by co-assembly of in-situ formed phenolic resin, chromium precursor, and Pluronic block copolymer under acidic conditions, followed by carbonization at 750oC under Argon. The TEM results confirmed that the Cr2O3 nanoparticles, ranging from 10 to 20 nm, were well dispersed in the matrix of mesoporous carbon. The composite exhibited an initial reversible capacity of 710 mAh g-1 and good cycling stability, which is mainly due to the synergic effects of carbons within the composites, i.e. confining the crystal growth of Cr2O3 during the high temperature treatment step and buffering the volume change of Cr2O3 during the cycling step. This composite material is a promising anode material for lithium ion batteries.

  15. Cloud point curve of nonionic surfactant related to the structures of mesoporous materials.

    PubMed

    Blin, J L; Bleta, R; Stébé, M J

    2006-08-15

    We have investigated the phase behavior of a fluorinated surfactant R(7)(F)(EO)(7) in water. The cloud point is situated at 19 degrees C for 2 wt% of surfactant. Using this surfactant, mesoporous materials have been synthesized with micellar solution prepared either at 10 degrees C (below the cloud point) or at 40 degrees C (above the cloud point). Results show that whatever the syntheses conditions, only wormhole-like structure is recovered. The effect of perfluorodecalin addition on the fluorinated surfactant/water system was also investigated. Swollen micelles, microemulsion, and lamellar (L(alpha)) liquid crystals were identified. When perfluorodecalin is added, the cloud point is shifted toward higher temperature. As regards the mesoporous syntheses, perfluorodecalin plays a dual role. First, incorporation of perfluorodecalin leads to the formation of well ordered materials. Secondly, the pore size enlargement occurs when perfluorodecalin is added. Our results evidence that the ratio between the volume of the hydrophilic headgroup (V(H)) and the hydrophobic part (V(L)) of the surfactant is not an efficiency parameter to explain the ordering improvement of mesoporous materials and that we should rather consider the existence of the cloud point curve, which disturbs the cooperative templating mechanism (CTM). PMID:16677667

  16. Structural investigation of nonionic fluorinated micelles by SANS in relation to mesoporous silica materials.

    PubMed

    Michaux, Florentin; Blin, Jean-Luc; Teixeira, José; Stébé, Marie José

    2012-01-12

    In an attempt to answer the question if there is dependence between the pore ordering of the mesoporous silica, obtained through the cooperative template mechanism, and the shape of the micellar aggregates of the surfactant solutions, the micellar structures of two nonionic fluorinated surfactant based-systems are studied by SANS. By fitting the experimental spectra with theoretical models, the structural evolution of the molecular aggregates can be described, and some important parameters can be obtained, such as the water and eventually oil penetration into the surfactant film, the aggregation number, the area per polar head of the surfactant, and the surfactant chain conformations. We have shown that for the C(8)F(17)C(2)H(4)(OC(2)H(4))(9)OH system, the micelles are prolate spheroids. The increase of the surfactant concentration in water does not change the characteristics of the interfacial film, but the aggregation number raises and the particles become more elongated. By contrast, the experimental curves of C(7)F(15)C(2)H(4)(OC(2)H(4))(8)OH cannot be fitted considering a small particle model. However, progressive incorporation of fluorocarbon induces a change of size and shape of the globules, which become smaller and more and more spherical. Regarding the material mesopore ordering, it appears that the micelles that lead to hexagonal mesoporous silica materials are described with a model of quasi-spherical globules. On the contrary, when large micelles are found, only wormhole-like structures are obtained. PMID:22145934

  17. The dynamic association processes leading from a silica precursor to a mesoporous SBA-15 material.

    PubMed

    Alfredsson, Viveka; Wennerström, Håkan

    2015-07-21

    During the last two decades, the synthesis of silica with an ordered mesoporous structure has been thoroughly explored. The basis of the synthesis is to let silica monomers polymerize in the presence of an amphiphilic template component. In the first studies, cationic surfactants were used as structure inducer. Later it was shown that pluronic copolymers also could have the role. One advantage with the pluronics copolymers is that they allow for a wider variation in the radius of pores in the resulting silica material. Another advantage lies in the higher stability resulting from the thicker walls between the pores. Mesoporous silica has a very high area to volume ratio, and the ordered structure ensures surface homogeneity. There are a number of applications of this type of material. It can be used as support for catalysts, as templates to produces other mesoporous inorganic materials, or in controlled release applications. The synthesis of mesoporous silica is, from a practical point of view, simple, but there are significant possibilities to vary synthesis conditions with a concomitant effect on the properties of the resulting material. It is clear that the structural properties on the nanometer scale are determined by the self-assembly properties of the amphiphile, and this knowledge has been used to optimize pore geometry and pore size. To have a practical functional material it is desirable to also control the structure on a micrometer scale and larger. In practice, one has largely taken an empirical approach in optimizing reaction conditions, paying less attention to underlying chemical and physicochemical mechanisms that lead from starting conditions to the final product. In this Account, we present our systematic studies of the processes involved not only in the formation of the mesoporous structure as such, but also of the formation of structures on the micrometer scale. The main point is to show how the ongoing silica polymerization triggers a sequence

  18. Potential of hybrid functionalized meso-porous materials for the separation and immobilization of radionuclides

    SciTech Connect

    Luca, V.

    2013-07-01

    Functionalized meso-porous materials are a class of hybrid organic-inorganic material in which a meso-porous metal oxide framework is functionalized with multifunctional organic molecules. These molecules may contain one or more anchor groups that form strong bonds to the pore surfaces of the metal oxide framework and free functional groups that can impart and or modify the functionality of the material such as for binding metal ions in solution. Such materials have been extensively studied over the past decade and are of particular interest in absorption applications because of the tremendous versatility in choosing the composition and architecture of the metal oxide framework and the nature of the functional organic molecule as well as the efficient mass transfer that can occur through a well-designed hierarchically porous network. A sorbent for nuclear applications would have to be highly selective for particular radio nuclides, it would need to be hydrolytically and radiolytically stable, and it would have to possess reasonable capacity and fast kinetics. The sorbent would also have to be available in a form suitable for use in a column. Finally, it would also be desirable if once saturated with radio nuclides, the sorbent could be recycled or converted directly into a ceramic or glass waste form suitable for direct repository disposal or even converted directly into a material that could be used as a transmutation target. Such a cradle-to- grave strategy could have many benefits in so far as process efficiency and the generation of secondary wastes are concerned.This paper will provide an overview of work done on all of the above mentioned aspects of the development of functionalized meso-porous adsorbent materials for the selective separation of lanthanides and actinides and discuss the prospects for future implementation of a cradle-to-grave strategy with such materials. (author)

  19. Enantioselectively controlled release of chiral drug (metoprolol) using chiral mesoporous silica materials

    NASA Astrophysics Data System (ADS)

    Guo, Zhen; Du, Yu; Liu, Xianbin; Ng, Siu-Choon; Chen, Yuan; Yang, Yanhui

    2010-04-01

    Chiral porous materials have attracted burgeoning attention on account of their potential applications in many areas, such as enantioseparation, chiral catalysis, chemical sensors and drug delivery. In this report, chiral mesoporous silica (CMS) materials with various pore sizes and structures were prepared using conventional achiral templates (other than chiral surfactant) and a chiral cobalt complex as co-template. The synthesized CMS materials were characterized by x-ray diffraction, nitrogen physisorption, scanning electron microscope and transmission electron microscope. These CMS materials, as carriers, were demonstrated to be able to control the enantioselective release of a representative chiral drug (metoprolol). The release kinetics, as modeled by the power law equation, suggested that the release profiles of metoprolol were remarkably dependent on the pore diameter and pore structure of CMS materials. More importantly, R- and S-enantiomers of metoprolol exhibited different release kinetics on CMS compared to the corresponding achiral mesoporous silica (ACMS), attributable to the existence of local chirality on the pore wall surface of CMS materials. The chirality of CMS materials on a molecular level was further substantiated by vibrational circular dichroism measurements.

  20. The electrochemical performance of ordered mesoporous carbon/nickel compounds composite material for supercapacitor

    SciTech Connect

    Feng, Jicheng; Zhao, Jiachang; Tang, Bohejin; Liu, Ping; Xu, Jingli

    2010-12-15

    A series of high performance ordered mesoporous carbon/nickel compounds composites have been synthesized by a combination of incipient wetness impregnation and hydrothermal method for the first time. X-ray diffraction (XRD), N{sub 2} adsorption/desorption isotherms and transmission electron microscopy (TEM) are used to characterize the composites derived at the hydrothermal temperature of 125, 150, 175, 200, 250, 275 and 300 {sup o}C. The formation of nanosized nickel compounds, fully inside the mesopore system, was confirmed with XRD and TEM. An N{sub 2} adsorption/desorption isotherms measurements still revealed mesoporosity for the host/guest compounds. It is noteworthy that an OMC/nickel nitrate hydroxide hydrate composite (OMCN-150) exhibits more excellent performance. Based on the various hydrothermal temperatures of the composite, the capacitance of an OMCN-150 delivering the best electrochemical performance is about 2.4 (5 mV s{sup -1}) and 1.5 (50 mV s{sup -1}) times of the pristine OMC. The capacitance retention of an OMCN-150 is 96.1%, which indicates that the electrochemical performance of the supercapacitor is improved greatly, and represents novel research and significant advances in the field of electrode composite materials for supercapacitor. -- Graphical abstract: A series of high performance nickel compound/ordered mesoporous carbon composites were synthesized by a combination of incipient wetness impregnation and hydrothermal method for the first time. Display Omitted

  1. Fluorescent and Magnetic Mesoporous Hybrid Material: A Chemical and Biological Nanosensor for Hg2+ Ions

    PubMed Central

    Suresh, Moorthy; Anand, Chokkalingam; Frith, Jessica E.; Dhawale, Dattatray S.; Subramaniam, Vishnu P.; Strounina, Ekaterina; Sathish, Clastinrusselraj I.; Yamaura, Kazunari; Cooper-White, Justin J.; Vinu, Ajayan

    2016-01-01

    We introduce “sense, track and separate” approach for the removal of Hg2+ ion from aqueous media using highly ordered and magnetic mesoporous ferrosilicate nanocages functionalised with rhodamine fluorophore derivative. These functionalised materials offer both fluorescent and magnetic properties in a single system which help not only to selectively sense the Hg2+ ions with a high precision but also adsorb and separate a significant amount of Hg2+ ion in aqueous media. We demonstrate that the magnetic affinity of these materials, generated from the ultrafine γ-Fe2O3 nanoparticles present inside the nanochannels of the support, can efficiently be used as a fluorescent tag to sense the Hg2+ ions present in NIH3T3 fibroblasts live cells and to track the movement of the cells by external magnetic field monitored using confocal fluorescence microscopy. This simple approach of introducing multiple functions in the magnetic mesoporous materials raise the prospect of creating new advanced functional materials by fusing organic, inorganic and biomolecules to create advanced hybrid nanoporous materials which have a potential use not only for sensing and the separation of toxic metal ions but also for cell tracking in bio-separation and the drug delivery. PMID:26911660

  2. Fluorescent and Magnetic Mesoporous Hybrid Material: A Chemical and Biological Nanosensor for Hg2+ Ions

    NASA Astrophysics Data System (ADS)

    Suresh, Moorthy; Anand, Chokkalingam; Frith, Jessica E.; Dhawale, Dattatray S.; Subramaniam, Vishnu P.; Strounina, Ekaterina; Sathish, Clastinrusselraj I.; Yamaura, Kazunari; Cooper-White, Justin J.; Vinu, Ajayan

    2016-02-01

    We introduce “sense, track and separate” approach for the removal of Hg2+ ion from aqueous media using highly ordered and magnetic mesoporous ferrosilicate nanocages functionalised with rhodamine fluorophore derivative. These functionalised materials offer both fluorescent and magnetic properties in a single system which help not only to selectively sense the Hg2+ ions with a high precision but also adsorb and separate a significant amount of Hg2+ ion in aqueous media. We demonstrate that the magnetic affinity of these materials, generated from the ultrafine γ-Fe2O3 nanoparticles present inside the nanochannels of the support, can efficiently be used as a fluorescent tag to sense the Hg2+ ions present in NIH3T3 fibroblasts live cells and to track the movement of the cells by external magnetic field monitored using confocal fluorescence microscopy. This simple approach of introducing multiple functions in the magnetic mesoporous materials raise the prospect of creating new advanced functional materials by fusing organic, inorganic and biomolecules to create advanced hybrid nanoporous materials which have a potential use not only for sensing and the separation of toxic metal ions but also for cell tracking in bio-separation and the drug delivery.

  3. Treatment of Volatile Organic Compounds with Mesoporous Materials Prepared from Calcium Fluoride Sludge.

    PubMed

    Kang, Sv-Yuan; Tsai, Hsiao-Hsin; Nguyen, Nhat-Thien; Chang, Chang-Tang; Tseng, Chao-Heng

    2016-02-01

    Large amount of calcium fluoride sludge was generated by semiconductor industry every year. It also needs high requirement of fuel consumption using rotor concentrator and thermal oxidizer to treat VOCs. The mesoporous catalyst prepared by calcium fluoride sludge was used for VOCs treatment in this study. Acetone is a kind of solvent and used in a large number of laboratories and factories. The serious problems will be caused when it exposed to the environmental. Economic and practical technology is needed to eliminate this kind of hazardous air pollutant. In this research, the adsorption of acetone was tested with CF-MCM (mesoporous silica materials synthesized from calcium fluoride). The raw material was mixed with cationic cetyltrimethyl ammonium bromide (CTAB) surfactants, firstly. The prepared mesoporous silica materials were characterized by nitrogen adsorption and desorption analysis, transmission electron microscope (TEM), scanning electron microscopy (SEM), X-ray powder diffractometer (XRPD) and Fourier transform infrared spectroscopy (FTIR). The results showed that the surface area, large pore volume and pore diameter could be up to 862 m2 g(-1), 0.57 cm3 g(-1) and 2.9 nm, respectively. The crystal patterns of CF-MCM were similar with MCM-41 from TEM image. The adsorption capacity of acetone with CF-MCM was 118, 190, 194 and 201 mg g(-1), respectively, under 500, 1000, 1500 and 2000 ppm. Furthermore, the adsorption capacity of MCM-41 and CF-MCM was almost the same. The effects of operation parameters, such as contact time and mixture concentration, on the performance of CF-MCM were also discussed in this study. PMID:27433709

  4. A highly resilient mesoporous SiOx lithium storage material engineered by oil-water templating.

    PubMed

    Park, Eunjun; Park, Min-Sik; Lee, Jaewoo; Kim, Ki Jae; Jeong, Goojin; Kim, Jung Ho; Kim, Young-Jun; Kim, Hansu

    2015-02-01

    Mesoporous silicon-based materials gained considerable attention as high-capacity lithium-storage materials. However, the practical use is still limited by the complexity and limited number of available synthetic routes. Here, we report carbon-coated porous SiOx as high capacity lithium storage material prepared by using a sol-gel reaction of hydrogen silsesquioxane and oil-water templating. A hydrophobic oil is employed as a pore former inside the SiOx matrix and a precursor for carbon coating on the SiOx . The anode exhibits a high capacity of 730 mAh g(-1) and outstanding cycling performance over 100 cycles without significant dimensional changes. Carbon-coated porous SiOx also showed highly stable thermal reliability comparable to that of graphite. These promising properties come from the mesopores in the SiOx matrix, which ensures reliable operation of lithium storage in SiOx . The scalable sol-gel process presented here can open up a new avenue for the versatile preparation of porous SiOx lithium storage materials. PMID:25581319

  5. Curcumin-loaded silica-based mesoporous materials: Synthesis, characterization and cytotoxic properties against cancer cells.

    PubMed

    Bollu, Vishnu Sravan; Barui, Ayan Kumar; Mondal, Sujan Kumar; Prashar, Sanjiv; Fajardo, Mariano; Briones, David; Rodríguez-Diéguez, Antonio; Patra, Chitta Ranjan; Gómez-Ruiz, Santiago

    2016-06-01

    Two different silica based (MSU-2 and MCM-41) curcumin loaded mesoporous materials V3 and V6 were synthesized and characterized by several physico-chemical techniques. Release kinetic study revealed the slow and sustained release of curcumin from those materials in blood simulated fluid (pH: 7.4). The materials V3 and V6 were found to be biocompatible in non-cancerous CHO cell line while exhibiting significant cytotoxicity in different cancer cells (human lung carcinoma cells: A549, human breast cancer cells: MCF-7, mouse melanoma cells: B16F10) compared to pristine curcumin indicating the efficacy of the mesoporous silica materials based drug delivery systems (DDSs). The generation of intracellular reactive oxygen species (ROS) and down regulation of anti-apoptotic protein leading to the induction of apoptosis were found to be the plausible mechanisms behind the anti-cancer activity of these DDSs. These results suggest that curcumin-loaded drug delivery system may be successfully employed as an alternative treatment strategy for cancer therapeutics through a nanomedicine approach in near future. PMID:27040234

  6. Excellent adsorption of ultraviolet filters using silylated MCM-41 mesoporous materials as adsorbent

    NASA Astrophysics Data System (ADS)

    Li, Li; Wang, Xuemei; Zhang, Dongxia; Guo, Ruibin; Du, Xinzhen

    2015-02-01

    Silylated MCM-41 materials were examined to adsorb of ultraviolet (UV) filters from aqueous solution at 303 K. Compared to UV filters adsorbed on unsilylated MCM-41, a much higher adsorption capacity was achieved by silylated MCM-41 materials. Surface modification offers a greater opportunity to adjust both the pore size and surface properties of organic functionalized MCM-41 type materials. In the present study, MCM-41, methyl functionalized MCM-41 (M-MCM-41) and chlorotrimethylsilane end-capped (TMS-M-MCM-41) mesoporous materials were successfully synthesized using sol-gel technology. The structures and properties before and after surface modification were systematically investigated through N2-adsorption desorption isotherms, scanning electron microscope (SEM) and transmission electron microscopy (TEM), small angle X-ray powder diffraction analysis (SXRD), and infrared spectroscopy (FT-IR). They together confirm that the methyl and trimethyl silyl (TMS) group is chemically bonded to the internal surface of the mesopores. The sorption of UV filters obeys Langmuir and Freundlich sorption isotherms, showing the suitability of silylated MCM-41 as adsorbent for enrichment of UV filters from water.

  7. Visible Light Enabled Photocatalytic Splitting of Water over Spatially Isolated Semiconductors Supported Mesoporous Materials

    NASA Astrophysics Data System (ADS)

    Peng, Rui

    Hydrogen generation from photocatalytic splitting of water is an ideal scenario that possesses promise for the sustainable development of human society and the establishment of the ultimate "green," infinitely renewable energy system. This work contains a series of novel photocatalytic systems in which the photoactive chromophores and/or the co-catalysts were incorporated into highly periodically cubic-phased MCM-48 mesoporous materials to achieve significantly higher photocatalytic efficiencies compared with conventional semiconductor photocatalysts. Cubic-phased MCM-48 mesoporous materials were chosen as supports to accommodate the photoactive species throughout the entire work. Several unique and iconic properties of these materials, such as large surface area, highly uniform mesoscale pores arrayed in a long-range periodicity, and an interconnected network of three-dimensional sets of pores that were recognized as positive parameters facilitated the photogenerated charge transfer and promoted the photocatalytic performance of the encapsulated photoactive species. It was validated that in the CdS/TiO2-incorporated MCM-48 photocatalytic system, the solar hydrogen conversion efficiency was prevalently governed by the photogenerated electron injection efficiency from the CdS conduction band to that of TiO2. The use of MCM-48 mesoporous host materials enabled the high and even dispersion of both CdS and TiO 2 so that the intimate and sufficient contact between CdS and TiO 2 was realized. In addition, with the presence of both TiO2 and MCM-48 mesoporous support, the photostability of CdS species was dramatically enhanced compared with that of bare CdS or CdS-incorporated MCM-48 photocatalysts. In advance, by loading the RuO2 co-catalyst into the CdS/TiO 2-incorporated MCM-48 photocatalytic system, the photocatalytic splitting of pure water to generate both hydrogen and oxygen under visible light illumination was achieved. In the various Pd-assisted, TiO2-incorporated

  8. Catalytic process for hydrocarbon cracking using synthetic mesoporous crystalline material

    SciTech Connect

    Le, Q.N.; Thomson, R.T.

    1993-08-03

    A process is described for catalytic cracking of naphtha feedstock which comprises contacting feedstock containing at least 20 wt % C7-C12 alkanes under catalytic reaction conditions with inorganic, porous, non-layered crystalline phase catalyst material exhibiting, after calcination, an X-ray diffraction pattern with at least one peak at a d-spacing greater than 18 Angstrom units and having a benzene adsorption capacity greater than 15 grams of benzene per 100 grams of said material at 50 torr and 25 C, said catalyst material having active Bronsted acid sites; and wherein said cracking conditions include total pressure up to 500 kPa and reaction temperature of 425 to 650 C for less than 50 wt % partial feedstock cracking; thereby producing cracking effluent containing at least 20 wt % isomeric C4-C5 aliphatics including at least 10 wt % C4-C5 tertiary alkene, and at least 10 wt % C4-C5 isoalkane, based on C[sub 5[minus

  9. Characterization of micro- and mesoporous materials using accelerated dynamics adsorption.

    PubMed

    Qajar, Ali; Peer, Maryam; Rajagopalan, Ramakrishnan; Foley, Henry C

    2013-10-01

    Porosimetry is a fundamental characterization technique used in development of new porous materials for catalysis, membrane separation, and adsorptive gas storage. Conventional methods like nitrogen and argon adsorption at cryogenic temperatures suffer from slow adsorption dynamics especially for microporous materials. In addition, CO2, the other common probe, is only useful for micropore characterization unless being compressed to exceedingly high pressures to cover all required adsorption pressures. Here, we investigated the effect of adsorption temperature, pressure, and type of probe molecule on the adsorption dynamics. Methyl chloride (MeCl) was used as the probe molecule, and measurements were conducted near room temperature under nonisothermal condition and subatmospheric pressure. A pressure control algorithm was proposed to accelerate adsorption dynamics by manipulating the chemical potential of the gas. Collected adsorption data are transformed into pore size distribution profiles using the Horvath-Kavazoe (HK), Saito-Foley (SF), and modified Kelvin methods revised for MeCl. Our study shows that the proposed algorithm significantly speeds up the rate of data collection without compromising the accuracy of the measurements. On average, the adsorption rates on carbonaceous and aluminosilicate samples were accelerated by at least a factor of 4-5. PMID:23919893

  10. Experimental and theoretical investigation of a mesoporous K(x)WO3 material having superior mechanical strength.

    PubMed

    Dey, Sonal; Anderson, Sean T; Mayanovic, Robert A; Sakidja, Ridwan; Landskron, Kai; Kokoszka, Berenika; Mandal, Manik; Wang, Zhongwu

    2016-02-01

    Mesoporous materials with tailored properties hold great promise for energy harvesting and industrial applications. We have synthesized a novel tungsten bronze mesoporous material (K(x)WO3; x ∼ 0.07) having inverse FDU-12 type pore symmetry and a crystalline framework. In situ small angle X-ray scattering (SAXS) measurements of the mesoporous K(0.07)WO3 show persistence of a highly ordered meso-scale pore structure to high pressure conditions (∼18.5 GPa) and a material with remarkable mechanical strength despite having ∼35% porosity. Pressure dependent in situ SAXS measurements reveal a bulk modulus κ = 44 ± 4 GPa for the mesoporous K(x)WO3 which is comparable to the corresponding value for the bulk monoclinic WO3 (γ-WO3). Evidence from middle angle (MAXS) and wide angle X-ray scattering (WAXS), high-resolution transmission electron microscopy (HR-TEM) and Raman spectroscopy shows that the presence of potassium leads to the formation of a K-bearing orthorhombic tungsten bronze (OTB) phase within a monoclinic WO3 host structure. Our ab initio molecular dynamics calculations show that the formation of the OTB phase provides superior strength to the mesoporous K(0.07)WO3. PMID:26781181

  11. Effect of electrolytes on proteins physisorption on ordered mesoporous silica materials.

    PubMed

    Salis, Andrea; Medda, Luca; Cugia, Francesca; Monduzzi, Maura

    2016-01-01

    This short review highlights the effect of electrolytes on the performance of proteins-mesoporous silica conjugates which can open interesting perspectives in biotechnological fields, particularly nanomedicine and biocatalysis. Indeed therapeutic proteins and peptides represent a challenging innovation for several kinds of diseases, but since their self-life in biological fluids is very short, they need a stealth protective carrier. Similarly, enzymes need a solid support to improve thermal stability and to allow for recycling. Ordered mesoporous silica materials represent a valid choice as widely demonstrated. Both proteins and silica mesoporous materials possess charged surfaces, and here, the crucial role of pH, buffer, ionic strength and electrolyte type is posed in relation with loading/release of proteins onto/from the silica support through the analysis of adsorption and release processes. A delicate interplay of electrostatic and van der Waals interactions arises from considering electrolytes' effects on the two different charged surfaces. Clear outcomes concern the effect of pH and ionic strength. Protein loading onto the silica matrix is favored by an adsorbing solution having a pH close to the protein pI, and by a high ionic strength that reduces the Debye length. Release is instead favored by an adsorbing solution characterized by an intermediate ionic strength, close to the physiological values. Significant specific ions effects are shown to affect both proteins and silica matrices, as well as protein adsorption onto silica matrices. Further work is needed to quantify specific ion effects on the preservation of the biological activity, and on the release performance. PMID:26009265

  12. Synthesis of butenes through 2-butanol dehydration over mesoporous materials produced from ferrierite

    SciTech Connect

    Jeong, Soyeon; Kim, Hyeonjoo; Bae, Jung A.; Kim, Do Heui; Peden, Charles HF; Park, Young-Kwon; Jeon, Jong Ki

    2012-05-20

    Mesoporous materials synthesized from commercial ferrierite (MMZ-FER) were applied to butanol dehydration. The MMZ-FER was produced by disassembling ferrierite into unit structures in the presence of an alkali solution, adding a surfactant as a templating material, followed by hydrothermal treatment. The effect of the alkali/(Si+Al) ratio in the disassembling step on the characteristics of the catalyst and butanol dehydration performance were investigated. The MMZ-FER materials, synthesized in a condition in which the NaOH/(Si + Al) mole ratio in the disassembling step was 0.67 and 1.0, demonstrated similar textural properties to those of MCM-41. Many weak acid sites developed on the MMZ-FER(0.67) and MMZ-FER(1.0) samples, which is attributed to the creation of ferrierite-induced acid sites. The MMZ-FER materials showed excellent catalytic activity, selectivity, and stability during the dehydration of 2-butanol.

  13. A novel mesoporous carbon-silica-titania nanocomposite as a high performance anode material in lithium ion batteries.

    PubMed

    Zhou, Yuanyuan; Kim, Younghun; Jo, Changshin; Lee, Jinwoo; Lee, Chul Wee; Yoon, Songhun

    2011-05-01

    An ordered mesoporous carbon-silica-titania material was prepared using the tetra-constituents co-assembly method. As regards its anode performance in lithium ion batteries, the composite material anode exhibited a high capacity (875 mAh g(-1)), a higher initial efficiency (56%) and an improved rate. PMID:21424009

  14. Enhancing stabilities of lipase by enzyme aggregate coating immobilized onto ionic liquid modified mesoporous materials

    NASA Astrophysics Data System (ADS)

    Zou, Bin; Song, Chunyan; Xu, Xiaping; Xia, Jiaojiao; Huo, Shuhao; Cui, Fengjie

    2014-08-01

    Mesoporous material SBA-15 as the matrix and hydrophilic methyl imidazolium ionic liquids [MSiIM]+BF4- as modifier were involved in preparing ionic liquid modified materials as enzyme carriers through after-grafting silane coupling reaction. The method of enzyme aggregates coating was firstly used to immobilize porcine pancreatic lipase (PPL) onto ionic liquid modified SBA-15. Characterization before and after modification and immobilization were conducted using infrared spectroscopy (FT-IR), differential thermal-thermal analysis (DTA-TG) and N2 adsorption-desorption method (BET). The results indicated that the ordering degree of SBA-15 declined after ionic liquid modification, but mesoporous structure remained. After enzyme immobilization, pore size and specific surface area of carrier became smaller. The cross-linking agent amount, reaction temperature and pH were optimized in this paper. The result demonstrated that the initial activity of enzyme was raised from 35% to 53% after five times recycle by enzyme aggregate coating. 74% of the original activity remained after 25 days storage.

  15. Wired enzymes in mesoporous materials: A benchmark for fabricating biofuel cells.

    PubMed

    Catalano, Paolo N; Wolosiuk, Alejandro; Soler-Illia, Galo J A A; Bellino, Martín G

    2015-12-01

    Evolution of fuel cells using metallic inorganic catalysts has led to the development of biofuel cells with potential applications in implantable devices. However, the main disadvantages in real world applications of enzymatic biofuel cells are short lifetime and low power density. Many efforts have been devoted to immobilize redox enzymes on surfaces to allow efficient electrical communication with electrodes and to provide an adequate habitat for biochemical activity. In this context, nanocavities of mesoporous materials offer a tailored environment for protein immobilization. Mesostructured platforms with high surface area and stability have been developed to enhance mass transport, charge transfer from biocatalysts to electrodes and enzyme stability, leading to biofuel cells with improved power density (up to 602 μW cm(-2) at physiological conditions) and overall performance (high stability after 30 h of continuous operation and after 10 days of storage). This review discusses recent developments using mesoporous materials as novel platforms for effective electronic charge transfer in the context of current and emerging technologies in enzymatic fuel cell research, emphasizing their practical implications and potential improvements leading to a major impact on medical science and portable electronics. PMID:26187442

  16. A mesoporous carbon–sulfur composite as cathode material for high rate lithium sulfur batteries

    SciTech Connect

    Choi, Hyunji; Zhao, Xiaohui; Kim, Dul-Sun; Ahn, Hyo-Jun; Kim, Ki-Won; Cho, Kwon-Koo; Ahn, Jou-Hyeon

    2014-10-15

    Highlights: • CMK-3 mesoporous carbon was synthesized as conducting reservoir for housing sulfur. • Sulfur/CMK-3 composites were prepared by two-stage thermal treatment. • The composite at 300 °C for 20 h shows improved electrochemical properties. - Abstract: Sulfur composite was prepared by encapsulating sulfur into CMK-3 mesoporous carbon with different heating times and then used as the cathode material for lithium sulfur batteries. Thermal treatment at 300 °C plays an important role in the sulfur encapsulation process. With 20 h of heating time, a portion of sulfur remained on the surface of carbon, whereas with 60 h of heating time, sulfur is confined deeply in the small pores of carbon that cannot be fully exploited in the redox reaction, thus causing low capacity. The S/CMK-3 composite with thermal treatment for 40 h at 300 °C contained 51.3 wt.% sulfur and delivered a high initial capacity of 1375 mA h g{sup −1} at 0.1 C. Moreover, it showed good capacity retention of 704 mA h g{sup −1} at 0.1 C and 578 mA h g{sup −1} at 2 C even after 100 cycles, which proves its potential as a cathode material for high capability lithium sulfur batteries.

  17. FePO 4 nanoparticles supported on mesoporous SBA-15: Interesting cathode materials for Li-ion cells

    NASA Astrophysics Data System (ADS)

    Gerbaldi, C.; Meligrana, G.; Bodoardo, S.; Tuel, A.; Penazzi, N.

    Exploiting the properties of stability, low cost and low toxicity of iron phosphates, we have tried to enhance the performance of FePO 4 as cathode material for Li-ion cells. We adopted the strategy of obtaining FePO 4, via a typical preparation, onto the channels of an ordered mesoporous SBA-15 silica, a low cost mesoporous material commonly used in industry, which possesses larger pores, thicker walls and higher thermal stability as compared with other mesoporous silicas like MCM-41. Characterizations with ICP-AES, XRPD, BET and HRTEM suggest that the supported iron phosphate species, with loading amounts as high as 30 wt%, are located and dispersed in the mesopores of SBA-15. Iron phosphate can be reduced/oxidized more readily than the unsupported iron phosphate at room temperature, and in fact, cycling at C/10, the supported phosphate shows a utilization of 70% with respect to a value of 30% for the unsupported solid. The result is interesting from the scientific viewpoint but not suitable for application at the moment. Indeed, the amount of active material does not exceed 30% of the electrode mass and the total electrode capacity, though the active material is very efficient, is largely insufficient. Researches are being developed trying to increase the performances of the materials and also to eliminate the support after the dispersion of the active material.

  18. Carboxylic acid-grafted mesoporous material and its high catalytic activity in one-pot three-component coupling reaction

    SciTech Connect

    Gomes, Ruth; Bhaumik, Asim; Dutta, Saikat

    2014-11-01

    A new carboxylic acid functionalized mesoporous organic polymer has been synthesized via in situ radical polymerization of divinylbenzene and acrylic acid using a mesoporous silica as a seed during the polymerization process under solvothermal conditions. The mesoporous material MPDVAA-1 has been thoroughly characterized employing powder XRD, solid state {sup 13}C cross polarization magic angle spinning-nuclear magnetic resonance, FT-IR spectroscopy, N{sub 2} sorption, HR-TEM, and NH{sub 3} temperature programmed desorption-thermal conductivity detector (TPD-TCD) analysis to understand its porosity, chemical environment, bonding, and surface properties. The mesoporous polymer was used as a catalyst for a three comp onent Biginelli condensation between various aldehydes, β-keto esters, and urea/thioureas to give 3,4-dihydropyrimidine-2(1H)-ones. The reactions were carried out under conventional heating as well as solvent-free microwave irradiation of solid components, and in both the cases, the mesoporous polymer MPDVAA-1 proved to be a powerful, robust, and reusable catalyst with high catalytic efficiency.

  19. Carboxylic acid-grafted mesoporous material and its high catalytic activity in one-pot three-component coupling reaction

    NASA Astrophysics Data System (ADS)

    Gomes, Ruth; Dutta, Saikat; Bhaumik, Asim

    2014-11-01

    A new carboxylic acid functionalized mesoporous organic polymer has been synthesized via in situ radical polymerization of divinylbenzene and acrylic acid using a mesoporous silica as a seed during the polymerization process under solvothermal conditions. The mesoporous material MPDVAA-1 has been thoroughly characterized employing powder XRD, solid state 13C cross polarization magic angle spinning-nuclear magnetic resonance, FT-IR spectroscopy, N2 sorption, HR-TEM, and NH3 temperature programmed desorption-thermal conductivity detector (TPD-TCD) analysis to understand its porosity, chemical environment, bonding, and surface properties. The mesoporous polymer was used as a catalyst for a three comp onent Biginelli condensation between various aldehydes, β-keto esters, and urea/thioureas to give 3,4-dihydropyrimidine-2(1H)-ones. The reactions were carried out under conventional heating as well as solvent-free microwave irradiation of solid components, and in both the cases, the mesoporous polymer MPDVAA-1 proved to be a powerful, robust, and reusable catalyst with high catalytic efficiency.

  20. Nonionic fluorinated-hydrogenated surfactants for the design of mesoporous silica materials.

    PubMed

    Michaux, F; Blin, J L; Stébé, M J

    2008-09-25

    We have investigated the influence of the ratio between the volume of the hydrophilic head (VA) and the volume of the hydrophobic part (VB) of the surfactant on the mesopore ordering. To understand the difference of behavior we have performed a complete study dealing with fluorinated [Rm(F)(EO)n] and hydrogenated [Rm(H)(EO)n] surfactants. Their mixtures have also been taken into account. Here only the phase diagrams and the structural parameters of the liquid crystal phases of the mixed systems are reported. We have shown that the mutual or partial miscibility of the fluorinated and the hydrogenated surfactants depends on the number of oxyethylene units of each surfactant. To follow, various systems were used for the preparation of silica mesoporous materials via a cooperative templating mechanism (CTM). Results clearly reveal that VA/VB ratios in the range between 0.95 and 1.78 lead to the formation of well-ordered mesostructures. Wormhole-like structures are obtained for higher or lower values. Moreover, results show that from the VA/VB point of view, polyoxyethylene fluoroalkyl ether surfactants behave like their hydrogenated analogues. PMID:18759404

  1. Preparation, characterization and catalytic properties of MCM-48 supported tungstophosphoric acid mesoporous materials for green synthesis of benzoic acid

    SciTech Connect

    Wu, Hai-Yan; Zhang, Xiao-Li; Chen, Xi; Chen, Ya; Zheng, Xiu-Cheng

    2014-03-15

    MCM-48 and tungstophosphoric acid (HPW) were prepared and applied for the synthesis of HPW/MCM-48 mesoporous materials. The characterization results showed that HPW/MCM-48 obtained retained the typical mesopore structure of MCM-48, and the textural parameters decreased with the increase loading of HPW. The catalytic oxidation results of benzyl alcohol and benzaldehyde with 30% H{sub 2}O{sub 2} indicated that HPW/MCM-48 was an efficient catalyst for the green synthesis of benzoic acid. Furthermore, 35 wt% HPW/MCM-48 sample showed the highest activity under the reaction conditions. Highlights: • 5–45 wt% HPW/MCM-48 mesoporous catalysts were prepared and characterized. • Their catalytic activities for the green synthesis of benzoic acid were investigated. • HPW/MCM-48 was approved to be an efficient catalyst. • 5 wt% HPW/MCM-48 exhibited the highest catalytic activity.

  2. A mini review of designed mesoporous materials for energy-storage applications: from electric double-layer capacitors to hybrid supercapacitors

    NASA Astrophysics Data System (ADS)

    Lim, Eunho; Jo, Changshin; Lee, Jinwoo

    2016-04-01

    In recent years, porous materials have attracted significant attention in various research fields because of their structural merits. In particular, well-designed mesoporous structures with two- or three-dimensionally interconnected pores have been recognized as electrode materials of particular interest for achieving high-performance electrochemical capacitors (ECs). In this mini review, recent progress in the design of mesoporous electrode materials for ECs, from electric double-layer capacitors (EDLCs) and pseudocapacitors (PCs) to hybrid supercapacitors (HSCs), and research challenges for the development of new mesoporous electrode materials has been discussed.

  3. A mini review of designed mesoporous materials for energy-storage applications: from electric double-layer capacitors to hybrid supercapacitors.

    PubMed

    Lim, Eunho; Jo, Changshin; Lee, Jinwoo

    2016-04-21

    In recent years, porous materials have attracted significant attention in various research fields because of their structural merits. In particular, well-designed mesoporous structures with two- or three-dimensionally interconnected pores have been recognized as electrode materials of particular interest for achieving high-performance electrochemical capacitors (ECs). In this mini review, recent progress in the design of mesoporous electrode materials for ECs, from electric double-layer capacitors (EDLCs) and pseudocapacitors (PCs) to hybrid supercapacitors (HSCs), and research challenges for the development of new mesoporous electrode materials has been discussed. PMID:27020465

  4. Sructure and dynamics of fluids in micropous and mesoporous earth and engineered materials

    SciTech Connect

    Cole, David R; Mamontov, Eugene; Rother, Gernot

    2009-01-01

    The behavior of liquids in confined geometries (pores, fractures) typically differs, due to the effects of large internal surfaces and geometri-cal confinement, from their bulk behavior in many ways. Phase transitions (i.e., freezing and capillary condensation), sorption and wetting, and dy-namical properties, including diffusion and relaxation, may be modified, with the strongest changes observed for pores ranging in size from <2 nm to 50 nm the micro- and mesoporous regimes. Important factors influ-encing the structure and dynamics of confined liquids include the average pore size and pore size distribution, the degree of pore interconnection, and the character of the liquid-surface interaction. While confinement of liq-uids in hydrophobic matrices, such as carbon nanotubes, or near the sur-faces of mixed character, such as many proteins, has also been an area of rapidly growing interest, the confining matrices of interest to earth and ma-terials sciences usually contain oxide structural units and thus are hydro-philic. The pore size distribution and the degree of porosity and inter-connection vary greatly amongst porous matrices. Vycor, xerogels, aerogels, and rocks possess irregular porous structures, whereas mesopor-ous silicas (e.g., SBA-15, MCM-41, MCM-48), zeolites, and layered sys-tems, for instance clays, have high degrees of internal order. The pore type and size may be tailored by means of adjusting the synthesis regimen. In clays, the interlayer distance may depend on the level of hydration. Al-though studied less frequently, matrices such as artificial opals and chry-sotile asbestos represent other interesting examples of ordered porous structures. The properties of neutrons make them an ideal probe for com-paring the properties of bulk fluids with those in confined geometries. In this chapter, we provide a brief review of research performed on liquids confined in materials of interest to the earth and material sciences (silicas, aluminas, zeolites

  5. Magnetic studies of mesoporous nanostructured iron oxide materials synthesized by one-step soft-templating.

    PubMed

    Jin, Jing; Hines, William A; Kuo, Chung-Hao; Perry, David M; Poyraz, Altug S; Xia, Yan; Zaidi, Taha; Nieh, Mu-Ping; Suib, Steven L

    2015-07-14

    A combined magnetization and (57)Fe spin-echo nuclear magnetic resonance (NMR) study has been carried out on mesoporous nanostructured materials consisting of the magnetite (Fe3O4) and maghemite (γ-Fe2O3) phases. Two series of samples were synthesized using a recently developed one-step soft-templating approach with systematic variations in calcination temperature and reaction atmosphere. Nuclear magnetic resonance has been shown to be a valuable tool for distinguishing between the two magnetic iron oxide spinel phases, Fe3O4 and γ-Fe2O3, on the nanoscale as well as monitoring phase transformation resulting from oxidation. For the Fe3O4 and γ-Fe2O3 phases, peaks in the NMR spectra are attributed to Fe in the tetrahedral (A) sites and octahedral (B) sites. The magnetic field dependence of the peaks was observed and confirmed the site assignments. Fe3O4 on a nanoscale readily oxidizes to form γ-Fe2O3 and this was clearly evident in the NMR spectra. As evidenced by transmission electron microscope (TEM) images, the porous mesostructure for the iron oxide materials is formed by a random close-packed aggregation of nanoparticles; correspondingly, superparamagnetic behavior was observed in the magnetic measurements. Although X-ray diffraction (XRD) shows the spinel structure for the Fe3O4 and γ-Fe2O3 phases, unlike NMR, it is difficult to distinguish between the two phases with XRD. Nitrogen sorption isotherms characterize the mesoporous structures of the materials, and yield BET surface area values and limited BJH pore size distribution curves. PMID:26067028

  6. Adsorption behaviors of methyl orange dye on nitrogen-doped mesoporous carbon materials.

    PubMed

    Li, He; An, Nihong; Liu, Gang; Li, Jialu; Liu, Na; Jia, Mingjun; Zhang, Wenxiang; Yuan, Xiaoling

    2016-03-15

    A series of nitrogen-doped mesoporous carbon materials (NMC) with different nitrogen contents (from 9.1 to 11.3 wt.%) were prepared using urea and ammonia as economical nitrogen resources by sol-gel method. The NMC materials possessed high surface areas (from 659 m(2)/g to 912 m(2)/g) as well as large number of oxygen-containing and nitrogen-containing groups. The adsorption behaviors of NMC materials for anionic dye methyl orange (MO) were investigated, which are fit excellent for the Langmuir isothermal adsorption equation. All the materials exhibited high adsorption capacity for MO at room temperature. Their adsorption capacity can be adjusted by changing the nitrogen contents in NMC materials. Moreover, treating the NMC material at higher temperature can significantly improve the adsorption capacity for MO. According to the results of characterization, the main features of NMC materials, like large pore size and abundant basic nitrogen-containing groups on the surface, should be related to the excellent adsorption property for MO. PMID:26748066

  7. Combined Au-plasmonic nanoparticles with mesoporous carbon material (CMK-3) for photocatalytic water splitting

    SciTech Connect

    Hung, Wei Hsuan E-mail: yinm@sari.ac.cn; Lai, Sz Nian; Su, Cheng Yi; Yin, Min E-mail: yinm@sari.ac.cn; Li, Dongdong; Xue, Xinzhong; Tseng, Chuan Ming

    2015-08-17

    The conventional TiO{sub 2} photoelectrode for water splitting was integrated with ordered mesoporous carbon material (CMK-3) and Au metal nanoparticles (NPs) to improve the photocatalytic efficiency under visible light irradiation. Compared to TiO{sub 2}, Au/TiO{sub 2}-CMK-3 photoelectrode demonstrated over two orders of magnitude enhancement of photocurrent under 532 nm laser irradiation due to the generation of hot electron and near field from Au NPs. Furthermore, the improvement of free carrier transport and additional long-wavelength absorption can be achieved by exploiting the superior conductivity and blackbody-like property of CMK-3. This proposed enhancement mechanism was proved by the measurements of photoluminescence emission spectrum and electrochemical impedance spectroscopy.

  8. Catalytic performance of subtilisin immobilized without covalently attachment on surface-functionalized mesoporous silica materials

    NASA Astrophysics Data System (ADS)

    Murai, K.; Nonoyama, T.; Ando, F.; Kato, K.

    2011-10-01

    Mesoporous silica (MPS) materials were synthesized using cetyltrimethylammonium bromide or amphiphilic pluronic polymer P123 (EO20PO70EO20) as structure-directing agent. MPS samples were characterized by FE-SEM and N2 adsorption-desorption isotherms, respectively. Subtilisin from Bacillus licheiformis (4.1 × 7.8 × 3.7 nm) was easily immobilized by a direct one-step immobilization process onto MPS with different organo-functinalized surfaces. However, enzyme immobilized on MPS modified with 3-mercaptopropyl group strongly reduced its enantioselectivity. Denaturation temperature of immobilized subtilisin shifted to a high temperature compared to free-enzyme. These biocatalysts on MPS particles retained about 30% of original activity even after 5 cycles of recycle use.

  9. Mesoporous carbon materials prepared from litchi shell as sulfur encapsulator for lithium-sulfur battery application

    NASA Astrophysics Data System (ADS)

    Sun, Zhenjie; Wang, Shuanjin; Yan, Longlong; Xiao, Min; Han, Dongmei; Meng, Yuezhong

    2016-08-01

    Novel mesoporous carbon materials (MCMs) with excellent electron conductivity and high surface area are successfully synthesized from waste litchi shells. The as-prepared MCMs possess a narrow pore size distribution (0.5-2.0 nm) and exhibit similar electron conductivities to conductive carbon black (Super P, Timcal). Because of the unique properties of MCMs, they are used as host matrixes to encapsulate sulfur for lithium-sulfur cathodes. The obtained MCMs-sulfur (MCMs-S) composite cathodes deliver a high initial specific capacity of 1667 mAh g-1. Moreover, 300 °C treated MCMs-S composite cathode shows a more stable discharge capacity than the untreated MCMs-S composite cathode, it remains 612 mAh g-1 after 200 cycles at a high current density of 0.5 C.

  10. Polyaniline nanofiber/large mesoporous carbon composites as electrode materials for supercapacitors

    NASA Astrophysics Data System (ADS)

    Liu, Huan; Xu, Bin; Jia, Mengqiu; Zhang, Mei; Cao, Bin; Zhao, Xiaonan; Wang, Yu

    2015-03-01

    A composite of polyaniline nanofiber/large mesoporous carbon (PANI-F/LMC) hybrid was prepared by an in situ chemical oxidative polymerization of aniline monomer with nano-CaCO3 templated LMC as host matrix for supercapacitors. The morphology, composition and electronic structure of the composites (PANI-F/LMC) together with pure PANI nanofibers and the LMC were characterized by scanning electron microscopy (SEM), transmission electron microscopy (TEM), FT-IR, X-ray diffraction (XRD) and X-ray photoelectron spectroscopy (XPS). It is found that the PANI nanofibers were incorporated into the large mesochannels of LMC with interpenetrating framework formed. Such unique structure endows the PANI-F/LMC composite with a high capacitance of 473 F g-1 at a current load of 0.1 A g-1 with good rate performance and cycling stability, suggesting its potential application in the electrode material for supercapacitors.

  11. Growth of mesoporous materials within colloidal crystal films by spin-coating.

    PubMed

    Villaescusa, Luis A; Mihi, Agustín; Rodríguez, Isabel; García-Bennett, Alfonso E; Míguez, Hernan

    2005-10-27

    A combination of colloidal crystal planarization, stabilization, and novel infiltration techniques is used to build a bimodal porous silica film showing order at both the micron and the nanometer length scale. An infiltration method based on the spin-coating of the mesophase precursor onto a three-dimensional polystyrene colloidal crystal film allows a nanometer control tuning of the filling fraction of the mesoporous phase while preserving the optical quality of the template. These materials combine a high specific surface arising from the nanopores with increased mass transport and photonic crystal properties provided by the order of the macropores. Optical Bragg diffraction from these type of hierarchically ordered oxides is observed, allowing performing of optical monitoring of the different processes involved in the formation of the bimodal silica structure. PMID:16853540

  12. Synthesis of acid-base bifunctional mesoporous materials by oxidation and thermolysis

    SciTech Connect

    Yu, Xiaofang; Zou, Yongcun; Wu, Shujie; Liu, Heng; Guan, Jingqi; Kan, Qiubin

    2011-06-15

    Graphical abstract: A novel and efficient method has been developed for the synthesis of acid-base bifunctional catalyst. The obtained sample of SO{sub 3}H-MCM-41-NH{sub 2} containing amine and sulfonic acids exhibits excellent catalytic activity in aldol condensation reaction. Research highlights: {yields} Synthesize acid-base bifunctional mesoporous materials SO{sub 3}H-MCM-41-NH{sub 2}. {yields} Oxidation and then thermolysis to generate acidic site and basic site. {yields} Exhibit good catalytic performance in aldol condensation reaction between acetone and various aldehydes. -- Abstract: A novel and efficient method has been developed for the synthesis of acid-base bifunctional catalyst SO{sub 3}H-MCM-41-NH{sub 2}. This method was achieved by co-condensation of tetraethylorthosilicate (TEOS), 3-mercaptopropyltrimethoxysilane (MPTMS) and (3-triethoxysilylpropyl) carbamicacid-1-methylcyclohexylester (3TAME) in the presence of cetyltrimethylammonium bromide (CTAB), followed by oxidation and then thermolysis to generate acidic site and basic site. X-ray diffraction (XRD) and transmission electron micrographs (TEM) show that the resultant materials keep mesoporous structure. Thermogravimetric analysis (TGA), X-ray photoelectron spectra (XPS), back titration, solid-state {sup 13}C CP/MAS NMR and solid-state {sup 29}Si MAS NMR confirm that the organosiloxanes were condensed as a part of the silica framework. The bifunctional sample (SO{sub 3}H-MCM-41-NH{sub 2}) containing amine and sulfonic acids exhibits excellent acid-basic properties, which make it possess high activity in aldol condensation reaction between acetone and various aldehydes.

  13. Evaluation of mesoporous TCPSi, MCM-41, SBA-15, and TUD-1 materials as API carriers for oral drug delivery.

    PubMed

    Heikkilä, T; Salonen, J; Tuura, J; Kumar, N; Salmi, T; Murzin, D Yu; Hamdy, M S; Mul, G; Laitinen, L; Kaukonen, A M; Hirvonen, J; Lehto, V-P

    2007-08-01

    The feasibility of four mesoporous materials composed of biocompatible Si (TCPSi) or SiO(2) (MCM-41, SBA-15, and TUD-1) were evaluated for oral drug delivery applications. The main focus was to study the effect of the materials different pore systems (unidirectional/2D/3D) and their pore diameters, pore size distributions, pore volumes on the maximal drug load capacity, and release profiles of a loaded active pharmaceutical ingredient. Ibuprofen was used as the model drug. The total pore volume of the mesoporous solid was the main factor limiting the maximum drug load capacity, with SBA-15 reaching a very high drug load of 1:1 in weight due to its high pore volume. Dissolution experiments were performed in HBSS buffers of pH 5.5, 6.8, and 7.4 to mimic the conditions in the small intestine. At pH 5.5 the dissolution rate of ibuprofen released from the mesoporous carriers was significantly faster compared with the standard bulk ibuprofen (86-63% versus 25% released at 45 min), with the fastest release observed from the 3D pore network of TUD-1 carrier. The utilization of mesoporous carriers diminished the pH dependency of ibuprofen dissolution (pK(a) = 4.42), providing an interesting prospect for the formulation of poorly soluble drug compounds. PMID:17701523

  14. Preparation of palladium containing cubic mesoporous materials and their application towards catalytic hydrogenation reactions

    NASA Astrophysics Data System (ADS)

    Balasanthiran, Vagulejan

    Pd --MCM-48 materials were synthesized by modified Stober synthesis in four hours at room temperature. In this procedure using Pd(0) nanoparticles, Na2[PdCl]4 and Pd(acac)2 were used as Pd precursors and Pd containing cubic MCM-48 mesoporous materials were successfully synthesized with metal loadings 1 to ˜5% wt. These materials were characterized by powder X-ray diffraction (XRD), transmission electron microscopy (TEM), UV-Vis spectroscopy, Physisorption, and chemisorption studies. Selected Pd-MCM-48 catalysts were employed for hydrogenation and coupling reactions. These materials provide excellent activity for regio- and chemoselective hydrogenation of olefins with a turnover frequency of 4400 mol/h. At the same time, these catalysts are very reactive for the coupling reactions such as Suzuki, Heck, etc. Pd-MCM-48 provides higher activity and selectivity compared with other reported Pd containing siliceous materials. The Pd-MCM-48 catalyst can be reused more than 10 times with minimal loss of cubic phase catalytic activity.

  15. Hierarchically ordered mesoporous carbon/graphene composites as supercapacitor electrode materials.

    PubMed

    Song, Yanjie; Li, Zhu; Guo, Kunkun; Shao, Ting

    2016-08-25

    Hierarchically ordered mesoporous carbon/graphene (OMC/G) composites have been fabricated by means of a solvent-evaporation-induced self-assembly (EISA) method. The structures of these composites are characterized by X-ray diffraction, transmission electron microscopy, Raman spectroscopy and nitrogen adsorption-desorption at 77 K. These results indicate that OMC/G composites possess the hierarchically ordered hexagonal p6mm mesostructure with the lattice unit parameter and pore diameter close to 10 nm and 3 nm, respectively. The specific surface area of OMC/G composites after KOH activation is high up to 2109.2 m(2) g(-1), which is significantly greater than OMC after activation (1474.6 m(2) g(-1)). Subsequently, the resulting OMC/G composites as supercapacitor electrode materials exhibit an outstanding capacitance as high as 329.5 F g(-1) in 6 M KOH electrolyte at a current density of 0.5 A g(-1), which is much higher than both OMC (234.2 F g(-1)) and a sample made by mechanical mixing of OMC with graphene (217.7 F g(-1)). In addition, the obtained OMC/G composites display good cyclic stability, and the final capacitance retention is approximately 96% after 5000 cycles. These ordered mesopores in the OMC/G composites are beneficial to the accessibility and rapid diffusion of the electrolyte, while graphene in OMC/G composites can also facilitate the transport of electrons during the processes of charging and discharging owing to its high conductivity, thereby leading to an excellent energy storage performance. The method demonstrated in this work would open up a new route to design and develop graphene-based architectures for supercapacitor applications. PMID:27523568

  16. In vitro biocompatibility evaluation of ePTFE graft with controlled release of heparin from mesoporous material

    NASA Astrophysics Data System (ADS)

    Li, Kun; Zhou, Yu; Yang, Jia yuan; Zhu, Jian hua; Liu, Chang jian

    2012-02-01

    Heparin-loaded mesoporous-expanded poly(tetrafluoroethylene) (ePTFE) vascular prosthesis (HMVP-n) are prepared and the biocompatibility is studied by contact angle, heparin release, platelet resistance, chromogenic assay, endothelial progenitor cells (EPCs) proliferation and produced-NO function, in order to illustrate the relationship between the performance of artificial vessels and their mesostructure. Through in situ synthesis of mesoporous silica on ePTFE grafts, different mesoporous silica materials can be uniformly coated on the surface as well as the internal fibers of the artificial vessels to give various mesoporous vascular prosthesis, named as MVP-n. Structure analysis through scanning electron microscopy (SEM), energy dispersive X-ray detector (EDX) analysis and nitrogen sorption experiment indicates that different MVP-n series own the similar nF/nSi ratio of both surface and cross-section, large Brunauer-Emmett-Tellerand (BET) surface area and average pore size located in meso range but different textural properties. Owning to the existence of mesostucture, controlled release and high bioactivity of heparin can be achieved, and the biocompatibility greatly enhance: surface hydrophilicity increases; no adherent platelet was observed on the surface of HMVP-n when they contacted with platelet-enriched plasma; endothelial progenitor cells proliferous potential and produced-NO function exhibit better endothelial coverage of grafts. And the performance is closely related to the mesostructure, suggesting a new way to improve the biocompatibility of biomaterials through controlling their mesostructure.

  17. Structure and Dynamics of Fluids in Microporous and Mesoporous Earth and Engineered Materials

    NASA Astrophysics Data System (ADS)

    Cole, David R.; Mamontov, Eugene; Rother, Gernot

    The behavior of liquids in confined geometries (pores, fractures) typically differs, due to the effects of large internal surfaces and geometrical confinement, from their bulk behavior in many ways. Phase transitions (i.e., freezing and capillary condensation), sorption and wetting, and dynamical properties, including diffusion and relaxation, may be modified, with the strongest changes observed for pores ranging in size from <2 to 50 nm—the micro- and mesoporous regimes. Important factors influencing the structure and dynamics of confined liquids include the average pore size and pore size distribution, the degree of pore interconnection, and the character of the liquid-surface interaction. While confinement of liquids in hydrophobic matrices, such as carbon nanotubes, or near the surfaces of mixed character, such as many proteins, has also been an area of rapidly growing interest, the confining matrices of interest to earth and materials sciences usually contain oxide structural units and thus are hydrophilic. The pore size distribution and the degree of porosity and inter-connection vary greatly amongst porous matrices. Vycor, xerogels, aerogels, and rocks possess irregular porous structures, whereas mesoporous silicas (e.g., SBA-15, MCM-41, MCM-48), zeolites, and layered systems, for instance clays, have high degrees of internal order. The pore type and size may be tailored by means of adjusting the synthesis regimen. In clays, the interlayer distance may depend on the level of hydration. Although studied less frequently, matrices such as artificial opals and chrysotile asbestos represent other interesting examples of ordered porous structures. The properties of neutrons make them an ideal probe for comparing the properties of bulk fluids with those in confined geometries. In this chapter, we provide a brief review of research performed on liquids confined in materials of interest to the earth and material sciences (silicas, aluminas, zeolites, clays, rocks

  18. The Formation Mechanism of Mesoporous Materials studied by EPR Spectroscopy and Cryo-TEM

    NASA Astrophysics Data System (ADS)

    Ruthstein, Sharon

    Ordered mesoporous materials raised a wide interest in the scientific community due to their unique structural properties which encompasses nanosize ordered channels. These materials have potential applications in diverse technological fields such as catalysis, membranes, microelectronics and sensors. The formation of these materials is initiated by the interaction of micelle of surfactant molecules with precursors of an inorganic oxide, usually silica, which further polymerizes to form solids with a well defined pore structure and amorphous walls. The aim of this study is to explore the details of this intriguing reaction mechanism on two types of materials, hexagonal and cubic, prepared with Pluronic block-copolymers as surfactants. The Pluronic micelles are characterized by a hydrophobic polypropylene oxide core and a hydrophilic polyethylene oxide corona. Examples of questions we address are: How does a homogeneous micellar solution transforms into an ordered phase? What kinds of interactions are responsible to this transformation? Our work focused on processes that take place on two levels, the molecular one and the mesoscale, which were investigated by combining electron paramagnetic resonance (EPR) and cryogenic transmission electron microscopy (cryo-TEM) techniques. The molecular level studies combine in-situ and freeze quench EPR spectroscopic techniques applied to nitroxide spin-probes introduced (at minute quantities) into the reaction mixtures. The nitroxide radicals serve as paramagnetic probes in the reaction mixture. They do not react or affect the reaction product but they sense in-situ the changes that occur in their environment during the reaction. The EPR spectrum provides information regarding the dynamic of the probe, which is affected by its surrounding, and the polarity of its environment. Fine structural details, such as the distribution of water and additives within the micelle, can be obtained from Electron Spin Echo Envelope Modulation

  19. Surface acidity effects of Al-SBA-15 mesoporous materials on adsorptive desulfurization.

    PubMed

    Meng, Xiuhong; Wang, Yuan; Duan, Linhai; Qin, Yucai; Yu, Wenguang; Wang, Qiang; Dong, Shiwei; Ruan, Yanjun; Wang, Haiyan; Song, Lijuan

    2014-09-01

    SBA-15 and Aluminum-substituted SBA-15 with Si/Al molar ratio 10 (Al-SBA-15(10)) mesoporous materials were directly synthesized by a hydrolysis approach and characterized by a powder X-ray diffraction (XRD), N2 physisorption analysis and Fourier transform infrared (FTIR) etc. The relative number of hydroxyl groups was investigated by in situ FTIR systematically. The acid type and acid strength of the adsorbents were monitord by FTIR at 423 K and 673 K, respectively, utilizing pyridine as a probe. Desulfurization performances of the adsorbents were investigated via static adsorption experiment. Gas chromatography-sulfur chemiluminescence detector (GC-SCD) was employed to detect the sulfur compounds in model fuels before and after treated by the adsorbents. The calcined Al-SBA-15(10) material shows well-ordered hexagonal mesostructure and strong Lewis acid sites (L acid) and weak Brönsted acid sites (B acid). The number of hydroxy on the surface of the Al-SBA-15(10) is more than that of SBA-15, which is beneficial to further modifications such as spontaneous monolayer dispersion. Desulfurization performance of the adsorbents is affected by surface acidity of adsorbents and the constituent of model fuels (olefins, arene, etc.). The thiophene and olefins adsorbed on the B acid site of the adsorbent may occur subsequently alkylation reactions, which may block the pores of the adsorbents and thus cause the reduction of desulfurization capacity. PMID:25924387

  20. Graphene and carbon nanodots in mesoporous materials: an interactive platform for functional applications

    NASA Astrophysics Data System (ADS)

    Innocenzi, Plinio; Malfatti, Luca; Carboni, Davide

    2015-07-01

    The present review is focused on a specific class of nanocomposites obtained through integration of graphene or carbon-based nanomaterials (such as carbon nanodots) with mesoporous inorganic or hybrid materials, obtained via template assisted self-assembly. The task of integrating graphene and carbon nanodots with a self-assembly process is still very challenging and this review shows some of the solutions which have been envisaged so far. These nanocomposite materials are an ideal interactive platform for developing innovative functional applications; they have a high capability of undergoing integration into advanced devices, which well exploits the advantage of tuning the wide properties and flexibility of the soft-chemistry route. A wide range of applications have been developed so far which span from sensing to electronics up to optics and biomedicine. Even though a large number of proof-of-concepts have been reported to date, an even greater expansion of applications in the field is expected to happen in the near future.

  1. Biocatalytic approach for polymer synthesis and polymer encapsulation in mesoporous materials

    NASA Astrophysics Data System (ADS)

    Ford, Christy

    The goal of this research is to encapsulate enzymatically synthesized polymers within the pores of mesoporous silica. In order to fully understand the effect of polymer incorporation on mesoporous silica structure, the effect of dopant and polymer on micelle shape, the effect of dopant on the final mesoporous silica structure, and the effect of incorporating polymer within mesoporous silica are investigated. Direct entrapment of aromatic molecules within cationic micelles to ultimately fabricate tailored, functional mesoporous silica/polymer composites is investigated. Specifically, the influence of 4-ethylphenol and aniline on the shape of cetyltrimethylammonium bromide (CTAB) micelles and on the structure of mesoporous silica synthesized via the micellar templating is investigated. Small angle neutron scattering indicates that the dopant affects the micellar size, micellar arrangement, and the domain size over which the arrangement extends. Cryo-TEM offers further insight into the micellar shape. The effect of the dopant-to-surfactant molar ratio on the structure of surfactant-templated mesoporous silica is characterized by x-ray diffraction, transmission electron microscopy, and nitrogen sorption techniques. The mesoporous silica undergoes a transition from hexagonal to lamellar with increasing dopant-to-surfactant molar ratio for both 4-ethylphenol and 2-naphthol, suggesting a possible change in the template morphology. A better understanding of the relation between dopant, micellar shape, and mesoporous structure plays a critical role in the development of polymer-ceramic nanocomposites with novel electrooptical, conductive, and fluorescent properties. A novel method for encapsulating polymers in mesoporous silica is presented. The method involves enzymatic synthesis of polyphenols and polyaromatic amines in micellar aggregates, and subsequently condensing silica at the surfactant-water interface. Thus, poly(4-ethylphenol), poly(2-naphthol), and polyaniline

  2. Acid Functionalized Mesoporous Ordered Materials for the Production of 5-Hydroxymethyfurfural from Carbohydrates

    NASA Astrophysics Data System (ADS)

    Crisci, Anthony J.

    Solid acid catalysts were designed for the conversion of fructose to 5-hydroxymethylfurfural (HMF). Some of the catalysts incorporate thioether groups to promote the tautomerization of fructose to its furanose form, as well as sulfonic acid groups to catalyze its dehydration. A bifunctional silane, 3-((3-(trimethoxysilyl)propyl)thio)propane-1-sulfonic acid (TESAS), was designed for incorporation into SBA-15-type silica by co-condensation. To achieve mesopore ordering in the functionalized silica, the standard SBA-15 synthetic protocol was modified, resulting in well-formed hexagonal particles. Functional groups incorporated into mesoporous silica by co-condensation are more robust under the reaction conditions than those grafted onto a non-porous silica. In a variation, the thioether group of TESAS was oxidized by H2O 2 to the sulfone during the synthesis of the modified SBA-15. The materials were tested in batch reactors and compared in the selective dehydration of fructose to 5-hydroxymethylfurfural (HMF). Compared to benchmark catalysts, the thioether-containing TESAS-SBA-15 showed the highest activity in the dehydration of aqueous fructose, as well as the highest selectivity towards HMF (71 % at 84 % conversion). In addition, the stability of several supported acid catalysts was evaluated in tubular reactors designed to produce 5-hydroxymethylfurfural (HMF) continuously. The reactors, packed with the solid catalysts, were operated at 403 K for extended periods, up to 180 h. The behaviors of three propylsulfonic acid-functionalized, ordered porous silicas (one inorganic SBA-15-type silica, and two ethane-bridged SBA-15-type organosilicas) were compared with that of a propylsulfonic acid-modified, non-ordered porous silica. The HMF selectivity of the catalysts with ordered pore structures ranged from 60 to 75 %, while the selectivity of the non-ordered catalyst peaked at 20 %. The latter was also the least stable, deactivating with a first-order rate constant of

  3. Quantum effects in the sorption kinetics of 4He by mesoporous materials

    NASA Astrophysics Data System (ADS)

    Dolbin, A. V.; Khlistyuck, M. V.; Esel'son, V. B.; Gavrilko, V. G.; Vinnikov, N. A.; Basnukaeva, R. M.; Danchuk, V. V.

    2016-02-01

    Sorption and desorption of 4He by a mesoporous silicate material MCM-41 was studied in the temperature range of 1.5-290 K. It was shown that for T = 25-290 K the thermal activation mechanism is dominant in the sorption kinetics of 4He atoms by an MCM-41 sample. Its activation energy was estimated as Ea ≈ 164.8 K. For T = 12-23 K, the diffusion of 4He atoms in the MCM-41 was practically independent of temperature, which typically occurs when the tunnelling mechanism of diffusion dominates over the thermally activated one. A change in the mobility of 4He atoms in MCM-41 channels was observed at T = 6-12 K, which may be indicative of the formation upon cooling (or decay upon heating) of a 4He monolayer and subsequent multilayers on the inner surfaces of the channels. Below 6 K, the diffusion coefficients of 4He are only weakly temperature dependent, which may be attributed to the behavior of quantum 4He liquid in the MCM-41 channels covered with several layers of 4He atoms.

  4. Synthesis, characterization, and catalytic properties of Ti-containing SBA-15 mesoporous materials

    NASA Astrophysics Data System (ADS)

    Dang, Phuong T.; Le, Hy G.; Hoang, Duc V.; Hoang, Yen; Dinh, Thang C.; Bui, Linh H.; Tran, Hoa T. K.; Nguyen, Phu H.; Vu, Tuan A.

    2006-12-01

    Titanium-containing SBA-15 mesoporous materials with Si/Ti molar ratios of 25, 50 and 100 (Ti-SBA-15) were successfully prepared by direct synthesized method using P123 as surfactant. The samples were characterized by XRD, BET, TEM and UV-Vis. It revealed at low Ti-loading (Si/Ti of 50-100), titanium was completely incorporated into SBA-15 framework, whereas at high Ti-loading (Si/Ti of 25) titanium was partially incorporated into SBA-15 framework, one part of Ti existed as extra-framework Ti (anatase phase). For comparison, Ti impregnated on Si-SBA-15 (Ti/SBA-15) was also prepared by postsynthesis method. In (*)this case, titanium was well dispersed onto the surface of SBA-15. The catalytic activities of Ti-SBA-15 with different Ti-content and Ti/SBA-15 samples were tested in the photocatalytic oxidation of red-phenol and in the photocatalytic reduction of Cr(VI) to Cr(III). The catalytic results showed that both the Ti-SBA-15 and Ti/SBA-15 solids are also the good catalysts for total photooxidation of red phenol. Especially, the tetrahedral coordinated titanium can oxidize red phenol much deeper than well dispersed titanium particles does. For photocatalytic reduction, the activities mainly depend on the number of Ti, not the state of Ti.

  5. Molecular Simulation Study of the Early Stages of Formation of Bioinspired Mesoporous Silica Materials.

    PubMed

    Centi, Alessia; Jorge, Miguel

    2016-07-19

    The use of bioinspired templates, such as polyamines and polypeptides, could lead to significant improvements in the synthesis conditions under which mesoporous materials are traditionally produced, removing the need for strong pH as well as high temperature or pressure. In this work, we perform atomistic molecular dynamics simulations of 1,12-diaminododecane surfactants, in water and in the presence of silica monomers, to investigate the early stages of synthesis of one of the first examples of bioinspired silica materials. Different surfactant concentrations and pH were considered, clarifying the influence of the charge state of the molecules on the self-assembly process. We show that the amphiphilic amines form stable lamellar structures at equilibrium in the range from intermediate to high pH values. In a later stage, when silica species are added to the system, our results reveal that, in the same range of pH, silicates strongly adsorb around these aggregates at the interface with water. This causes a considerable modification of the curvature of the layer, which suggests a tendency for the system to evolve from a lamellar phase to the formation of vesicle structures. Furthermore, we show that silica monomers are able to penetrate the layer spontaneously when defects are created as a result of surfactants' head-to-head repulsion. These findings are in agreement with experimental observations and support the pillaring mechanism postulated for this class of materials. However, our simulations indicate that the aggregation process is driven by charge matching between surfactant heads and silica monomers rather than by hydrogen bond interactions between neutral species, as had been previously hypothesized. PMID:27340948

  6. Direct-synthesis method towards copper-containing periodic mesoporous organosilicas: detailed investigation of the copper distribution in the material.

    PubMed

    Lin, Feng; Meng, Xiangyan; Kukueva, Elena; Altantzis, Thomas; Mertens, Myrjam; Bals, Sara; Cool, Pegie; Van Doorslaer, Sabine

    2015-06-01

    Three-dimensional cubic Fm3[combining macron]m mesoporous copper-containing ethane-bridged PMO materials have been prepared through a direct-synthesis method at room temperature in the presence of cetyltrimethylammonium bromide as surfactant. The obtained materials have been unambiguously characterized in detail by several sophisticated techniques, including XRD, UV-Vis-Dr, TEM, elemental mapping, continuous-wave and pulsed EPR spectroscopy. The results show that at lower copper loading, the Cu(2+) species are well dispersed in the Cu-PMO materials, and mainly exist as mononuclear Cu(2+) species. At higher copper loading amount, Cu(2+) clusters are observed in the materials, but the distribution of the Cu(2+) species is still much better in the Cu-PMO materials prepared through the direct-synthesis method than in a Cu-containing PMO material prepared through an impregnation method. Moreover, the evolution of the copper incorporation during the PMO synthesis has been followed by EPR. The results show that the immobilization of the Cu(2+) ion/complex and the formation of the PMO materials are taking place simultaneously. The copper ions are found to be situated on the inner surface of the mesopores of the materials and are accessible, which will be beneficial for the catalytic applications. PMID:25945682

  7. Novel hollow mesoporous 1D TiO2 nanofibers as photovoltaic and photocatalytic materials.

    PubMed

    Zhang, Xiang; Thavasi, Velmurugan; Mhaisalkar, S G; Ramakrishna, Seeram

    2012-03-01

    Hollow mesoporous one dimensional (1D) TiO(2) nanofibers are successfully prepared by co-axial electrospinning of a titanium tetraisopropoxide (TTIP) solution with two immiscible polymers; polyethylene oxide (PEO) and polyvinylpyrrolidone (PVP) using a core-shell spinneret, followed by annealing at 450 °C. The annealed mesoporous TiO(2) nanofibers are found to having a hollow structure with an average diameter of 130 nm. Measurements using the Brunauer-Emmett-Teller (BET) method reveal that hollow mesoporous TiO(2) nanofibers possess a high surface area of 118 m(2) g(-1) with two types of mesopores; 3.2 nm and 5.4 nm that resulted from gaseous removal of PEO and PVP respectively during annealing. With hollow mesoporous TiO(2) nanofibers as the photoelectrode in dye sensitized solar cells (DSSC), the solar-to-current conversion efficiency (η) and short circuit current (J(sc)) are measured as 5.6% and 10.38 mA cm(-2) respectively, which are higher than those of DSSC made using regular TiO(2) nanofibers under identical conditions (η = 4.2%, J(sc) = 8.99 mA cm(-2)). The improvement in the conversion efficiency is mainly attributed to the higher surface area and mesoporous TiO(2) nanostructure. It facilitates the adsorption of more dye molecules and also promotes the incident photon to electron conversion. Hollow mesoporous TiO(2) nanofibers with close packing of grains and crystals intergrown with each other demonstrate faster electron diffusion, and longer electron recombination time than regular TiO(2) nanofibers as well as P25 nanoparticles. The surface effect of hollow mesoporous TiO(2) nanofibers as a photocatalyst for the degradation of rhodamine dye was also investigated. The kinetic study shows that the hollow mesoporous surface of the TiO(2) nanofibers influenced its interactions with the dye, and resulted in an increased catalytic activity over P25 TiO(2) nanocatalysts. PMID:22315140

  8. In Operando Monitoring of the Pore Dynamics in Ordered Mesoporous Electrode Materials by Small Angle X-ray Scattering.

    PubMed

    Park, Gwi Ok; Yoon, Jeongbae; Park, Eunjun; Park, Su Bin; Kim, Hyunchul; Kim, Kyoung Ho; Jin, Xing; Shin, Tae Joo; Kim, Hansu; Yoon, Won-Sub; Kim, Ji Man

    2015-05-26

    To monitor dynamic volume changes of electrode materials during electrochemical lithium storage and removal process is of utmost importance for developing high performance lithium storage materials. We herein report an in operando probing of mesoscopic structural changes in ordered mesoporous electrode materials during cycling with synchrotron-based small angel X-ray scattering (SAXS) technique. In operando SAXS studies combined with electrochemical and other physical characterizations straightforwardly show how porous electrode materials underwent volume changes during the whole process of charge and discharge, with respect to their own reaction mechanism with lithium. This comprehensive information on the pore dynamics as well as volume changes of the electrode materials will not only be critical in further understanding of lithium ion storage reaction mechanism of materials, but also enable the innovative design of high performance nanostructured materials for next generation batteries. PMID:25869353

  9. Novel hollow mesoporous 1D TiO2 nanofibers as photovoltaic and photocatalytic materials

    NASA Astrophysics Data System (ADS)

    Zhang, Xiang; Thavasi, Velmurugan; Mhaisalkar, S. G.; Ramakrishna, Seeram

    2012-02-01

    Hollow mesoporous one dimensional (1D) TiO2 nanofibers are successfully prepared by co-axial electrospinning of a titanium tetraisopropoxide (TTIP) solution with two immiscible polymers; polyethylene oxide (PEO) and polyvinylpyrrolidone (PVP) using a core-shell spinneret, followed by annealing at 450 °C. The annealed mesoporous TiO2 nanofibers are found to having a hollow structure with an average diameter of 130 nm. Measurements using the Brunauer-Emmett-Teller (BET) method reveal that hollow mesoporous TiO2 nanofibers possess a high surface area of 118 m2 g-1 with two types of mesopores; 3.2 nm and 5.4 nm that resulted from gaseous removal of PEO and PVP respectively during annealing. With hollow mesoporous TiO2 nanofibers as the photoelectrode in dye sensitized solar cells (DSSC), the solar-to-current conversion efficiency (η) and short circuit current (Jsc) are measured as 5.6% and 10.38 mA cm-2 respectively, which are higher than those of DSSC made using regular TiO2 nanofibers under identical conditions (η = 4.2%, Jsc = 8.99 mA cm-2). The improvement in the conversion efficiency is mainly attributed to the higher surface area and mesoporous TiO2 nanostructure. It facilitates the adsorption of more dye molecules and also promotes the incident photon to electron conversion. Hollow mesoporous TiO2 nanofibers with close packing of grains and crystals intergrown with each other demonstrate faster electron diffusion, and longer electron recombination time than regular TiO2 nanofibers as well as P25 nanoparticles. The surface effect of hollow mesoporous TiO2 nanofibers as a photocatalyst for the degradation of rhodamine dye was also investigated. The kinetic study shows that the hollow mesoporous surface of the TiO2 nanofibers influenced its interactions with the dye, and resulted in an increased catalytic activity over P25 TiO2 nanocatalysts.Hollow mesoporous one dimensional (1D) TiO2 nanofibers are successfully prepared by co-axial electrospinning of a titanium

  10. Development of novel delivery system for warfarin based on mesoporous silica: adsorption characteristics of silica materials for the anticoagulant.

    PubMed

    Dolinina, Ekaterina S; Vorobyeva, Evgeniya V; Parfenyuk, Elena V

    2016-08-01

    The adsorption of the anticoagulant warfarin onto unmodified (UMS) and modified (phenyl (PhMS), methyl (MMS), mercaptopropyl (MPMS)) mesoporous silica materials was studied at pH 1.6 and 7.4 and in the temperature range of 293-325 K. The silica materials were prepared by sol-gel method for further characterization by FTIR spectroscopy, N2 adsorption/desorption method, transmission electron microscopy and zeta potential measurements. The effects of medium pH, temperature and surface modification of mesoporous silica material on their adsorption characteristics (adsorption capacity, thermodynamic parameters of adsorption) relative to anticoagulant warfarin were investigated. It was found that medium acid-base properties strongly affect the adsorption of warfarin due to the pH-dependent structural diversity of the drug and ionization state of the silica surfaces. The adsorption capacity of the silica materials at pH 1.6 decreases in the order: MMS > MPMS > UMS > PhMS. The influence of various non-covalent interactions on the adsorption capacity of the silica materials and energy of the drug-silica interactions is discussed. These results may be useful for the development of a novel delivery system of warfarin. PMID:26465269

  11. Quick high-temperature hydrothermal synthesis of mesoporous materials with 3D cubic structure for the adsorption of lysozyme

    NASA Astrophysics Data System (ADS)

    Lawrence, Geoffrey; Baskar, Arun V.; El-Newehy, Mohammed H.; Cha, Wang Soo; Al-Deyab, Salem S.; Vinu, Ajayan

    2015-04-01

    Three-dimensional cage-like mesoporous FDU-12 materials with large tuneable pore sizes ranging from 9.9 to 15.6 nm were prepared by varying the synthesis temperature from 100 to 200 °C for the aging time of just 2 h using a tri-block copolymer F-127(EO106PO70EO106) as the surfactant and 1,3,5-trimethyl benzene as the swelling agent in an acidic condition. The mesoporous structure and textural features of FDU-12-HX (where H denotes the hydrothermal method and X denotes the synthesis temperature) samples were elucidated and probed using x-ray diffraction, N2 adsorption, 29Si magic angle spinning nuclear magnetic resonance, scanning electron microscopy and transmission electron microscopy. It has been demonstrated that the aging time can be significantly reduced from 72 to 2 h without affecting the structural order of the FDU-12 materials with a simple adjustment of the synthesis temperature from 100 to 200 °C. Among the materials prepared, the samples prepared at 200 °C had the highest pore volume and the largest pore diameter. Lysozyme adsorption experiments were conducted over FDU-12 samples prepared at different temperatures in order to understand their biomolecule adsorption capacity, where the FDU-12-HX samples displayed high adsorption performance of 29 μmol g-1 in spite of shortening the actual synthesis time from 72 to 2 h. Further, the influence of surface area, pore volume and pore diameter on the adsorption capacity of FDU-12-HX samples has been investigated and results are discussed in correlation with the textural parameters of the FDU-12-HX and other mesoporous adsorbents including SBA-15, MCM-41, KIT-5, KIT-6 and CMK-3.

  12. Synthesis of ordered mesoporous crystalline CuS and Ag2S materials via cation exchange reaction

    NASA Astrophysics Data System (ADS)

    Wang, Jun; Xu, Weiming; Bao, Haifeng; Shi, Yifeng

    2015-02-01

    Cation exchange reaction is a strong tool for the synthesis of new ionic nanomaterials. Most of them are isolated nanoparticles with simple geometric features, such as nanodots, nanorods and nanospheres. In this work, we demonstrated that ordered mesoporous CdS with a complex cubic Ia3d gyroidal 3D bicontinuous porous structure and large particle size can be successfully converted to crystalline CuS and Ag2S materials via cation exchange reaction without destroying the well-defined nanostructure. The change in crystal structure is an important factor for a successful conversion when the reaction is carried out without the presence of a silica template. In addition, the cation exchange reaction is sufficient for a complete compositional conversion, even when the mesostructured CdS precursor is embedded inside a mesoporous silica matrix. Our results indicate that cation exchange reaction may be applied to highly complex nanostructures with extremely large particle sizes.Cation exchange reaction is a strong tool for the synthesis of new ionic nanomaterials. Most of them are isolated nanoparticles with simple geometric features, such as nanodots, nanorods and nanospheres. In this work, we demonstrated that ordered mesoporous CdS with a complex cubic Ia3d gyroidal 3D bicontinuous porous structure and large particle size can be successfully converted to crystalline CuS and Ag2S materials via cation exchange reaction without destroying the well-defined nanostructure. The change in crystal structure is an important factor for a successful conversion when the reaction is carried out without the presence of a silica template. In addition, the cation exchange reaction is sufficient for a complete compositional conversion, even when the mesostructured CdS precursor is embedded inside a mesoporous silica matrix. Our results indicate that cation exchange reaction may be applied to highly complex nanostructures with extremely large particle sizes. Electronic supplementary

  13. MCM-41 supported 12-tungstophosphoric acid mesoporous materials: Preparation, characterization, and catalytic activities for benzaldehyde oxidation with H2O2

    NASA Astrophysics Data System (ADS)

    Chen, Ya; Zhang, Xiao-Li; Chen, Xi; Dong, Bei-Bei; Zheng, Xiu-Cheng

    2013-10-01

    Mesoporous molecular sieves MCM-41 and bulk 12-tungstophosphoric acid (HPW) were synthesized and employed to prepare 5-45 wt.% HPW/MCM-41 mesoporous materials. Characterization results suggested the good dispersion of HPW within MCM-41 when the loading of HPW was less than 35 wt.% and HPW/MCM-41 retained the typical mesopore structure of the supports. The results of the catalytic oxidation of benzaldehyde to benzoic acid with 30% H2O2, in the absence of any organic solvent and co-catalysts, indicated that HPW/MCM-41 was an efficient catalyst and 30 wt.% HPW/MCM-41 sample exhibited the highest catalytic activity among these materials.

  14. Micro-mesoporous carbon spheres derived from carrageenan as electrode material for supercapacitors

    NASA Astrophysics Data System (ADS)

    Fan, Yang; Yang, Xin; Zhu, Bing; Liu, Pei-Fang; Lu, Hai-Ting

    2014-12-01

    The polysaccharide carrageenan is used as a natural precursor to prepare micro-mesoporous carbon spheres. The carbon spheres were synthesized by hydrothermal carbonization of carrageenan, and subsequent chemical activation by KOH at different temperatures. The obtained micro-mesoporous carbon spheres have high surface area (up to 2502 m2 g-1) and large pore volume (up to 1.43 cm3 g-1). Moreover, the micro- and mesoporosity can be finely tuned be modifying the activation temperatures in the range of 700-900 °C. The carbon spheres activated at 900 °C present high specific capacitance of 230 F g-1 at a current density of 1 A g-1 and good ion transport kinetics. The good capacitive performance can be ascribed to the high specific surface area, well-controlled micro- and mesoporosity and narrow pore size distribution.

  15. Mesoporous MFe{sub 2}O{sub 4} (M = Mn, Co, and Ni) for anode materials of lithium-ion batteries: Synthesis and electrochemical properties

    SciTech Connect

    Duan, Lianfeng; Wang, Yuanxin; Wang, Linan; Zhang, Feifei; Wang, Limin

    2015-01-15

    Highlights: • MFe{sub 2}O{sub 4} (M = Mn, Co, and Ni) are synthesized by a template-free hydrothermal method. • The mesoporous morphology is formed by self-assembly of crystal nucleus. • The mesporous MnFe{sub 2}O{sub 4} have the active phase and the synergy for Li-ion storage. - Abstract: The MFe{sub 2}O{sub 4} (M = Mn, Co, and Ni) mesoporous spheres with an average diameter of 250 nm were synthesized through a template-free hydrothermal method. The mesoporous MnFe{sub 2}O{sub 4} with a large surface area of 87.5 m{sup 2}/g and an average pore size of 27.52 nm were obtained. As the anode materials for Li-ion batteries, the mesoporous MnFe{sub 2}O{sub 4} exhibits excellent initial charge and discharge capacities of 1010 and 642.5 mA h/g. After 50 cycles, the discharge capacity could still remain at 379 mA h/g. The results showed that the active phase and the synergy between different metal oxides greatly improved the electrochemical performance, and the mesoporous composite could stabilize the structure of the electrodes.

  16. Designing novel hybrid materials by one-pot co-condensation: from hydrophobic mesoporous silica nanoparticles to superamphiphobic cotton textiles.

    PubMed

    Pereira, C; Alves, C; Monteiro, A; Magén, C; Pereira, A M; Ibarra, A; Ibarra, M R; Tavares, P B; Araújo, J P; Blanco, G; Pintado, J M; Carvalho, A P; Pires, J; Pereira, M F R; Freire, C

    2011-07-01

    This work reports the synthesis and characterization of mesoporous silica nanoparticles (MSNs) functionalized with tridecafluorooctyltriethoxysilane (F13) and their in situ incorporation onto cotton textiles. The hybrid MSNs and the functional textiles were prepared by a one-pot co-condensation methodology between tetraethylorthosilicate (TEOS) and F13, with hexadecyltrimethylammonium chloride (CTAC) as the template and triethanolamine as the base. The influence of the F13 to TEOS molar ratio (1:10, 1:5 and 1:3) on the nanoparticle morphology, porosity, degree of functionalization, and hydro/oleophobic properties is discussed. The hybrid nanosilicas presented high colloidal stability and were spherical and monodispersed with average particle size of ∼45 nm. They also showed high surface areas, large pore volumes, and a wormhole-type mesoporous structure. The increase in the organosilane proportion during the co-condensation process led to a more radially branched wormhole-like mesoporosity, a decrease in the surface area, pore volume, and amount of surface silanol groups, and an enrichment of the surface with fluorocarbon moieties. These changes imparted hydrophobic and oleophobic properties to the materials, especially to that containing the highest F13 loading. Cotton textiles were coated with the F13-MSNs through an efficient and less time-consuming route. The combination between surface roughness and mesoporosity imparted by the MSNs, and the low surface energy provided by the organosilane resulted in superhydrophobic functional textiles. Moreover, the textile with the highest loading of fluorocarbon groups was superamphiphobic. PMID:21615151

  17. [Metal-Organic Frameworks: A New Class of Mesoporous Materials and Potential Possibilities of Their Use in Pharmaceutical Technology].

    PubMed

    Wyszogrodzka, Gabriela; Dorożyński, Przemysław

    2015-01-01

    Metal-organic frameworks (MOFs) belong to the new class of mesoporous, hybrid materials composed of metal ions and organic binding ligands. Their unique features: wide range of chemical building components, which enables obtaining biocompatible materials, and high surface area and loading capacity, make them promising drug delivery vehicles for therapeutic agents. The ability to tune their structures and porosities provides better adjustment for adsorbed drug molecule. Moreover, MOFs functionalized with ligands or antibodies can be used in cancer targeted therapy. Through the incorporation of paramagnetic metal ions into the structure, MOFs are suited to serve as magnetic resonance imaging (MRI) contrast agents. Combining drug delivery ability with imaging properties of MOFs indicates their potential use as theranostic agents and makes possible monitoring drug delivery within the body after administration in the real time. The aim of the present study is to characterize a new class of compounds and to present potential possibilities of their use as excipients in pharmaceutical technology . PMID:26994890

  18. Synthesis of an Ionic Liquid and Its Application as Template for the Preparation of Mesoporous Material MCM-41: A Comprehensive Experiment for Undergraduate Students

    ERIC Educational Resources Information Center

    Hu, Jun; Yin, Jinxiang; Lin, Tianshu; Li, Guangtao

    2012-01-01

    A new solvent-free microwave experiment to synthesize the ionic liquid 1-hexadecyl-3-methylimidazolium bromide (HDMIm-Br) in high yield is presented. The structure is confirmed by IR and [superscript 1]H NMR spectra. HDMIm-Br is then used to prepare an organic-inorganic mesoporous material MCM-41. The microscopic arrangements of mesoporous…

  19. Mesoporous Co3O4 nanostructured material synthesized by one-step soft-templating: A magnetic study

    NASA Astrophysics Data System (ADS)

    Poyraz, Altug S.; Hines, William A.; Kuo, Chung-Hao; Li, Nan; Perry, David M.; Suib, Steven L.

    2014-03-01

    A combined magnetization and zero-field 59Co spin-echo nuclear magnetic resonance (NMR) study has been carried out on one member of a recently developed class of highly ordered mesoporous nanostructured materials, mesoporous Co3O4 (designated UCT-8, University of Connecticut, mesoporous materials). The material was synthesized using one-step soft-templating by an inverse micelles packing approach. Characterization of UCT-8 by powder x-ray diffraction and electron microscopy reveals that the mesostructure consists of random close-packed Co3O4 nanoparticles ≈ 12 nm in diameter. The N2 sorption isotherm for UCT-8, which is type IV with a type H1 hysteresis loop, yields a 134 m2/g BET surface area and a 7.7 nm BJH desorption pore diameter. The effect of heat treatment on the structure is discussed. The antiferromagnetic Co3O4 nanoparticles have a Néel temperature TN = 27 K, somewhat lower than the bulk. A fit to the Curie-Weiss law over the temperature range 75 K ≤ T ≤ 300 K yields an effective magnetic moment of μeff = 4.36 μB for the Co2+ ions, indicative of some orbital contribution, and a Curie-Weiss temperature Θ = -93.5 K, consistent with antiferromagnetic ordering. The inter-sublattice and intra-sublattice exchange constants for the Co2+ ions are J1/kB = (-)4.75 K and J2/kB = (-)0.87 K, respectively, both corresponding to antiferromagnetic coupling. The presence of uncompensated surface spins is observed below TN with shifts in the hysteresis loops, i.e., an exchange-bias effect. The 59Co NMR spectrum for UCT-8, which is attributed to Co2+ ions at the tetrahedral A sites, is asymmetrically broadened with a peak at ≈55 MHz (T = 4.2 K). Since there is cubic symmetry at the A-sites, the broadening is indicative of a magnetic field distribution due to the uncompensated surface spins. The spectrum is consistent with antiferromagnetically ordered particles that are nanometer in size and single domain.

  20. On the Synergistic Catalytic Properties of Bimetallic Mesoporous Materials Containing Aluminum and Zirconium: The Prins Cyclisation of Citronellal

    PubMed Central

    Telalović, Selvedin; Ramanathan, Anand; Ng, Jeck Fei; Maheswari, Rajamanickam; Kwakernaak, Cees; Soulimani, Fouad; Brouwer, Hans C; Chuah, Gaik Khuan; Weckhuysen, Bert M; Hanefeld, Ulf

    2011-01-01

    Bimetallic three-dimensional amorphous mesoporous materials, Al-Zr-TUD-1 materials, were synthesised by using a surfactant-free, one-pot procedure employing triethanolamine (TEA) as a complexing reagent. The amount of aluminium and zirconium was varied in order to study the effect of these metals on the Brønsted and Lewis acidity, as well as on the resulting catalytic activity of the material. The materials were characterised by various techniques, including elemental analysis, X-ray diffraction, high-resolution TEM, N2 physisorption, temperature-programmed desorption (TPD) of NH3, and 27Al MAS NMR, XPS and FT-IR spectroscopy using pyridine and CO as probe molecules. Al-Zr-TUD-1 materials are mesoporous with surface areas ranging from 700–900 m2 g−1, an average pore size of around 4 nm and a pore volume of around 0.70 cm3 g−1. The synthesised Al-Zr-TUD-1 materials were tested as catalyst materials in the Lewis acid catalysed Meerwein–Ponndorf–Verley reduction of 4-tert-butylcyclohexanone, the intermolecular Prins synthesis of nopol and in the intramolecular Prins cyclisation of citronellal. Although Al-Zr-TUD-1 catalysts possess a lower amount of acid sites than their monometallic counterparts, according to TPD of NH3, these materials outperformed those of the monometallic Al-TUD-1 as well as Zr-TUD-1 in the Prins cyclisation of citronellal. This proves the existence of synergistic properties of Al-Zr-TUD-1. Due to the intramolecular nature of the Prins cyclisation of citronellal, the hydrophilic surface of the catalyst as well as the presence of both Brønsted and Lewis acid sites synergy could be obtained with bimetallic Al-Zr-TUD-1. Besides spectroscopic investigation of the active sites of the catalyst material a thorough testing of the catalyst in different types of reactions is crucial in identifying its specific active sites. PMID:21259348

  1. One-pot synthesis of superacid catalytic material SO{sub 4}{sup 2-}/ZrO{sub 2}-SiO{sub 2} with thermostable well-ordered mesoporous structure

    SciTech Connect

    Li Ruifeng; Yu Feng; Li Fuxiang; Zhou Meimei; Xu Bingshe; Xie Kechang

    2009-05-15

    A superacid mesostructured catalyst was directly synthesized by adding sulfuric acid to mesoporous zirconia-silica synthesis mixtures, and was characterized by HRTEM, XRD, UV-Vis, nitrogen sorption, NH{sub 3}-TPD, and Pyridine-FTIR. The XRD patterns and electron diffraction micrographs of the calcined samples showed the ordered mesoporous structure and tetragonal crystalline in frameworks. The ammonia TPD, pyridine in situ FTIR, and paraffin isomerization illustrated a new acidic property of the samples. The synthesis of the mesoporous materials, which have stable crystalline frameworks, high surface area, and strong acidity, is very likely to have important technological implications for catalytic reactions of large molecules. - Graphical abstract: TEM images of the calcined mesoporous catalyst MSC{sub x} (x=1.1), in which no aggregated ZrO{sub 2} particles can be observed. The corresponding electron diffraction (insets in figures) indicated the final product was a mesoporous material with a crystalline framework.

  2. Facile Synthesis of Prussian Blue Derivate-Modified Mesoporous Material via Photoinitiated Thiol-Ene Click Reaction for Cesium Adsorption.

    PubMed

    Qian, Jun; Ma, Jiaqi; He, Weiwei; Hua, Daoben

    2015-08-01

    A novel strategy to synthesize a functional mesoporous material for efficient removal of cesium is reported. Specifically, Prussian blue derivate-modified SBA-15 (SBA-15@FC) was prepared by photoinitiated thiol-ene reaction between thiol-modified SBA-15 and pentacyano(4-vinyl pyridine)ferrate complex. The effects of weight percentage of the Prussian blue derivate, pH, adsorbent dose, co-existing ions, and initial concentration were evaluated on the adsorption of cesium ions. The adsorption kinetically follows a pseudo-second-order model and reaches equilibrium within 2 h with a high adsorption capacity of about 13.90 mg Cs g(-1) , which indicates that SBA-15@FC is a promising adsorbent to effectively remove cesium from aqueous solutions. PMID:25965318

  3. The surface of ordered mesoporous benzene-silica hybrid material: an infrared and ab initio molecular modeling study.

    PubMed

    Onida, Barbara; Borello, Luisa; Busco, Claudia; Ugliengo, Piero; Goto, Yasutomo; Inagaki, Shinji; Garrone, Edoardo

    2005-06-23

    Joint IR and computational results allow a detailed characterization of the surface properties of a mesoporous benzene-silica hybrid material with crystal-like wall structure. After outgassing at 450 degrees C, hydroxyl species mainly consist of noninteracting silanols, with both O-H and Si-O stretching modes at lower frequencies than those of SiOH in silica. Interaction with several probe molecules, followed both by experiment and calculus, shows that the aryl group in the coordination sphere of Si imparts a lesser acidity with respect to the isolated silanol in silica. In contrast, adsorption isotherms indicate that the interaction with acetone is stronger with benzene-silica than with silica: this is interpreted in terms of secondary interactions taking place between the slightly acidic CH in acetone and the electronic cloud in benzene-like rings. This suggests that both the inorganic component and the organic one play a role in dictating the surface behavior. PMID:16852474

  4. Parameters affecting the efficient delivery of mesoporous silica nanoparticle materials and gold nanorods into plant tissues by the biolistic method.

    PubMed

    Martin-Ortigosa, Susana; Valenstein, Justin S; Sun, Wei; Moeller, Lorena; Fang, Ning; Trewyn, Brian G; Lin, Victor S-Y; Wang, Kan

    2012-02-01

    Applying nanotechnology to plant science requires efficient systems for the delivery of nanoparticles (NPs) to plant cells and tissues. The presence of a cell wall in plant cells makes it challenging to extend the NP delivery methods available for animal research. In this work, research is presented which establishes an efficient NP delivery system for plant tissues using the biolistic method. It is shown that the biolistic delivery of mesoporous silica nanoparticle (MSN) materials can be improved by increasing the density of MSNs through gold plating. Additionally, a DNA-coating protocol is used based on calcium chloride and spermidine for MSN and gold nanorods to enhance the NP-mediated DNA delivery. Furthermore, the drastic improvement of NP delivery is demonstrated when the particles are combined with 0.6 μm gold particles during bombardment. The methodology described provides a system for the efficient delivery of NPs into plant cells using the biolistic method. PMID:22174078

  5. Synthesis and characterization of mesoporous ceria/alumina nanocomposite materials via mixing of the corresponding ceria and alumina gel precursors.

    PubMed

    Khalil, Kamal M S

    2007-03-01

    Mesoporous ceria/alumina, CeO(2)/Al(2)O(3), composites containing 10, 20 and 30% (w/w) ceria were prepared by a novel gel mixing method. In the method, ceria gel (formed via hydrolysis of ammonium cerium(IV) nitrate by aqueous ammonium carbonate solution) and alumina gel (formed via controlled hydrolysis of aluminum tri-isopropoxide) were mixed together. The mixed gel was subjected to subsequent drying and calcination for 3 h at 400, 600, 800 and 1000 degrees C. The uncalcined (dried at 110 degrees C) and the calcined composites were investigated by different techniques including TGA, DSC, FTIR, XRD, SEM and nitrogen adsorption/desorption isotherms. Results indicated that composites calcined for 3 h at 800 degrees C mainly kept amorphous alumina structure and gamma-alumina formed only upon calcinations at 1000 degrees C. On the other hand, CeO(2) was found to crystallize in the common ceria, cerinite, phase and it kept this structure over the entire calcination range (400-1000 degrees C). Therefore, high surface areas, stable surface textures, and non-aggregated nano-sized ceria dispersions were obtained. A systematic texture change based on ceria ratio was observed, however in all cases mesoporous composite materials exposing thermally stable texture and structure were obtained. The presented method produces composite ceria/alumina materials that suit different applications in the field of catalysis and membranes technology, and throw some light on physicochemical factors that determine textural morphology and thermal stability of such important composite. PMID:17182052

  6. Mesoporous carbons and polymers

    DOEpatents

    Bell, William; Dietz, Steven

    2001-01-01

    A mesoporous material prepared by polymerizing a resorcinol/formaldehyde system from an aqueous solution containing resorcinol, formaldehyde and a surfactant and optionally pyrolyzing the polymer to form a primarily carbonaceous solid. The material has an average pore size between 4 and 75 nm and is suitable for use in liquid-phase surface limited applications, including sorbent, catalytic, and electrical applications.

  7. Real Understanding of the Nitrogen-Doping Effect on the Electrochemical Performance of Carbon Materials by Using Carbon-Coated Mesoporous Silica as a Model Material.

    PubMed

    Castro-Muñiz, Alberto; Hoshikawa, Yasuto; Kasukabe, Takatoshi; Komiyama, Hiroshi; Kyotani, Takashi

    2016-03-01

    The main aim of the present work is to precisely understand the sole effect of nitrogen doping on the electrochemical performance of porous carbon materials. To achieve this objective, the whole surface of mesoporous silica (SBA-15) was coated with a thin layer of carbon (about 0.4 nm) with and without N-doping by using acetonitrile and acetylene chemical vapor deposition, respectively. The resulting N-doped and nondoped carbon-coated silica samples have mesopore structures identical to those in the original SBA-15, and they are practically the same in terms of not only the pore size and pore structure but also the particle size distribution and particle morphology, with the exception of N-doping, which makes them unique model materials to extract the sole effect of nitrogen on the performances of electrochemical capacitors and electrocatalytic oxygen reduction. Moreover, the outstanding features of the carbon-coated silica samples allow even a quantitative understanding of the pseudocapacitance induced by nitrogen functionalities on the carbon surface in an acidic aqueous electrolyte. PMID:26859703

  8. Adsorptive interaction of bisphenol A with mesoporous titanosilicate/reduced graphene oxide nanocomposite materials: FT-IR and Raman analyses.

    PubMed

    Nguyen-Huy, Chinh; Kim, Nayoung; Nguyen-Phan, Thuy-Duong; Yoo, Ik-Keun; Shin, Eun Woo

    2014-01-01

    Nanocomposite materials containing graphene oxide have attracted tremendous interest as catalysts and adsorbents for water purification. In this study, mesoporous titanosilicate/reduced graphene oxide composite materials with different Ti contents were employed as adsorbents for removing bisphenol A (BPA) from water systems. The adsorptive interaction between BPA and adsorption sites on the composite materials was investigated by Fourier transform infrared (FT-IR) and Raman spectroscopy. Adsorption capacities of BPA at equilibrium, q e (mg/g), decreased with increasing Ti contents, proportional to the surface area of the composite materials. FT-IR observations for fresh and spent adsorbents indicated that BPA adsorbed onto the composite materials by the electrostatic interaction between OH functional groups contained in BPA and on the adsorbents. The electrostatic adsorption sites on the adsorbents were categorized into three hydroxyl groups: Si-OH, Ti-OH, and graphene-OH. In Raman spectra, the intensity ratios of D to G band were decreased after the adsorption of BPA, implying adsorptive interaction of benzene rings of BPA with the sp(2) hybrid structure of the reduced graphene oxide. PMID:25258598

  9. Adsorptive interaction of bisphenol A with mesoporous titanosilicate/reduced graphene oxide nanocomposite materials: FT-IR and Raman analyses

    NASA Astrophysics Data System (ADS)

    Nguyen-Huy, Chinh; Kim, Nayoung; Nguyen-Phan, Thuy-Duong; Yoo, Ik-Keun; Woo Shin, Eun

    2014-09-01

    Nanocomposite materials containing graphene oxide have attracted tremendous interest as catalysts and adsorbents for water purification. In this study, mesoporous titanosilicate/reduced graphene oxide composite materials with different Ti contents were employed as adsorbents for removing bisphenol A (BPA) from water systems. The adsorptive interaction between BPA and adsorption sites on the composite materials was investigated by Fourier transform infrared (FT-IR) and Raman spectroscopy. Adsorption capacities of BPA at equilibrium, q e (mg/g), decreased with increasing Ti contents, proportional to the surface area of the composite materials. FT-IR observations for fresh and spent adsorbents indicated that BPA adsorbed onto the composite materials by the electrostatic interaction between OH functional groups contained in BPA and on the adsorbents. The electrostatic adsorption sites on the adsorbents were categorized into three hydroxyl groups: Si-OH, Ti-OH, and graphene-OH. In Raman spectra, the intensity ratios of D to G band were decreased after the adsorption of BPA, implying adsorptive interaction of benzene rings of BPA with the sp2 hybrid structure of the reduced graphene oxide.

  10. Hybrid nanostructured microporous carbon-mesoporous carbon doped titanium dioxide/sulfur composite positive electrode materials for rechargeable lithium-sulfur batteries

    NASA Astrophysics Data System (ADS)

    Zegeye, Tilahun Awoke; Kuo, Chung-Feng Jeffrey; Wotango, Aselefech Sorsa; Pan, Chun-Jern; Chen, Hung-Ming; Haregewoin, Atetegeb Meazah; Cheng, Ju-Hsiang; Su, Wei-Nien; Hwang, Bing-Joe

    2016-08-01

    Herein, we design hybrid nanostructured microporous carbon-mesoporous carbon doped titanium dioxide/sulfur composite (MC-Meso C-doped TiO2/S) as a positive electrode material for lithium-sulfur batteries. The hybrid MC-Meso C-doped TiO2 host material is produced by a low-cost, hydrothermal and annealing process. The resulting conductive material shows dual microporous and mesoporous behavior which enhances the effective trapping of sulfur and polysulfides. The hybrid MC-Meso C-doped TiO2/S composite material possesses rutile TiO2 nanotube structure with successful carbon doping while sulfur is uniformly distributed in the hybrid MC-Meso C-doped TiO2 composite materials after the melt-infusion process. The electrochemical measurement of the hybrid material also shows improved cycle stability and rate performance with high sulfur loading (61.04%). The material delivers an initial discharge capacity of 802 mAh g-1 and maintains it at 578 mAh g-1 with a columbic efficiency greater than 97.1% after 140 cycles at 0.1 C. This improvement is thought to be attributed to the unique hybrid nanostructure of the MC-Meso C-doped TiO2 host and the good dispersion of sulfur in the narrow pores of the MC spheres and the mesoporous C-doped TiO2 support.

  11. Hybrid nanostructured microporous carbon-mesoporous carbon doped titanium dioxide/sulfur composite positive electrode materials for rechargeable lithium-sulfur batteries

    NASA Astrophysics Data System (ADS)

    Zegeye, Tilahun Awoke; Kuo, Chung-Feng Jeffrey; Wotango, Aselefech Sorsa; Pan, Chun-Jern; Chen, Hung-Ming; Haregewoin, Atetegeb Meazah; Cheng, Ju-Hsiang; Su, Wei-Nien; Hwang, Bing-Joe

    2016-08-01

    Herein, we design hybrid nanostructured microporous carbon-mesoporous carbon doped titanium dioxide/sulfur composite (MC-Meso C-doped TiO2/S) as a positive electrode material for lithium-sulfur batteries. The hybrid MC-Meso C-doped TiO2 host material is produced by a low-cost, hydrothermal and annealing process. The resulting conductive material shows dual microporous and mesoporous behavior which enhances the effective trapping of sulfur and polysulfides. The hybrid MC-Meso C-doped TiO2/S composite material possesses rutile TiO2 nanotube structure with successful carbon doping while sulfur is uniformly distributed in the hybrid MC-Meso C-doped TiO2 composite materials after the melt-infusion process. The electrochemical measurement of the hybrid material also shows improved cycle stability and rate performance with high sulfur loading (61.04%). The material delivers an initial discharge capacity of 802 mAh g-1 and maintains it at 578 mAh g-1 with a columbic efficiency greater than 97.1% after 140 cycles at 0.1 C. This improvement is thought to be attributed to the unique hybrid nanostructure of the MC-Meso C-doped TiO2 host and the good dispersion of sulfur in the narrow pores of the MC spheres and the mesoporous C-doped TiO2 support.

  12. Method of dehydroxylating a hydroxylated material and method of making a mesoporous film

    DOEpatents

    Domansky, Karel [Richland, WA; Fryxell, Glen E [Kennewick, WA; Liu, Jun [West Richland, WA; Kohler, Nathan J [Richland, WA; Baskaran, Suresh [Kennewick, WA

    2002-05-07

    The present invention is a method of dehydroxylating a silica surface that is hydroxylated having the steps of exposing the silica surface separately to a silicon organic compound and a dehydroxylating gas. Exposure to the silicon organic compound can be in liquid, gas or solution phase, and exposure to a dehydroxylating gas is typically at elevated temperatures. In one embodiment, the improvement of the dehydroxylation procedure is the repetition of the soaking and dehydroxylating gas exposure. In another embodiment, the improvement is the use of an inert gas that is substantially free of hydrogen. In yet another embodiment, the present invention is the combination of the two-step dehydroxylation method with a surfactant templating method of making a mesoporous film.

  13. Enhanced electrochemical performance of mesoporous NiCo2O4 as an excellent supercapacitive alternative energy storage material

    NASA Astrophysics Data System (ADS)

    Bhojane, Prateek; Sen, Somaditya; Shirage, Parasharam M.

    2016-07-01

    Here we report the supercapacitive properties of mesoporous nickel cobalt oxide (NiCo2O4) synthesized by fast, inexpensive and facile chemical bath method, by avoiding high pressure, high temperature and chemical complexity. Physico-chemical characterization techniques such as X-ray diffraction (XRD), field-emission scanning electron microscopy (FESEM), high-resolution transmission electron microscopy (HRTEM), Raman Spectra, and nitrogen adsorption-desorption isotherm analysis is performed to characterize the electrode material. Brunauer-Emmett-Teller (BET) measurements reveal the surface area 52.86 m2 g-1 and from Barrett-Joyner-Halenda (BJH), typical pores size ranges between 10 and 50 nm, also confirms the mesoporosity. The electrochemical properties are measured by cyclic voltammetry, electrochemical impedance spectroscopy and galvanostatic charging/discharging. The synthesized material exhibits remarkably enhanced electrochemical performance with specific capacitance of 1130 F g-1 at 1 mV s-1 sweep rate and 1125 F g-1 at current density of 0.05 A g-1, highest without supporting base like carbon cloth, Ni-foam, Ti- foil used for direct growth (deposition) of electrode material. It is superior to those of its individual and hybrid components prepared by similar technique. Ragone plot shows high specific energy density (49.25 Wh kg-1) and corresponding specific power density (1851.31 W kg-1) even at high current density of 0.5 A g-1.

  14. Investigation of the physicochemical aspects from natural kaolin to Al-MCM-41 mesoporous materials.

    PubMed

    Du, Chunfang; Yang, Huaming

    2012-03-01

    Aluminum-containing hexagonally ordered mesoporous silica Al-MCM-41 was synthesized by hydrothermal treatment of leached products produced by pre-grinding and subsequent acid leaching of natural kaolin, without addition of silica or aluminum regents. The resulting Al-MCM-41 had a high surface area of 1041 m(2)/g, a pore volume of 0.97 mL/g, and an average pore diameter of 3.7 nm with narrow pore size distribution centered at 2.7 nm. During the synthesis process of Al-MCM-41 from natural kaolin, the evolutions of chemical environments for Si and Al atoms should be emphasized. Wide angle X-ray diffraction (WAXRD), high-resolution transmission electron micrographs (HRTEMs), solid-state magic-angle-spinning nuclear magnetic resonance (MAS NMR), Fourier transform infrared spectroscopy (FT-IR) were used to trace the variations of chemical structures. Pretreatment of grinding and subsequent acid leaching acted as an important role in the whole synthesis process. NMR spectroscopy showed that Q(3) structure (Si(SiO)(3)(OH)), condensed Q(4) framework structure (Si(SiO)(4)), also the octahedral and tetrahedral Al existed in the leached sample and Al-MCM-41, with higher chemical contents of Q(4) structure and the octahedral Al in final product Al-MCM-41 than those in the leached sample. A possible mechanism for the formation of Al-MCM-41 from natural kaolin was suggested. PMID:22226501

  15. Bimodal mesoporous silica with bottleneck pores.

    PubMed

    Reber, M J; Brühwiler, D

    2015-11-01

    Bimodal mesoporous silica consisting of two sets of well-defined mesopores is synthesized by a partial pseudomorphic transformation of an ordered mesoporous starting material (SBA-15 type). The introduction of a second set of smaller mesopores (MCM-41 type) establishes a pore system with bottlenecks that restricts the access to the core of the bimodal mesoporous silica particles. The particle size and shape of the starting material are retained, but micropores present in the starting material disappear during the transformation, leading to a true bimodal mesoporous product. A varying degree of transformation allows the adjustment of the pore volume contribution of the two mesopore domains. Information on the accessibility of the mesopores is obtained by the adsorption of fluorescence-labeled poly(amidoamine) dendrimers and imaging by confocal laser scanning microscopy. This information is correlated with nitrogen sorption data to provide insights regarding the spatial distribution of the two mesopore domains. The bimodal mesoporous materials are excellent model systems for the investigation of cavitation effects in nitrogen desorption isotherms. PMID:26399172

  16. Fabrication of multiwalled carbon nanotubes in the channels of iron loaded three dimensional mesoporous material by catalytic chemical vapour deposition technique

    NASA Astrophysics Data System (ADS)

    Somanathan, T.; Gokulakrishnan, N.; Chandrasekar, G.; Pandurangan, A.

    2011-01-01

    The growth of multiwalled carbon nanotubes (MWNTs) was successfully achieved in the channels of three dimensional (3D) iron loaded mesoporous matrices (KIT-6) by employing catalytic chemical vapour deposition (CCVD) technique. The synthesised MWNTs, which were characterised by SEM, TEM and Raman spectroscopy, consist of thick graphene layers of about 10 nm composed of 29 graphene sheets with inner and outer diameter of ∼17 nm and ∼37 nm, respectively. The Raman spectrum showed the formation of well-graphitised MWNTs with significantly higher IG/ID ratio of 1.47 compared to commercial MWNTs. Comparatively, 2 wt% Fe loaded KIT-6 material produced a better yield of 91%, which is also highest compared with the report of MWNTs synthesis using mesoporous materials reported so far.

  17. Immobilization of Lactobacillus rhamnosus in mesoporous silica-based material: An efficiency continuous cell-recycle fermentation system for lactic acid production.

    PubMed

    Zhao, Zijian; Xie, Xiaona; Wang, Zhi; Tao, Yanchun; Niu, Xuedun; Huang, Xuri; Liu, Li; Li, Zhengqiang

    2016-06-01

    Lactic acid bacteria immobilization methods have been widely used for lactic acid production. Until now, the most common immobilization matrix used is calcium alginate. However, Ca-alginate gel disintegrated during lactic acid fermentation. To overcome this deficiency, we developed an immobilization method in which Lactobacillus rhamnosus cells were successfully encapsulated into an ordered mesoporous silica-based material under mild conditions with a high immobilization efficiency of 78.77% by using elemental analysis. We also optimized the cultivation conditions of the immobilized L. rhamnosus and obtained a high glucose conversion yield of 92.4%. Furthermore, L. rhamnosus encapsulated in mesoporous silica-based material exhibited operational stability during repeated fermentation processes and no decrease in lactic acid production up to 8 repeated batches. PMID:26803707

  18. Processed Lignin as a Byproduct of the Generation of 5-(Chloromethyl)furfural from Biomass: A Promising New Mesoporous Material.

    PubMed

    Budarin, Vitaliy L; Clark, James H; Henschen, Jonatan; Farmer, Thomas J; Macquarrie, Duncan J; Mascal, Mark; Nagaraja, Gundibasappa K; Petchey, Tabitha H M

    2015-12-21

    The lignin by-product of the conversion of lignocellulosic biomass to 5-(chloromethyl)furfural (CMF) has been characterised by thermogravimetric analysis, N2 physisorption porosimetry, attenuated internal reflectance IR spectroscopy, elemental analysis and solid-state NMR spectroscopy. The lignin (LCMF) has a moderate level of mesoporosity before thermal treatment and a surface area of 63 m(2)  g(-1) , which increases dramatically on pyrolysis at temperatures above 400 °C. An assessment of the functionality and textural properties of the material was achieved by analysing LCMF treated thermally over a range of pyrolysis temperatures. Samples were sulfonated to test their potential as heterogeneous acid catalysts in the esterification of levulinic acid. It was shown that unpyrolysed catalysts gave the highest ester yields of up to 93 %. To the best of our knowledge, this is the first example of mesoporous lignin with an appreciable surface area that is produced directly from a bio-refinery process and with further textural modification of the material demonstrated. PMID:26601798

  19. Multifunctional hybrid organic-inorganic catalytic materials with a hierarchical system of well-defined micro- and mesopores.

    PubMed

    Corma, Avelino; Díaz, Urbano; García, Teresa; Sastre, Germán; Velty, Alexandra

    2010-10-27

    Novel layered zeolitic organic-inorganic materials (MWW-BTEB) have been synthesized by intercalation and stabilization of arylic silsesquioxane molecules between inorganic zeolitic MWW layers. The organic linkers are conformed by two condensed silyl-arylic groups from disilane molecules, such as 1,4-bis(triethoxysilyl)benzene (BTEB), which react with the external silanol groups of the zeolitic layers. The hybrids contain micropores within the inorganic layers and a well-defined mesoporous system in between the organic linkers. An amination post-treatment introduces basic groups in the organic linkers close to the acid sites present in the structural inorganic counterpart. Through this methodology it has been possible to prepare bifunctional acid-base catalysts where the acid sites are of zeolitic nature located in the inorganic building blocks and the basic sites are part of the organic structure. The resultant materials can act as bifunctional catalysts for performing a two-step cascade reaction that involves the catalytic conversion of benzaldehyde dimethylacetal into benzylidene malononitrile. PMID:20879788

  20. Mesoporous Silica: A Suitable Adsorbent for Amines

    PubMed Central

    2009-01-01

    Mesoporous silica with KIT-6 structure was investigated as a preconcentrating material in chromatographic systems for ammonia and trimethylamine. Its adsorption capacity was compared to that of existing commercial materials, showing its increased adsorption power. In addition, KIT-6 mesoporous silica efficiently adsorbs both gases, while none of the employed commercial adsorbents did. This means that KIT-6 Mesoporous silica may be a good choice for integrated chromatography/gas sensing micro-devices. PMID:20628459

  1. Preparation and physical characterization of calcium sulfate cement/silica-based mesoporous material composites for controlled release of BMP-2

    PubMed Central

    Tan, Honglue; Yang, Shengbing; Dai, Pengyi; Li, Wuyin; Yue, Bing

    2015-01-01

    As a commonly used implant material, calcium sulfate cement (CSC), has some shortcomings, including low compressive strength, weak osteoinduction capability, and rapid degradation. In this study, silica-based mesoporous materials such as SBA-15 were synthesized and combined with CSC to prepare CSC/SBA-15 composites. The properties of SBA-15 were characterized by X-ray diffraction, transmission electron microscopy, and nitrogen adsorption–desorption isotherms. SBA-15 was blended into CSC at 0, 5, 10, and 20 wt%, referred to as CSC, CSC-5S (5% mass ratio), CSC-10S (10% mass ratio), and CSC-20S (20% mass ratio), respectively. Fourier-transform infrared spectroscopy and compression tests were used to determine the structure and mechanical properties of the composites, respectively. The formation of hydroxyapatite on composite surfaces was analyzed using scanning electron microscopy and X-ray diffraction after soaking in simulated body fluid. BMP-2 was loaded into the composites by vacuum freeze-drying, and its release characteristics were detected by Bradford protein assay. The in vitro degradation of the CSC/SBA-15 composite was investigated by measuring weight loss. The results showed that the orderly, nanostructured, mesoporous SBA-15 possessed regular pore size and structure. The compressive strength of CSC/SBA-15 increased with the increase in SBA-15 mass ratio, and CSC-20S demonstrated the maximum strength. Compared to CSC, hydroxyapatite that formed on the surfaces of CSC/SBA-15 was uniform and compact. The degradation rate of CSC/SBA-15 decreased with increasing mass ratio of SBA-15. The adsorption of BMP-2 increased and released at a relatively slow rate; the release rate of BMP-2 in CSC-20S was the slowest, and presented characteristics of low doses of release. In vitro experiments demonstrated that the physical properties of pure CSC incorporated with SBA-15 could be improved significantly, which made the CSC/SBA-15 composite more suitable for bone repair

  2. Preparation and physical characterization of calcium sulfate cement/silica-based mesoporous material composites for controlled release of BMP-2.

    PubMed

    Tan, Honglue; Yang, Shengbing; Dai, Pengyi; Li, Wuyin; Yue, Bing

    2015-01-01

    As a commonly used implant material, calcium sulfate cement (CSC), has some shortcomings, including low compressive strength, weak osteoinduction capability, and rapid degradation. In this study, silica-based mesoporous materials such as SBA-15 were synthesized and combined with CSC to prepare CSC/SBA-15 composites. The properties of SBA-15 were characterized by X-ray diffraction, transmission electron microscopy, and nitrogen adsorption-desorption isotherms. SBA-15 was blended into CSC at 0, 5, 10, and 20 wt%, referred to as CSC, CSC-5S (5% mass ratio), CSC-10S (10% mass ratio), and CSC-20S (20% mass ratio), respectively. Fourier-transform infrared spectroscopy and compression tests were used to determine the structure and mechanical properties of the composites, respectively. The formation of hydroxyapatite on composite surfaces was analyzed using scanning electron microscopy and X-ray diffraction after soaking in simulated body fluid. BMP-2 was loaded into the composites by vacuum freeze-drying, and its release characteristics were detected by Bradford protein assay. The in vitro degradation of the CSC/SBA-15 composite was investigated by measuring weight loss. The results showed that the orderly, nanostructured, mesoporous SBA-15 possessed regular pore size and structure. The compressive strength of CSC/SBA-15 increased with the increase in SBA-15 mass ratio, and CSC-20S demonstrated the maximum strength. Compared to CSC, hydroxyapatite that formed on the surfaces of CSC/SBA-15 was uniform and compact. The degradation rate of CSC/SBA-15 decreased with increasing mass ratio of SBA-15. The adsorption of BMP-2 increased and released at a relatively slow rate; the release rate of BMP-2 in CSC-20S was the slowest, and presented characteristics of low doses of release. In vitro experiments demonstrated that the physical properties of pure CSC incorporated with SBA-15 could be improved significantly, which made the CSC/SBA-15 composite more suitable for bone repair

  3. Synthesis of proton conducting mesoporous materials and composite membranes for high temperature proton exchange membrane (PEM) fuel cells

    NASA Astrophysics Data System (ADS)

    Feng, Fangxia

    Tungstosilicate mesoporous materials (WMM) were synthesized using the ionic surfactant cetyltrimethylammonium bromide (C16H33N +(CH3)3Br- CTMABr) and non-ionic surfactants, including C12H25(OCH2CH 2)10OH (Brij 22, C12EO10OH), C 16H33(OCH2CH2)10OH (Brij 56, C16EO10OH), and C18H37(OCH 2CH2)10OH (Brij 76, C18EO10OH). The proton conductivities were measured by AC impedance spectroscopy. Using CTMABr, the highest W/Si ratio achieved for the molecular sieve product was 0.03. The conductivity ranged from 0.5 to 2.2 x 10-2 S/cm, where the highest conductivity was observed with the H3PO 4 based preparation. Non-ionic surfactants produced materials with a W/Si ratio as high as 0.05 without any dense WO3 impurities. These samples showed thicker pore walls (39A), higher thermal stability, and higher proton conductivity (4.0 x 10-2 S/cm). The WMMs were also employed to make a composite membrane with linear polyethyleneimine (PEI), 3-glycidoxypropyltrimethoxysilane (GLYMO), bis(trifluoromethanesulfonyl)imide (HTFSI). At 100°C and 100% relative humidity, the composite membrane with 30 wt.% calcined (at 500°C) WMM showed the highest conductivity of 6.1 x 10-2 S/cm. At 130°C and 20% relative humidity, the highest conductivity of 6.4 x 10-3 S/cm was obtained for the composite membrane with 30 wt.% as-synthesized WMM. Transparent free-standing mesoporous silica (MS) films were synthesized from a system of TMOS-Brij-Acid-H2O. The non-ionic surfactants used included Brij 22 (Cl2EO10OH), Brij 56 (C16EO 10OH), and Brij 76 (C18EO10OH). The acids used include HCl, H3PO4, and CF3SO3H. The effect of synthesis parameters on the synthesis and the proton conductivity of mesoporous silica were investigated. The Brij 56/CF3SO 3H based product showed the highest conductivity of 6.5 x 10 -2 S/cm at room temperature. Composite was prepared by combing TMOS, Brij surfactant, acid (HCl, H3PO4, or CF 3SO3H), N-[3-(trimethoxysilyl)propyl]-ethylenediamine (EDATMS), 3-glycidoxypropylmethoxysilane (GLYMO

  4. Mesoporous aluminum phosphite

    SciTech Connect

    El Haskouri, Jamal; Perez-Cabero, Monica; Guillem, Carmen; Latorre, Julio; Beltran, Aurelio; Beltran, Daniel; Amoros, Pedro

    2009-08-15

    High surface area pure mesoporous aluminum-phosphorus oxide-based derivatives have been synthesized through an S{sup +}I{sup -} surfactant-assisted cooperative mechanism by means of a one-pot preparative procedure from aqueous solution and starting from aluminum atrane complexes and phosphoric and/or phosphorous acids. A soft chemical extraction procedure allows opening the pore system of the parent as-prepared materials by exchanging the surfactant without mesostructure collapse. The nature of the pore wall can be modulated from mesoporous aluminum phosphate (ALPO) up to total incorporation of phosphite entities (mesoporous aluminum phosphite), which results in a gradual evolution of the acidic properties of the final materials. While phosphate groups in ALPO act as network building blocks (bridging Al atoms), the phosphite entities become basically attached to the pore surface, what gives practically empty channels. The mesoporous nature of the final materials is confirmed by X-ray diffraction (XRD), transmission electron microscopy (TEM) and N{sub 2} adsorption-desorption isotherms. The materials present regular unimodal pore systems whose order decreases as the phosphite content increases. NMR spectroscopic results confirm the incorporation of oxo-phosphorus entities to the framework of these materials and also provide us useful information concerning the mechanism through which they are formed. - Abstract: TEM image of the mesoporous aluminum phosphite showing the hexagonal disordered pore array that is generated by using surfactant micelles as template. Also a scheme emphasizing the presence of an alumina-rich core and an ALPO-like pore surface is presented.

  5. The effects of surface chemistry of mesoporous silica materials and solution pH on kinetics of molsidomine adsorption

    SciTech Connect

    Dolinina, E.S.; Parfenyuk, E.V.

    2014-01-15

    Adsorption kinetics of molsidomine on mesoporous silica material (UMS), the phenyl- (PhMS) and mercaptopropyl-functionalized (MMS) derivatives from solution with different pH and 298 K was studied. The adsorption kinetics was found to follow the pseudo-second-order kinetic model for all studied silica materials and pH. Effects of surface functional groups and pH on adsorption efficiency and kinetic adsorption parameters were investigated. At all studied pH, the highest molsidomine amount is adsorbed on PhMS due to π–π interactions and hydrogen bonding between surface groups of PhMS and molsidomine molecules. An increase of pH results in a decrease of the amounts of adsorbed molsidomine onto the silica materials. Furthermore, the highest adsorption rate kinetically evaluated using a pseudo-second-order model, is observed onto UMS and it strongly depends on pH. The mechanism of the adsorption process was determined from the intraparticle diffusion and Boyd kinetic film–diffusion models. The results showed that the molsidomine adsorption on the silica materials is controlled by film diffusion. Effect of pH on the diffusion parameters is discussed. - Graphical abstract: The kinetic study showed that the k{sub 2} value, the rate constant of pseudo-second order kinetic model, is the highest for molsidomine adsorption on UMS and strongly depends on pH because it is determined by availability and accessibility of the reaction sites of the adsorbents molsidomine binding. Display Omitted - Highlights: • The adsorption capacities of UMS, PhMS and MMS were dependent on the pH. • At all studied pH, the highest molsidomine amount is adsorbed on PhMS. • The highest adsorption rate, k{sub 2}, is observed onto UMS and strongly depends on pH. • Film diffusion was the likely rate-limiting step in the adsorption process.

  6. A simple, template-free route for the synthesis of bicrystalline mesoporous TiO2 materials.

    PubMed

    Su, Zhili; Yang, Chun

    2009-11-01

    A simple, low-temperature and green template-free synthetic route has been used to prepare mesoporous TiO2 with anatase and brookite bicrystalline framework. This route combines a quick hydrolysis at ambient temperature and sequent hydrothermal treatment at 80-180 egrees C without further calcination. The resultant materials were characterized by XRD, TEM and nitrogen adsorption. It was found that the wormhole-like mesostructure and the bicrystalline framework could be formed in the hydrothermal treatment, and high surface areas of 160-250 m2 x g(-1) could be obtained due to the avoidance of calcination at high temperature. The effect of hydrothermal temperature on mesoporosity and crystallinity was also investigated and discussed. The as-prepared TiO2 samples exhibited higher photocatalytic activities than pure anatase TiO2 and corresponding calcined samples in the degradation of methyl orange, which can be attributed to the combined effect of composite crystalline phase and high surface area. PMID:19908583

  7. Influence of methanol on the phase behavior of nonionic fluorinated surfactant: relation to the structure of mesoporous silica materials.

    PubMed

    Zimny, K; Blin, J L; Stébé, M J

    2009-02-15

    We have investigated the effect of methanol addition on the R(F)(8)(EO)(9) and R(F)(7)(EO)(8) surfactant-based systems. While upon the addition of methanol the L(1) micellar phase grows, the direct hexagonal (H(1)) and the lamellar (L(alpha)) liquid crystals progressively melt with the increase of alcohol content. Phase behavior and SAXS measurements proved that methanol molecules interact with the oxyethylene units of the surfactant. This involves a folding up of the hydrophobic chains in the liquid crystal phases. Moreover, for the R(F)(7)(EO)(8) surfactant, the cloud point curve is shifted to high temperatures upon addition of alcohol. Starting from these systems, we have prepared mesoporous materials. Results show that due to the hydrogen bonds between the alcohol and the EO groups, the hexagonal structure of the mesostructured silica obtained from R(F)(8)(EO)(9) is lost when the content of CH(3)OH is increased. In contrast, for the compounds prepared from the R(F)(7)(EO)(8)-based system, the pore ordering occurs in the presence of alcohol. This phenomenon has been related to the moving of the cloud point curve toward high temperatures with the addition of methanol. Our study reveals also that under our conditions the methanol released during the hydrolysis of the silica precursor does not affect the self-assembly mechanism in a positive or negative way. PMID:19058809

  8. Hydrophilic modification of silica-titania mesoporous materials as restricted-access matrix adsorbents for enrichment of phosphopeptides.

    PubMed

    Wang, Fei; Guan, Yafeng; Zhang, Sen; Xia, Yan

    2012-07-13

    A new nano-scale restricted-access matrix (RAM) SiO₂ (MCM-41) with relatively high Ti-content (Ti/Si=0.1), but superior surface area (1129 m²/g), was successfully synthesised for the enrichment of phosphopeptides. The TiO₂ was incorporated into the Si-MCM-41 via a hydrothermal process and the external surface was modified with alkyl diol by the successive hydrolysis of γ-(glycidyloxypropyl) trimethoxysilane (GPTMS). Scanning electron microscopy, transmission electron microscopy, N₂ adsorption and Fourier transform infrared spectroscopy were used to characterise the alkyl diol-Ti-MCM-41. The appropriate pore diameter (2 nm) coupled to the marshy weeds-like hydrophilic external surface result in an efficient size-exclusion effect for the adsorption of standard cytochrome c with a molecular weight (MW) of ca. 12.4 kDa. At the same time, the strong affinity interaction between the incorporated titanium in the framework and the phosphoryl groups of phosphopeptides demonstrated a selective extract of phosphopeptides from the tryptic digestion. The detection sensitivity for phosphopeptides, determined by matrix-assisted laser desorption/ionisation time-of-flight mass spectrometry (MALDI-TOF MS) was as low as 5 fmol for standard tryptic digest of β-casein. Therefore, this alkyl diol-Ti-MCM-41 mesoporous material can be used as a potential adsorbent for applications in MS-based phosphoproteomics. PMID:22410151

  9. Tailoring the nano-channel of ZrO 2/SBA-15 mesoporous materials for efficiently trapping and degradation volatile nitrosamines

    NASA Astrophysics Data System (ADS)

    Shi, Liying; Chu, Sheng; Kong, Fei; Luo, Leilei; Wang, Ying; Zou, Zhigang

    2011-12-01

    This article reports a bifunctionalized mesoporous ZrO 2/SBA-15 materials prepared through a simplified one-pot synthesis, in which the aged sample was evaporated with mother solution under the self-adjusted pH condition. The results of low-angle XRD, HRTEM, nitrogen adsorption-desorption, in-situ 1H NMR and NH 3-TPD tests confirmed the well-ordered hexagonal structure and large pore size of these composites along with the newly formed acidity and basicity. Temperature programmed surface reaction (TPSR) was employed to assess the catalytic function of ZrO 2/SBA-15 composites on the degradation of carcinogenic volatile nitrosamines such as N-nitrosopyrrolidine (NPYR). Due to the special interaction between the N-NO group of nitrosamines and the acidic site of mesoporous composite, NPYR could be efficiently trapped and then catalytic degraded at lower temperature, which enables this functional composite to be a new candidate for environment protection.

  10. Cellular membrane trafficking of mesoporous silica nanoparticles

    SciTech Connect

    Fang, I-Ju

    2012-01-01

    This dissertation mainly focuses on the investigation of the cellular membrane trafficking of mesoporous silica nanoparticles. We are interested in the study of endocytosis and exocytosis behaviors of mesoporous silica nanoparticles with desired surface functionality. The relationship between mesoporous silica nanoparticles and membrane trafficking of cells, either cancerous cells or normal cells was examined. Since mesoporous silica nanoparticles were applied in many drug delivery cases, the endocytotic efficiency of mesoporous silica nanoparticles needs to be investigated in more details in order to design the cellular drug delivery system in the controlled way. It is well known that cells can engulf some molecules outside of the cells through a receptor-ligand associated endocytosis. We are interested to determine if those biomolecules binding to cell surface receptors can be utilized on mesoporous silica nanoparticle materials to improve the uptake efficiency or govern the mechanism of endocytosis of mesoporous silica nanoparticles. Arginine-glycine-aspartate (RGD) is a small peptide recognized by cell integrin receptors and it was reported that avidin internalization was highly promoted by tumor lectin. Both RGD and avidin were linked to the surface of mesoporous silica nanoparticle materials to investigate the effect of receptor-associated biomolecule on cellular endocytosis efficiency. The effect of ligand types, ligand conformation and ligand density were discussed in Chapter 2 and 3. Furthermore, the exocytosis of mesoporous silica nanoparticles is very attractive for biological applications. The cellular protein sequestration study of mesoporous silica nanoparticles was examined for further information of the intracellular pathway of endocytosed mesoporous silica nanoparticle materials. The surface functionality of mesoporous silica nanoparticle materials demonstrated selectivity among the materials and cancer and normal cell lines. We aimed to determine

  11. Mesoporous carbon-coated LiFePO4 nanocrystals co-modified with graphene and Mg2+ doping as superior cathode materials for lithium ion batteries

    NASA Astrophysics Data System (ADS)

    Wang, Bo; Xu, Binghui; Liu, Tiefeng; Liu, Peng; Guo, Chenfeng; Wang, Shuo; Wang, Qiuming; Xiong, Zhigang; Wang, Dianlong; Zhao, X. S.

    2013-12-01

    In this work, mesoporous carbon-coated LiFePO4 nanocrystals further co-modified with graphene and Mg2+ doping (G/LFMP) were synthesized by a modified rheological phase method to improve the speed of lithium storage as well as cycling stability. The mesoporous structure of LiFePO4 nanocrystals was designed and realized by introducing the bead milling technique, which assisted in forming sucrose-pyrolytic carbon nanoparticles as the template for generating mesopores. For comparison purposes, samples modified only with graphene (G/LFP) or Mg2+ doping (LFMP) as well as pure LiFePO4 (LFP) were also prepared and investigated. Microscopic observation and nitrogen sorption analysis have revealed the mesoporous morphologies of the as-prepared composites. X-ray diffraction (XRD) and Rietveld refinement data demonstrated that the Mg-doped LiFePO4 is a single olivine-type phase and well crystallized with shortened Fe-O and P-O bonds and a lengthened Li-O bond, resulting in an enhanced Li+ diffusion velocity. Electrochemical properties have also been investigated after assembling coin cells with the as-prepared composites as the cathode active materials. Remarkably, the G/LFMP composite has exhibited the best electrochemical properties, including fast lithium storage performance and excellent cycle stability. That is because the modification of graphene provided active sites for nuclei, restricted the in situ crystallite growth, increased the electronic conductivity and reduced the interface reaction current density, while, Mg2+ doping improved the intrinsically electronic and ionic transfer properties of LFP crystals. Moreover, in the G/LFMP composite, the graphene component plays the role of ``cushion'' as it could quickly realize capacity response, buffering the impact to LFMP under the conditions of high-rate charging or discharging, which results in a pre-eminent rate capability and cycling stability.In this work, mesoporous carbon-coated LiFePO4 nanocrystals further co

  12. Mesoporous carbon-coated LiFePO4 nanocrystals co-modified with graphene and Mg2+ doping as superior cathode materials for lithium ion batteries.

    PubMed

    Wang, Bo; Xu, Binghui; Liu, Tiefeng; Liu, Peng; Guo, Chenfeng; Wang, Shuo; Wang, Qiuming; Xiong, Zhigang; Wang, Dianlong; Zhao, X S

    2014-01-21

    In this work, mesoporous carbon-coated LiFePO4 nanocrystals further co-modified with graphene and Mg(2+) doping (G/LFMP) were synthesized by a modified rheological phase method to improve the speed of lithium storage as well as cycling stability. The mesoporous structure of LiFePO4 nanocrystals was designed and realized by introducing the bead milling technique, which assisted in forming sucrose-pyrolytic carbon nanoparticles as the template for generating mesopores. For comparison purposes, samples modified only with graphene (G/LFP) or Mg(2+) doping (LFMP) as well as pure LiFePO4 (LFP) were also prepared and investigated. Microscopic observation and nitrogen sorption analysis have revealed the mesoporous morphologies of the as-prepared composites. X-ray diffraction (XRD) and Rietveld refinement data demonstrated that the Mg-doped LiFePO4 is a single olivine-type phase and well crystallized with shortened Fe-O and P-O bonds and a lengthened Li-O bond, resulting in an enhanced Li(+) diffusion velocity. Electrochemical properties have also been investigated after assembling coin cells with the as-prepared composites as the cathode active materials. Remarkably, the G/LFMP composite has exhibited the best electrochemical properties, including fast lithium storage performance and excellent cycle stability. That is because the modification of graphene provided active sites for nuclei, restricted the in situ crystallite growth, increased the electronic conductivity and reduced the interface reaction current density, while, Mg(2+) doping improved the intrinsically electronic and ionic transfer properties of LFP crystals. Moreover, in the G/LFMP composite, the graphene component plays the role of "cushion" as it could quickly realize capacity response, buffering the impact to LFMP under the conditions of high-rate charging or discharging, which results in a pre-eminent rate capability and cycling stability. PMID:24287590

  13. Pore Size Effect on Methane Adsorption in Mesoporous Silica Materials Studied by Small-Angle Neutron Scattering.

    PubMed

    Chiang, Wei-Shan; Fratini, Emiliano; Baglioni, Piero; Chen, Jin-Hong; Liu, Yun

    2016-09-01

    Methane adsorption in model mesoporous silica materials with the size range characteristic of shale is studied by small-angle neutron scattering (SANS). Size effect on the temperature-dependent gas adsorption at methane pressure about 100 kPa is investigated by SANS using MCM-41 and SBA-15 as adsorbents. Above the gas-liquid condensation temperature, the thickness of the adsorption layer is found to be roughly constant as a function of the temperature. Moreover, the gas adsorption properties, such as the adsorbed layer thickness and the specific amount of adsorbed gas, have little dependence on the pore size being studied, i.e., pore radius of 16.5 and 34.1 Å, but are mainly affected by the roughness of the pore surfaces. Hence, the surface properties of the pore wall are more dominant than the pore size in determining the methane gas adsorption of pores at the nanometer size range. Not surprisingly, the gas-liquid condensation temperature is observed to be sensitive to pore size and shifts to higher temperature when the pore size is smaller. Below the gas-liquid condensation temperature, even though the majority of gas adsorption experiments/simulations have assumed the density of confined liquid to be the same as the bulk density, the measured methane mass density in our samples is found to be appreciably smaller than the bulk methane density regardless of the pore sizes studied here. The mass density of liquid/solid methane in pores with different sizes shows different temperature dependence below the condensation temperature. With decreasing temperature, the methane density in larger pores (SBA-15) abruptly increases at approximately 65 K and then plateaus. In contrast, the density in smaller pores (MCM-41) monotonically increases with decreasing temperature before reaching a plateau at approximately 30 K. PMID:27512895

  14. A highly ordered cubic mesoporous silica/graphene nanocomposite.

    PubMed

    Lee, Chang-Wook; Roh, Kwang Chul; Kim, Kwang-Bum

    2013-10-21

    A highly ordered cubic mesoporous silica (KIT-6)/graphene nanocomposite and 2D KIT-6 nanoflakes were synthesized using a novel synthesis methodology. The non-ionic triblock copolymer, P123, played a dual role as a structure-directing agent in the formation of the cubic mesoporous structure and as a cross-linking agent between mesoporous silica and graphene. The prepared (KIT-6)/graphene nanocomposite could act as a template for the preparation of mesoporous material/graphene nanocomposites. PMID:24057016

  15. Self-Assembled Sandwich-like Vanadium Oxide/Graphene Mesoporous Composite as High-Capacity Anode Material for Lithium Ion Batteries.

    PubMed

    Wang, Xingchao; Huang, Yudai; Jia, Dianzeng; Pang, Wei Kong; Guo, Zaiping; Du, Yaping; Tang, Xincun; Cao, Yali

    2015-12-21

    Sandwich-like V2O5/graphene mesoporous composite has been synthesized by a facile solvothermal approach. The crystalline structure, morphology, and electrochemical performance of the as-prepared materials have been investigated in detail. The results demonstrate that the 30-50 nm V2O5 particles are homogeneously anchored on conducting graphene sheets, which allow the V2O5 nanoparticles to be wired up to a current collector through the underlying conducting graphene layers. As an anode material for lithium ion batteries, the composite exhibits a high reversible capacity of 1006 mAh g(-1) at a current density of 0.5 A g(-1) after 300 cycles. It also exhibits excellent rate performance with a discharge capacity of 500 mAh g(-1) at the current density of 3.0 A g(-1), which is superior to the performance of the vanadium-based materials reported previously. The electrochemical properties demonstrate that the sandwich-like V2O5/graphene mesoporous composite could be a promising candidate material for high-capacity anode in lithium ion batteries. PMID:26650604

  16. Aligned mesoporous architectures and devices.

    SciTech Connect

    Brinker, C. Jeffrey; Lu, Yunfeng

    2011-03-01

    This is the final report for the Presidential Early Career Award for Science and Engineering - PECASE (LDRD projects 93369 and 118841) awarded to Professor Yunfeng Lu (Tulane University and University of California-Los Angeles). During the last decade, mesoporous materials with tunable periodic pores have been synthesized using surfactant liquid crystalline as templates, opening a new avenue for a wide spectrum of applications. However, the applications are somewhat limited by the unfavorabe pore orientation of these materials. Although substantial effort has been devoted to align the pore channels, fabrication of mesoporous materials with perpendicular pore channels remains challenging. This project focused on fabrication of mesoporous materials with perpendicularly aligned pore channels. We demonstrated structures for use in water purification, separation, sensors, templated synthesis, microelectronics, optics, controlled release, and highly selective catalysts.

  17. Synthesis of nanostructured hybrid sorbent materials using organosilane self-assembly on mesoporous ceramic oxides

    SciTech Connect

    Fryxell, Glen E.

    2007-01-30

    The single most important factor in determining quality of life in human society is the availability of pure, clean drinking water. Wars have been fought, and will continue to be fought, over access and control of clean water. Drinking water has two major classes of contamination, biological contamination and chemical contamination. Bacterial contamination can be dealt with by a number of well-established technologies (e.g. chlorination, ozone, UV, etc.), but chemical contamination is a somewhat more challenging target. Common organic contaminants, such as pesticides, agricultural chemicals, industrial solvents, and fuels can be removed by treatment with UV/ozone, activated carbon or plasma technologies. Toxic heavy metals like mercury, lead and cadmium can be partially addressed by using traditional sorbent materials like alumina, but these materials bind metal ions non-specifically and can easily be saturated with harmless, ubiquitous species like calcium, magnesium and zinc (which are actually nutrients, and don’t need to be removed). Another weakness of these traditional sorbent materials is that metal ion sorption to a ceramic oxide surface is a reversible process, meaning they can easily desorb back into the drinking water supply.

  18. A facile method to prepare mesoporous anatase TiO{sub 2} materials in water at lower temperatures

    SciTech Connect

    Luo, Qingzhi; Chen, Yu; Wang, Desong An, Jing; Li, Xueyan; Yin, Rong; Shi, Le

    2015-07-15

    Highlights: • Mesoporous anatase TiO{sub 2} was prepared in water at lower temperatures than 90 °C. • The specific surface areas of as-prepared TiO{sub 2} are in the range of 235–345 m{sup 2} g{sup −1}. • The as-prepared TiO{sub 2} possesses high UV or visible light photocatalytic activity. - Abstract: Mesoporous anatase TiO{sub 2} has been successfully prepared in water at lower temperatures than 90 °C. Firstly, amorphous TiO{sub 2} gels were prepared by conventional sol–gel method at room temperature with tetrabutyl titanate as precursor, and then TiO{sub 2} gels were directly put into water at temperatures of 50–90 °C for 0.5–10 h to form mesoporous anatase TiO{sub 2}. The as-prepared mesoporous TiO{sub 2} was characterized by XRD, TEM, FTIR, Raman, UV–vis DRS, DSC–TGA, and XPS. The results showed that mesoporous anatase TiO{sub 2} contained some organic residuals, the mean size of the TiO{sub 2} nanocrystals was in the range of 3.5–5.4 nm, and their BET specific surface areas were in the range of 235–345 m{sup 2} g{sup −1}. The photocatalytic activity of as-prepared TiO{sub 2} was obviously higher than those of the commercial TiO{sub 2} (P25) and TiO{sub 2} calcined at 450 °C for 3 h under UV or visible light irradiation.

  19. Ionic Liquid Directed Mesoporous Carbon Nanoflakes as an Effiencient Electrode material.

    PubMed

    Kong, Lirong; Chen, Wei

    2015-01-01

    Supercapacitors are considered to be the most promising approach to meet the pressing requirements for energy storage devices. The electrode materials for supercapacitors have close relationship with their electrochemical properties and thus become the key point to improve their energy storage efficiency. Herein, by using poly (vinylidene fluoride-co-hexafluoropropylene) and ionic liquid as the dual templates, polyacrylonitrile as the carbon precursor, a flake-like carbon material was prepared by a direct carbonization method. In this method, poly (vinylidene fluoride-co-hexafluoropropylene) worked as the separator for the formation of isolated carbon flakes while aggregated ionic liquid worked as the pore template. The obtained carbon flakes exhibited a specific capacitance of 170 F/g at 0.1 A/g, a high energy density of 12.2 Wh/kg and a high power density of 5 kW/kg at the current of 10 A/g. It also maintained a high capacitance retention capability with almost no declination after 500 charge-discharge cycles. The ionic liquid directed method developed here also provided a new idea for the preparation of hierarchically porous carbon nanomaterials. PMID:26656464

  20. Ionic Liquid Directed Mesoporous Carbon Nanoflakes as an Effiencient Electrode material

    PubMed Central

    Kong, Lirong; Chen, Wei

    2015-01-01

    Supercapacitors are considered to be the most promising approach to meet the pressing requirements for energy storage devices. The electrode materials for supercapacitors have close relationship with their electrochemical properties and thus become the key point to improve their energy storage efficiency. Herein, by using poly (vinylidene fluoride-co-hexafluoropropylene) and ionic liquid as the dual templates, polyacrylonitrile as the carbon precursor, a flake-like carbon material was prepared by a direct carbonization method. In this method, poly (vinylidene fluoride-co-hexafluoropropylene) worked as the separator for the formation of isolated carbon flakes while aggregated ionic liquid worked as the pore template. The obtained carbon flakes exhibited a specific capacitance of 170 F/g at 0.1 A/g, a high energy density of 12.2 Wh/kg and a high power density of 5 kW/kg at the current of 10 A/g. It also maintained a high capacitance retention capability with almost no declination after 500 charge-discharge cycles. The ionic liquid directed method developed here also provided a new idea for the preparation of hierarchically porous carbon nanomaterials. PMID:26656464

  1. Synthesis of non-siliceous mesoporous oxides.

    PubMed

    Gu, Dong; Schüth, Ferdi

    2014-01-01

    Mesoporous non-siliceous oxides have attracted great interest due to their unique properties and potential applications. Since the discovery of mesoporous silicates in 1990s, organic-inorganic assembly processes by using surfactants or block copolymers as soft templates have been considered as a feasible path for creating mesopores in metal oxides. However, the harsh sol-gel conditions and low thermal stabilities have limited the expansion of this method to various metal oxide species. Nanocasting, using ordered mesoporous silica or carbon as a hard template, has provided possibilities for preparing novel mesoporous materials with new structures, compositions and high thermal stabilities. This review concerns the synthesis, composition, and parameter control of mesoporous non-siliceous oxides. Four synthesis routes, i.e. soft-templating (surfactants or block copolymers as templates), hard-templating (mesoporous silicas or carbons as sacrificial templates), colloidal crystal templating (3-D ordered colloidal particles as a template), and super lattice routes, are summarized in this review. Mesoporous metal oxides with different compositions have different properties. Non-siliceous mesoporous oxides are comprehensively described, including a discussion of constituting elements, synthesis, and structures. General aspects concerning pore size control, atomic scale crystallinity, and phase control are also reviewed. PMID:23942521

  2. Multiscale anode materials in lithium ion batteries by combining micro- with nanoparticles: design of mesoporous TiO2 microfibers@nitrogen doped carbon composites

    NASA Astrophysics Data System (ADS)

    Cheng, Wei; Rechberger, Felix; Primc, Darinka; Niederberger, Markus

    2015-08-01

    TiO2 has been considered as a promising anode material for lithium ion batteries. However, its poor rate capability originating from the intrinsically low lithium ion diffusivity and its poor electronic conductivity hampers putting such an application into practice. Both issues can be addressed by nanostructure engineering and conductive surface coating. Herein, we report a template-assisted synthesis of micron sized TiO2 fibers consisting of a mesoporous network of anatase nanoparticles of about 7.5 nm and coated by N doped carbon. In a first step, an amorphous layer of TiO2 was deposited on cobalt silicate nanobelts and subsequently transformed into crystalline anatase nanoparticles by hydrothermal treatment. The N doped carbon coating was realized by in situ polymerization of dopamine on the crystalline TiO2 followed by annealing under N2. After removal of the template, we obtained the final mesoporous TiO2 fibers@N doped carbon composite. Electrochemical tests revealed that the composite electrode exhibited excellent electrochemical properties in terms of specific capacity, rate performance and long term stability.TiO2 has been considered as a promising anode material for lithium ion batteries. However, its poor rate capability originating from the intrinsically low lithium ion diffusivity and its poor electronic conductivity hampers putting such an application into practice. Both issues can be addressed by nanostructure engineering and conductive surface coating. Herein, we report a template-assisted synthesis of micron sized TiO2 fibers consisting of a mesoporous network of anatase nanoparticles of about 7.5 nm and coated by N doped carbon. In a first step, an amorphous layer of TiO2 was deposited on cobalt silicate nanobelts and subsequently transformed into crystalline anatase nanoparticles by hydrothermal treatment. The N doped carbon coating was realized by in situ polymerization of dopamine on the crystalline TiO2 followed by annealing under N2. After

  3. Synthesis Mechanism and Thermal Optimization of an Economical Mesoporous Material Using Silica: Implications for the Effective Removal or Delivery of Ibuprofen.

    PubMed

    Kittappa, Shanmuga; Cui, Mingcan; Ramalingam, Malarvili; Ibrahim, Shaliza; Khim, Jeehyeong; Yoon, Yeomin; Snyder, Shane A; Jang, Min

    2015-01-01

    Mesoporous silica materials (MSMs) were synthesized economically using silica (SiO2) as a precursor via a modified alkaline fusion method. The MSM prepared at 500°C (MSM-500) had the highest surface area, pore size, and volume, and the results of isotherms and the kinetics of ibuprofen (IBP) removal indicated that MSM-500 had the highest sorption capacity and fastest removal speed vs. SBA-15 and zeolite. Compared with commercial granular activated carbon (GAC), MSM-500 had a ~100 times higher sorption rate at neutral pH. IBP uptake by MSM-500 was thermodynamically favorable at room temperature, which was interpreted as indicating relatively weak bonding because the entropy (∆adsS, -0.07 J mol(-1) K(-1)) was much smaller. Five times recycling tests revealed that MSM-500 had 83-87% recovery efficiencies and slower uptake speeds due to slight deformation of the outer pore structure. In the IBP delivery test, MSM-500 drug loading was 41%, higher than the reported value of SBA-15 (31%). The in vitro release of IBP was faster, almost 100%, reaching equilibrium within a few hours, indicating its effective loading and unloading characteristics. A cost analysis study revealed that the MSM was ~10-70 times cheaper than any other mesoporous silica material for the removal or delivery of IBP. PMID:26161510

  4. Synthesis Mechanism and Thermal Optimization of an Economical Mesoporous Material Using Silica: Implications for the Effective Removal or Delivery of Ibuprofen

    PubMed Central

    Kittappa, Shanmuga; Cui, Mingcan; Ramalingam, Malarvili; Ibrahim, Shaliza; Khim, Jeehyeong; Yoon, Yeomin; Snyder, Shane A.; Jang, Min

    2015-01-01

    Mesoporous silica materials (MSMs) were synthesized economically using silica (SiO2) as a precursor via a modified alkaline fusion method. The MSM prepared at 500°C (MSM–500) had the highest surface area, pore size, and volume, and the results of isotherms and the kinetics of ibuprofen (IBP) removal indicated that MSM–500 had the highest sorption capacity and fastest removal speed vs. SBA–15 and zeolite. Compared with commercial granular activated carbon (GAC), MSM–500 had a ~100 times higher sorption rate at neutral pH. IBP uptake by MSM–500 was thermodynamically favorable at room temperature, which was interpreted as indicating relatively weak bonding because the entropy (∆adsS, –0.07 J mol–1 K–1) was much smaller. Five times recycling tests revealed that MSM–500 had 83–87% recovery efficiencies and slower uptake speeds due to slight deformation of the outer pore structure. In the IBP delivery test, MSM–500 drug loading was 41%, higher than the reported value of SBA–15 (31%). The in vitro release of IBP was faster, almost 100%, reaching equilibrium within a few hours, indicating its effective loading and unloading characteristics. A cost analysis study revealed that the MSM was ~10–70 times cheaper than any other mesoporous silica material for the removal or delivery of IBP. PMID:26161510

  5. Designed synthesis of carbon-functional magnetic graphene mesoporous silica materials using polydopamine as carbon precursor for the selective enrichment of N-linked glycan.

    PubMed

    Sun, Nianrong; Yao, Jizong; Deng, Chunhui

    2016-02-01

    Glycosylation, which has been confirmed to be associated with many diseases, is an important protein post-translation modification. Taking into account the low abundant of glycan, the purification of complex biological samples is considered to be very significant before mass spectrometry detection. In this work, carbon-functionalized magnetic graphene /mesoporous silica materials (C-Mag G@mSiO2 materials) with high content of carbon were designed and synthesized by using polydopamine as carbon precursor. Taking advantage of the special interaction between carbon and glycan, C-Mag G@mSiO2 materials were successfully applied to enrich N-linked glycans in different complex samples, such as standard glycoprotein digestion, the mixture of standard glycoprotein digestion, glycoprotein and non-glycoprotein, and human serum. PMID:26653470

  6. Synthesis of Mesoporous ZnO Nanosheets via Facile Solvothermal Method as the Anode Materials for Lithium-ion Batteries

    NASA Astrophysics Data System (ADS)

    Wang, Xin; Huang, Lanyan; Zhao, Yan; Zhang, Yongguang; Zhou, Guofu

    2016-01-01

    Mesoporous ZnO nanosheets are synthesized through a room temperature solvothermal method. Transmission and scanning electronic microscopy observations indicate that as-prepared ZnO hierarchical aggregates are composed and assembled by nanosheets with a length of 1-2 μm and a thickness of 10-20 nm, and interlaced ZnO nanosheets irregularly stack together, forming a three-dimensional network. Furthermore, large mesopores are embedded in the walls of ZnO nanosheets, confirmed by Brunauer-Emmett-Teller (BET) measurement. Accordingly, the resulting ZnO anode exhibits a high and stable specific discharge capacity of 421 mAh g-1 after 100 cycles at 200 mA g-1 and a good rate capability. Such electrochemical performance could be attributed to the multiple synergistic effects of its mesoporous nanosheet structure, which can not only provide a large specific surface area for lithium storage, but also favor the ion transport and electrolyte diffusion.

  7. Synthesis of Mesoporous ZnO Nanosheets via Facile Solvothermal Method as the Anode Materials for Lithium-ion Batteries.

    PubMed

    Wang, Xin; Huang, Lanyan; Zhao, Yan; Zhang, Yongguang; Zhou, Guofu

    2016-12-01

    Mesoporous ZnO nanosheets are synthesized through a room temperature solvothermal method. Transmission and scanning electronic microscopy observations indicate that as-prepared ZnO hierarchical aggregates are composed and assembled by nanosheets with a length of 1-2 μm and a thickness of 10-20 nm, and interlaced ZnO nanosheets irregularly stack together, forming a three-dimensional network. Furthermore, large mesopores are embedded in the walls of ZnO nanosheets, confirmed by Brunauer-Emmett-Teller (BET) measurement. Accordingly, the resulting ZnO anode exhibits a high and stable specific discharge capacity of 421 mAh g(-1) after 100 cycles at 200 mA g(-1) and a good rate capability. Such electrochemical performance could be attributed to the multiple synergistic effects of its mesoporous nanosheet structure, which can not only provide a large specific surface area for lithium storage, but also favor the ion transport and electrolyte diffusion. PMID:26815606

  8. Mesoporous hybrid organosilica containing urethane moieties

    SciTech Connect

    Seo, You-Kyong; Park, Sung-Bae; Ho Park, Dong . E-mail: chempdh@inje.ac.kr

    2006-04-15

    Mesoporous hybrid material containing urethane moieties in functionalized long chain organic group have been synthesized by using bis[3-(triethoxysilyl) propyl urethane]ethane (BTESPUE) and tetraethoxysilane as structural ingredients. The incorporation of BTESPUE within the framework of mesoporous material was confirmed by Fourier transform-infrared, X-ray photoelectron spectroscopy, solid-state NMR spectroscopy and thermogravimetric analysis. This material had a thick wall and uniform pore, which may be attributed to the hydrogen bonding inside framework due to urethane moieties.

  9. High-performance electrode materials of hierarchical mesoporous nickel oxide ultrathin nanosheets derived from self-assembled scroll-like α-nickel hydroxide

    NASA Astrophysics Data System (ADS)

    Yao, Mingming; Hu, Zhonghua; Xu, Zijie; Liu, Yafei; Liu, Peipei; Zhang, Qiang

    2015-01-01

    A two-step approach is proposed to prepare high-performance NiO electrode material. First, the scroll-like α-Ni(OH)2 is prepared by hydrothermal reaction via a self-assembly growth process using guanidine hydrochloride as precipitant. Second, the precursor Ni(OH)2 is converted to NiO by calcination. The resultants of hierarchical mesoporous NiO ultrathin nanosheets are characterized by X-ray diffraction (XRD), field-emission scanning electron microscopy (FESEM), transmission electron microscopy (TEM), selected area electron diffraction (SAED) patterns and N2 adsorption and desorption. The electrochemical properties of the samples are evaluated though cyclic voltammetry (CV), charge-discharge and electrochemical impedance spectroscopy (EIS) in 6.0 M KOH electrolytic solution. The results show that the typical hierarchical mesoporous NiO ultrathin nanosheets exhibits a very large specific capacitance of 1060 F g-1 at 1 A g-1, an outstanding cyclic stability with a capacitance retention of 91% after 5000 cycles of charge-discharge and a low resistance.

  10. Hybrid luminescence materials assembled by [Ln(DPA)3]3− and mesoporous host through ion-pairing interactions with high quantum efficiencies and long lifetimes

    PubMed Central

    Li, Qing-Feng; Yue, Dan; Lu, Wei; Zhang, Xinlei; Li, Chunyang; Wang, Zhenling

    2015-01-01

    A kind of mesoporous hybrid luminescence material was assembled through the ion exchange method between [Ln(DPA)3]3− and ionic liquid functionalized SBA-15. [Ln(DPA)3]3− was successfully anchored onto positive-charge modified SBA-15 by the strong electrostatic interaction. In [Ln(DPA)3]3−, Ln3+ ions are in 9-fold coordination through six oxygen atoms of carboxyl groups and three nitrogen atoms of pyridine units, leaving no coordination site for water molecules. Therefore the hybrids possess prominent luminescent properties, SBA-15-IMI-Tb(DPA)3 and SBA-15-IMI-Eu(DPA)3 exhibit high quantum yield values of 63% and 79%, and long lifetimes values of 2.38 ms and 2.34 ms, respectively. Especially, SBA-15-IMI-Eu(DPA)3 presents a high color purity, and the red/orange intensity ratio is as high as 7.6. The excellent luminescence properties and ordered mesoporous structures give rise to many potential applications in optical and electronic areas. PMID:25669156

  11. Enhanced thermal properties of novel shape-stabilized PEG composite phase change materials with radial mesoporous silica sphere for thermal energy storage

    NASA Astrophysics Data System (ADS)

    Min, Xin; Fang, Minghao; Huang, Zhaohui; Liu, Yan'Gai; Huang, Yaoting; Wen, Ruilong; Qian, Tingting; Wu, Xiaowen

    2015-08-01

    Radial mesoporous silica (RMS) sphere was tailor-made for further applications in producing shape-stabilized composite phase change materials (ss-CPCMs) through a facile self-assembly process using CTAB as the main template and TEOS as SiO2 precursor. Novel ss-CPCMs composed of polyethylene glycol (PEG) and RMS were prepared through vacuum impregnating method. Various techniques were employed to characterize the structural and thermal properties of the ss-CPCMs. The DSC results indicated that the PEG/RMS ss-CPCM was a promising candidate for building thermal energy storage applications due to its large latent heat, suitable phase change temperature, good thermal reliability, as well as the excellent chemical compatibility and thermal stability. Importantly, the possible formation mechanisms of both RMS sphere and PEG/RMS composite have also been proposed. The results also indicated that the properties of the PEG/RMS ss-CPCMs are influenced by the adsorption limitation of the PEG molecule from RMS sphere with mesoporous structure and the effect of RMS, as the impurities, on the perfect crystallization of PEG.

  12. Enhanced thermal properties of novel shape-stabilized PEG composite phase change materials with radial mesoporous silica sphere for thermal energy storage.

    PubMed

    Min, Xin; Fang, Minghao; Huang, Zhaohui; Liu, Yan'gai; Huang, Yaoting; Wen, Ruilong; Qian, Tingting; Wu, Xiaowen

    2015-01-01

    Radial mesoporous silica (RMS) sphere was tailor-made for further applications in producing shape-stabilized composite phase change materials (ss-CPCMs) through a facile self-assembly process using CTAB as the main template and TEOS as SiO2 precursor. Novel ss-CPCMs composed of polyethylene glycol (PEG) and RMS were prepared through vacuum impregnating method. Various techniques were employed to characterize the structural and thermal properties of the ss-CPCMs. The DSC results indicated that the PEG/RMS ss-CPCM was a promising candidate for building thermal energy storage applications due to its large latent heat, suitable phase change temperature, good thermal reliability, as well as the excellent chemical compatibility and thermal stability. Importantly, the possible formation mechanisms of both RMS sphere and PEG/RMS composite have also been proposed. The results also indicated that the properties of the PEG/RMS ss-CPCMs are influenced by the adsorption limitation of the PEG molecule from RMS sphere with mesoporous structure and the effect of RMS, as the impurities, on the perfect crystallization of PEG. PMID:26261089

  13. Facile synthesis of mesoporous ZnCo2O4 coated with polypyrrole as an anode material for lithium-ion batteries

    NASA Astrophysics Data System (ADS)

    Zhong, Xiao-Bin; Wang, Hui-Yuan; Yang, Zhi-Zheng; Jin, Bo; Jiang, Qi-Chuan

    2015-11-01

    Although many research efforts have been devoted to improving the electrochemical performance of ZnCo2O4, there is still a great need for a facile, low cost and time-saving method to synthesize ZnCo2O4. Herein, we first report a facile method to prepare mesoporous ZnCo2O4 with polypyrrole (PPy) coating (ZnCo2O4/PPy). The facile strategy involves a reflux method and a subsequent chemical polymerization method. The mesoporous ZnCo2O4/PPy shows an outstanding electrochemical performance. The discharge capacity of the ZnCo2O4/PPy is 615 mAh g-1 after 100 cycles at a current density of 0.1 A g-1. When the current density increases to 0.2 A g-1, the discharge capacity still retains 458 mAh g-1 after 100 cycles. The improved electrochemical performance is attributed to the coating of PPy layer, which acts as a conductive agent and buffer during charge/discharge. Our results demonstrate that the ZnCo2O4/PPy has potential as a high-energy anode material for lithium-ion batteries.

  14. Multiscale anode materials in lithium ion batteries by combining micro- with nanoparticles: design of mesoporous TiO2 microfibers@nitrogen doped carbon composites.

    PubMed

    Cheng, Wei; Rechberger, Felix; Primc, Darinka; Niederberger, Markus

    2015-09-01

    TiO2 has been considered as a promising anode material for lithium ion batteries. However, its poor rate capability originating from the intrinsically low lithium ion diffusivity and its poor electronic conductivity hampers putting such an application into practice. Both issues can be addressed by nanostructure engineering and conductive surface coating. Herein, we report a template-assisted synthesis of micron sized TiO2 fibers consisting of a mesoporous network of anatase nanoparticles of about 7.5 nm and coated by N doped carbon. In a first step, an amorphous layer of TiO2 was deposited on cobalt silicate nanobelts and subsequently transformed into crystalline anatase nanoparticles by hydrothermal treatment. The N doped carbon coating was realized by in situ polymerization of dopamine on the crystalline TiO2 followed by annealing under N2. After removal of the template, we obtained the final mesoporous TiO2 fibers@N doped carbon composite. Electrochemical tests revealed that the composite electrode exhibited excellent electrochemical properties in terms of specific capacity, rate performance and long term stability. PMID:26220269

  15. Enhanced thermal properties of novel shape-stabilized PEG composite phase change materials with radial mesoporous silica sphere for thermal energy storage

    PubMed Central

    Min, Xin; Fang, Minghao; Huang, Zhaohui; Liu, Yan’gai; Huang, Yaoting; Wen, Ruilong; Qian, Tingting; Wu, Xiaowen

    2015-01-01

    Radial mesoporous silica (RMS) sphere was tailor-made for further applications in producing shape-stabilized composite phase change materials (ss-CPCMs) through a facile self-assembly process using CTAB as the main template and TEOS as SiO2 precursor. Novel ss-CPCMs composed of polyethylene glycol (PEG) and RMS were prepared through vacuum impregnating method. Various techniques were employed to characterize the structural and thermal properties of the ss-CPCMs. The DSC results indicated that the PEG/RMS ss-CPCM was a promising candidate for building thermal energy storage applications due to its large latent heat, suitable phase change temperature, good thermal reliability, as well as the excellent chemical compatibility and thermal stability. Importantly, the possible formation mechanisms of both RMS sphere and PEG/RMS composite have also been proposed. The results also indicated that the properties of the PEG/RMS ss-CPCMs are influenced by the adsorption limitation of the PEG molecule from RMS sphere with mesoporous structure and the effect of RMS, as the impurities, on the perfect crystallization of PEG. PMID:26261089

  16. Hybrid mesoporous materials for on-line preconcentration of Cr(VI) followed by one-step scheme for elution and colorimetric determination at ultratrace levels.

    PubMed

    Kim, Manuela L; Stripeikis, Jorge D; Tudino, Mabel B

    2009-01-15

    An hybrid mesoporous material synthesised in our laboratories for solid phase extraction (SPE) in flow through systems has been used for analytical purposes. The solid was obtained from mesoporous silica MCM-41 functionalized with 3-aminopropyltriethoxy silane by Sol-Gel methodology. In order to exploit the large sorption capacity of the material together with the possibility of modeling it for anions retention, a microcolumn (MC) filled with the solid was inserted in a flow system for preconcentration of Cr(VI) and its determination at ultratrace levels in natural waters. The analytical methodology involved a reverse flow injection system (rFI) holding a MC filled with the solid for the analyte extraction. Elution and colorimetric detection were carried out with 1-5 diphenylcarbazide (DPC) in sulfuric acid. DPC produced the reduction of Cr(VI) to Cr(III) together with the generation of a cationic red complex between Cr(III) and 1-5 diphenylcarbazone which was easily eluted and detected with a visible spectrophotometer. Moreover, the filling material got ready for the next sample loading remaining unspoiled for more than 300 cycles. The effect of several variables on the analytical signal as well as the influence of cationic and anionic interferences were discussed. Particular attention was given to sulfuric acid interference since it is the required media for the complex generation. Under optimal conditions, 99.8% of Cr(VI) recovery was obtained for a preconcentration time of 120s (sample and DPC flow rates=1 mL min(-1)) and an elution volume of 250 micro L. The limit of detection (3s) was found to be 0.09 microg L(-1) Cr(VI) with a relative standard deviation (n=10, 3 microg L(-1)) of 1.8. Since no Cr(III) was retained by the solid material and Cr(VI) was completely adsorbed, electrothermal atomic absorption spectrometry (ET AAS) determinations of Cr(III) were also performed by simply measuring its concentration at the end of the microcolumn after Cr

  17. Mesoporous Carbon Membranes for Selective Gas Separations

    SciTech Connect

    2009-04-01

    This factsheet describes a study whose focus is on translating a novel class of material developed at Oak Ridge National Laboratory—selfassembled mesoporous carbon—into robust, efficient membrane systems for selective industrial gas separations.

  18. Single crystalline mesoporous silicon nanowires

    SciTech Connect

    Hochbaum, Allon; Dargas, Daniel; Hwang, Yun Jeong; Yang, Peidong

    2009-08-18

    Herein we demonstrate a novel electroless etching synthesis of monolithic, single-crystalline, mesoporous silicon nanowire arrays with a high surface area and luminescent properties consistent with conventional porous silicon materials. The photoluminescence of these nanowires suggest they are composed of crystalline silicon with small enough dimensions such that these arrays may be useful as photocatalytic substrates or active components of nanoscale optoelectronic devices. A better understanding of this electroless route to mesoporous silicon could lead to facile and general syntheses of different narrow bandgap semiconductor nanostructures for various applications.

  19. Mesoporous Co{sub 3}O{sub 4} nanostructured material synthesized by one-step soft-templating: A magnetic study

    SciTech Connect

    Poyraz, Altug S.; Kuo, Chung-Hao; Li, Nan; Hines, William A. Perry, David M.; Suib, Steven L.

    2014-03-21

    A combined magnetization and zero-field {sup 59}Co spin-echo nuclear magnetic resonance (NMR) study has been carried out on one member of a recently developed class of highly ordered mesoporous nanostructured materials, mesoporous Co{sub 3}O{sub 4} (designated UCT-8, University of Connecticut, mesoporous materials). The material was synthesized using one-step soft-templating by an inverse micelles packing approach. Characterization of UCT-8 by powder x-ray diffraction and electron microscopy reveals that the mesostructure consists of random close-packed Co{sub 3}O{sub 4} nanoparticles ≈ 12 nm in diameter. The N{sub 2} sorption isotherm for UCT-8, which is type IV with a type H1 hysteresis loop, yields a 134 m{sup 2}/g BET surface area and a 7.7 nm BJH desorption pore diameter. The effect of heat treatment on the structure is discussed. The antiferromagnetic Co{sub 3}O{sub 4} nanoparticles have a Néel temperature T{sub N} = 27 K, somewhat lower than the bulk. A fit to the Curie-Weiss law over the temperature range 75 K ≤ T ≤ 300 K yields an effective magnetic moment of μ{sub eff} = 4.36 μ{sub B} for the Co{sup 2+} ions, indicative of some orbital contribution, and a Curie-Weiss temperature Θ = −93.5 K, consistent with antiferromagnetic ordering. The inter-sublattice and intra-sublattice exchange constants for the Co{sup 2+} ions are J{sub 1}/k{sub B} = (−)4.75 K and J{sub 2}/k{sub B} = (−)0.87 K, respectively, both corresponding to antiferromagnetic coupling. The presence of uncompensated surface spins is observed below T{sub N} with shifts in the hysteresis loops, i.e., an exchange-bias effect. The {sup 59}Co NMR spectrum for UCT-8, which is attributed to Co{sup 2+} ions at the tetrahedral A sites, is asymmetrically broadened with a peak at ≈55 MHz (T = 4.2 K). Since there is cubic symmetry at the A-sites, the broadening is indicative of a magnetic field distribution due to the uncompensated

  20. Mesoporous Silicon-Based Anodes

    NASA Technical Reports Server (NTRS)

    Peramunage, Dharmasena

    2015-01-01

    For high-capacity, high-performance lithium-ion batteries. A new high-capacity anode composite based on mesoporous silicon is being developed. With a structure that resembles a pseudo one-dimensional phase, the active anode material will accommodate significant volume changes expected upon alloying and dealloying with lithium (Li).

  1. SBA-15 mesoporous material modified with APTES as the carrier for 2-(3-benzoylphenyl)propionic acid

    NASA Astrophysics Data System (ADS)

    Moritz, Michał; Łaniecki, Marek

    2012-07-01

    SBA-15 ordered mesoporous silica functionalized with (3-aminopropyl)triethoxysilane (APTES) was used as the carrier for anti-inflammatory drug: 2-(3-benzoylphenyl)propionic acid - ketoprofen. The surface of SBA-15 containing free silanol groups was modified with 3-aminopropyltriethoxysilane via post-synthetic reaction. Functionalization of the carrier with basic aminopropyl groups resulted in an ionic interaction with acidic ketoprofen. The samples of carriers and carrier-drug complexes were characterized by elemental analysis, TG, N2 adsorption, FTIR, DRUV spectroscopies and an in vitro drug release test. The adsorption of ketoprofen on modified mesoporous matrix was proportional to the amount of introduced aminopropyl groups. The maximum content of deposited drug in modified SBA-15 was close to 20 wt.%. After drug adsorption the reduction of BET surface area, pore volume and pore diameter of non-modified SBA-15 and aminopropyl-modified SBA-15 after drug adsorption were observed while the hexagonal array of siliceous matrix was well preserved. The release profiles of the aminopropyl-modified drug-containing SBA-15 exhibited prolonged release of ketoprofen in applied media. Tests performed in acidic solution (pH 1.2) showed the best pharmaceutical availability.

  2. Characterization and acidic properties of Al-SBA-15 materials prepared by post-synthesis alumination of a low-cost ordered mesoporous silica

    SciTech Connect

    Gomez-Cazalilla, M.; Merida-Robles, J.M.; Gurbani, A.; Rodriguez-Castellon, E.; Jimenez-Lopez, A.

    2007-03-15

    A series of Al-containing SBA-15 type materials with different Si/Al ratio, were prepared by post-synthesis modification of a pure highly ordered mesoporous silica SBA-15 obtained by using sodium silicate as silica source, and amphiphilic block copolymer as structure-directing agent. A high level of aluminum incorporation was achieved, reaching an Si/Al ratio of up to 5.5, without any significant loss in the textural properties of SBA-15. These materials were fully characterized by powder X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS), {sup 27}Al NMR spectroscopy, and N{sub 2} adsorption at 77 K. The acid properties of these materials have been evaluated by NH{sub 3}-TPD, adsorption of pyridine and deuterated acetonitrile coupled to FTIR spectroscopy. The effective acidity of these materials was evaluated using two catalytic reactions: 2-propanol dehydrogenation and 1-butene isomerization. The adsorption of basic probe molecules and the catalytic behavior revealed an evolution of the acid properties with the Al content. These studies have shown that the Al-SBA-15 materials contain Bronsted and Lewis acid sites with medium acidity which makes them appropriate to be used as acid catalysts in heterogeneous catalysis, catalytic supports, and adsorbents. - Graphical abstract: Al KLL spectra of Al-SBA-15 materials with different Si/Al ratios.

  3. THE BIOCOMPATIBILITY OF MESOPOROUS SILICATES

    PubMed Central

    Hudson, Sarah; Padera, Robert F.; Langer, Robert; Kohane, Daniel S.

    2008-01-01

    Micro- and nano- mesoporous silicate particles are considered potential drug delivery systems because of their ordered pore structures, large surface areas and the ease with which they can be chemically modified. However, few cytotoxicity or biocompatibility studies have been reported, especially when silicates are administered in the quantities necessary to deliver low-potency drugs. The biocompatibility of mesoporous silicates of particle sizes ~ 150 nm, ~ 800 nm and ~ 4 µm and pore sizes of 3 nm, 7 nm and 16 nm respectively are examined here. In vitro, mesoporous silicates showed a significant degree of toxicity at high concentrations with mesothelial cells. Following subcutaneous injection of silicates in rats, the amount of residual material decreased progressively over three months, with good biocompatibility on histology at all time points. In contrast, intra peritoneal and intra venous injections in mice resulted in death or euthanasia. No toxicity was seen with subcutaneous injection of the same particles in mice. Microscopic analysis of the lung tissue of the mice indicates that death may be due to thrombosis. Although local tissue reaction to mesoporous silicates was benign, they caused severe systemic toxicity. This toxicity could be mitigated by modification of the materials. PMID:18675454

  4. Magnetic Mesoporous Photonic Cellulose Films.

    PubMed

    Giese, Michael; Blusch, Lina K; Schlesinger, Maik; Meseck, Georg R; Hamad, Wadood Y; Arjmand, Mohammad; Sundararaj, Uttandaraman; MacLachlan, Mark J

    2016-09-13

    Novel hybrid materials of cellulose and magnetic nanoparticles (NPs) were synthesized and characterized. The materials combine the chiral nematic structural features of mesoporous photonic cellulose (MPC) with the magnetic properties of cobalt ferrite (CoFe2O4). The photonic, magnetic, and dielectric properties of the hybrid materials were investigated during the dynamic swelling and deswelling of the MPC films. It was observed that the dielectric properties of the generated MPC films increased tremendously following swelling in water, endorsing efficient swelling ability of the generated mesoporous films. The high magnetic permeability of the developed MPC films in conjunction with their superior dielectric properties, predominantly in the swollen state, makes them interesting for electromagnetic interference shielding applications. PMID:27588561

  5. Synthesis and electrochemical characterization of mesoporous Li2FeSiO4/C composite cathode material for Li-ion batteries

    NASA Astrophysics Data System (ADS)

    Kumar, Ajay; Jayakumar, O. D.; Bazzi, Khadije; Nazri, Gholam-Abbas; Naik, Vaman M.; Naik, Ratna

    2015-03-01

    Lithium iron silicate (Li2FeSiO4) has the potential as cathode for Li ion batteries due to its high theoretical capacity (~ 330 mAh/g) and improved safety. The application of Li2FeSiO4 as cathode material has been challenged by its poor electronic conductivity and slow lithium ion diffusion in the solid phase. In order to solve these problems, we have synthesized mesoporous Li2FeSiO4/C composites by sol-gel method using the tri-block copolymer (P123) as carbon source. The phase purity and morphology of the composite materials were characterized by x-ray diffraction, SEM and TEM. The XRD pattern confirmed the formation of ~ 12 nm size Li2FeSiO4 crystallites in composites annealed at 600 °C for 6 h under argon atmosphere. The electrochemical properties are measured using the composite material as positive electrode in a standard coin cell configuration with lithium as the active anode and the cells were tested using AC impedance spectroscopy, cyclic voltammetry, and galvanostatic charge/discharge cycling. The Li2FeSiO4/C composites showed a discharge capacity of ~ 240 mAh/g at a rate of C/30 at room temperature. The effect of different annealing temperature and synthesis time on the electrochemical performance of Li2FeSiO4/C will be presented.

  6. Modified mesoporous silica materials for on-line separation and preconcentration of hexavalent chromium using a microcolumn coupled with flame atomic absorption spectrometry.

    PubMed

    Wang, Zheng; Fang, Dong-Mei; Li, Qing; Zhang, Ling-Xia; Qian, Rong; Zhu, Yan; Qu, Hai-Yun; Du, Yi-Ping

    2012-05-01

    A modified SBA-15 mesoporous silica material NH(2)-SBA-15 was synthesized successfully by grafting γ-aminopropyl-triethoxysilane. The material was characterized using transmission electron microscopy (TEM) and Fourier transform infrared/Raman (FT-IR/Raman) spectroscopy, and used for the first time in a flow injection on-line solid phase extraction (SPE) coupled with flame atomic absorption spectrometry (FAAS) to detect trace Cr (VI). Effective sorption of Cr (VI) was achieved at pH 2.0 with no interference from Cr (III) and other ions and 0.5 mol L(-1) NH(3)·H(2)O solution was found optimal for the complete elution of Cr (VI). An enrichment factor of 44 and was achieved under optimized experimental conditions at a sample loading of 2.0 mL min(-1) sample loading (300 s) and an elution flow rate of 2.0 mL min(-1) (24s). The precision of the 11 replicate Cr (VI) measurements was 2.1% at the 100 μg L(-1) level with a detection limit of 0.2 μg L(-1) (3s, n=10) using the FAAS. The developed method was successfully applied to trace chromium determination in waste water. The accuracy was validated using a certified reference material of riverine water (GBW08607). PMID:22502615

  7. Novel Sol–Gel Precursors for Thin Mesoporous Eu3+-Doped Silica Coatings as Efficient Luminescent Materials.

    PubMed Central

    2012-01-01

    Europium(III) ions containing mesoporous silica coatings have been prepared via a solvent evaporation-induced self-assembly (EISA) approach of different single-source precursors (SSPs) in the presence of Pluronic P123 as a structure-directing agent, using the spin-coating process. A deliberate tailoring of the chemical composition of the porous coatings with various Si:Eu ratios was achieved by processing mixtures of tetraethylorthosilicate (TEOS) and Eu3+-coordinated SSPs. Small-angle X-ray scattering (SAXS) and transmission electron microscopy (TEM) analyses demonstrate that the thin metal oxide-doped silica coatings consist of a porous network with a short-range order of the pore structure, even at high europium(III) loadings. Furthermore, luminescence properties were investigated at different temperatures and different degrees of Eu3+ contents. The photoluminescence spectra clearly show characteristic emission peaks corresponding to the 5D0 → 7FJ (J = 0–5) transitions resulting in a red luminescence visible by the eyes, although the films have a very low thickness (150–200 nm). PMID:23503160

  8. Functionalized bimodal mesoporous silicas as carriers for controlled aspirin delivery

    NASA Astrophysics Data System (ADS)

    Gao, Lin; Sun, Jihong; Li, Yuzhen

    2011-08-01

    The bimodal mesoporous silica modified with 3-aminopropyltriethoxysilane was performed as the aspirin carrier. The samples' structure, drug loading and release profiles were characterized with X-ray diffraction, scanning electron microscopy, N 2 adsorption and desorption, Fourier transform infrared spectroscopy, TG analysis, elemental analysis and UV-spectrophotometer. For further exploring the effects of the bimodal mesopores on the drug delivery behavior, the unimodal mesoporous material MCM-41 was also modified as the aspirin carrier. Meantime, Korsmeyer-Peppas equation ft= ktn was employed to analyze the dissolution data in details. It is indicated that the bimodal mesopores are beneficial for unrestricted drug molecules diffusing and therefore lead to a higher loading and faster releasing than that of MCM-41. The results show that the aspirin delivery properties are influenced considerably by the mesoporous matrix, whereas the large pore of bimodal mesoporous silica is the key point for the improved controlled-release properties.

  9. Carbon dioxide adsorption on micro-mesoporous composite materials of ZSM-12/MCM-48 type: The role of the contents of zeolite and functionalized amine

    SciTech Connect

    Santos, S.C.G.

    2015-10-15

    Highlights: • Synthesis of the micro-mesoporous composite materials of ZSM-12/MCM-48 type. • Application of these adsorbents in the carbon dioxide adsorption. • Effects of the contents of zeolite and amino group in the material surface on the CO{sub 2} capture efficiency. - Abstract: In this study ZSM-12/MCM-48 adsorbents have been synthesized at three ZSM-12 content, and also were functionalizated with amine groups by grafting. All the adsorbents synthesized were evaluated for CO{sub 2} capture. The X-ray diffraction analysis of the ZSM-12/MCM-48 composite showed the main characteristic peaks of ZSM-12 and MCM-48, and after the functionalization, the structure of MCM-48 on the composite impregnated was affected due amine presence. For the composites without amine, the ZSM-12 content was the factor determining in the adsorption capacity of CO{sub 2} and for the composites with amine the amount of amine was that influenced in the adsorption capacity.

  10. Preparation of highly ordered mesoporous AlSBA-15-SO 3H hybrid material for the catalytic synthesis of chalcone under solvent-free condition

    NASA Astrophysics Data System (ADS)

    Li, Wei; Xu, Kejin; Xu, Leilei; Hu, Jianglei; Ma, Fengyan; Guo, Yihang

    2010-03-01

    Single-step preparation of SBA-15 materials functionalized with both propylsulfonic acid groups and aluminum species (AlSBA-15-SO 3H) was carried out by hydrothermal treatment of a mixture of aluminum isopropoxide, 3-mercaptopropyltriethoxysilane, tetraethoxysilane, and triblock copolymer surfactant. At Si/Al molar ratio of 11-96, the materials exhibited well-ordered hexagonally arranged mesopores with pore diameter of ca. 9 nm, BET surface area of 546.9-666.0 m 2 g -1, and pore volume of 0.82-1.03 cm 3 g -1. As-prepared AlSBA-15-SO 3H was successfully used in the Claisen-Schmidt condensation reaction of benzaldehyde with acetophenone to produce chalcone under solvent-free condition, and the influence of the reaction parameters including temperatures, molar ratios of BZD to APN, and aluminum loadings were considered during the chalcone synthesis procedure. It showed that AlSBA-15-SO 3H exhibited significantly high catalytic activity and selectivity, outperforming the reference catalysts such as sulfuric acid, ZSM-5, and acidic MCM-49. In addition, the catalytic stability and regeneration of AlSBA-15-SO 3H was studied.

  11. A hybrid mesoporous material functionalized by 1,8-naphthalimide-base receptor and the application as chemosensor and absorbent for Hg2+ in water.

    PubMed

    Meng, Qingtao; Zhang, Xiaolin; He, Cheng; Zhou, Peng; Su, Weiping; Duan, Chunying

    2011-03-15

    A novel hybrid material (SBA-P1) is prepared through the functionalization of mesoporous silica (SBA-15) with a 1,8-naphthalimide-based dye by sol-gel reaction. The characterization results of elemental analysis (EA), X-ray powder diffractometer (XRD) and spectroscopic methods demonstrate the fluorescence dye P1 is successfully grafted onto the inner surface of SBA-15 and the organized structure is preserved. SBA-P1 can detect Hg(2+) with high selectivity to Cu(2+), Zn(2+), Cd(2+), Pb(2+), Mn(2+), Ni(2+), Co(2+), Ag(+), Cr(3+), and Mg(2+), Ca(2+), Li(+), Na(+), K(+) in water and sensitivity to environmentally relevant mercury in complex natural samples. The quenching fluorescence detection is also reversible by treating with EDTA/base. Furthermore, its fluorescence intensity keeps stable in the physiologically relevant pH range. The extraction ability of SBA-P1 is also estimated by inductively coupled plasma source mass spectrometer (ICP), showing that approximately 90% of the Hg(2+) ion is extracted. These results imply that the hybrid material has potential application for sensing and removing of Hg(2+) ions in waste water and working as toxicide for acute mercury poisoning. PMID:21315897

  12. Removal of uranium(VI) ions from aqueous solutions using Schiff base functionalized SBA-15 mesoporous silica materials.

    PubMed

    Dolatyari, Leila; Yaftian, Mohammad Reza; Rostamnia, Sadegh

    2016-03-15

    Functionalized SBA-15 mesoporous silica particles, bearing N-propylsalicylaldimine and ethylenediaminepropylesalicylaldimine Schiff base ligands, abbreviated as SBA/SA and SBA/EnSA respectively, were prepared and characterized by FT-IR, elemental analysis, TGA, XRD, TEM and SEM techniques. The potentials of these adsorbents were examined by using them in solid phase extraction of U(VI) ions from water samples. It is shown that 20 mg of SBA/SA or SBA/EnSA can remove rapidly (∼15 min) and quantitatively uranium(VI) ions from 10 to 200 mL of water solutions (pH 4) containing 0.2 mg of the ions, at 25 °C. The adsorbed ions were stripped by 1 mL of dilute nitric acid solution (0.1 mol L(-1)). It means that the studied adsorbents are able to be used for removal and concentration of uranyl ions. This allowed achieving to a concentration factor of 200 for uranyl ions. The variation in the ionic strength in the range 0-1 mol L(-1) did not affect the extraction efficiencies of the adsorbents. The adsorbents showed selective separation of uranyl ions from Cd(2+), Co(2+), Ni(2+), Mn(2+), Cr(3+), Ba(2+), Fe(3+) and Eu(3+) ions. Thermodynamic investigations revealed that the adsorption of uranyl ions by the adsorbents was spontaneous and endothermic. The Langmuir model described suitably the adsorption isotherms. This model determined the maximum adsorption capacity of the adsorbents SBA/SA and SBA/EnSA as 54 and 105.3 mg uranyl/g adsorbent, respectively. The kinetics of the processes was interpreted by using Pseudo-second-order model. PMID:26720327

  13. One-pot synthesis of silicon nanoparticles trapped in ordered mesoporous carbon for use as an anode material in lithium-ion batteries

    NASA Astrophysics Data System (ADS)

    Park, Junsu; Kim, Gil-Pyo; Nam, Inho; Park, Soomin; Yi, Jongheop

    2013-01-01

    Silicon nanoparticles trapped in an ordered mesoporous carbon composite were prepared by a one-step self-assembly with solvent evaporation using the triblock copolymer Pluronic F127 and a resorcinol-formaldehyde polymer as the templating agent and carbon precursor respectively. Such a one-pot synthesis of Si/ordered mesoporous carbon nanocomposite is suitable for large-scale synthesis. Characterization confirmed that the Si nanoparticles were trapped in the ordered mesoporous carbon, as evidenced by transmission electron microscopy, x-ray diffraction analysis and nitrogen sorption isotherms. The composite showed a high reversible capacity above 700 mA h g-1 during 50 cycles at 2 A g-1. The improved electrochemical performance of the composite can be ascribed to the buffering effect of spaces formed in the ordered pore channels during the volume expansion of silicon and the rapid movement of lithium ions through the uniform cylindrical pore structure of the mesopores.

  14. Facile mesoporous template-assisted hydrothermal synthesis of ordered mesoporous magnesium silicate as an efficient adsorbent

    NASA Astrophysics Data System (ADS)

    Lu, Qingshan; Li, Qiang; Zhang, Jingjing; Li, Jingfeng; Lu, Jinhua

    2016-01-01

    Mesoporous materials with unique structure as well as special morphology have potential applications in pollutant adsorption. In this work, using mesoporous silica SBA-15 filled with carbon (C@SBA-15) as both silicon source and assisted template, the ordered mesoporous magnesium silicate (Mg3Si4O9(OH)4) has been fabricated at 140 °C by a novel and facile hydrothermal method. During the hydrothermal process, the magnesium silicate grew along the silica walls at the expense of consuming silica and deposited on the carbon surface of the C@SBA-15. Meanwhile, the rigid carbon inside the pores of the SBA-15 supported the magnesium silicate as mesoporous walls under hydrothermal condition. The obtained magnesium silicate possessed ordered mesoporous structure, high specific surface area of 446 m2/g, large pore volume of 0.84 cm3/g, and hierarchical structure assembled with ultrathin nanosheets of 15 nm in thickness. These characteristics endow the ordered mesoporous magnesium silicate with the fast adsorption rate and high adsorption capacity of 382 mg/g for methylene blue. In addition, this synthesis method opens a new approach to fabricate other ordered mesoporous silicates.

  15. Ascorbic Acid-Assisted Synthesis of Mesoporous Sodium Vanadium Phosphate Nanoparticles with Highly sp(2) -Coordinated Carbon Coatings as Efficient Cathode Materials for Rechargeable Sodium-Ion Batteries.

    PubMed

    Hung, Tai-Feng; Cheng, Wei-Jen; Chang, Wen-Sheng; Yang, Chang-Chung; Shen, Chin-Chang; Kuo, Yu-Lin

    2016-07-18

    Herein, mesoporous sodium vanadium phosphate nanoparticles with highly sp(2) -coordinated carbon coatings (meso-Na3 V2 (PO4 )3 /C) were successfully synthesized as efficient cathode material for rechargeable sodium-ion batteries by using ascorbic acid as both the reductant and carbon source, followed by calcination at 750 °C in an argon atmosphere. Their crystalline structure, morphology, surface area, chemical composition, carbon nature and amount were systematically explored. Following electrochemical measurements, the resultant meso-Na3 V2 (PO4 )3 /C not only delivered good reversible capacity (98 mAh g(-1) at 0.1 A g(-1) ) and superior rate capability (63 mAh g(-1) at 1 A g(-1) ) but also exhibited comparable cycling performance (capacity retention: ≈74 % at 450 cycles at 0.4 A g(-1) ). Moreover, the symmetrical sodium-ion full cell with excellent reversibility and cycling stability was also achieved (capacity retention: 92.2 % at 0.1 A g(-1) with 99.5 % coulombic efficiency after 100 cycles). These attributes are ascribed to the distinctive mesostructure for facile sodium-ion insertion/extraction and their continuous sp(2) -coordinated carbon coatings, which facilitate electronic conduction. PMID:27346677

  16. Mesoporous Bi₂S₃ nanorods with graphene-assistance as low-cost counter-electrode materials in dye-sensitized solar cells.

    PubMed

    Guo, Sheng-qi; Jing, Tian-zeng; Zhang, Xiao; Yang, Xiao-bing; Yuan, Zhi-hao; Hu, Fang-zhong

    2014-11-01

    In this work, we report the synthesis of mesoporous Bi₂S₃ nanorods under hydrothermal conditions without additives, and investigated their catalytic activities as the CE in DSCs by I-V curves and tested conversion efficiency. To further improve their power conversion efficiency, we added different amounts of reduced graphene by simple physical mixing. With the addition of 9 wt% reduced graphene (rGO), the short-circuit current density, open-circuit voltage and fill factor were Jsc = 15.33 mA cm(-2), Voc = 0.74 V and FF = 0.609. More importantly, the conversion efficiency reached 6.91%, which is slightly inferior to the commercial Pt counter electrode (7.44%). Compared to the conventional Pt counter electrodes of solar cells, this new material has the advantages of low-cost, facile synthesis and high efficiency with graphene assistance. To the best of our knowledge, this Bi₂S₃ + 9 wt% rGO system has the best performance ever recorded in all Bi₂S₃-based CEs in the DSCs system. PMID:25341187

  17. Monodispersed mesoporous Li4Ti5O12 submicrospheres as anode materials for lithium-ion batteries: morphology and electrochemical performances

    NASA Astrophysics Data System (ADS)

    Lin, Chunfu; Fan, Xiaoyong; Xin, Yuelong; Cheng, Fuquan; Lai, Man On; Zhou, Henghui; Lu, Li

    2014-05-01

    Although nanosizing Li4Ti5O12 (LTO) materials is an effective way to improve their rate performances, their low tap density and first cycle coulombic efficiency limit their practical applications. To tackle these problems while preserving the advanced rate performances, monodispersed mesoporous LTO submicrospheres are developed here. These submicrospheres are synthesized via a solvothermal method using TiO2 submicrospheres and LiOH as precursors followed by a mild calcinations. The roles of the solvent used in the solvothermal process and calcination temperature are systematically investigated and optimized. The LTO submicrospheres fabricated by the solvothermal process using a water-ethanol (60 vol%) solvent followed by a calcination process at 600 °C reveal a large sphere size of 660 +/- 30 nm with a small primary particle size of 20-100 nm, a large specific surface area of 15.5 m2 g-1, an appropriate pore size of 4.5 nm and an ultra-high tap density of 1.62 g cm-3. Furthermore, they show high crystallinity and no blockage of Li+ ion transportation pathways. Due to the novel morphology and ideal crystal structure, these submicrospheres exhibit outstanding electrochemical performances. They display a high first cycle coulombic efficiency of 93.5% and a high charge capacity of 179 mA h g-1 at 0.5 C between 1.0 and 2.5 V (vs. Li/Li+), surpassing the theoretical capacity of LTO. Their charge capacity at 10 C is as high as 109 mA h g-1 with a capacity retention of 97.8% over 100 cycles. Therefore, this LTO material can be a superior and practical candidate for the anodes of high-power lithium-ion batteries.Although nanosizing Li4Ti5O12 (LTO) materials is an effective way to improve their rate performances, their low tap density and first cycle coulombic efficiency limit their practical applications. To tackle these problems while preserving the advanced rate performances, monodispersed mesoporous LTO submicrospheres are developed here. These submicrospheres are

  18. Monodispersed mesoporous Li4Ti5O12 submicrospheres as anode materials for lithium-ion batteries: morphology and electrochemical performances.

    PubMed

    Lin, Chunfu; Fan, Xiaoyong; Xin, Yuelong; Cheng, Fuquan; Lai, Man On; Zhou, Henghui; Lu, Li

    2014-06-21

    Although nanosizing Li4Ti5O12 (LTO) materials is an effective way to improve their rate performances, their low tap density and first cycle coulombic efficiency limit their practical applications. To tackle these problems while preserving the advanced rate performances, monodispersed mesoporous LTO submicrospheres are developed here. These submicrospheres are synthesized via a solvothermal method using TiO2 submicrospheres and LiOH as precursors followed by a mild calcinations. The roles of the solvent used in the solvothermal process and calcination temperature are systematically investigated and optimized. The LTO submicrospheres fabricated by the solvothermal process using a water-ethanol (60 vol%) solvent followed by a calcination process at 600 °C reveal a large sphere size of 660 ± 30 nm with a small primary particle size of 20-100 nm, a large specific surface area of 15.5 m(2) g(-1), an appropriate pore size of 4.5 nm and an ultra-high tap density of 1.62 g cm(-3). Furthermore, they show high crystallinity and no blockage of Li(+) ion transportation pathways. Due to the novel morphology and ideal crystal structure, these submicrospheres exhibit outstanding electrochemical performances. They display a high first cycle coulombic efficiency of 93.5% and a high charge capacity of 179 mA h g(-1) at 0.5 C between 1.0 and 2.5 V (vs. Li/Li(+)), surpassing the theoretical capacity of LTO. Their charge capacity at 10 C is as high as 109 mA h g(-1) with a capacity retention of 97.8% over 100 cycles. Therefore, this LTO material can be a superior and practical candidate for the anodes of high-power lithium-ion batteries. PMID:24816782

  19. Drug release from ordered mesoporous silicas.

    PubMed

    Doadrio, Antonio L; Salinas, Antonio J; Sánchez-Montero, José M; Vallet-Regí, M

    2015-01-01

    The state-of-the-art in the investigation of drugs release from Silica-based ordered Mesoporous Materials (SMMs) is reviewed. First, the SMM systems used like host matrixes are described. Then, the model drugs studied until now, including their pharmacological action, structure and the mesoporous matrix employed for each drug, are comprehensively listed. Next, the factors influencing the release of drugs from SMMs and the strategies used to control the drug delivery, specially the chemical functionalization of the silica surface, are discussed. In addition, how all these factors were gathered in a kinetic equation that describes the drug release from the mesoporous matrixes is explained. The new application of molecular modeling and docking in the investigation of the drug delivery mechanisms from SMMs is also presented. Finally, the new approaches under investigation in this field are mentioned including the design of smart stimuli-responsive materials and other recent proposals for a future investigation. PMID:26549760

  20. Corrosion behavior of mesoporous transition metal nitrides

    SciTech Connect

    Yang, Minghui; Allen, Amy J.; Nguyen, Minh T.; Ralston, Walter T.; MacLeod, Michelle J.; DiSalvo, Francis J.

    2013-09-15

    Transition metal nitrides (TMN) have many desirable characteristics such as high hardness and good thermal stability under reducing conditions. This work reports an initial survey of the chemical stability of mesoporous TMNs (TM=Nb, V, Cr and Ti) in water at 80 °C at neutral, acidic and alkaline pH. The mesoporous TMNs had specific surface areas of 25–60 m{sup 2}/g with average pore sizes ranging from 10 to 50 nm. The high surface areas of these materials enhance the rate of corrosion per unit mass over that of a bulk material, making detection of corrosion much easier. The products were characterized by Rietveld refinement of powder X-ray diffraction (PXRD) patterns and by scanning electron microscopy (SEM). Several nitrides have corrosion rates that are, within error, not distinguishable from zero (±1 Å/day). Of the nitrides examined, CrN appears to be the most corrosion resistant under acidic conditions. None of the nitrides studied are corrosion resistant under alkaline conditions. - Graphical abstract: Corrosion behavior of mesoporous transition metal nitrides (TM=Nb, V, Cr and Ti) in acidic and alkaline solutions at 80 °C for 2 weeks. Display Omitted - highlights: • Corrosion rates of mesoporous transition metal nitrides in aqueous solution is reported. • The mesoporous TMNs had surface areas of 25–60 m{sup 2}/g. • CrN is the most corrosion resistant under the conditions studied.

  1. Brick-and-Mortar Self-Assembly Approach to Graphitic Mesoporous Carbon Nanocomposites

    SciTech Connect

    Dai, Sheng; Fulvio, Pasquale F; Mayes, Richard T; Wang, Xiqing; Mahurin, Shannon Mark; Bauer, Christopher; Presser, Volker; Mcdonough, John; Gogotsi, Yury

    2011-01-01

    Mesoporous carbon materials do not have sufficient ordering at the atomic scale to exhibit good electronic conductivity. To date, mesoporous carbons having uniform mesopores and high surface areas have been prepared from partially-graphitizable precursors in the presence of templates. High temperature thermal treatments above 2000 C, which are usually required to increase conductivity, result in a partial or total collapse of the mesoporous structures and reduced surface areas induced by growth of graphitic domains, limiting their applications in electric double layer capacitors and lithium-ion batteries. In this work, we successfully implemented a 'brick-and-mortar' approach to obtain ordered graphitic mesoporous carbon nanocomposites with tunable mesopore sizes below 850 C without using graphitization catalysts or high temperature thermal treatments. Phenolic resin-based mesoporous carbons act as mortar to highly conductive carbon blacks and carbon onions (bricks). The capacitance and resistivity of final materials can be tailored by changing the mortar to brick ratios.

  2. Crystalline mesoporous zirconia catalysts having stable tetragonal pore wall structure

    DOEpatents

    Sachtler, Wolfgang M. H.; Huang, Yin-Yan

    1998-01-01

    Methods for the preparation of new sulfated mesoporous zirconia materials/catalysts with crystalline pore walls of predominantly tetragonal crystal structure, characterized by nitrogen physisorption measurement, X-ray diffraction, transmission electron microscopy and catalytic tests using n-butane isomerization to iso-butane and alkylation of 1-naphthol with 4-tert-butylstyrene as probe reactions. Sulfate deposition is preferred for the transformation of a mesoporous precursor with amorphous pore walls into a material with crystalline pore walls maintaining the mesoporous characteristics.

  3. Crystalline mesoporous zirconia catalysts having stable tetragonal pore wall structure

    DOEpatents

    Sachtler, W.M.H.; Huang, Y.Y.

    1998-07-28

    Methods are disclosed for the preparation of new sulfated mesoporous zirconia materials/catalysts with crystalline pore walls of predominantly tetragonal crystal structure, characterized by nitrogen physical sorption measurement, X-ray diffraction, transmission electron microscopy and catalytic tests using n-butane isomerization to iso-butane and alkylation of 1-naphthol with 4-tert-butylstyrene as probe reactions. Sulfate deposition is preferred for the transformation of a mesoporous precursor with amorphous pore walls into a material with crystalline pore walls maintaining the mesoporous characteristics. 17 figs.

  4. A highly ordered cubic mesoporous silica/graphene nanocomposite

    NASA Astrophysics Data System (ADS)

    Lee, Chang-Wook; Roh, Kwang Chul; Kim, Kwang-Bum

    2013-09-01

    A highly ordered cubic mesoporous silica (KIT-6)/graphene nanocomposite and 2D KIT-6 nanoflakes were synthesized using a novel synthesis methodology. The non-ionic triblock copolymer, P123, played a dual role as a structure-directing agent in the formation of the cubic mesoporous structure and as a cross-linking agent between mesoporous silica and graphene. The prepared (KIT-6)/graphene nanocomposite could act as a template for the preparation of mesoporous material/graphene nanocomposites.A highly ordered cubic mesoporous silica (KIT-6)/graphene nanocomposite and 2D KIT-6 nanoflakes were synthesized using a novel synthesis methodology. The non-ionic triblock copolymer, P123, played a dual role as a structure-directing agent in the formation of the cubic mesoporous structure and as a cross-linking agent between mesoporous silica and graphene. The prepared (KIT-6)/graphene nanocomposite could act as a template for the preparation of mesoporous material/graphene nanocomposites. Electronic supplementary information (ESI) available: S1: TEM images of disordered mesoporous silica/graphene nanocomposite; S2: TEM images of KIT-6/GO nanocomposite; S3: Thermogravimetric analysis of KIT-6/GO and KG-400-700; S4: SEM and TEM images of KIT-6; S5: Low angle XRD, Raman spectra, N2 adsorption isotherms, pore size distribution and photographic images of the prepared samples; S6: TEM image and N2 adsorption isotherms of mesoporous carbon/graphene nanocomposite; S7: XPS C1s spectra of the prepared samples. See DOI: 10.1039/c3nr03108j

  5. Structure elucidation of alkaline earth impregnated MCM-41 type mesoporous materials obtained by direct synthesis: An experimental and theoretical study

    NASA Astrophysics Data System (ADS)

    Paz, Gizeuda L.; Silva, Francisco das Chagas M.; Araújo, Maciel M.; Lima, Francisco das Chagas A.; Luz, Geraldo E.

    2014-06-01

    In this work, MCM-41 were synthesized hydrothermally and functionalized with calcium and strontium salts by direct method, using the Si/M = 50 molar ratio, in order to elucidate the way as the alkaline earth is incorporated on MCM-41 molecular sieve. The materials were characterized by X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FTIR), Raman spectroscopy, nitrogen adsorption-desorption and theoretical calculations by DFT method. Experimental results and computer simulations showed that the alkaline earths were incorporated on MCM-41 through a complex structure, which negatively influences on basic sites formation.

  6. Lower Permittivity Characteristic of Mesoporous-Alumina/Epoxy Composite due to Particle Porosity

    NASA Astrophysics Data System (ADS)

    Kurimoto, Muneaki; Murakami, Yoshinobu; Nagao, Masayuki

    Introduction of metal oxide nanoparticles to polymer composite material is known to have unique dielectric behavior and significant advantage in the electrical insulation performance of electrical power apparatus. This paper presents an attempt to derive the dielectric characteristics of polymer composite filled with the metal oxide particle which has mesoporous structure. Experiments were carried out in the epoxy composites filled with alumina microparticles which have the mesoporous structure (mesoporous-alumina/epoxy composites) with different particle content. Based on the measurement of the specific gravity of mesoporous-alumina/epoxy composites, the porosity of mesoporous-alumina particle in the epoxy matrix was found to be higher than that of nonporous-alumina particle. Furthermore, we evaluated relative permittivity of mesoporous-alumina/epoxy composites by measuring the capacitance of its specimens. As the results, we verified that the permittivity of mesoporous-alumina/epoxy composites was lower than that of nonporous-alumina/epoxy composites due to the particle porosity.

  7. The synthesis and application of two mesoporous silica nanoparticles as drug delivery system with different shape

    NASA Astrophysics Data System (ADS)

    Wang, Jiayi; Wang, Zhuyuan; Chen, Hui; Zong, Shenfei; Cui, Yiping

    2015-05-01

    Mesoporous silica nanospheres(MSNSs) have been obtained utilizing the conventional reverse micelles synthesis method while the mesoporous silica nanorods(MSNRs) have been acquired by means of changing certain parameters. Afterwards, the prepared mesoporous silica nanospheres and nanorods were used as drug carriers to load and release the classical cancer therapeutic drug—DOX. According to the absorption spectra, the encapsulation efficiency of the mesoporous silica nanospheres is almost as high as that of the nanospheres. Different from the familiar encapsulation efficiency, the release characteristic curves of the mesoporous silica nanospheres and nanorods possessed certain differences during the release process. Finally incellular fluorescence imaging was achieved to observe the endocytosis of the mesoporous silica materials. Our results show that although both of the two kinds of nanoparticles possess favourable properties for loading and releasing drugs, the mesoporous silica nanospheres perform better in dispersity and controlled release than the nanorods, which probably endow them the potential as incellular drug delivery system.

  8. In-situ immobilization of enzymes in mesoporous silicas

    NASA Astrophysics Data System (ADS)

    Santalla, Esther; Serra, Elías; Mayoral, Alvaro; Losada, José; Blanco, Rosa M.; Díaz, Isabel

    2011-04-01

    Lipase from Candida antarctica B, horseradish peroxidase and laccase have been entrapped in silica cages rising mesoporous structures. Lipase and laccase yielded the highest structured mesoporous material whereas horseradish peroxidase may have altered the symmetry giving as a result mesocelullar foam (MCF) type of cages. The possible effect in the final structure of the material of the nature, size and surface structure of the proteins as well as the presence of various additives in the enzyme extracts is currently under investigations.

  9. Single crystalline mesoporous silicon nanowires

    SciTech Connect

    Hochbaum, A.I.; Gargas, Daniel; Jeong Hwang, Yun; Yang, Peidong

    2009-08-04

    Herein we demonstrate a novel electroless etching synthesis of monolithic, single-crystalline, mesoporous silicon nanowire arrays with a high surface area and luminescent properties consistent with conventional porous silicon materials. These porous nanowires also retain the crystallographic orientation of the wafer from which they are etched. Electron microscopy and diffraction confirm their single-crystallinity and reveal the silicon surrounding the pores is as thin as several nanometers. Confocal fluorescence microscopy showed that the photoluminescence (PL) of these arrays emanate from the nanowires themselves, and their PL spectrum suggests that these arrays may be useful as photocatalytic substrates or active components of nanoscale optoelectronic devices.

  10. Incorporation of antimicrobial compounds in mesoporous silica film monolith.

    PubMed

    Izquierdo-Barba, Isabel; Vallet-Regí, María; Kupferschmidt, Natalia; Terasaki, Osamu; Schmidtchen, Artur; Malmsten, Martin

    2009-10-01

    Incorporation of the antimicrobial peptide LL-37 ([LL-37, 37 aa]), as well as low molecular weight antimicrobial chlorhexidine, into mesoporous silica was obtained using an EISA one-pot synthesis method. FTIR confirmed efficient encapsulation of both LL-37 and chlorhexidine into mesoporous silica, while XRD and TEM showed that antimicrobial agent incorporation can be achieved without greatly affecting the structure of the mesoporous silica. The modified mesoporous silica released LL-37 and chlorhexidine slowly, reaching maximum release after about 200 h. The release rate could also be controlled through incorporation of SH groups in the pore walls, adding to pore hydrophobicity and reducing the release rate by about 50% compared to the unmodified mesoporous silica. Mesoporous silica containing either LL-37 or chlorhexidine displayed potent bactericidal properties against both Gram-positive Staphylococcus aureus and Gram-negative Escherichia coli. While chlorhexidine-loaded mesoporous silica displayed an accompanying high toxicity, as judged from hemolysis, LDH release, and MTT assay, the corresponding material containing LL-37 showed very low toxicity by all these assays, comparable to that observed for mesoporous silica in the absence of antibacterial drug, as well as to the negative controls in the respective assays. Mesoporous silica containing LL-37 therefore holds potential as an implantable material or a surface coating for such materials, as it combines potent bactericidal action with low toxicity, important features for controlling implant-related infections, e.g., for multi-resistant pathogens or for cases where access to the infection site of systemically administered antibiotics is limited due to collagen capsule formation or other factors. PMID:19628277

  11. Distributions of noble metal Pd and Pt in mesoporous silica

    NASA Astrophysics Data System (ADS)

    Arbiol, J.; Cabot, A.; Morante, J. R.; Chen, Fanglin; Liu, Meilin

    2002-10-01

    Mesoporous silica nanostructures have been synthesized and loaded with Pd and Pt catalytic noble metals. It is found that Pd forms small nanoclusters (3-5 nm) on the surface of the mesoporous structure whereas Pt impregnation results in the inclusion of Pt nanostructures within the silica hexagonal pores (from nanoclusters to nanowires). It is observed that these materials have high catalytic properties for CO-CH4 combustion, even in a thick film form. In particular, results indicate that the Pt and Pd dispersed in mesoporous silica are catalytically active as a selective filter for gas sensors.

  12. Designed synthesis of Graphene @titania @mesoporous silica hybrid material as size-exclusive metal oxide affinity chromatography platform for selective enrichment of endogenous phosphopeptides.

    PubMed

    Yao, Jizong; Sun, Nianrong; Deng, Chunhui; Zhang, Xiangming

    2016-04-01

    In this work, a novel size-exclusive metal oxide affinity chromatography (SE-MOAC) platform was built for phosphoproteome research. The operation for preparing graphene @titania @mesoporous silica nanohybrids (denoted as G@TiO2@mSiO2) was facile and easy to conduct by grafting titania nanoparticles on polydopamine (PD)-covered graphene, following a layer of mesoporous silica was coated on the outermost layer. The G@TiO2@mSiO2 nanohybrids exhibited high sensitivity with a low detection limit of 5 amol/μL (a total amount of 1 fmol) and high selectivity for phosphopeptides at a mass ratio of phosphopeptides to non-phosphopeptides (1:1000). The size-exclusive capability of the nanohybrids were also demonstrated by enriching the phosphopeptides from the mixture of Bovine Serum Albumin (BSA), α-casein, and β-casein digests with a high mass ratio (β-casein digests: α-casein: BSA, 1:500:500), which was attributed to the large surface area and ordered mesoporous channels. In addition, the G@TiO2@mSiO2 nanohybrids were employed to capture the endogenous phosphopeptides from human serum successfully. PMID:26838411

  13. Functionalized bimodal mesoporous silicas as carriers for controlled aspirin delivery

    SciTech Connect

    Gao Lin; Sun Jihong; Li Yuzhen

    2011-08-15

    The bimodal mesoporous silica modified with 3-aminopropyltriethoxysilane was performed as the aspirin carrier. The samples' structure, drug loading and release profiles were characterized with X-ray diffraction, scanning electron microscopy, N{sub 2} adsorption and desorption, Fourier transform infrared spectroscopy, TG analysis, elemental analysis and UV-spectrophotometer. For further exploring the effects of the bimodal mesopores on the drug delivery behavior, the unimodal mesoporous material MCM-41 was also modified as the aspirin carrier. Meantime, Korsmeyer-Peppas equation f{sub t}=kt{sup n} was employed to analyze the dissolution data in details. It is indicated that the bimodal mesopores are beneficial for unrestricted drug molecules diffusing and therefore lead to a higher loading and faster releasing than that of MCM-41. The results show that the aspirin delivery properties are influenced considerably by the mesoporous matrix, whereas the large pore of bimodal mesoporous silica is the key point for the improved controlled-release properties. - Graphical abstract: Loading (A) and release profiles (B) of aspirin in N-BMMs and N-MCM-41 indicated that BMMs have more drug loading capacity and faster release rate than that MCM-41. Highlights: > Bimodal mesoporous silicas (BMMs) and MCM-41 modified with amino group via post-treatment procedure. > Loading and release profiles of aspirin in modified BMMs and MCM-41. > Modified BMMs have more drug loading capacity and faster release rate than that modified MCM-41.

  14. (1)H relaxivity of water in aqueous suspensions of Gd(3+)-loaded NaY nanozeolites and AlTUD-1 mesoporous material: the influence of Si/Al ratio and pore size.

    PubMed

    Norek, Małgorzata; Neves, Isabel C; Peters, Joop A

    2007-07-23

    The results of a (1)H nuclear magnetic relaxation dispersion (NMRD) and EPR study on aqueous suspensions of Gd(3+)-loaded NaY nanozeolites and AlTUD-1 mesoporous material are described. Upon increase of the Si/Al ratio from 1.7 to 4.0 in the Gd(3+)-loaded zeolites, the relaxation rate per mM Gd(3+) (r1) at 40 MHz and 25 degrees C increases from 14 to 27 s(-)1 mM(-1). The NMRD and EPR data were fitted with a previously developed two-step model that considers the system as a concentrated aqueous solution of Gd(3+) in the interior of the zeolite that is in exchange with the bulk water outside the zeolite. The results show that the observed increase in relaxivity can mainly be attributed to the residence lifetime of the water protons in the interior of the material, which decreased from 0.3 to 0.2 micros, upon the increase of the Si/Al ratio. This can be explained by the decreased interaction of water with the zeolite walls as a result of the increased hydrophobicity. The importance of the exchange rate of water between the inside and the outside of the material was further demonstrated by the relatively high relaxivity (33 s(-1) mM(-1) at 40 MHz, 25 degrees C) observed for a suspension of the Gd(3+)-loaded mesoporous material AlTUD-1. Unfortunately, Gd(3+) leaches rather easily from that material, but not from the Gd(3+)-loaded NaY zeolites, which may have potential as contrast agents for magnetic resonance imaging. PMID:17589991

  15. Silica-based mesoporous nanoparticles for controlled drug delivery.

    PubMed

    Kwon, Sooyeon; Singh, Rajendra K; Perez, Roman A; Abou Neel, Ensanya A; Kim, Hae-Won; Chrzanowski, Wojciech

    2013-01-01

    Drug molecules with lack of specificity and solubility lead patients to take high doses of the drug to achieve sufficient therapeutic effects. This is a leading cause of adverse drug reactions, particularly for drugs with narrow therapeutic window or cytotoxic chemotherapeutics. To address these problems, there are various functional biocompatible drug carriers available in the market, which can deliver therapeutic agents to the target site in a controlled manner. Among the carriers developed thus far, mesoporous materials emerged as a promising candidate that can deliver a variety of drug molecules in a controllable and sustainable manner. In particular, mesoporous silica nanoparticles are widely used as a delivery reagent because silica possesses favourable chemical properties, thermal stability and biocompatibility. Currently, sol-gel-derived mesoporous silica nanoparticles in soft conditions are of main interest due to simplicity in production and modification and the capacity to maintain function of bioactive agents. The unique mesoporous structure of silica facilitates effective loading of drugs and their subsequent controlled release. The properties of mesopores, including pore size and porosity as well as the surface properties, can be altered depending on additives used to fabricate mesoporous silica nanoparticles. Active surface enables functionalisation to modify surface properties and link therapeutic molecules. The tuneable mesopore structure and modifiable surface of mesoporous silica nanoparticle allow incorporation of various classes of drug molecules and controlled delivery to the target sites. This review aims to present the state of knowledge of currently available drug delivery system and identify properties of an ideal drug carrier for specific application, focusing on mesoporous silica nanoparticles. PMID:24020012

  16. Silica-based mesoporous nanoparticles for controlled drug delivery

    PubMed Central

    Kwon, Sooyeon; Singh, Rajendra K; Perez, Roman A; Abou Neel, Ensanya A

    2013-01-01

    Drug molecules with lack of specificity and solubility lead patients to take high doses of the drug to achieve sufficient therapeutic effects. This is a leading cause of adverse drug reactions, particularly for drugs with narrow therapeutic window or cytotoxic chemotherapeutics. To address these problems, there are various functional biocompatible drug carriers available in the market, which can deliver therapeutic agents to the target site in a controlled manner. Among the carriers developed thus far, mesoporous materials emerged as a promising candidate that can deliver a variety of drug molecules in a controllable and sustainable manner. In particular, mesoporous silica nanoparticles are widely used as a delivery reagent because silica possesses favourable chemical properties, thermal stability and biocompatibility. Currently, sol-gel-derived mesoporous silica nanoparticles in soft conditions are of main interest due to simplicity in production and modification and the capacity to maintain function of bioactive agents. The unique mesoporous structure of silica facilitates effective loading of drugs and their subsequent controlled release. The properties of mesopores, including pore size and porosity as well as the surface properties, can be altered depending on additives used to fabricate mesoporous silica nanoparticles. Active surface enables functionalisation to modify surface properties and link therapeutic molecules. The tuneable mesopore structure and modifiable surface of mesoporous silica nanoparticle allow incorporation of various classes of drug molecules and controlled delivery to the target sites. This review aims to present the state of knowledge of currently available drug delivery system and identify properties of an ideal drug carrier for specific application, focusing on mesoporous silica nanoparticles. PMID:24020012

  17. Periodic Mesoporous Organosilica Nanorice

    NASA Astrophysics Data System (ADS)

    Mohanty, Paritosh; Landskron, Kai

    2009-02-01

    A periodic mesoporous organosilica (PMO) with nanorice morphology was successfully synthesized by a template assisted sol-gel method using a chain-type precursor. The PMO is composed of D and T sites in the ratio 1:2. The obtained mesoporous nanorice has a surface area of 753 m2 g-1, one-dimensional channels, and a narrow pore size distribution centered at 4.3 nm. The nanorice particles have a length of ca. 600 nm and width of ca. 200 nm.

  18. Drug Loading of Mesoporous Silicon

    NASA Astrophysics Data System (ADS)

    Moffitt, Anne; Coffer, Jeff; Wang, Mengjia

    2011-03-01

    The nanostructuring of crystalline solids with low aqueous solubilities by their incorporation into mesoporous host materials is one route to improve the bioavailability of such solids. Earlier studies suggest that mesoporous Si (PSi), with pore widths in the range of 5-50 nm, is a candidate for such an approach. In this presentation, we describe efforts to load curcumin into free-standing microparticles of PSi. Curcumin is a compound extracted from turmeric root, which is an ingredient of curry. Curucmin has shown activity against selected cancer cell lines, bacteria, and other medical conditions. However, curcumin has a very low bioavailability due to its extremely low water solubility (0.6 μ g/mL). Incorporation of curcumin was achieved by straightforward loading of the molten solid at 185circ; C. Loading experiments were performed using PSi particles of two different size ranges, 45-75 μ m and 150-250 μ m. Longer loading times and ratio of curcumin to PSi leads to a higher percentage of loaded curcumin in both PSi particle sizes (as determined by weight difference). The extent of curcumin crystallinity was assessed by x-ray diffraction (XRD). The solubility and release kinetics of loaded curcumin from the PSi was determined by extraction into water at 37circ; C, with analysis using UV-VIS spectrometry. NSF-REU and TCU.

  19. Nitrogen-Doped Ordered Mesoporous Anatase TiO2 Nanofibers as Anode Materials for High Performance Sodium-Ion Batteries.

    PubMed

    Wu, Ying; Liu, Xiaowu; Yang, Zhenzhong; Gu, Lin; Yu, Yan

    2016-07-01

    Nitrogen-doped ordered mesoporous TiO2 nanofibers (N-MTO) have been fabricated by electrospinning and subsequent nitridation treatment. The N-doping in TiO2 leads to the formation of Ti(3+) , resulting in the improved electron conductivity of TiO2 . In addition, one-dimensional (1D) N-MTO nanostructure possesses very short diffusion length of Na(+) /e(-) in N-MTO, easy access of electrolyte, and high conductivity transport of electrons along the percolating fibers. The N-MTO shows excellent sodium storage performance. PMID:27185585

  20. Energy Storage: Nitrogen-Doped Ordered Mesoporous Anatase TiO2 Nanofibers as Anode Materials for High Performance Sodium-Ion Batteries (Small 26/2016).

    PubMed

    Wu, Ying; Liu, Xiaowu; Yang, Zhenzhong; Gu, Lin; Yu, Yan

    2016-07-01

    On page 3522, Y. Yu and co-workers fabricate nitrogen-doped ordered mesoporous TiO2 nanofibers (denoted as N-MTO) by electrospinning and subsequent nitridation treatment. Nitrogen atoms are successfully doped into the TiO2 lattice, accompanied by the formation of Ti(3+) and oxygen vacancies, contributing to the improvement of electronic conductivity of TiO2 . When used as an anode for a sodium-ion battery, the N-MTO demonstrates excellent rate capability and superior long cycling performance. PMID:27383035

  1. Thermally stable crystalline mesoporous metal oxides with substantially uniform pores

    SciTech Connect

    Wiesner, Ulrich; Orilall, Mahendra Christopher; Lee, Jinwoo; DiSalvo, Jr., Francis J

    2015-01-27

    Highly crystalline metal oxide-carbon composites, as precursors to thermally stable mesoporous metal oxides, are coated with a layer of amorphous carbon. Using a `one-pot` method, highly crystalline metal oxide-carbon composites are converted to thermally stable mesoporous metal oxides, having highly crystalline mesopore walls, without causing the concomitant collapse of the mesostructure. The `one-pot` method uses block copolymers with an sp or sp 2 hybridized carbon containing hydrophobic block as structure directing agents which converts to a sturdy, amorphous carbon material under appropriate heating conditions, providing an in-situ rigid support which maintains the pores of the oxides intact while crystallizing at temperatures as high as 1000 deg C. A highly crystalline metal oxide-carbon composite can be heated to produce a thermally stable mesoporous metal oxide consisting of a single polymorph.

  2. Synthesis, characterization and catalytic activity of a novel mesoporous ZSM-5 zeolite

    SciTech Connect

    Ma, Yuanyuan; Hu, Jing; Jia, Lihua; Li, Zhifang; Kan, Qiubin; Wu, Shujie

    2013-05-15

    Highlights: ► Mesoporous ZSM-5 zeolites. ► The strong acidic intensity. ► High activity for the alkylation of phenol and tert-butyl alcohol. ► Remarkable hydrothermal stability. - Abstract: A novel mesoporous ZSM-5 zeolite was hydrothermally synthesized using glucose as a template. Characterizations by XRD, TEM and nitrogen isotherms indicated that ZSM-5 possessed worm-like mesoporous. {sup 27}Al-MAS-NMR and NH{sub 3}-TPD showed that the mesoporous ZSM-5 preserved tetrahedral coordination aluminum and stronger acidity than conventional mesoporous material. As-prepared mesoporous ZSM-5 was successfully used in alkylation reaction of phenol with tert-butanol and exhibited significantly high phenol conversion and 2,4-DTBP selectivity. In addition, the hydrothermal stability was also studied by boiling in water for 7 days and displayed good results.

  3. Nano-hard template synthesis of pure mesoporous NiO and its application for streptavidin protein immobilization.

    PubMed

    Wahab, Mohammad A; Darain, Farzana

    2014-04-25

    A simple and efficient immobilization of streptavidin protein (with hexa-histidine tag) onto the surface of mesoporous NiO is described. Before immobilization of streptavidin protein (with hexa-histidine tag) onto the surface of mesoporous NiO, we first synthesized well-organized mesoporous NiO by a nanocasting method using mesoporous silica SBA-15 as the hard template. Then, the well-organized mesoporous NiO particles were characterized by small angle x-ray diffraction (XRD), wide angle XRD, nitrogen adsorption/desorption, and transmission electron microscopy (TEM). TEM and small angle XRD suggested the formation of mesoporous NiO materials, whereas the wide angle XRD pattern of mesoporous NiO indicated that the nickel precursor had been transformed into crystalline NiO. The N2 sorption experiments demonstrated that the mesoporous NiO particles had a high surface area of 281 m2 g(-1), a pore volume of 0.51 cm3 g(-1) and a pore size of 4.8 nm. Next, the immobilization of streptavidin protein (with hexa-histidine tag) onto the surface of mesoporous NiO was studied. Detailed analysis using gel electrophoresis confirmed that this approach can efficiently bind his-tagged streptavidin onto the surface of mesoporous NiO material since the mesoporous NiO provides sufficient surface sites for the binding of streptavidin via non-covalent ligand binding with the histidine tag. PMID:24670980

  4. Synthesis and characterization of mesoporous zirconia and aluminated mesoporous zirconia

    NASA Astrophysics Data System (ADS)

    Zhao, Elizabeth Sun

    Synthesis of mesoporous zirconia has been performed by slowly hydrolyzing zirconium propoxide in the presence of anionic surfactants: namely, dodecyl phosphate or sulfate (P12 and Sf12) and hexadecyl sulfonate (So16) The zirconia. outgassed at 140--150°C has T-plot surface areas higher than 400 M2/g. This outgassing does not remove the surfactant. After calcination in air at 500°C and combustion of the surfactant, the mesoporous volume is reduced by a factor of about 2, whereas the pore wall material crystallizes in the tetragonal phase. The high-resolution electron microscopic study reveals the presence of a disorganized network of polygonal pores structure. It is suggested that the chemistry of the hydrolysis solution is instrumental in determining the pore structure. A schematic model in which the surfactant is a scaffold component is suggested in order to explain these results and the fixation of PO4, or SO4 in the walls may help to preserve the porous structure. It is very different from the templating mechanism. From the density obtained from phase transition temperature, and from the mesoporous volume (N2 adsorption), the thickness of the wall can be calculated as well as the pseudo-length of the pores. From the thickness, the T-plot area can be recalculated and agrees well with the measured T-plot surface area for the sample calcined at 500°C. Around 900°C, the walls become thicker and crystallizes into monoclinic zirconia without pore structure. In order to try to modify, the acidity of the mesoporous sulfated and oxo-phosphated zirconia, they were doped with aluminum. The sulfated zirconia only has a coating layer of amorphous alumina, while the phosphated zirconia has aluminum in the lattice and the alumina coat. A maximum ratio of Al/Zr ˜ 0.04 can be reached in the lattice. The introduction of aluminum into the lattice prevents the crystallization of the oxo-phosphate at 900°C, and helps to preserve the surface area and porosity of the sulfated

  5. Synthesis and characterization of mesoporous semiconductors and their energy applications

    NASA Astrophysics Data System (ADS)

    Kang, Chris Byung-hwa

    In this dissertation, we examine the structure and physical properties of mesoporous group IV materials. Two different synthetic routes were developed to synthesize mesoporous germanium powder and thin film mesoporous silicon. The structural of these materials was confirmed by various analytical techniques. The electrochemical behavior of mesoporous silicon was further explored for applications as anodes in lithium ion batteries. The thermal conductivity was also measured and the electrical conductivity was tuned for potential applications as thermoelectrics. Ordered nanostructured germanium composite materials were produced using solution-phase surfactant templating methods. Anionic germanium/surfactand frameworks with a 2-D hexagonal structure were prepared and then condensed to form zero-valent porous germanium using oxidative coupling. The majority of the cationic surfactant inside the pores can be removed, resulting in mesoporous germanium with surface areas up to 500 m2/g. Thin film of mesoporous silicon was produced from polymer template porous silica films at relatively low temperature (<700 C) using magnesium vapor as reducing agent. The final porous silicon retains its ordered cubic mesoporosity. The lithium ion cycling performance of mesoporous silicon anodes was then examined. Mesoporous silicon films formed directly on a metal current collector showed stable cycling with excellent coulomb efficiency over 3000 cycles with capacities up to 3000 mAh/g at cycling rates between 1C to 20C. The results indicate porous silicon material in this size scale can accommodate the volume expansion associated with Li alloying without cracking or loosing contact with the current collector. The thermal conductivity of mesoporous silicon was also measured using the 3 omega method. Periodic pores and grain boundaries enhance phonon scattering to dissipate thermal energy throughout the material, resulting in a decrease in the thermal conductivity by 3-5 orders of magnitude

  6. Application of mesoporous SiO2 layer as an insulating layer in high performance hole transport material free CH3NH3PbI3 perovskite solar cells

    NASA Astrophysics Data System (ADS)

    Cheng, Nian; Liu, Pei; Bai, Sihang; Yu, Zhenhua; Liu, Wei; Guo, Shi-Shang; Zhao, Xing-Zhong

    2016-07-01

    A mesoporous SiO2 layer is successfully introduced into the hole transport material free perovskite solar cells by spin-coating a SiO2 paste onto the TiO2 scaffold layer. This SiO2 layer can act as an insulating layer and effectively inhibit the charge recombination between the TiO2 layer and carbon electrode. The variation of power conversion efficiencies with the thickness of SiO2 layer is studied here. Under optimized SiO2 thickness, perovskite solar cell fabricated on the TiO2/SiO2 film shows a superior power conversion efficiency of ∼12% and exhibits excellent long time stability for 30 days.

  7. Samarium-doped mesoporous TiO2 nanoparticles with improved photocatalytic performance for elimination of gaseous organic pollutants

    NASA Astrophysics Data System (ADS)

    Tang, Jianting; Chen, Xiaomiao; Liu, Yu; Gong, Wei; Peng, Zhenshan; Cai, Tiejun; Luo, Lianjing; Deng, Qian

    2013-01-01

    Mesoporous TiO2 doped with different amounts of Sm were prepared via a sol-gel route with Pluronic P123 as template. The materials were characterized by X-ray diffraction, transmission electron microscopy, and N2 sorption experiments, etc. The photocatalytic activity of the mesoporous TiO2 was tested in elimination of gaseous methanol and acetone. The Sm doped mesoporous TiO2 have higher activity than those of the commercial photocatalyst (Degussa, P25) and Sm doped TiO2 counterparts without mesopore structure under ultraviolet light irradiation. A possible mechanism was proposed to account for the high photocatalytic activity of the Sm doped mesoporous TiO2. The superior activity of the Sm doped mesoporous TiO2 may be attributed to the synergic effect of the high surface area, mesopore structure and doped Sm species.

  8. Cobalt oxide and nitride particles supported on mesoporous carbons as composite electrocatalysts for dye-sensitized solar cells

    NASA Astrophysics Data System (ADS)

    Chen, Ming; Shao, Leng-Leng; Gao, Ze-Min; Ren, Tie-Zhen; Yuan, Zhong-Yong

    2015-07-01

    The composite electrocatalysts of cobalt oxide/mesoporous carbon and cobalt nitride/mesoporous carbon are synthesized via a convenient oxidation and subsequent ammonia nitridation of cobalt particles-incorporated mesoporous carbon, respectively. The cobalt oxide and nitride particles are uniformly imbedded in mesoporous carbon matrix, forming the unique composites with high surface area and mesopore architecture, and the resultant composites are evaluated as counter electrode materials, exhibiting good catalytic activity for the reduction of triiodide. The composites of cobalt nitride and mesoporous carbon are superior to the counterparts of cobalt oxide and mesoporous carbon in catalyzing the triiodide reduction, and the dye-sensitized solar cell with the composites achieves an optimum power conversion efficiency of 5.26%, which is comparable to the one based on the conventional Pt counter electrode (4.88%).

  9. Mesoporous hybrids containing Eu 3+ complexes covalently bonded to SBA-15 functionalized: Assembly, characterization and photoluminescence

    NASA Astrophysics Data System (ADS)

    Li Kong, Li; Yan, Bing; Li, Ying

    2009-07-01

    A novel series of luminescent mesoporous organic-inorganic hybrid materials has been prepared by linking Eu 3+ complexes to the functionalized ordered mesoporous SBA-15 which was synthesis by a co-condensation process of 1,3-diphenyl-1,3-propanepione (DBM) modified by the coupling agent 3-(triethoxysilyl)-propyl isocyanate (TEPIC), tetraethoxysilane (TEOS), Pluronic P123 surfactant as a template. It was demonstrated that the efficient intramolecular energy transfer in the mesoporous material Eu(DBMSi-SBA-15) 3phen mainly occurred between the modified DBM (named as DBM-Si) and the central Eu 3+ ion. So the Eu(DBMSi-SBA-15) 3phen showed characteristic emission of Eu 3+ ion under UV irradiation with higher luminescence quantum efficiency. Moreover, the mesoporous hybrid materials exhibited excellent thermal stability as the lanthanide complex was covalently bonded to the mesoporous matrix.

  10. Antibacterial mesoporous molecular sieves modified with polymeric N-halamine.

    PubMed

    Wang, Yingfeng; Li, Lin; Liu, Ying; Ren, Xuehong; Liang, Jie

    2016-12-01

    In this research, a new kind of porous N-halamine material with high antibacterial efficacies was prepared. Poly [5,5-dimethyl-3-(3'-triethoxysilylpropyl)-hydantoin] (PSPH), an N-halamine precursor, was synthesized and grafted onto the surface of mesoporous molecular sieves (SBA-15). The mesoporous molecular sieves modified with the N-halamine polymer could be rendered biocidal upon exposure to dilute household bleach. The modified mesoporous molecular sieves were characterized by SEM, TEM, FTIR, XPS, TGA, XRD and BET analysis. It was found that the PSPH has been successfully grafted on the surface of mesoporous molecular sieves, and the morphology and structure of the modified mesoporous molecular sieves were slightly affected. The N-halamine modified mesoporous molecular sieves showed excellent antibacterial property, and inactivated 100% of S. aureus and E. coli O157:H7 with 8.05 and 7.92 log reductions within 1min of contact, respectively. The modified SBA-15 with high-antibacterial efficiency has potential application in water treatment and biomaterials areas. PMID:27612805

  11. Monolithic Gyroidal Mesoporous Mixed Titanium–Niobium Nitrides

    PubMed Central

    2015-01-01

    Mesoporous transition metal nitrides are interesting materials for energy conversion and storage applications due to their conductivity and durability. We present ordered mixed titanium–niobium (8:2, 1:1) nitrides with gyroidal network structures synthesized from triblock terpolymer structure-directed mixed oxides. The materials retain both macroscopic integrity and mesoscale ordering despite heat treatment up to 600 °C, without a rigid carbon framework as a support. Furthermore, the gyroidal lattice parameters were varied by changing polymer molar mass. This synthesis strategy may prove useful in generating a variety of monolithic ordered mesoporous mixed oxides and nitrides for electrode and catalyst materials. PMID:25122534

  12. Mesoporous anatase TiO2 nanorods as thermally robust anode materials for Li-ion batteries: detailed insight into the formation mechanism.

    PubMed

    Seisenbaeva, Gulaim A; Nedelec, Jean-Marie; Daniel, Geoffrey; Tiseanu, Carmen; Parvulescu, Vasile; Pol, Vilas G; Abrego, Luis; Kessler, Vadim G

    2013-12-16

    Uniformly mesoporous and thermally robust anatase nanorods were produced with quantitative yield by a simple and efficient one-step approach. The mechanism of this process was revealed by insertion of Eu(3+) cations from the reaction medium as luminescent probes. The obtained structure displays an unusually high porosity, an active surface area of about 300 m(2) g(-1) and a specific capacity of 167 mA h g(-1) at a C/3 rate, making it attractive as an anode electrode for Li-ion batteries. An additional attractive feature is its remarkable thermal stability; heating to 400 °C results in a decrease in the active surface area to a still relatively high value of 110 m(2) g(-1) with conservation of open mesoporosity. Thermal treatment at 800 °C or higher, however, causes transformation into a non-porous rutile monolith, as commonly observed with nanoscale titania. PMID:24243542

  13. Actinide sequestration using self-assembled monolayers on mesoporous supports.

    PubMed

    Fryxell, Glen E; Lin, Yuehe; Fiskum, Sandy; Birnbaum, Jerome C; Wu, Hong; Kemner, Ken; Kelly, Shelley

    2005-03-01

    Surfactant templated synthesis of mesoporous ceramics provides a versatile foundation upon which to create high efficiency environmental sorbents. These nanoporous ceramic oxides condense a huge amount of surface area into a very small volume. The ceramic oxide interface is receptive to surface functionalization through molecular self-assembly. The marriage of mesoporous ceramics with self-assembled monolayer chemistry creates a powerful new class of environmental sorbent materials called self-assembled monolayers on mesoporous supports (SAMMS). These SAMMS materials are highly efficient sorbents whose interfacial chemistry can be fine-tuned to selectively sequester a specific target species, such as heavy metals, tetrahedral oxometalate anions, and radionuclides. Details addressing the design, synthesis, and characterization of SAMMS materials specifically designed to sequester actinides, of central importance to the environmental cleanup necessary after 40 years of weapons-grade plutonium production, as well as evaluation of their binding affinities and kinetics are presented. PMID:15787373

  14. Actinide Sequestration Using Self-Assembled Monolayers on Mesoporous Supports

    SciTech Connect

    Fryxell, Glen E.; Lin, Yuehe; Fiskum, Sandra K.; Birnbaum, Jerome C.; Wu, Hong; Kemner, K. M.; Kelly, Shelley

    2005-03-01

    Surfactant templated synthesis of mesoporous ceramics provides a versatile foundation upon which to create high efficiency environmental sorbents. These nanoporous ceramic oxides condense a huge amount of surface area into a very small volume. The ceramic oxide interface is receptive to surface functionalization through molecular self-assembly. The marriage of mesoporous ceramics with self-assembled monolayer chemistry creates a powerful new class of environmental sorbent materials called self-assembled monolayers on mesoporous supports (SAMMS). These SAMMS materials are highly efficient sorbents, whose interfacial chemistry can be fine-tuned to selectively sequester a specific target species, such as heavy metals, tetrahedral oxometallate anions and radionuclides. Details addressing the design, synthesis and characterization of SAMMS materials specifically designed to sequester actinides, of central importance to the environmental clean-up necessary after 40 years of weapons grade plutonium production, as well as evaluation of their binding affinities and kinetics are presented.

  15. Silica-based mesoporous nanobiomaterials as promoter of bone regeneration process.

    PubMed

    Shadjou, Nasrin; Hasanzadeh, Mohammad

    2015-11-01

    Silica-based mesostructured nanomaterials have emerged as a full family of biomaterials with tremendous potential to address the requirements for the bone regeneration process. This review focuses on more recent advances in bone regeneration process based on silica-based mesoporous biomaterials during 2012 to January 2015. In this review, we describe application of silica-based mesoporous mesostructured nanomaterials (possessing pore sizes in the range 2-50 nm) for the bone regeneration process. We summarize the preparation methods, the effect of mesopore templates and composition on the mesopore-structure characteristics, and different forms of these materials, including particles, fibers, spheres, scaffolds, and composites. The effect of structural and textural properties of mesoporous materials on the development of new biomaterials for treatment of different bone pathologies such as infection, osteoporosis, cancer, and so forth is discussed. In addition, silica-based mesoporous bioactive glass, as a potential drug/growth factor carrier, is reviewed, which includes the composition-structure-drug delivery relationship and the functional effect on the antibacteria and tissue-stimulation properties. Also, application of different mesoporous materials on construction of 3D macroporous scaffolds for bone tissue engineering was disused. Finally, this review discusses the possibility of covalently grafting different osteoinductive agents to the silica-based mesoporous scaffold surface that act as attracting signals for bone cells to promote the bone regeneration process. PMID:26011776

  16. Facile preparation of mesoporous carbon-silica-coated graphene for the selective enrichment of endogenous peptides.

    PubMed

    Zhang, Quanqing; Zhang, Qinghe; Xiong, Zhichao; Wan, Hao; Chen, Xiaoting; Li, Hongmei; Zou, Hanfa

    2016-01-01

    A sandwich-like composite composed of ordered mesoporous carbon-silica shell-coated graphene (denoted as graphene@mSiO2-C) was prepared by an in-situ carbonation strategy. A mesoporous silica shell was synthesized by a sol-gel method, and cetyltrimethyl ammonium bromide inside the mesopores were in-situ carbonized as a carbon source to obtain a carbon-silica shell. The resulting mesoporous carbon-silica material with a sandwich structure possesses a high surface area (600 m(2) g(-1)), large pore volume (0.587 cm(3) g(-1)), highly ordered mesoporous pore (3 nm), and high carbon content (30%). This material shows not only high hydrophobicity of graphene and mesoporous carbon but also a hydrophilic silica framework that ensures excellent dispersibility in aqueous solution. The material can capture many more peptides from bovine serum albumin tryptic digests than mesoporous silica shell-coated graphene, demonstrating great enrichment efficiency for peptides. Furthermore, the prepared composite was applied to the enrichment of low-abundance endogenous peptides in human serum. Based on Matrix-Assisted Laser Desorption/ Ionization Time of Flight Mass Spectrometry identification, the graphene@mSiO2-C could efficiently size-exclude proteins and enriches the low-abundant peptides on the graphene and mesoporous carbon. And based on the LC-MS/MS results, 892 endogenous peptides were obtained by graphene@mSiO2-C, hinting at its great potential in peptides analysis. PMID:26695263

  17. Mesoporous carbon nanomaterials as environmental adsorbents.

    PubMed

    Tripathi, Pranav K; Gan, Lihua; Liu, Mingxian; Rao, Nageswara N

    2014-02-01

    The transportation and diffusion of the guest objects or molecules in the porous carbon nanomaterials can be facilitated by reducing the pathway and resistance. The reduced pathway depends on the porous nature of carbon nanomaterials. Classification of porous carbon materials by the International Union of Pure and Applied Chemistry (IUPAC) has given a new opportunity to design the pores as per their applicability and to understand the mobility of ions, atoms, and molecules in the porous network of carbon materials and also advanced their countless applicability. However, synthesis of carbon nanomaterials with a desired porous network is still a great challenge. Although, remarkable developments have taken place in the recent years, control over the pores size and/or hierarchical porous architectures, especially in the synthesis of carbon nanospheres (CNSs) and ordered mesoporous carbon (OMCs) is still intriguing. The micro and mesoporous CNSs and OMCs have been prepared by a variety of procedures and over a wide range of compositions using various different surfactant templates and carbon precursors etc. The mechanisms of formation of micromesopore in the CNSs and OMCs are still evolving. On the other hand, the urge for adsorbents with very high adsorption capacities for removing contaminants from water is growing steadily. In this review, we address the state-of-the-art synthesis of micro and mesoporous CNSs and OMCs, giving examples of their applications for adsorptive removals of contaminants including our own research studies. PMID:24749459

  18. Polymer/mesoporous metal oxide composites

    NASA Astrophysics Data System (ADS)

    Ver Meer, Melissa Ann

    Understanding the nature of the interfacial region between an organic polymer matrix and an inorganic filler component is essential in determining how this region impacts the overall bulk properties of the organic/inorganic hybrid composite material. In this work, polystyrene was used as the model polymer matrix coupled with silica-based filler materials to investigate the nature of structure-property relationships in polymer composites. Initial work was conducted on synthesis and characterization of colloidal and mesoporous silica particles melt blended into the polystyrene matrix. Modification of the interface was accomplished by chemically bonding the silica particles with the polystyrene chains through polymerization from the particle surface via atom transfer radical polymerization. High molecular weight polystyrene chains were formed and bulk test samples were evaluated with increased thermal stability of the grafted polymer composite system versus equivalent melt blended polymer composites. Polymer grafting was also conducted from the internal pores of mesoporous silica, further improving the thermal stability of the composite system without degrading dynamic mechanical properties. Characterization of the polymer composites was conducted with gel permeation chromatography, transmission electron microscopy, thermogravimetric analysis and dynamic mechanical analysis. It was also discovered during the polystyrene-silica composite studies that amorphous polystyrene can possess a less mobile phase, evident in a second peak of the loss tangent (tan delta). The long annealing times necessitated by the mesoporous silica composites were replicated in as received polystyrene. This new, less mobile phase is of particular interest in determining the mobility of polymer chains in the interfacial region.

  19. Gyroidal mesoporous multifunctional nanocomposites via atomic layer deposition

    NASA Astrophysics Data System (ADS)

    Werner, Jörg G.; Scherer, Maik R. J.; Steiner, Ullrich; Wiesner, Ulrich

    2014-07-01

    We demonstrate the preparation of rationally designed, multifunctional, monolithic and periodically ordered mesoporous core-shell nanocomposites with tunable structural characteristics. Three-dimensionally (3D) co-continuous gyroidal mesoporous polymer monoliths are fabricated from a solution-based triblock terpolymer-resol co-assembly and used as the functional templates for the fabrication of free-standing core-shell carbon-titania composites using atomic layer deposition (ALD). The deposition depth into the torturous gyroidal nanonetwork is investigated as a function of ALD conditions and the resulting composites are submitted to different thermal treatments. Results suggest that ALD can homogenously coat mesoporous templates with well defined pore sizes below 50 nm and thicknesses above 10 μm. Structural tunability like titania shell thickness and pore size control is demonstrated. The ordered nanocomposites exhibit triple functionality; a 3D continuous conductive carbon core that is coated with a crystalline titania shell that in turn is in contact with a 3D continuous mesopore network in a compact monolithic architecture. This materials design is of interest for applications including energy conversion and storage. Gyroidal mesoporous titania monoliths can be obtained through simultaneous titania crystallization and template removal in air.We demonstrate the preparation of rationally designed, multifunctional, monolithic and periodically ordered mesoporous core-shell nanocomposites with tunable structural characteristics. Three-dimensionally (3D) co-continuous gyroidal mesoporous polymer monoliths are fabricated from a solution-based triblock terpolymer-resol co-assembly and used as the functional templates for the fabrication of free-standing core-shell carbon-titania composites using atomic layer deposition (ALD). The deposition depth into the torturous gyroidal nanonetwork is investigated as a function of ALD conditions and the resulting composites are

  20. Preparation of irregular mesoporous hydroxyapatite

    SciTech Connect

    Wang Hualin Zhai Linfeng; Li Yanhong; Shi Tiejun

    2008-06-03

    An irregular mesoporous hydroxyapatite (meso-HA), Ca{sub 10}(PO{sub 4}){sub 6}(OH){sub 2}, is successfully prepared from Ca(NO{sub 3}){sub 2}.4H{sub 2}O and NH{sub 4}H{sub 2}PO{sub 4} using surfactant cetyltrimethyl ammonium bromide (CTAB) as template. Fourier transform infrared spectroscopy (FTIR) and differential scanning calorimetry (DSC) results reveal that the positive head of CTAB is assembled on the surface precipitated HA and much NH{sub 4}{sup +} is enclosed in precipitated HA before calcination. Field scanning electron microscope (FSEM) reveals that there exist many interconnected pores throughout the HA reticular skeleton. Nitrogen adsorption-desorption experiment exhibits a mesoporous material type IV curve, and pore size distribution calculated from the desorption branch of the isotherms based on Barrett-Joyner-Halenda (BJH) model shows that most pores throughout the HA reticular skeleton are sized at about 40 nm, but the pores are not uniform on the whole, owning to decomposition of the 'organic' CTAB templating structures and ammonium salt enclosed in the precipitated HA. The specific surface area of irregular meso-HA is calculated to be 37.6 m{sup 2}/g according to the Brunauer-Emmett-Teller (BET) equation. Moreover, after polylactic acid/meso-HA (PLA/meso-HA) composites degraded 12 weeks in normal saline at 37 deg. C, the interconnected pores throughout the HA skeleton were enlarged and sized in micron degree, which resemble trabecular bone structure very much.

  1. Adsorption of mycotoxins in beverages onto functionalized mesoporous silicas

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Mycotoxins, natural toxins produced by fungi, are a global concern as contaminates of agricultural commodities. Exposure to these toxins can be reduced by the use of binding materials. Templated mesoporous silicas are promising materials with favorable adsorptive properties for dyes, ions, and toxin...

  2. Mesoporous Aluminosilicate Catalysts for the Selective Isomerization of n-Hexane: The Roles of Surface Acidity and Platinum Metal.

    PubMed

    Musselwhite, Nathan; Na, Kyungsu; Sabyrov, Kairat; Alayoglu, Selim; Somorjai, Gabor A

    2015-08-19

    Several types of mesoporous aluminosilicates were synthesized and evaluated in the catalytic isomerization of n-hexane, both with and without Pt nanoparticles loaded into the mesopores. The materials investigated included mesoporous MFI and BEA type zeolites, MCF-17 mesoporous silica, and an aluminum modified MCF-17. The acidity of the materials was investigated through pyridine adsorption and Fourier Transform-Infrared Spectroscopy (FT-IR). It was found that the strong Brönsted acid sites in the micropores of the zeolite catalysts facilitated the cracking of hexane. However, the medium strength acid sites on the Al modified MCF-17 mesoporous silica greatly enhanced the isomerization reaction. Through the loading of different amounts of Pt into the mesopores of the Al modified MCF-17, the relationship between the metal nanoparticles and acidic sites on the support was revealed. PMID:26168190

  3. Hierarchical Mesoporous Lithium-Rich Li[Li0.2Ni0.2Mn0.6]O2 Cathode Material Synthesized via Ice Templating for Lithium-Ion Battery.

    PubMed

    Li, Yu; Wu, Chuan; Bai, Ying; Liu, Lu; Wang, Hui; Wu, Feng; Zhang, Na; Zou, Yufeng

    2016-07-27

    Tuning hierarchical micro/nanostructure of electrode materials is a sought-after means to reinforce their electrochemical performance in the energy storage field. Herein, we introduce a type of hierarchical mesoporous Li[Li0.2Ni0.2Mn0.6]O2 microsphere composed of nanoparticles synthesized via an ice templating combined coprecipitation strategy. It is a low-cost, eco-friendly, and easily operated method using ice as a template to control material with homogeneous morphology and rich porous channels. The as-prepared material exhibits remarkably enhanced electrochemical performances with higher capacity, more excellent cycling stability and more superior rate property, compared with the sample prepared by conventional coprecipitation method. It has satisfactory initial discharge capacities of 280.1 mAh g(-1) at 0.1 C, 207.1 mAh g(-1) at 2 C, and 152.4 mAh g(-1) at 5 C, as well as good cycle performance. The enhanced electrochemical performance can be ascribed to the stable hierarchical microsized structure and the improved lithium-ion diffusion kinetics from the highly porous structure. PMID:27359202

  4. Plutonium complexation by phosphonate-functionalized mesoporous silica

    SciTech Connect

    Parsons-Moss, T; Schwaiger, L K; Hubaud, A; Hu, Y J; Tuysuz, H; Yang, P; Balasubramanian, K; Nitsche, H

    2010-10-27

    MCM-41-type mesoporous silica functionalized with the CMPO-based 'Ac-Phos' silane has been reported in the literature (1) to show good capacity as an acftinide sorbent material, with potential applications in environmental sequestration, aqueous waste separation and/or vitrification, and chemical sensing of actinides in solution. The study explores the complexation of Pu(IV and VI) and other selected actinides and lanthanides by SBA-15 type mesoporous silica functionalized with Ac-Phos. The Pu binding kinetics and binding capacity were determined for both the Ac-Phos functionalized and unmodified SBA-15. They analyzed the binding geometry and redox behavior of Pu(VI) by X-ray absorption spectroscopy (XAS). They discuss the synthesis and characterization of the functionalized mesoporous material, batch sorption experiments, and the detailed analyses of the actinide complexes that are formed. Structural measurements are paired with high-level quantum mechanical modeling to elucidate the binding mechanisms.

  5. Enhanced retention of aqueous transition metals in mesoporous silica

    NASA Astrophysics Data System (ADS)

    Nelson, J.; Bargar, J.; Brown, G. E.; Maher, K.

    2013-12-01

    Mesoporosity (2-50 nm diameter pores) is abundant within grain coatings and primary silicate minerals in natural environments. Mesopores often contribute significantly to total specific surface area and act as gateways for the transport of subsurface solutes, including nutrients and contaminants, between mineral surfaces and ambient fluids. However, the physiochemical mechanisms of sorption and transport within mesopores cannot be assumed to be the same as for macropores (>50 nm), because of confinement-induced changes in water properties, the structure of electrical double layers, solvation shells and dehydration rates of aquo ions, and the charge and reactive site densities of mineral surfaces. Despite the ubiquity of confined spaces in natural and industrial porous media, few studies have examined the molecular-scale mechanisms and geochemical reactions controlling meso-confinement phenomena in environmentally relevant materials. We conducted batch Zn sorption experiments using synthetic, controlled pore-size (i.e., 7.5-300 nm), metal-oxide beads as model geologic substrates. Comparison of Zn adsorbed onto macroporous and mesoporous silica beads indicates Zn adsorption capacity is increased in mesopores when normalized to surface area. In the presence of a background electrolyte (i.e., NaCl), Zn sorption capacity to macroporous silica is reduced; however, no significant difference in Zn sorption capacity on mesoporous silica was observed between the presence and absence of a background electrolyte. The effect of competing cations is indirect evidence that mesopores promote inner-sphere complexation and reduce outer-sphere complexation. EXAFS characterization of adsorbed zinc to macroporous silica matches that reported for low Zn coverages on silica (Roberts et al., JCIS, 2003), whereas a different spectrum is observed for the mesoporous case. Shell-by-shell fitting indicates that Zn is dominantly in octahedral coordination in macropores, as opposed to

  6. Design and functionalization of photocatalytic systems within mesoporous silica.

    PubMed

    Qian, Xufang; Fuku, Kojirou; Kuwahara, Yasutaka; Kamegawa, Takashi; Mori, Kohsuke; Yamashita, Hiromi

    2014-06-01

    In the past decades, various photocatalysts such as TiO2, transition-metal-oxide moieties within cavities and frameworks, or metal complexes have attracted considerable attention in light-excited catalytic processes. Owing to high surface areas, transparency to UV and visible light as well as easily modified surfaces, mesoporous silica-based materials have been widely used as excellent hosts for designing efficient photocatalytic systems under the background of environmental remediation and solar-energy utilization. This Minireview mainly focuses on the surface-chemistry engineering of TiO2/mesoporous silica photocatalytic systems and fabrication of binary oxides and nanocatalysts in mesoporous single-site-photocatalyst frameworks. Recently, metallic nanostructures with localized surface plasmon resonance (LSPR) have been widely studied in catalytic applications harvesting light irradiation. Accordingly, silver and gold nanostructures confined in mesoporous silica and their corresponding catalytic activity enhanced by the LSPR effect will be introduced. In addition, the integration of metal complexes within mesoporous silica materials for the construction of functional inorganic-organic supramolecular photocatalysts will be briefly described. PMID:24828540

  7. Hydrothermal synthesis of mesoporous metal oxide arrays with enhanced properties for electrochemical energy storage

    SciTech Connect

    Xiao, Anguo Zhou, Shibiao; Zuo, Chenggang; Zhuan, Yongbing; Ding, Xiang

    2015-01-15

    Highlights: • NiO mesoporous nanowall arrays are prepared via hydrothermal method. • Mesoporous nanowall arrays are favorable for fast ion/electron transfer. • NiO mesoporous nanowall arrays show good supercapacitor performance. - Abstract: Mesoporous nanowall NiO arrays are prepared by a facile hydrothermal synthesis method with a following annealing process. The NiO nanowall shows continuous mesopores ranging from 5 to 10 nm and grows vertically on the substrate forming a porous net-like structure with macropores of 20–300 nm. A plausible mechanism is proposed for the growth of mesoporous nanowall NiO arrays. As cathode material of pseudocapacitors, the as-prepared mesoporous nanowall NiO arrays show good pseudocapacitive performances with a high capacitance of 600 F g{sup −1} at 2 A g{sup −1} and impressive high-rate capability with a specific capacitance of 338 F g{sup −1} at 40 A g{sup −1}. In addition, the mesoporous nanowall NiO arrays possess good cycling stability. After 6000 cycles at 2 A g{sup −1}, a high capacitance of 660 F g{sup −1} is attained, and no obvious degradation is observed. The good electrochemical performance is attributed to its highly porous morphology, which provides large reaction surface and short ion diffusion paths, leading to enhanced electrochemical properties.

  8. Mesoporous hexagonal Co3O4 for high performance lithium ion batteries

    PubMed Central

    Su, Dawei; Xie, Xiuqiang; Munroe, Paul; Dou, Shixue; Wang, Guoxiu

    2014-01-01

    Mesoporous Co3O4 nanoplates were successfully prepared by the conversion of hexagonal β-Co(OH)2 nanoplates. TEM, HRTEM and N2 sorption analysis confirmed the facet crystal structure and inner mesoporous architecture. When applied as anode materials for lithium storage in lithium ion batteries, mesoporous Co3O4 nanocrystals delivered a high specific capacity. At 10 C current rate, as-prepared mesoporous Co3O4 nanoplates delivered a specific capacity of 1203 mAh/g at first cycle and after 200 cycles it can still maintain a satisfied value (330 mAh/g). From ex-situ TEM, SAED and FESEM observation, it was found that mesoporous Co3O4 nanoplates were reduced to Li2O and Co during the discharge process and re-oxidised without losing the mesoporous structure during charge process. Even after 100 cycles, mesoporous Co3O4 crystals still preserved their pristine hexagonal shape and mesoporous nanostructure. PMID:25283174

  9. Mesoporous silica nanoparticles in target drug delivery system: A review

    PubMed Central

    Bharti, Charu; Nagaich, Upendra; Pal, Ashok Kumar; Gulati, Neha

    2015-01-01

    Due to lack of specification and solubility of drug molecules, patients have to take high doses of the drug to achieve the desired therapeutic effects for the treatment of diseases. To solve these problems, there are various drug carriers present in the pharmaceuticals, which can used to deliver therapeutic agents to the target site in the body. Mesoporous silica materials become known as a promising candidate that can overcome above problems and produce effects in a controllable and sustainable manner. In particular, mesoporous silica nanoparticles (MSNs) are widely used as a delivery reagent because silica possesses favorable chemical properties, thermal stability, and biocompatibility. The unique mesoporous structure of silica facilitates effective loading of drugs and their subsequent controlled release of the target site. The properties of mesoporous, including pore size, high drug loading, and porosity as well as the surface properties, can be altered depending on additives used to prepare MSNs. Active surface enables functionalization to changed surface properties and link therapeutic molecules. They are used as widely in the field of diagnosis, target drug delivery, bio-sensing, cellular uptake, etc., in the bio-medical field. This review aims to present the state of knowledge of silica containing mesoporous nanoparticles and specific application in various biomedical fields. PMID:26258053

  10. Photocatalytic activity of a hierarchically macro/mesoporous titania.

    PubMed

    Wang, Xinchen; Yu, Jimmy C; Ho, Chunman; Hou, Yidong; Fu, Xianzhi

    2005-03-15

    Light-harvesting macroporous channels have been successfully incorporated into a mesoporous TiO(2) framework to increase its photocatalytic activity. This bimodal porous material was characterized by X-ray diffractometry in both low-angle and wide-angle ranges, N(2) adsorption-desorption analysis, scanning and transmission electron microscopy, FT-IR, and diffuse reflectance spectroscopy. Ethylene photodegradation in gas-phase medium was employed as a probe reaction to evaluate the photocatalytic reactivity of the catalysts. The results reveal that sintering temperature significantly affects the structural stability and photocatalytic activity of titania. The catalyst which calcined at 350 degrees C possessed an intact macro/mesoporous structure and showed photocatalytic reactivity about 60% higher than that of commercial P25 titania. When the sample was calcined at 500 degrees C, the macroporous structure was retained but the mesoporous structure was partly destroyed. Further heating at temperatures above 600 degrees C destroyed both macro- and mesoporous structures, accompanied by a loss in photocatalytic activity. The high photocatalytic performance of the intact macro/mesoporous TiO(2) may be explained by the existence of macrochannels that increase photoabsorption efficiency and allow efficient diffusion of gaseous molecules. PMID:15752052

  11. Magnetic properties of mesoporous cobalt-silica-alumina ternary mixed oxides

    SciTech Connect

    Pal, Nabanita; Seikh, Md. Motin; Bhaumik, Asim

    2013-02-15

    Mesoporous cobalt-silica-alumina mixed oxides with variable cobalt content have been synthesized through slow evaporation method by using Pluronic F127 non-ionic surfactant as template. N{sub 2} sorption analysis of the template-free mixed oxide samples revealed that these mesoporous materials have high BET surface areas together with large mesopores. Powder XRD, TEM, EDS, FT IR and EPR spectroscopic analysis have been employed to understand the nature of the mesophases, bonding and composition of the materials. Low temperature magnetic measurements of these mixed oxide materials show the presence of ferromagnetic correlation at elevated temperature though at low temperature paramagnetic to ferrimagnetic transition is observed. Highlights: Black-Right-Pointing-Pointer Mesoporous cobalt-silica-alumina ternary mixed oxides. Black-Right-Pointing-Pointer High surface area and mesoporosity in magnetic materials. Black-Right-Pointing-Pointer Ferromagnetic correlation at elevated temperature. Black-Right-Pointing-Pointer Low temperature paramagnetic to ferrimagnetic transition.

  12. FINAL REPORT. ACTINIDE-SPECIFIC INTERFACIAL CHEMISTRY OF MONOLAYER COATED MESOPOROUS CERAMICS

    EPA Science Inventory

    The objective of this program was the design, synthesis and evaluation of high-efficiency, high-capacity sorbent materials capable of selectively sequestering actinides and other radionuclides from complex aqueous mixtures. Self-assembled monolayers on mesoporous supports (SAMMS)...

  13. Container effect in nanocasting synthesis of mesoporous metal oxides.

    PubMed

    Sun, Xiaohong; Shi, Yifeng; Zhang, Peng; Zheng, Chunming; Zheng, Xinyue; Zhang, Fan; Zhang, Yichi; Guan, Naijia; Zhao, Dongyuan; Stucky, Galen D

    2011-09-21

    We report a general reaction container effect in the nanocasting synthesis of mesoporous metal oxides. The size and shape of the container body in conjunction with simply modifying the container opening accessibility can be used to control the escape rate of water and other gas-phase byproducts in the calcination process, and subsequently affect the nanocrystal growth of the materials inside the mesopore space of the template. In this way, the particle size, mesostructure ordering, and crystallinity of the final product can be systemically controlled. The container effect also explain some of the problems with reproducibility in previously reported results. PMID:21861449

  14. Diffusion NMR of Fluids Confined to Mesopores under High Pressures

    NASA Astrophysics Data System (ADS)

    Zeigermann, Philipp; Dvoyashkin, Muslim; Gläser, Roger; Valiullin, Rustem

    2011-03-01

    Supercritical fluids are extensively used in various chemical applications including processes involving porous solids. The knowledge of their transport in bulk as well as under spatial confinements is critical for modeling and optimizing chemical reactions. In this contribution, we describe a high-pressure cell designed for pulsed field gradient NMR studies of diffusion of supercritical solvents in mesoporous materials. Some preliminary results on diffusion properties of ethane in bulk phase and confined to pores of mesoporous silicon obtained in a broad range of pressures below and above the critical temperature are reported.

  15. Container Effect in Nanocasting Synthesis of Mesoporous Metal Oxides

    SciTech Connect

    Sun, Xiaohong; Shi, Yifeng; Zhang, Peng; Zheng, Chunming; Zheng, Xinyue; Zhang, Fan; Zhang, Yichi; Guan, Naijia; Zhao, Dongyuan; Stucky, Galen D.

    2011-08-23

    We report a general reaction container effect in the nanocasting synthesis of mesoporous metal oxides. The size and shape of the container body in conjunction with simply modifying the container opening accessibility can be used to control the escape rate of water and other gas-phase byproducts in the calcination process, and subsequently affect the nanocrystal growth of the materials inside the mesopore space of the template. In this way, the particle size, mesostructure ordering, and crystallinity of the final product can be systemically controlled. The container effect also explain some of the problems with reproducibility in previously reported results.

  16. Syntheses and applications of periodic mesoporous organosilica nanoparticles.

    PubMed

    Croissant, Jonas G; Cattoën, Xavier; Wong, Michel Chi Man; Durand, Jean-Olivier; Khashab, Niveen M

    2015-12-28

    Periodic Mesoporous Organosilica (PMO) nanomaterials are envisioned to be one of the most prolific subjects of research in the next decade. Similar to mesoporous silica nanoparticles (MSN), PMO nanoparticles (NPs) prepared from organo-bridged alkoxysilanes have tunable mesopores that could be utilized for many applications such as gas and molecule adsorption, catalysis, drug and gene delivery, electronics, and sensing; but unlike MSN, the diversity in chemical nature of the pore walls of such nanomaterials is theoretically unlimited. Thus, we expect that PMO NPs will attract considerable interest over the next decade. In this review, we will present a comprehensive overview of the synthetic strategies for the preparation of nanoscaled PMO materials, and then describe their applications in catalysis and nanomedicine. The remarkable assets of the PMO structure are also detailed, and insights are provided for the preparation of more complex PMO nanoplatforms. PMID:26585498

  17. Selective SERS Sensing Modulated by Functionalized Mesoporous Films.

    PubMed

    López-Puente, Vanesa; Angelomé, Paula C; Soler-Illia, Galo J A A; Liz-Marzán, Luis M

    2015-11-25

    A hybrid material comprising metal nanoparticles embedded in functionalized mesoporous thin films was constructed, and its use as a selective SERS-based sensor was demonstrated. The presence of specific functional groups in the pore network allows control over the surface chemistry of the pores, tuning the selectivity for specific molecules. Amino-functionalized hybrid mesoporous thin films were used in a proof of concept experiment, to discern the presence of methylene blue (MB) in mixtures with acid blue (AB), with no need for any sample pretreatment step. Selective detection of MB was possible through entrapment of AB in the mesoporous matrix, based on its high affinity for amino groups. The sensor selectivity can be tuned by varying the solution pH, rendering a pH responsive surface and thus, selective SERS-based sensing. The developed sensors allow specific detection of molecules in complex matrixes. PMID:26536368

  18. Syntheses and applications of periodic mesoporous organosilica nanoparticles

    NASA Astrophysics Data System (ADS)

    Croissant, Jonas G.; Cattoën, Xavier; Wong Chi Man, Michel; Durand, Jean-Olivier; Khashab, Niveen M.

    2015-12-01

    Periodic Mesoporous Organosilica (PMO) nanomaterials are envisioned to be one of the most prolific subjects of research in the next decade. Similar to mesoporous silica nanoparticles (MSN), PMO nanoparticles (NPs) prepared from organo-bridged alkoxysilanes have tunable mesopores that could be utilized for many applications such as gas and molecule adsorption, catalysis, drug and gene delivery, electronics, and sensing; but unlike MSN, the diversity in chemical nature of the pore walls of such nanomaterials is theoretically unlimited. Thus, we expect that PMO NPs will attract considerable interest over the next decade. In this review, we will present a comprehensive overview of the synthetic strategies for the preparation of nanoscaled PMO materials, and then describe their applications in catalysis and nanomedicine. The remarkable assets of the PMO structure are also detailed, and insights are provided for the preparation of more complex PMO nanoplatforms.

  19. Adsorption of vitamin E on mesoporous titania nanocrystals

    SciTech Connect

    Shih, C.J.; Lin, C.T.; Wu, S.M.

    2010-07-15

    Tri-block nonionic surfactant and titanium chloride were used as starting materials for the synthesis of mesoporous titania nanocrystallite powders. The main objective of the present study was to examine the synthesis of mesoporous titania nanocrystals and the adsorption of vitamin E on those nanocrystals using X-ray diffraction (XRD), transmission electron microscopy, and nitrogen adsorption and desorption isotherms. When the calcination temperature was increased to 300 {sup o}C, the reflection peaks in the XRD pattern indicated the presence of an anatase phase. The crystallinity of the nanocrystallites increased from 80% to 98.6% with increasing calcination temperature from 465 {sup o}C to 500 {sup o}C. The N{sub 2} adsorption data and XRD data taken after vitamin E adsorption revealed that the vitamin E molecules were adsorbed in the mesopores of the titania nanocrystals.

  20. Bifunctional mesoporous silicas with clearly distinguished localization of grafted groups

    NASA Astrophysics Data System (ADS)

    Roik, N. V.; Belyakova, L. A.

    2013-12-01

    Bifunctional mesoporous silicas with clearly distinguished localization of grafted groups on the surface of particles and inside their pores were obtained by means of sol-gel synthesis with postsynthetic vapor-phase treatment in vacuum. It was found that the synthesized materials have the hexagonally ordered porous structure typical of MCM-41 type silica.

  1. Mesoporous silica nanoparticles with organo-bridged silsesquioxane framework as innovative platforms for bioimaging and therapeutic agent delivery.

    PubMed

    Du, Xin; Li, Xiaoyu; Xiong, Lin; Zhang, Xueji; Kleitz, Freddy; Qiao, Shi Zhang

    2016-06-01

    Mesoporous silica material with organo-bridged silsesquioxane frameworks is a kind of synergistic combination of inorganic silica, mesopores and organics, resulting in some novel or enhanced physicochemical and biocompatible properties compared with conventional mesoporous silica materials with pure Si-O composition. With the rapid development of nanotechnology, monodispersed nanoscale periodic mesoporous organosilica nanoparticles (PMO NPs) and organo-bridged mesoporous silica nanoparticles (MSNs) with various organic groups and structures have recently been synthesized from 100%, or less, bridged organosilica precursors, respectively. Since then, these materials have been employed as carrier platforms to construct bioimaging and/or therapeutic agent delivery nanosystems for nano-biomedical application, and they demonstrate some unique and/or enhanced properties and performances. This review article provides a comprehensive overview of the controlled synthesis of PMO NPs and organo-bridged MSNs, physicochemical and biocompatible properties, and their nano-biomedical application as bioimaging agent and/or therapeutic agent delivery system. PMID:27017579

  2. "Bricks and mortar" self-assembly approach to graphitic mesoporous carbon nanocomposites

    SciTech Connect

    Fulvio, P. F.; Mayes, R.; Wang, X. Q.; Mahurin, S., M.; Bauer, J. C.; Presser, V.; McDonough, J.; Gogotsi, Y.; Dai, S.

    2011-04-20

    Mesoporous carbon materials do not have sufficient ordering at the atomic scale to exhibit good electronic conductivity. To date, mesoporous carbons having uniform mesopores and high surface areas have been prepared from partially-graphitizable precursors in the presence of templates. High temperature thermal treatments above 2000 °C, which are usually required to increase conductivity, result in a partial or total collapse of the mesoporous structures and reduced surface areas induced by growth of graphitic domains, limiting their applications in electric double layer capacitors and lithium-ion batteries. In this work, we successfully implemented a “brick-and-mortar” approach to obtain ordered graphitic mesoporous carbon nanocomposites with tunable mesopore sizes below 850 °C without using graphitization catalysts or high temperature thermal treatments. Phenolic resin-based mesoporous carbons act as mortar to highly conductive carbon blacks and carbon onions (bricks). The capacitance and resistivity of final materials can be tailored by changing the mortar to brick ratios.

  3. Mesoporous ZnS–NiS Nanocomposites for Nonenzymatic Electrochemical Glucose Sensors

    PubMed Central

    Wei, Chengzhen; Cheng, Cheng; Zhao, Junhong; Wang, Zhangtao; Wu, Haipeng; Gu, Kaiyue; Du, Weimin; Pang, Huan

    2015-01-01

    Mesoporous ZnS–NiS composites are prepared via ion- exchange reactions using ZnS as the precursor. The prepared mesoporous ZnS–NiS composite materials have large surface areas (137.9 m2 g−1) compared with the ZnS precursor. More importantly, the application of these mesoporous ZnS–NiS composites as nonenzymatic glucose sensors was successfully explored. Electrochemical sensors based on mesoporous ZnS–NiS composites exhibit a high selectivity and a low detection limit (0.125 μm) toward the oxidation of glucose, which can mainly be attributed to the morphological characteristics of the mesoporous structure with high specific surface area and a rational composition of the two constituents. In addition, the mesoporous ZnS–NiS composites coated on the surface of electrodes can be used to modify the mass transport regime, and this alteration can, in favorable circumstances, facilitate the amperometric discrimination between species. These results suggest that such mesoporous ZnS–NiS composites are promising materials for nonenzymatic glucose sensors. PMID:25861568

  4. Incorporation of anti-inflammatory agent into mesoporous silica.

    PubMed

    Braz, Wilson Rodrigues; Rocha, Natállia Lamec; de Faria, Emerson H; Silva, Márcio L A E; Ciuffi, Katia J; Tavares, Denise C; Furtado, Ricardo Andrade; Rocha, Lucas A; Nassar, Eduardo J

    2016-09-23

    The unique properties of macroporous, mesoporous, and microporous systems, including their ability to accommodate molecules of different sizes inside their pores and to act as drug delivery systems, have been the object of extensive studies. In this work, mesoporous silica with hexagonal structure was obtained by template synthesis via the sol-gel process. The resulting material was used as support to accommodate the anti-inflammatory agent indomethacin. The alkaline route was used to prepare the mesoporous silica; cetyltrimethylammonium bromide was employed as porogenic agent. The silica particles were functionalized with 3-aminopropyltriethoxysilane alkoxide (APTES) by the sol-gel post-synthesis method. Indomethacin was incorporated into the silica functionalized with APTES and into non-functionalized silica. The resulting systems were characterized by x-ray diffraction (XRD), specific area, infrared spectroscopy, and thermal analyses (TGA). XRD attested to formation of mesoporous silica with hexagonal structure. This structure remained after silica functionalization with APTES and incorporation of indomethacin. Typical infrared spectroscopy vibrations and organic material decomposition during TGA confirmed silica functionalization and drug incorporation. The specific surface area and pore volume of the functionalized material incorporated with indomethacin decreased as compared with the specific surface area and pore volume of the non-functionalized silica containing no drug, suggesting both the functionalizing agent and the drug were present in the silica. Cytotoxicity tests conducted on normal fibroblasts (GM0479A) cells attested that the silica matrix containing indomethacin was less toxic than the free drug. PMID:27533108

  5. Flash freezing route to mesoporous polymer nanofibre networks.

    PubMed

    Samitsu, Sadaki; Zhang, Rui; Peng, Xinsheng; Krishnan, Mohan Raj; Fujii, Yoshihisa; Ichinose, Izumi

    2013-01-01

    There are increasing requirements worldwide for advanced separation materials with applications in environmental protection processes. Various mesoporous polymeric materials have been developed and they are considered as potential candidates. It is still challenging, however, to develop economically viable and durable separation materials from low-cost, mass-produced materials. Here we report the fabrication of a nanofibrous network structure from common polymers, based on a microphase separation technique from frozen polymer solutions. The resulting polymer nanofibre networks exhibit large free surface areas, exceeding 300 m(2) g(-1), as well as small pore radii as low as 1.9 nm. These mesoporous polymer materials are able to rapidly adsorb and desorb a large amount of carbon dioxide and are also capable of condensing organic vapours. Furthermore, the nanofibres made of engineering plastics with high glass transition temperatures over 200 °C exhibit surprisingly high, temperature-dependent adsorption of organic solvents from aqueous solution. PMID:24145702

  6. Bone tissue engineering using silica-based mesoporous nanobiomaterials:Recent progress.

    PubMed

    Shadjou, Nasrin; Hasanzadeh, Mohammad

    2015-10-01

    Bone disorders are of significant concern due to increase in the median age of our population. It is in this context that tissue engineering has been emerging as a valid approach to the current therapies for bone regeneration/substitution. Tissue-engineered bone constructs have the potential to alleviate the demand arising from the shortage of suitable autograft and allograft materials for augmenting bone healing. Silica based mesostructured nanomaterials possessing pore sizes in the range 2-50 nm and surface reactive functionalities have elicited immense interest due to their exciting prospects in bone tissue engineering. In this review we describe application of silica-based mesoporous nanomaterials for bone tissue engineering. We summarize the preparation methods, the effect of mesopore templates and composition on the mesopore-structure characteristics, and different forms of these materials, including particles, fibers, spheres, scaffolds and composites. Also, the effect of structural and textural properties of mesoporous materials on development of new biomaterials for production of bone implants and bone cements was discussed. Also, application of different mesoporous materials on construction of manufacture 3-dimensional scaffolds for bone tissue engineering was discussed. It begins by giving the reader a brief background on tissue engineering, followed by a comprehensive description of all the relevant components of silica-based mesoporous biomaterials on bone tissue engineering, going from materials to scaffolds and from cells to tissue engineering strategies that will lead to "engineered" bone. PMID:26117771

  7. Phosphate adsorption on aluminum-impregnated mesoporous silicates: surface structure and behavior of adsorbents.

    PubMed

    Shin, Eun Woo; Han, James S; Jang, Min; Min, Soo-Hong; Park, Jae Kwang; Rowell, Roger M

    2004-02-01

    Phosphorus from excess fertilizers and detergents ends up washing into lakes, creeks, and rivers. This overabundance of phosphorus causes excessive aquatic plant and algae growth and depletes the dissolved oxygen supply in the water. In this study, aluminum-impregnated mesoporous adsorbents were tested for their ability to remove phosphate from water. The surface structure of the materials was investigated with X-ray diffraction (XRD), a N2 adsorption-desorption technique, Fourier transform-infrared (FT-IR), and X-ray photoelectron spectroscopy (XPS) to understand the effect of surface properties on the adsorption behavior of phosphate. The mesoporous materials were loaded with Al components by reaction with surface silanol groups. In the adsorption test, the Al-impregnated mesoporous materials showed fast adsorption kinetics as well as high adsorption capacities, compared with activated alumina. The uniform mesopores of the Al-impregnated mesoporous materials caused the diffusion rate in the adsorption process to increase, which in turn caused the fast adsorption kinetics. High phosphate adsorption capacities of the Al-impregnated mesoporous materials were attributed to not only the increase of surface hydroxyl density on Al oxide due to well-dispersed impregnation of Al components but also the decrease in stoichiometry of surface hydroxyl ions to phosphate by the formation of monodentate surface complexes. PMID:14968882

  8. Mesoporous MgO: Synthesis, physico-chemical, and catalytic properties

    NASA Astrophysics Data System (ADS)

    Maerle, A. A.; Kasyanov, I. A.; Moskovskaya, I. F.; Romanovsky, B. V.

    2016-06-01

    Mesoporous MgO was obtained via the hydrothermal synthesis using both ionogenic and non-ionogenic surfactants as structure-directing templates. The materials prepared were characterized by SEM, BET-N2, XRD, and TG-DTA techniques. MgO particles are spherical 20-μm aggregates of primary oxide particles well shaped as rectangular parallelepipeds. Magnesium oxide samples have the specific surface area of 290-400 m2/g and pore sizes of 3.3-4.1 nm. Their mesoporous structure remained unchanged after calcination up to 350°C. Catalytic activity of mesoporous MgO was studied in acetone condensation reaction.

  9. Synthesis of highly-ordered mesoporous carbon/silica nanocomposites and derivative hierarchically mesoporous carbon from a phenyl-bridged organosiloxane

    NASA Astrophysics Data System (ADS)

    Wu, Zhiwang; Pang, Jiebin; Lu, Yunfeng

    2009-11-01

    Mesoporous carbon/silica nanocomposites and derivative hierarchically mesoporous carbon have been prepared using 1,4-bis(triethoxysilyl)benzene (BTEB) as a precursor for a carbon/silica network and Pluronic P123 (HO(CH2CH2O)20(CH2CH(CH3)O)70(CH2CH2O)20H) as a template for highly-ordered hexagonal pores. Co-assembly of BTEB and P123 and subsequent carbonization results in a mesoporous carbon/silica nanocomposite with hexagonally oriented pores. Removal of the silica component in the carbon/silica network creates a second porosity in the network and results in hierarchically mesoporous carbon. The mesostructure of these materials was characterized by transmission electron microscopy (TEM), field-emission scanning electron microscopy (FE-SEM), powder X-ray diffraction (PXRD), and N2 sorption.

  10. Bovine Serum Albumin Adsorption in Mesoporous Titanium Dioxide: Pore Size and Pore Chemistry Effect.

    PubMed

    Liu, Chang; Guo, Yanhua; Hong, Qiliang; Rao, Chao; Zhang, Haijuan; Dong, Yihui; Huang, Liangliang; Lu, Xiaohua; Bao, Ningzhong

    2016-04-26

    Understanding the mechanism of protein adsorption and designing materials with high sensitivity, high specificity and fast response are critical to develop the next-generation biosensing and diagnostic platforms. Mesoporous materials with high surface area, tunable pores, and good thermal/hydrostatic stabilities are promising candidates in this field. Because of the excellent biocompatibility, titanium dioxide has received an increasing interest in the past decade for biomedical applications. In this work, we synthesized mesoporous titanium dioxide with controlled pore sizes (7.2-28.0 nm) and explored their application for bovine serum albumin (BSA) adsorption. Scanning electron microscopy (SEM), X-ray powder diffraction (XRD), Fourier transform infrared spectroscopy (FTIR), and nitrogen adsorption/desorption experiments were performed to characterize the mesoporous TiO2 samples before and after BSA adsorption. Isothermal microcalorimetry was applied to measure both the adsorption heat and conformation rearrangement heat of BSA in those mesopores. We also carried out thermogravimetry measurements to qualitatively estimate the concentration of hydroxyl groups, which plays an important role in stabilizing BSA in-pore adsorption. The adsorption stability was also examined by leaching experiments. The results showed that TiO2 mesopores can host BSA adsorption when their diameters are larger than the hydrodynamic size of BSA (∼9.5 nm). In larger mesopores studied, two BSA molecules were adsorbed in the same pores. In contrast to the general understanding that large mesopores demonstrate poor stabilities for protein adsorptions, the synthesized mesoporous TiO2 samples demonstrated good leaching stabilities for BSA adsorption. This is probably due to the combination of the mesoporous confinement and the in-pore hydroxyl groups. PMID:27048991

  11. Optically tunable chiral nematic mesoporous cellulose films.

    PubMed

    Schlesinger, Maik; Hamad, Wadood Y; MacLachlan, Mark J

    2015-06-21

    Demand for sustainable functional materials has never been larger. The introduction of functionality into pure cellulose might be one step forward in this field as it is one of the most abundant natural biopolymers. In this paper, we demonstrate a straightforward and scalable way to produce iridescent, mesoporous cellulose membranes with tunable colors and porosity. Concomitant assembly of cellulose nanocrystals (CNCs) and condensation of silica precursors results in CNC-silica composites with chiral nematic structures and tunable optical properties. Removal of the stabilizing silica matrix by alkaline or acid treatment gives access to novel chiral nematic mesoporous cellulose (CNMC) films. Importantly, the optical properties and the mesoporosity can be controlled by either varying the silica-to-CNC ratio, or by varying the substrate used during the evaporation-induced self-assembly process. In order to introduce additional functionality, CNMC has been used to stabilize gold nanoparticles with three different concentrations by wet impregnation. These materials are stable in water and can potentially function in sensors, tissue engineering or functional membranes. PMID:25972020

  12. Modified Mesoporous Silica for Efficient Siloxane Capture.

    PubMed

    Jafari, Tahereh; Jiang, Ting; Zhong, Wei; Khakpash, Nasser; Deljoo, Bahareh; Aindow, Mark; Singh, Prabhakar; Suib, Steven L

    2016-03-15

    In this study, octamethylcyclotetrasiloxane (D4) was removed by using a novel modified solid adsorbent of mesoporous silica. The adsorbent was synthesized using inverse micelles with some modifications in the synthesis process (temperature of gelation) and in the post treatment conditions (calcination temperature and heating rate) with a concomitant improvement of D4 uptake. This is the first report on regulating the textural properties of the mesoporous silica material UCT-14 to develop an active silica adsorbent. These adjustments resulted in an increase of the silica surface area from 391 to 798 m(2)·g(-1), which leads to a high capacity (686 mg·g(-1)) of D4-capture for the silica synthesized at 80 °C, calcined at 450 °C with the heating rate of 100 °C·min(-1) (Si-Syn80). This adsorbent showed comparable adsorption performance with the widely used commercial silica gel under dry and humid condition. Recyclability tests on the commercial silica gel and mesoporous silica synthesized at 120 °C and calcined at 450 °C with a heating rate of 100 °C·min(-1) (called Si-Syn120 or Si-450 or Si-100 °C·min(-1)) indicated that the Si-Syn120 (capacity drop 10%) is more efficient than silica gel (capacity drop 15%) after three cycles. Although, the presence of moisture (25%) in the nitrogen gas stream led to capacity reduction in both Si-Syn120 and commercial silica gel, the modified UCT-14 shows slightly better resistance to humid condition. PMID:26890152

  13. A cationic surfactant assisted selective etching strategy to hollow mesoporous silica spheres.

    PubMed

    Fang, Xiaoliang; Chen, Cheng; Liu, Zhaohui; Liu, Pengxin; Zheng, Nanfeng

    2011-04-01

    Hollow mesoporous silica spheres have recently attracted increasing attention. However, effective synthesis of uniform hollow mesoporous spheres with controllable well-defined pore structures for fundamental research and practical applications has remained a significant challenge. In this work, a straightforward and effective "cationic surfactant assisted selective etching" synthetic strategy was developed for the preparation of high-quality hollow mesoporous silica spheres with either wormhole-like or oriented mesoporous shell. The as-prepared hollow mesoporous silica spheres have large surface area, high pore volume, and controllable structure parameters. Our experiments demonstrated that cationic surfactant plays critical roles in forming the hollow mesoporous structure. A formation mechanism involving the etching of solid SiO(2) accelerated by cationic surfactant followed by the redeposition of dissolved silica species directed by cationic surfactant is proposed. Furthermore, the strategy can be extended as a general strategy to transform silica-coated composite materials into yolk-shell structures with either wormhole-like or oriented mesoporous shell. PMID:21305093

  14. Multifunctional mesoporous silica nanocomposite nanoparticles for theranostic applications.

    PubMed

    Lee, Ji Eun; Lee, Nohyun; Kim, Taeho; Kim, Jaeyun; Hyeon, Taeghwan

    2011-10-18

    Clever combinations of different types of functional nanostructured materials will enable the development of multifunctional nanomedical platforms for multimodal imaging or simultaneous diagnosis and therapy. Mesoporous silica nanoparticles (MSNs) possess unique structural features such as their large surface areas, tunable nanometer-scale pore sizes, and well-defined surface properties. Therefore, they are ideal platforms for constructing multifunctional materials that incorporate a variety of functional nanostructured materials. In this Account, we discuss recent progress by our group and other researchers in the design and fabrication of multifunctional nanocomposite nanoparticles based on mesoporous silica nanostructures for applications to simultaneous diagnosis and therapy. Versatile mesoporous silica-based nanocomposite nanoparticles were fabricated using various methods. Here, we highlight two synthetic approaches: the encapsulation of functional nanoparticles within a mesoporous silica shell and the assembly of nanoparticles on the surface of silica nanostructures. Various nanoparticles were encapsulated in MSNs using surfactants as both phase transfer agents and pore-generating templates. Using MSNs as a scaffold, functional components such as magnetic nanoparticles and fluorescent dyes have been integrated within these systems to generate multifunctional nanocomposite systems that maintain their individual functional characteristics. For example, uniform mesoporous dye-doped silica nanoparticles immobilized with multiple magnetite nanocrystals on their surfaces have been fabricated for their use as a vehicle capable of simultaneous magnetic resonance (MR) and fluorescence imaging and drug delivery. The resulting nanoparticle-incorporated MSNs were then tested in mice with tumors. These in vivo experiments revealed that these multifunctional nanocomposite nanoparticles were delivered to the tumor sites via passive targeting. These nanocomposite

  15. Synthesis of morphology-controllable mesoporous Co{sub 3}O{sub 4} and CeO{sub 2}

    SciTech Connect

    Wang Yangang; Wang Yanqin; Ren Jiawen; Mi Yan; Zhang Fengyuan; Li Changlin; Liu Xiaohui; Guo Yun; Guo Yanglong; Lu Guanzhong

    2010-02-15

    Recently, extensive works have been devoted to the morphology control of mesoporous materials with respect to their use in various applications. In this paper, we used two kinds of mesoporous silica, SBA-15 rods and spheres as hard templates to synthesize morphology-controllable mesoporous metal oxides. By carefully controlling the loading of metal precursors in the mesopores of the hard template, mesoporous Co{sub 3}O{sub 4} and CeO{sub 2} with different morphologies, such as micrometer-sized rod, hollow sphere, saucer-like sphere, and solid sphere were conveniently obtained. The structural properties of these materials were characterized by XRD, BET, SEM and TEM. In addition, it is found that the differences observed in the textural properties of the two mesoporous metal oxides nanocasted from the same template can be attributed to the properties of metal precursors and the interaction between metal oxide and SiO{sub 2}. Thus-obtained mesoporous metal oxides with such special morphologies may have a potential application in the field of environmental catalytic oxidation. - Graphical Abstract: Mesoporous Co{sub 3}O{sub 4} and CeO{sub 2} with different morphologies, such as micrometer-sized rod, hollow sphere, saucer-like sphere, and solid sphere were synthesized by nanocasting.

  16. Synthesis, characterization, and application of surface-functionalized ordered mesoporous nanoparticles

    SciTech Connect

    Chung, Po-Wen

    2009-12-15

    The dissertation begins with Chapter 1, which is a general introduction of the fundamental synthesis of mesoporous silica materials, the selective functionlization of mesoporous silica materials, and the synthesis of nanostructured porous materials via nanocasting. In Chapter 2, the thermo-responsive polymer coated mesoporous silica nanoparticles (MSN) was synthesized via surface-initated polymerization and exhibited unique partition activities in a biphasic solution with the thermally induced change. In Chapter 3, the monodispersed spherical MSN with different mesoporous structure (MCM-48) was developed and employed as a template for the synthesis of mesoporous carbon nanoparticles (MCN) via nanocasting. MCN was demonstrated for the delivery of membrane impermeable chemical agents inside the cells. The cellular uptake efficiency and biocompabtibility of MCN with human cervical cancer cells were also investigated. In addition to the biocompabtibility of MCN, MCN was demonstrated to support Rh-Mn nanoparticles for catalytic reaction in Chapter 4. Owing to the unique mesoporosity, Rh-Mn nanoparticles can be well distributed inside the mesoporous structure and exhibited interesting catalytic performance on CO hydrogenation. In Chapter 5, the synthesis route of the aforementioned MCM-48 MSN was discussed and investigated in details and other metal oxide nanoparticles were also developed via nanocasting by using MCM-48 MSN as a template. At last, there is a general conclusion summarized in Chapter 6.

  17. Impact of nanopore morphology on cell viability on mesoporous polymer and carbon surfaces.

    PubMed

    Chavez, Vicki L; Song, Lingyan; Barua, Sutapa; Li, Xinxin; Wu, Quanyan; Zhao, Dongyuan; Rege, Kaushal; Vogt, Bryan D

    2010-08-01

    Topography at the nanoscale can lead to dramatic changes in the adhesion of cells to surfaces and their subsequent viability. For biological applications, including tissue engineering and cell-based sensing, the large internal surface area of ordered mesoporous carbons provides an opportunity for enhanced sensitivity and performance, but the mesostructure also affects the topography of the material. In this work, we probe the viability and adhesion of osteoblasts on ordered mesoporous materials with different morphologies and matrix chemistries. FDU-15 (hexagonal) and FDU-16 (cubic) films were processed at either 350 degrees C (polymeric) or 800 degrees C (carbon) to provide these different materials. For the films processed at 350 degrees C, the cell adhesion was markedly improved on the mesoporous films in comparison to a dense film analog, consistent with many reports in the literature that nanostructuring of surfaces improves the viability and adhesion of osteoblasts. Conversely, osteoblast adhesion was reduced on the carbonized surfaces processed at 800 degrees C when ordered mesopores were introduced, particularly for the cubic mesostructure (FDU-16). We attribute the decrease in cell adhesion to the propensity of the ordered mesoporous carbon films to sorb organics from aqueous solution, which could lead to removal of adhesion-promoting compounds at the film surface. These results suggest that cell viability on mesoporous polymer and carbon films can be controlled through simple changes in the pyrolysis temperature. PMID:20144750

  18. Development and characterization of spin coated oxide films with mesoporous structure

    NASA Astrophysics Data System (ADS)

    Paik, Jong-Ah

    2003-10-01

    Mesoporous materials offer unique opportunities for applications requiring low density and low thermal conductivity due to high porosity with uniform pore size. The diversity of the sol-gel process to modify the inorganic framework around the pore structure extends the application of mesoporous materials to the fields of sensors and catalysis. This dissertation provides the first report in which mesoporous films were adapted for MEMS applications. Mesoporous SiO2 and Al2O3 films were prepared by spin coating using block copolymers as the structure-directing agents. The resulting films were over 50% porous with uniform pore size of 8 nm average diameter (+/-3 nm) and an extremely smooth surface. The unique mesoporous morphology leads to novel behavior including extremely high etching rates and the ability to etch underlying layers. Surface micromachining methods were used to fabricate such MEMS structures as micro bridges, cantilevers and membranes, from the mesoporous oxides. Research studies on spin-coated silica and hybrid organic-inorganic silica films addressed the question of how mesostructures generated from a block copolymer surfactant were affected by processing conditions. The hybrid system was synthesized using a one-step process in which MTES (methyltriethoxysilane) was combined with TEOS (tetraethylorthosilicate). Two separate ternary phase diagrams, one for the silica system and one for the hybrid system, were established. Both a hexagonal and a cubic pore structure were observed depending on the composition of the coating solutions, and high porosity was measured with films located at the transition region between two pore structures. Another topic investigated in this dissertation is the development of mesoporous materials with a crystallized oxide framework. An approach for synthesizing mesoporous alpha-Al2O3 powder was successfully developed. Mesoporous TiO2 films (anatase phase) were also successfully synthesized and these films show resistance to

  19. Mesoporous-silica films, fibers, and powders by evaporation

    DOEpatents

    Bruinsma, Paul J.; Baskaran, Suresh; Bontha, Jagannadha R.; Liu, Jun

    2008-05-06

    This invention pertains to surfactant-templated nanometer-scale porosity of a silica precursor solution and forming a mesoporous material by first forming the silica precursor solution into a preform having a high surface area to volume ratio, then rapid drying or evaporating a solvent from the silica precursor solution. The mesoporous material may be in any geometric form, but is preferably in the form of a film, fiber, powder or combinations thereof. The rapid drying or evaporation of solvent from the solution is accomplished by layer thinning, for example spin casting, liquid drawing, and liquid spraying respectively. Production of a film is by layer thinning, wherein a layer of the silica precursor solution is formed on a surface followed by removal of an amount of the silica precursor solution and leaving a geometrically thinner layer of the silica precursor solution from which the solvent quickly escapes via evaporation. Layer thinning may be by any method including but not limited to squeegeeing and/or spin casting. In powder formation by spray drying, the same conditions of fast drying exists as in spin-casting (as well as in fiber spinning) because of the high surface-area to volume ratio of the product. When a powder is produced by liquid spraying, the particles or micro-bubbles within the powder are hollow spheres with walls composed of mesoporous silica. Mesoporous fiber formation starts with a similar silica precursor solution but with an added pre-polymer making a pituitous mixture that is drawn into a thin strand from which solvent is evaporated leaving the mesoporous fiber(s).

  20. Mesoporous-silica films, fibers, and powders by evaporation

    DOEpatents

    Bruinsma, Paul J.; Baskaran, Suresh; Bontha, Jagannadha R.; Liu, Jun

    1999-01-01

    This invention pertains to surfactant-templated nanometer-scale porosity of a silica precursor solution and forming a mesoporous material by first forming the silica precursor solution into a preform having a high surface area to volume ratio, then rapid drying or evaporating a solvent from the silica precursor solution. The mesoporous material may be in any geometric form, but is preferably in the form of a film, fiber, powder or combinations thereof. The rapid drying or evaporation of solvent from the solution is accomplished by layer thinning, for example spin casting, liquid drawing, and liquid spraying respectively. Production of a film is by layer thinning, wherein a layer of the silica precursor solution is formed on a surface followed by removal of an amount of the silica precursor solution and leaving a geometrically thinner layer of the silica precursor solution from which the solvent quickly escapes via evaporation. Layer thinning may be by any method including but not limited to squeegeeing and/or spin casting. In powder formation by spray drying, the same conditions of fast drying exists as in spin-casting (as well as in fiber spinning) because of the high surface-area to volume ratio of the product. When a powder is produced by liquid spraying, the particles or micro-bubbles within the powder are hollow spheres with walls composed of mesoporous silica. Mesoporous fiber formation starts with a similar silica precursor solution but with an added pre-polymer making a pituitous mixture that is drawn into a thin strand from which solvent is evaporated leaving the mesoporous fiber(s).

  1. Mesoporous-silica films, fibers, and powders by evaporation

    DOEpatents

    Bruinsma, P.J.; Baskaran, S.; Bontha, J.R.; Liu, J.

    1999-07-13

    This invention pertains to surfactant-templated nanometer-scale porosity of a silica precursor solution and forming a mesoporous material by first forming the silica precursor solution into a preform having a high surface area to volume ratio, then rapid drying or evaporating a solvent from the silica precursor solution. The mesoporous material may be in any geometric form, but is preferably in the form of a film, fiber, powder or combinations thereof. The rapid drying or evaporation of solvent from the solution is accomplished by layer thinning, for example spin casting, liquid drawing, and liquid spraying respectively. Production of a film is by layer thinning, wherein a layer of the silica precursor solution is formed on a surface followed by removal of an amount of the silica precursor solution and leaving a geometrically thinner layer of the silica precursor solution from which the solvent quickly escapes via evaporation. Layer thinning may be by any method including but not limited to squeegeeing and/or spin casting. In powder formation by spray drying, the same conditions of fast drying exists as in spin-casting (as well as in fiber spinning) because of the high surface-area to volume ratio of the product. When a powder is produced by liquid spraying, the particles or micro-bubbles within the powder are hollow spheres with walls composed of mesoporous silica. Mesoporous fiber formation starts with a similar silica precursor solution but with an added pre-polymer making a pituitous mixture that is drawn into a thin strand from which solvent is evaporated leaving the mesoporous fiber(s). 24 figs.

  2. CO₂ adsorption on amine-functionalized periodic mesoporous benzenesilicas.

    PubMed

    Sim, Kyohyun; Lee, Nakwon; Kim, Joonseok; Cho, Eun-Bum; Gunathilake, Chamila; Jaroniec, Mietek

    2015-04-01

    CO2 adsorption was investigated on amine-functionalized mesoporous silica (SBA-15) and periodic mesoporous organosilica (PMO) samples. Hexagonally (p6mm) ordered mesoporous SBA-15 and benzene-PMO (BPMO) samples were prepared in the presence of Pluronic P123 block copolymer template under acidic conditions. Three kinds of amine-containing organosilanes and polyethylenimine were used to functionalize SBA-15 and BPMO. Small-angle X-ray scattering and nitrogen adsorption isotherms showed that these samples featured ordered mesostructure, high surface area, and narrow pore size distributions. Solid-state (13)C- and (29)Si cross-polarization magic-angle spinning NMR spectra showed chemical linkage between amine-containing modifiers and the surface of mesoporous materials. The chemically linked amine-containing modifiers were found to be on both the inner and outer surfaces. N-[3-(trimethoxysilyl)propyl]ethylenediamine-modified BPMO (A2-BPMO) sample exhibited the highest CO2 uptake (i.e., ∼3.03 mmol/g measured on a volumetric adsorption analyzer) and the fastest adsorption rate (i.e., ∼13 min to attain 90% of the maximum amount) among all the samples studied. Selectivity and reproducibility measurements for the A2-BPMO sample showed quite good performance in flowing N2 gas at 40 mL/min and CO2 gas of 60 mL/min at 25 °C. PMID:25742049

  3. Microporous-mesoporous carbons for energy storage synthesized by activation of carbonaceous material by zinc chloride, potassium hydroxide or mixture of them

    NASA Astrophysics Data System (ADS)

    Härmas, M.; Thomberg, T.; Kurig, H.; Romann, T.; Jänes, A.; Lust, E.

    2016-09-01

    Various electrochemical methods have been applied to establish the electrochemical characteristics of the electrical double layer capacitor (EDLC) consisting of the 1 M triethylmethylammonium tetrafluoroborate solution in acetonitrile and activated carbon based electrodes. Activated microporous carbon materials used for the preparation of electrodes have been synthesized from the hydrothermal carbonization product (HTC) prepared via hydrothermal carbonization process of D-(+)-glucose solution in H2O, followed by activation with ZnCl2, KOH or their mixture. Highest porosity and Brunauer-Emmett-Teller specific surface area (SBET = 2150 m2 g-1), micropore surface area (Smicro = 2140 m2 g-1) and total pore volume (Vtot = 1.01 cm3 g-1) have been achieved for HTC activated using KOH with a mass ratio of 1:4 at 700 °C. The correlations between SBET, Smicro, Vtot and electrochemical characteristics have been studied to investigate the reasons for strong dependence of electrochemical characteristics on the synthesis conditions of carbon materials studied. Wide region of ideal polarizability (ΔV ≤ 3.0 V), very short characteristic relaxation time (0.66 s), and high specific series capacitance (134 F g-1) have been calculated for the mentioned activated carbon material, demonstrating that this system can be used for completing the EDLC with high energy- and power densities.

  4. Enantioselective recognition at mesoporous chiral metal surfaces

    PubMed Central

    Wattanakit, Chularat; Côme, Yémima Bon Saint; Lapeyre, Veronique; Bopp, Philippe A.; Heim, Matthias; Yadnum, Sudarat; Nokbin, Somkiat; Warakulwit, Chompunuch; Limtrakul, Jumras; Kuhn, Alexander

    2014-01-01

    Chirality is widespread in natural systems, and artificial reproduction of chiral recognition is a major scientific challenge, especially owing to various potential applications ranging from catalysis to sensing and separation science. In this context, molecular imprinting is a well-known approach for generating materials with enantioselective properties, and it has been successfully employed using polymers. However, it is particularly difficult to synthesize chiral metal matrices by this method. Here we report the fabrication of a chirally imprinted mesoporous metal, obtained by the electrochemical reduction of platinum salts in the presence of a liquid crystal phase and chiral template molecules. The porous platinum retains a chiral character after removal of the template molecules. A matrix obtained in this way exhibits a large active surface area due to its mesoporosity, and also shows a significant discrimination between two enantiomers, when they are probed using such materials as electrodes. PMID:24548992

  5. Mesoporous hybrids containing Eu{sup 3+} complexes covalently bonded to SBA-15 functionalized: Assembly, characterization and photoluminescence

    SciTech Connect

    Kong Lili; Bing Yan; Ying Li

    2009-07-15

    A novel series of luminescent mesoporous organic-inorganic hybrid materials has been prepared by linking Eu{sup 3+} complexes to the functionalized ordered mesoporous SBA-15 which was synthesis by a co-condensation process of 1,3-diphenyl-1,3-propanepione (DBM) modified by the coupling agent 3-(triethoxysilyl)-propyl isocyanate (TEPIC), tetraethoxysilane (TEOS), Pluronic P123 surfactant as a template. It was demonstrated that the efficient intramolecular energy transfer in the mesoporous material Eu(DBMSi-SBA-15){sub 3}phen mainly occurred between the modified DBM (named as DBM-Si) and the central Eu{sup 3+} ion. So the Eu(DBMSi-SBA-15){sub 3}phen showed characteristic emission of Eu{sup 3+} ion under UV irradiation with higher luminescence quantum efficiency. Moreover, the mesoporous hybrid materials exhibited excellent thermal stability as the lanthanide complex was covalently bonded to the mesoporous matrix. - Graphical abstract: A novel organic-inorganic mesoporous luminescent hybrid materials is prepared by linking the binary and ternary Eu{sup 3+} complexes to the functionalized ordered mesoporous SBA-15 with the modified 1,3-diphenyl-1,3-propanepione (DBM) via a co-condensation process of tetraethoxysilane (TEOS) in the presence of Pluronic P123 surfactant as a template.

  6. Morphological Control of Multifunctional Mesoporous Silica Nanomaterials for Catalysis Applications

    SciTech Connect

    Seong Huh

    2004-12-19

    I found an efficient method to control the morphology of the organically monofunctionalized mesoporous silica materials by introducing different types of organoalkoxysilanes in a base-catalyzed co-condensation reaction. The monofunctionalized materials exhibit different particle morphologies relative to the pure MCM-41 material. The concentration dependence of the morphology is a critical factor to determine the final particle shape. A proposed mechanism of the shape evolution is also offered. After understanding the role of organoalkoxysilanes in producing various well-shaped nanomaterials, I also obtained a series of bifunctional mesoporous silica materials with certain particle morphology. A series of bifunctional mesoporous silica nanospheres (MSNs) whose physicochemical properties was investigated via solid state NMR techniques and Cu{sup 2+} adsorption capacity tests, The ratio of two different organic groups inside of mesopores of these MSNs could be fine-tuned. These MSNs serve as a useful model system to study substrate selectivity in catalytic reactions and sorption phenomena. For example, the Cu{sup 2+} adsorption capacity of these materials was dictated by the chemical nature of the mesopores generated by the different organic functional groups. An investigation of the substrate selectivity of the bifunctionalized MSNs in a competitive nitroaldol reaction using an equimolar amount of two competing 4-nitrobenzaldehyde derivatives was performed. Shape-controlled bifunctional MSNs were employed as the catalysts. The properties of the MSNs were investigated using various spectroscopic methods and electron microscopy. The more hydrophobic the surface organic groups are, the higher the ratio of hydrophobic final product. This is the first example to demonstrate the selection of substrate using physicochemical nature of the mesopore surface other than the conventional shape selection in zeolite systems. I also created a cooperative dual catalyst system that is

  7. Morphological control of multifunctionalized mesoporous silica nanomaterials for catalysis applications

    NASA Astrophysics Data System (ADS)

    Huh, Seong

    I found an efficient method to control the morphology of the organically monofunctionalized mesoporous silica materials by introducing different types of organoalkoxysilanes in a base-catalyzed co-condensation reaction. The monofunctionalized materials exhibit different particle morphologies relative to the pure MCM-41 material. The concentration dependence of the morphology is a critical factor to determine the final particle shape. A proposed mechanism of the shape evolution is also offered. After understanding the role of organoalkoxysilanes in producing various well-shaped nanomaterials, I also obtained a series of bifunctional mesoporous silica materials with certain particle morphology. A series of bifunctional mesoporous silica nanospheres (MSNs) whose physicochemical properties was investigated via solid state NMR techniques and Cu 2+ adsorption capacity tests. The ratio of two different organic groups inside of mesopores of these MSNs could be fine-tuned. These MSNs serve as a useful model system to study substrate selectivity in catalytic reactions and sorption phenomena. For example, the Cu2+ adsorption capacity of these materials was dictated by the chemical nature of the mesopores generated by the different organic functional groups. An investigation of the substrate selectivity of the bifunctionalized MSNs in a competitive nitroaldol reaction using an equimolar amount of two competing 4-nitrobenzaldehyde derivatives was performed. Shape-controlled bifunctional MSNs were employed as the catalysts. The properties of the MSNs were investigated using various spectroscopic methods and electron microscopy. The more hydrophobic the surface organic groups are, the higher the ratio of hydrophobic final product. This is the first example to demonstrate the selection of substrate using physicochemical nature of the mesopore surface other than the conventional shape selection in zeolite systems. I also created a cooperative dual catalyst system that is capable of

  8. Anion Binding in Self-Assembled Monolayers in Mesoporous Supports (SAMMS)

    SciTech Connect

    Mattigod, Shas V.; Fryxell, Glen E.; Parker, Kent E.

    2007-02-19

    The binding of various anions to cationic transition metal complexes lining the pores of mesoporous silica is characterized and correlated to anion basicity. By lining the pore surfaces of mesoporous silica with self-assembled monolayer of organosilanes terminated with chemically selective ligands, a powerful new class of heavy metal sorbents has been realized, called self-assembled monolayers on mesoporous supports (SAMMS) [1-18]. When this interfacial functionality is composed of cationic transition metal complexes, a valuable new class of anion exchange material came into being [19]. Yoshitake and co-workers, have extended this concept to include other transition metal cations in similar cationic complexes inside mesoporous silica [20-23]. Other amine-based ligands (including polymer-based systems) were also explored, and the highest binding capacity was found with the diethylenetriamine ligand [20]. This synthetic strategy allows the chemist to easily modify both the metal center and ligand field, thereby tailoring chemical selectivity at multiple levels.

  9. Synthesis of bifunctionalized mesoporous organosilica spheres for high-performance liquid chromatography.

    PubMed

    Zhu, Guiru; Yang, Qihua; Jiang, Dongmei; Yang, Jie; Zhang, Lei; Li, Ying; Li, Can

    2006-01-27

    Phenyl-functionalized mesoporous ethane-silicas with spherical morphology were synthesized by one-step co-condensation of phenyltrimethoxysilane (PTMS) and 1,2-bis(trimethoxysily)ethane (BTME) using a triblock copolymer EO(20)PO(70)EO(20) (P123) as template with the aid of a co-surfactant (cetyltrimethylammonium bromide, CTAB) and a co-solvent (ethanol) in acidic medium. Powder X-ray diffraction (XRD), nitrogen sorption measurement and scanning electron microscopy (SEM) show that phenyl-functionalized ethane-silica has wormhole-like mesostructure and perfect spherical morphology. The chemical stability of phenyl-functionalized mesoporous ethane-silica in basic medium is greatly improved owing to the ethane groups bridged in the mesoporous framework. This work also demonstrates that the phenyl-functionalized mesoporous ethane-silica spheres are excellent packing materials for potential application in the reversed-phase high-performance liquid chromatography (HPLC). PMID:16325828

  10. Synthesis and characterization of nanoparticulate MnS within the pores of mesoporous silica

    NASA Astrophysics Data System (ADS)

    Barry, Louse; Copley, Mark; Holmes, Justin D.; Otway, David J.; Kazakova, Olga; Morris, Michael A.

    2007-12-01

    Mesoporous silica was loaded with nanoparticulate MnS via a simple post-synthesis treatment. The mesoporous material that still contained surfactant was passivated to prevent MnS formation at the surface. The surfactant was extracted and a novel manganese ethylxanthate was used to impregnate the pore network. This precursor thermally decomposes to yield MnS particles that are smaller or equal to the pore size. The particles exhibit all three common polymorphs. The passivation treatment is most effective at lower loadings because at the highest loadings (SiO 2:MnS molar ratio of 6:1) large particles (>50 nm) form at the exterior of the mesoporous particles. The integrity of the mesoporous network is maintained through the preparation and high order is maintained. The MnS particles exhibit unexpected ferromagnetism at low temperatures. Strong luminescence of these samples is observed and this suggests that they may have a range of important application areas.

  11. Ordered mesoporous carbons obtained by a simple soft template method as sulfur immobilizers for lithium-sulfur cells.

    PubMed

    Moreno, Noelia; Caballero, Alvaro; Hernán, Lourdes; Morales, Julián; Canales-Vázquez, Jesús

    2014-08-28

    Carbon materials with ordered mesoporous structures were synthesized using soft template methods and then activated by CO2 treatment. Sulfur was incorporated in these carbons via a simple chemical deposition method in aqueous solutions and the resulting composites were tested as electrodes in Li-S cells. The electrochemical results showed that well-ordered mesoporous carbons perform better than those with a random mesopore arrangement (wormhole-like mesoporous structure). The mesopore ordering yields a framework of well-connected empty sites that results in an enhancement of both the charge carrier mobility and the reversibility of the electrochemical reaction. Although the activation with CO2 partially destroys the mesopore arrangement, which adversely affects the electrode performance, it notably increases the surface area and the micropore content which improves the connectivity between the mesopores. The final observation was an irrelevant effect of the activation process at low current densities. However, at higher rates the activated carbon composite delivered higher capacities. The hierarchical pore structure formed by micro- and mesopores should guarantee the required fast mobility of the Li(+). PMID:25019261

  12. Curcumin loaded mesoporous silica: an effective drug delivery system for cancer treatment.

    PubMed

    Kotcherlakota, Rajesh; Barui, Ayan Kumar; Prashar, Sanjiv; Fajardo, Mariano; Briones, David; Rodríguez-Diéguez, Antonio; Patra, Chitta Ranjan; Gómez-Ruiz, Santiago

    2016-03-01

    In the present study, we report the delivery of anti-cancer drug curcumin to cancer cells using mesoporous silica materials. A series of mesoporous silica material based drug delivery systems (S2, S4 and S6) were first designed and developed through the amine functionalization of KIT-6, MSU-2 and MCM-41 followed by the loading of curcumin. The curcumin loaded materials were characterized with several physico-chemical techniques and thoroughly screened on cancer cells to evaluate their in vitro drug delivery efficacy. All the curcumin loaded silica materials exhibited higher cellular uptake and inhibition of cancer cell viability compared to pristine curcumin. The effective internalization of curcumin in cancer cells through the mesoporous silica materials initiated the generation of intracellular reactive oxygen species and the down regulation of poly ADP ribose polymerase (PARP) enzyme levels compared to free curcumin leading to the activation of apoptosis. This study shows that the anti-cancer activity of curcumin can be potentiated by loading onto mesoporous silica materials. Therefore, we strongly believe that mesoporous silica based curcumin loaded drug delivery systems may have future potential applications for the treatment of cancers. PMID:26674254

  13. The unusual electrochemical characteristics of a novel three-dimensional ordered bicontinuous mesoporous carbon

    NASA Astrophysics Data System (ADS)

    Wang, Tao; Liu, Xiaoying; Zhao, Dongyuan; Jiang, Zhiyu

    2004-05-01

    The electrochemical properties of the ordered three-dimensional (3D) mesoporous carbon, synthesized by using mesoporous silica (FDU-5) as a hard template from an impregnation procedure, has been firstly explored as an anode material for lithium-ion batteries. The material presents uniform pore size of 7.4 nm, BET surface area of 750 m 2/g. As a novel nano-material C-FDU-5 shows almost constant resistance and Li + diffusion coefficient when the potential is lower than the critical potential. The material also presents a reversible capacity higher than that of carbon nanotubes, and can be charge/discharged at the large current rate.

  14. Immobilizing gold nanoparticles in mesoporous silica covered reduced graphene oxide: a hybrid material for cancer cell detection through hydrogen peroxide sensing.

    PubMed

    Maji, Swarup Kumar; Sreejith, Sivaramapanicker; Mandal, Amal Kumar; Ma, Xing; Zhao, Yanli

    2014-08-27

    A new kind of two-dimensional (2-D) hybrid material (RGO-PMS@AuNPs), fabricated by the immobilization of ultrasmall gold nanoparticles (AuNPs, ∼3 nm) onto sandwich-like periodic mesopourous silica (PMS) coated reduced graphene oxide (RGO), was employed for both electrocatalytic application and cancer cell detection. The hybrid-based electrode sensor showed attractive electrochemical performance for sensitive and selective nonenzymatic detection of hydrogen peroxide (H2O2) in 0.1 M phosphate buffered saline, with wide linear detection range (0.5 μM to 50 mM), low detection limit (60 nM), and good sensitivity (39.2 μA mM(-1) cm(-2)), and without any interference by common interfering agents. In addition, the sensor exhibited a high capability for glucose sensing and H2O2 detection in human urine. More interestingly, the hybrid was found to be nontoxic, and the electrode sensor could sensitively detect a trace amount of H2O2 in a nanomolar level released from living tumor cells (HeLa and HepG2). Because the hybrid presents significant properties for the detection of bioactive species and certain cancerous cells by the synergistic effect from RGO, PMS, and AuNPs, it could be able to serve as a versatile platform for biosensing, bioanalysis, and biomedical applications. PMID:25046127

  15. Mesoporous composite nickel cobalt oxide/graphene oxide synthesized via a template-assistant co-precipitation route as electrode material for supercapacitors

    NASA Astrophysics Data System (ADS)

    Xu, Yanjie; Wang, Lincai; Cao, Peiqi; Cai, Chuanlin; Fu, Yanbao; Ma, Xiaohua

    2016-02-01

    A simple co-precipitation method utilizing SDS (sodium dodecyl sulfate) as template and ammonia as precipitant is successfully employed to synthesize nickel cobalt oxide/graphene oxide (NiCo2O4/GO) composite. The as-prepared composite (NCG-10) exhibits a high capacitance of 1211.25 F g-1, 687 F g-1 at the current density of 1 A g-1, 10 A g-1 and good cycling ability which renders NCG-10 as promising electrode material for supercapacitors. An asymmetric supercapacitor (ASC) (full button cell) has been constructed with NCG-10 as positive electrode and lab-made reduced graphene oxide (rGO) as negative electrode. The fabricated NCG-10//rGO with an extended stable operational voltage of 1.6 V can deliver a high specific capacitance of 144.45 F g-1 at a current density of 1 A g-1. The as-prepared NCG-10//rGO demonstrates remarkable energy density (51.36 W h kg-1 at 1 A g-1), high power density (50 kW kg-1 at 20 A g-1). The retention of capacitance is 88.6% at the current density of 8 A g-1 after 2000 cycles. The enhanced capacitive performance can be attributed to the improved specific surface area and 3D open area of NCG-10 generated by the pores and channels with the substantial function of SDS.

  16. Chemistry of Mesoporous Organosilica in Nanotechnology: Molecularly Organic-Inorganic Hybridization into Frameworks.

    PubMed

    Chen, Yu; Shi, Jianlin

    2016-05-01

    Organic-inorganic hybrid materials aiming to combine the individual advantages of organic and inorganic components while overcoming their intrinsic drawbacks have shown great potential for future applications in broad fields. In particular, the integration of functional organic fragments into the framework of mesoporous silica to fabricate mesoporous organosilica materials has attracted great attention in the scientific community for decades. The development of such mesoporous organosilica materials has shifted from bulk materials to nanosized mesoporous organosilica nanoparticles (designated as MONs, in comparison with traditional mesoporous silica nanoparticles (MSNs)) and corresponding applications in nanoscience and nanotechnology. In this comprehensive review, the state-of-art progress of this important hybrid nanomaterial family is summarized, focusing on the structure/composition-performance relationship of MONs of well-defined morphology, nanostructure, and nanoparticulate dimension. The synthetic strategies and the corresponding mechanisms for the design and construction of MONs with varied morphologies, compositions, nanostructures, and functionalities are overviewed initially. Then, the following part specifically concentrates on their broad spectrum of applications in nanotechnology, mainly in nanomedicine, nanocatalysis, and nanofabrication. Finally, some critical issues, presenting challenges and the future development of MONs regarding the rational synthesis and applications in nanotechnology are summarized and discussed. It is highly expected that such a unique molecularly organic-inorganic nanohybrid family will find practical applications in nanotechnology, and promote the advances of this discipline regarding hybrid chemistry and materials. PMID:26936391

  17. Electronic Parameters of Mesoporous Silicon Upon Adsorption of Plant Viruses

    NASA Astrophysics Data System (ADS)

    Vashpanov, Yuriy; Son, Jung-Young; Kwack, Kae-Dal; Shin, Seung-Jung

    2008-06-01

    Changes in the electronic parameters of mesoporous silicon upon adsorption of nematodetransmitted polyhedral (NEPO) viruses of plant [tomato ringspot virus (TORSV), grapevine virus A (GVA), and grapevine fan leaf virus (GFLV)] measured at room temperature are investigated. The adsorption of these viruses affected essentially on the electronic characteristic of the porous material. The measurement of the electronic characteristics of porous silicon can be applied to the creation of detectors for the presence of viruses in a given environment.

  18. Application of surfactant-templated ordered mesoporous material as sorbent in micro-solid phase extraction followed by liquid chromatography-triple quadrupole mass spectrometry for determination of perfluorinated carboxylic acids in aqueous media.

    PubMed

    Lashgari, Maryam; Basheer, Chanbasha; Kee Lee, Hian

    2015-08-15

    In the present study, micro-solid phase extraction (µ-SPE) followed by liquid chromatography-triple tandem mass spectrometery (LC-MS/MS) was developed for the determination of perfluorocarboxylic acids (PFCAs) at trace levels in water samples. The µ-SPE device comprised of a porous polypropylene membrane bag containing 5mg sorbent. The membrane bag acted as a clean-up filter and prevented matrix compounds from interfering with the extraction process. Analysis was carried out by LC-MS/MS in negative electrospray ionization mode. MS/MS parameters were optimized for multiple reaction monitoring. Calcined and non-calcined MCM-41, as silica-ordered mesoporous materials, were used as sorbents in µ-SPE for the extraction of five PFCAs-perfluoropentanoic acid (PFPA), perfluoroheptanoic acid (PFHpA), perfluorooctanoic acid (PFOA), perfluorononanoic acid (PFNA), and perfluorodecanoic acid (PFDA)-from aqueous media. The performances of these two sorbents were compared with other sorbents such as octadecylsilane (C18) modified silica, HayeSep-A, HayeSep-B, and Porapak-R. It was found that non-calcined MCM-41 showed better extraction performance for the analytes considered. Parameters influencing extraction efficiency, such as desorption time, extraction time, desorption solvent, and salt concentration, were investigated. The effect of the matrix on MS signals (suppression or enhancement) was also evaluated. Only minor effects on ionization efficiencies were observed. The developed method proved to be convenient and offered good sensitivity and reproducibility. The limits of detection ranged from 0.02 to 0.08ng L(-1), with a relative standard deviations between 1.9 and 10.5. It was successfully applied to the extraction of PFCAs in river and rain water samples. As expected from the ubiquitous nature of PFCAs, contamination at low levels was detected for some analytes in the samples (with the highest concentration recorded for PFOA). Satisfactory relative recoveries ranging

  19. Synthesis of mesoporous nanocomposites for their application in solid oxide electrolysers cells: microstructural and electrochemical characterization.

    PubMed

    Torrell, M; Almar, L; Morata, A; Tarancón, A

    2015-01-01

    Fabrication routes for new SOEC mesoporous nanocomposite materials as electrodes are presented in this paper. NiO-CGO and SDC-SSC are described as possible new materials and their synthesis and the cell fabrication are discussed. The obtained materials are microstructurally characterised by SEM, TEM and XRD, where the mesoporous structures are observed and analysed. The obtained samples are electrochemically analysed by I-V polarisation curves and EIS analysis, showing a maximum current density of 330 mA cm(-2) at 1.7 V. A degradation of the cell performance is evidenced after a potentiostatic test at 1.4 V after more than 40 hours. Oxygen electrode delaminating is detected, which is most probably the main cause of ageing. Even taking into account the lack of durability of the fabricated cells, the mesoporous electrodes do not seem to be altered, opening the possibility for further studies devoted to this high stability material for SOEC electrodes. PMID:26212761

  20. Micelle-Template Synthesis of Nitrogen-Doped Mesoporous Graphene as an Efficient Metal-Free Electrocatalyst for Hydrogen Production

    PubMed Central

    Huang, Xiaodan; Zhao, Yufei; Ao, Zhimin; Wang, Guoxiu

    2014-01-01

    Synthesis of mesoporous graphene materials by soft-template methods remains a great challenge, owing to the poor self-assembly capability of precursors and the severe agglomeration of graphene nanosheets. Herein, a micelle-template strategy to prepare porous graphene materials with controllable mesopores, high specific surface areas and large pore volumes is reported. By fine-tuning the synthesis parameters, the pore sizes of mesoporous graphene can be rationally controlled. Nitrogen heteroatom doping is found to remarkably render electrocatalytic properties towards hydrogen evolution reactions as a highly efficient metal-free catalyst. The synthesis strategy and the demonstration of highly efficient catalytic effect provide benchmarks for preparing well-defined mesoporous graphene materials for energy production applications. PMID:25523276

  1. Micelle-Template Synthesis of Nitrogen-Doped Mesoporous Graphene as an Efficient Metal-Free Electrocatalyst for Hydrogen Production

    NASA Astrophysics Data System (ADS)

    Huang, Xiaodan; Zhao, Yufei; Ao, Zhimin; Wang, Guoxiu

    2014-12-01

    Synthesis of mesoporous graphene materials by soft-template methods remains a great challenge, owing to the poor self-assembly capability of precursors and the severe agglomeration of graphene nanosheets. Herein, a micelle-template strategy to prepare porous graphene materials with controllable mesopores, high specific surface areas and large pore volumes is reported. By fine-tuning the synthesis parameters, the pore sizes of mesoporous graphene can be rationally controlled. Nitrogen heteroatom doping is found to remarkably render electrocatalytic properties towards hydrogen evolution reactions as a highly efficient metal-free catalyst. The synthesis strategy and the demonstration of highly efficient catalytic effect provide benchmarks for preparing well-defined mesoporous graphene materials for energy production applications.

  2. Synthesis and Characterization of Periodic Mesoporous Organosilicas as Anion-Exchance Resins for Perrhenate Adsorption.

    SciTech Connect

    Lee, Byunghwan; Im, Hee-Jung; Luo, Huimin; Hagaman, Edward {Ed} W; Dai, Sheng

    2005-01-01

    A new methodology to immobilize ionic liquids through the use of a bridged silsesquioxane N-(3-triethoxysilylpropyl), N(3)-3-trimethoxysilylpropyl-4,5-dihydroimidazolium iodide that incorporates an ionic functionality for the assembly of novel periodic mesoporous organosilica (PMO) materials has been developed. The resulting PMO materials were investigated for use as novel anion exchange resins for the separation of perrhenate anions in aqueous solution. As compared with cetyltrimethylammonium chloride, 1-hexadecane-3-methylimidazolium bromide has been demonstrated to be a more efficient surfactant template for the generation of mesopores and surface areas for such PMO materials.

  3. Mesoporous titanium dioxide coating for metallic implants.

    PubMed

    Xia, Wei; Grandfield, Kathryn; Hoess, Andreas; Ballo, Ahmed; Cai, Yanling; Engqvist, Håkan

    2012-01-01

    A bioactive mesoporous titanium dioxide (MT) coating for surface drug delivery has been investigated to develop a multifunctional implant coating, offering quick bone bonding and biological stability. An evaporation induced self-assembly (EISA) method was used to prepare a mesoporous titanium dioxide coating of the anatase phase with BET surface area of 172 m(2)/g and average pore diameter of 4.3 nm. Adhesion tests using the scratch method and an in situ screw-in/screw-out technique confirm that the MT coating bonds tightly with the metallic substrate, even after removal from bone. Because of its high surface area, the bioactivity of the MT coating is much better than that of a dense TiO(2) coating of the same composition. Quick formation of hydroxyapatite (HA) in vitro can be related to enhance bonding with bone. The uptake of antibiotics by the MT coating reached 13.4 mg/cm(3) within a 24 h loading process. A sustained release behavior has been obtained with a weak initial burst. By using Cephalothin as a model drug, drug loaded MT coating exhibits a sufficient antibacterial effect on the material surface, and within millimeters from material surface, against E.coli. Additionally, the coated and drug loaded surfaces showed no cytotoxic effect on cell cultures of the osteoblastic cell line MG-63. In conclusion, this study describes a novel, biocompatiblemesoporous implant coating, which has the ability to induce HA formation and could be used as a surface drug-delivery system. PMID:21954047

  4. Interleaved mesoporous copper for the anode catalysis in direct ammonium borane fuel cells.

    PubMed

    Auxilia, Francis M; Tanabe, Toyokazu; Ishihara, Shinsuke; Saravanan, Govindachetty; Ramesh, Gubbala V; Matsumoto, Futoshi; Ya, Xu; Ariga, Katsuhiko; Dakshanamoorthy, Arivuoli; Abe, Hideki

    2014-06-01

    Mesoporous materials with tailored microstructures are of increasing importance in practical applications particularly for energy generation and/or storage. Here we report a mesoporous copper material (MS-Cu) can be prepared in a hierarchical microstructure and exhibit high catalytic performance for the half-cell reaction of direct ammonium borane (NH3BH3) fuel cells (DABFs). Hierarchical copper oxide (CuO) nanoplates (CuO Npls) were first synthesized in a hydrothermal condition. CuO Npls were then reduced at room temperature using water solution of sodium borohydride (NaBH4) to yield the desired mesoporous copper material, MS-Cu, consisting of interleaved nanoplates with a high density of mesopores. The surface of MS-Cu comprised high-index facets, whereas a macroporous copper material (MC-Cu), which was prepared from CuO Npls at elevated temperatures in a hydrogen stream, was surrounded by low-index facets with a low density of active sites. MS-Cu exhibited a lower onset potential and improved durability for the electro-oxidation of NH3BH3 than MC-Cu or copper particles because of the catalytically active mesopores on the interleaved nanoplates. PMID:24738410

  5. Using mesoporous carbon electrodes for brackish water desalination.

    PubMed

    Zou, Linda; Li, Lixia; Song, Huaihe; Morris, Gayle

    2008-04-01

    Electrosorptive deionisation is an alternative process to remove salt ions from the brackish water. The porous carbon materials are used as electrodes. When charged in low voltage electric fields, they possess a highly charged surface that induces adsorption of salt ions on the surface. This process is reversible, so the adsorbed salt ions can be desorbed and the electrode can be reused. In the study, an ordered mesoporous carbon (OMC) electrode was developed for electrosorptive desalination. The effects of pore arrangement pattern (ordered and random) and pore size distribution (mesopores and micropores) on the desalination performance was investigated by comparing OMC and activated carbon (AC). It were revealed from X-ray diffraction and N(2) sorption measurements that AC has both micropores and mesopores, whereas ordered mesopores are dominant in OMC. Their performance as potential electrodes to remove salt was evaluated by cyclic voltammetry (CV) and galvanostatic charge/discharge tests at a range of electrolyte concentrations and sweep rates. It is deduced that under the same electrochemical condition the specific capacitance values of OMC electrode (i.e. 133 F/g obtained from CV at a sweep rate of 1 mV/s in 0.1M NaCl solution) are larger than those of AC electrode (107 F/g), suggesting that the former has a higher desalting capacity than the latter. Furthermore, the OMC electrode shows a better rate capacity than the AC electrode. In addition, the desalination capacities were quantified by the batch-mode experiment at low voltage of 1.2V in 25 ppm NaCl solution (50 micros/cm conductivity). It was found that the adsorbed ion amounts of OMC and AC electrodes were 11.6 and 4.3 micromol/g, respectively. The excellent electrosorptive desalination performance of OMC electrode might be not only due to the suitable pore size (average of 3.3 nm) for the propagation of the salt ions, but also due to the ordered mesoporous structure that facilitates desorption of the

  6. Mesoporous Silica Nanoparticles and Films for Cargo Delivery

    NASA Astrophysics Data System (ADS)

    Guardado Alvarez, Tania Maria

    Mesoporous silica materials are well known materials that can range from films to nanoparticles. Mesoporous silica nanoparticles (MSNs) and mesoporous silica films have been of increasing interest among the scientific community for its use in cargo delivery. Silica provides ease of functionalization, a robust support and biocompatibility. Several methods have been used in order to give the mesoporous silica nanomaterials different qualities that render them a useful material with different characteristics. Among these methods is surface modification by taking advantage of the OH groups on the surface. When a molecule attached to the surface can act as a molecular machine it transforms the nanomaterial to act as delivery system that can be activated upon command. The work covered in this thesis focuses on the development and synthesis of different mesoporous silica materials for the purpose of trapping and releasing cargo molecules. Chapter 2 focuses in the photoactivation of "snap-top" stoppers over the pore openings of mesoporous silica nanoparticles that releases intact cargo molecules from the pores. The on-command release can be stimulated by either one UV photon or two coherent near-IR photons. Two-photon activation is particularly desirable for use in biological systems because it enables good tissue penetration and precise spatial control. Chapter 3 focuses on the design and synthesis of a nano-container consisting of mesoporous silica nanoparticles with the pore openings covered by "snap-top" caps that are opened by near-IR light. A photo transducer molecule that is a reducing agent in an excited electronic state is covalently attached to the system. Near IR two-photon excitation causes intermolecular electron transfer that reduces a disulfide bond holding the cap in place, thus allowing the cargo molecules to escape. The operation of the "snap-top" release mechanism by both one- and two photon is described. This system presents a proof of concept of a near

  7. A magnetic mesoporous silica nanoparticle-based drug delivery system for photosensitive cooperative treatment of cancer with a mesopore-capping agent and mesopore-loaded drug

    NASA Astrophysics Data System (ADS)

    Knežević, Nikola Ž.; Lin, Victor S.-Y.

    2013-01-01

    Lately, there has been a growing interest in anticancer therapy with a combination of different drugs that work by different mechanisms of action, which decreases the possibility that resistant cancer cells will develop. Herein we report on the development of a drug delivery system for photosensitive delivery of a known anticancer drug camptothecin along with cytotoxic cadmium sulfide nanoparticles from a magnetic drug nanocarrier. Core-shell nanoparticles consisting of magnetic iron-oxide-cores and mesoporous silica shells are synthesized with a high surface area (859 m2 g-1) and hexagonal packing of mesopores, which are 2.6 nm in diameter. The mesopores are loaded with anticancer drug camptothecin while entrances of the mesopores are blocked with 2-nitro-5-mercaptobenzyl alcohol functionalized CdS nanoparticles through a photocleavable carbamate linkage. Camptothecin release from this magnetic drug delivery system is successfully triggered upon irradiation with UV light, as measured by fluorescence spectroscopy. Photosensitive anticancer activity of the drug delivery system is monitored by viability studies on Chinese hamster ovarian cells. The treatment of cancer cells with drug loaded magnetic material leads to a decrease in viability of the cells due to the activity of capping CdS nanoparticles. Upon exposure to low power UV light (365 nm) the loaded camptothecin is released which induces additional decrease in viability of CHO cells. Hence, the capping CdS nanoparticles and loaded camptothecin exert a cooperative anticancer activity. Responsiveness to light irradiation and magnetic activity of the nanocarrier enable its potential application for selective targeted treatment of cancer.

  8. Molecular simulation of adsorption and transport in hierarchical porous materials.

    PubMed

    Coasne, Benoit; Galarneau, Anne; Gerardin, Corine; Fajula, François; Villemot, François

    2013-06-25

    Adsorption and transport in hierarchical porous solids with micro- (~1 nm) and mesoporosities (>2 nm) are investigated by molecular simulation. Two models of hierarchical solids are considered: microporous materials in which mesopores are carved out (model A) and mesoporous materials in which microporous nanoparticles are inserted (model B). Adsorption isotherms for model A can be described as a linear combination of the adsorption isotherms for pure mesoporous and microporous solids. In contrast, adsorption in model B departs from adsorption in pure microporous and mesoporous solids; the inserted microporous particles act as defects, which help nucleate the liquid phase within the mesopore and shift capillary condensation toward lower pressures. As far as transport under a pressure gradient is concerned, the flux in hierarchical materials consisting of microporous solids in which mesopores are carved out obeys the Navier-Stokes equation so that Darcy's law is verified within the mesopore. Moreover, the flow in such materials is larger than in a single mesopore, due to the transfer between micropores and mesopores. This nonzero velocity at the mesopore surface implies that transport in such hierarchical materials involves slippage at the mesopore surface, although the adsorbate has a strong affinity for the surface. In contrast to model A, flux in model B is smaller than in a single mesopore, as the nanoparticles act as constrictions that hinder transport. By a subtle effect arising from fast transport in the mesopores, the presence of mesopores increases the number of molecules in the microporosity in hierarchical materials and, hence, decreases the flow in the micropores (due to mass conservation). As a result, we do not observe faster diffusion in the micropores of hierarchical materials upon flow but slower diffusion, which increases the contact time between the adsorbate and the surface of the microporosity. PMID:23718554

  9. A Single-Step Synthesis of Electroactive Mesoporous ProDOT-Silica Structures.

    PubMed

    Kim, Jeonghun; Kim, Byeonggwan; Anand, Chokkalingam; Mano, Ajayan; Zaidi, Javaid S M; Ariga, Katsuhiko; You, Jungmok; Vinu, Ajayan; Kim, Eunkyoung

    2015-07-13

    The single-step preparation of highly ordered mesoporous silica hybrid nanocomposites with conjugated polymers was explored using a novel cationic 3,4-propylenedioxythiophene (ProDOT) surfactant (PrS). The method does not require high-temperature calcination or a washing procedure. The combination of self-assembly of the silica surfactant and in situ polymerization of the ProDOT tail is responsible for creation of the mesoporosity with ultralarge pores, large pore volume, and electroactivity. As this novel material exhibits excellent textural parameters together with electrical conductivity, we believe that this could find potential applications in various fields. This novel concept of creating mesoporosity without a calcination process is a significant breakthrough in the field of mesoporous materials and the method can be further generalized as a rational preparation of various mesoporous hybrid materials having different structures and pore diameters. PMID:26037244

  10. Synthesis, characterization and enhanced photoconductivity from a mesoporous titania on dye doping.

    PubMed

    Pal, Nabanita; Paul, Manidipa; Bera, Ashoke; Basak, Durga; Bhaumik, Asim

    2010-07-26

    New wormhole-like mesoporous TiO(2) material has been synthesized through a convenient sol-gel method in the presence of a Schiff base secondary amine hexadecyl-2-pyrrole-methylamine (HPMA) containing chelating donor sites as template or structure directing agent (SDA). SDA molecules can be easily removed from the composite to generate mesoporosity and upon removal of the SDA molecule, this mesoporous TiO(2) material showed very high surface area (480+/-10 m(2)/g) with an average pore diameter of 2.57+/-0.05 nm. When Rose Bengal dye is entrapped inside the nanopores of this material, it showed a drastic enhancement (ca. 40-folds) in the photoconductivity vis-à-vis mesoporous TiO(2) alone under white light illumination. PMID:20638505

  11. Chemoradiotherapeutic wrinkled mesoporous silica nanoparticles for use in cancer therapy

    SciTech Connect

    Munaweera, Imalka; Balkus, Kenneth J. Jr. E-mail: Anthony.DiPasqua@unthsc.edu; Koneru, Bhuvaneswari; Shi, Yi; Di Pasqua, Anthony J. E-mail: Anthony.DiPasqua@unthsc.edu

    2014-11-01

    Over the last decade, the development and application of nanotechnology in cancer detection, diagnosis, and therapy have been widely reported. Engineering of vehicles for the simultaneous delivery of chemo- and radiotherapeutics increases the effectiveness of the therapy and reduces the dosage of each individual drug required to produce an observable therapeutic response. We here developed a novel chemoradiotherapeutic 1,2-dioleoyl-sn-glycero-3-phosphocholine lipid coated/uncoated platinum drug loaded, holmium-containing, wrinkled mesoporous silica nanoparticle. The materials were characterized with TEM, FTIR, {sup 1}H NMR, energy dispersive x-ray, inductively coupled plasma-mass spectrometry, and zeta potential measurements. In vitro platinum drug release from both lipid coated and uncoated chemoradiotherapeutic wrinkled mesoporous silica are reported. Various kinetic models were used to analyze the release kinetics. The radioactivity of the chemoradiotherapeutic nanocarriers was measured after neutron-activation.

  12. Chemoradiotherapeutic wrinkled mesoporous silica nanoparticles for use in cancer therapy

    NASA Astrophysics Data System (ADS)

    Munaweera, Imalka; Koneru, Bhuvaneswari; Shi, Yi; Di Pasqua, Anthony J.; Balkus, Kenneth J., Jr.

    2014-11-01

    Over the last decade, the development and application of nanotechnology in cancer detection, diagnosis, and therapy have been widely reported. Engineering of vehicles for the simultaneous delivery of chemo- and radiotherapeutics increases the effectiveness of the therapy and reduces the dosage of each individual drug required to produce an observable therapeutic response. We here developed a novel chemoradiotherapeutic 1,2-dioleoyl-sn-glycero-3-phosphocholine lipid coated/uncoated platinum drug loaded, holmium-containing, wrinkled mesoporous silica nanoparticle. The materials were characterized with TEM, FTIR, 1H NMR, energy dispersive x-ray, inductively coupled plasma-mass spectrometry, and zeta potential measurements. In vitro platinum drug release from both lipid coated and uncoated chemoradiotherapeutic wrinkled mesoporous silica are reported. Various kinetic models were used to analyze the release kinetics. The radioactivity of the chemoradiotherapeutic nanocarriers was measured after neutron-activation.

  13. Chemical Insight into the Adsorption of Chromium(III) on Iron Oxide/Mesoporous Silica Nanocomposites.

    PubMed

    Egodawatte, Shani; Datt, Ashish; Burns, Eric A; Larsen, Sarah C

    2015-07-14

    Magnetic iron oxide/mesoporous silica nanocomposites consisting of iron oxide nanoparticles embedded within mesoporous silica (MCM-41) and modified with aminopropyl functional groups were prepared for application to Cr(III) adsorption followed by magnetic recovery of the nanocomposite materials from aqueous solution. The composite materials were extensively characterized using physicochemical techniques, such as powder X-ray diffraction, thermogravimetric and elemental analysis, nitrogen adsorption, and zeta potential measurements. For aqueous Cr(III) at pH 5.4, the iron oxide/mesoporous silica nanocomposite exhibited a superior equilibrium adsorption capacity of 0.71 mmol/g, relative to 0.17 mmol/g for unmodified mesoporous silica. The aminopropyl-functionalized iron oxide/mesoporous silica nanocomposites displayed an equilibrium adsorption capacity of 2.08 mmol/g, the highest adsorption capacity for Cr(III) of all the materials evaluated in this study. Energy-dispersive spectroscopy (EDS) with transmission electron microscopy (TEM) and X-ray photoelectron spectroscopy (XPS) experiments provided insight into the chemical nature of the adsorbed chromium species. PMID:26134074

  14. Chemistry of alkali cation exchanged faujasite and mesoporous NaX using alkyl halides and phosphates

    NASA Astrophysics Data System (ADS)

    Lee, Min-Hong

    The purpose of this work was to increase the reactivity of Faujasite X (NaX) zeolite toward the reactive decontamination of materials subject to nucleophilic attack by means of zeolite cation optimization and by means of the synthesis of mesoporous Faujasite X. Primary alkyl halides and trialkyl phosphates have been the test materials on which the cation-optimized and mesoporous zeolites have been tested. In the alkali cation optimization work, reactions of methyl iodide and 1-chloropropane with alkali metal cation exchanged Faujasite zeolite X were investigated at room temperature. The reactivity of the framework and the product formation were shown to depend on zeolite framework counter-cation. A quantitative study of zeolite product formation has been carried out, primarily using solid-state NMR spectroscopy. Large alkali cations showed preference toward substitution chemistry. In contrast, alkyl halide exposed LiX and NaX zeolites underwent both substitution and elimination. Subsequently introduced water molecules led to hydrolysis of framework species that was sensitive to framework counter-cation. The mesoporous NaX zeolites work undertakes to test whether an improvement in surface chemical reactivity can be achieved by introducing mesopores into the already reactive nucleophilic microporous NaX zeolite. Incorporation of the polydiallyl dimethyl ammonium chloride (PDADMAC) template and the formation of mesopores in Faujasite X zeolite (NaX) were successful and well-characterized. The mesopores are proposed to have occurred from incorporation of the cationic PDADMAC polymer into the zeolite by compensating zeolite framework charge. Subsequent sodium cation exchange of calcined mesoporous NaX was shown to restore the chemical reactivity characteristic of as-synthesized NaX. Trialkyl organophosphorous compounds underwent substitution reactions. The reactivity of both microporous and mesoporous Faujasite zeolite X and the product formation was shown to depend on

  15. Modulation of microporous/mesoporous structures in self-templated cobalt-silica.

    PubMed

    Martens, Dana L; Wang, David K; Motuzas, Julius; Smart, Simon; da Costa, João C Diniz

    2015-01-01

    Finite control of pore size distributions is a highly desired attribute when producing porous materials. While many methodologies strive to produce such materials through one-pot strategies, oftentimes the pore structure requires post-treatment modification. In this study, modulation of pore size in cobalt-silica systems was investigated by a novel, non-destructive, self-templated method. These systems were produced from two cobalt-containing silica starting materials which differed by extent of condensation. These starting materials, sol (SG') and xerogel (XG'), were mixed with pure silica sol to produce materials containing 5-40 mol% Co. The resultant SG-series materials exhibited typical attributes for cobalt-silica systems: mesoporous characteristics developed at high cobalt concentrations, coinciding with Co3O4 formation; whereas, in the XG-series materials, these mesoporous characteristics were extensively suppressed. Based on an examination of the resultant materials a mechanism describing the pore size formation and modulation of the two systems was proposed. Pore size modulation in the XG-series was caused, in part, by the cobalt source acting as an autogenous template for the condensation of the silica network. These domains could be modified when wetted, allowing for the infiltration and subsequent condensation of silica oligomers into the pre-formed, mesoporous cages, leading to a reduction in the mesoporous content of the final product. PMID:25609189

  16. Modulation of microporous/mesoporous structures in self-templated cobalt-silica

    NASA Astrophysics Data System (ADS)

    Martens, Dana L.; Wang, David K.; Motuzas, Julius; Smart, Simon; da Costa, João C. Diniz

    2015-01-01

    Finite control of pore size distributions is a highly desired attribute when producing porous materials. While many methodologies strive to produce such materials through one-pot strategies, oftentimes the pore structure requires post-treatment modification. In this study, modulation of pore size in cobalt-silica systems was investigated by a novel, non-destructive, self-templated method. These systems were produced from two cobalt-containing silica starting materials which differed by extent of condensation. These starting materials, sol (SG') and xerogel (XG'), were mixed with pure silica sol to produce materials containing 5-40 mol% Co. The resultant SG-series materials exhibited typical attributes for cobalt-silica systems: mesoporous characteristics developed at high cobalt concentrations, coinciding with Co3O4 formation; whereas, in the XG-series materials, these mesoporous characteristics were extensively suppressed. Based on an examination of the resultant materials a mechanism describing the pore size formation and modulation of the two systems was proposed. Pore size modulation in the XG-series was caused, in part, by the cobalt source acting as an autogenous template for the condensation of the silica network. These domains could be modified when wetted, allowing for the infiltration and subsequent condensation of silica oligomers into the pre-formed, mesoporous cages, leading to a reduction in the mesoporous content of the final product.

  17. Modulation of microporous/mesoporous structures in self-templated cobalt-silica

    PubMed Central

    Martens, Dana L.; Wang, David K.; Motuzas, Julius; Smart, Simon; da Costa, João C. Diniz

    2015-01-01

    Finite control of pore size distributions is a highly desired attribute when producing porous materials. While many methodologies strive to produce such materials through one-pot strategies, oftentimes the pore structure requires post-treatment modification. In this study, modulation of pore size in cobalt-silica systems was investigated by a novel, non-destructive, self-templated method. These systems were produced from two cobalt-containing silica starting materials which differed by extent of condensation. These starting materials, sol (SG′) and xerogel (XG′), were mixed with pure silica sol to produce materials containing 5–40 mol% Co. The resultant SG-series materials exhibited typical attributes for cobalt-silica systems: mesoporous characteristics developed at high cobalt concentrations, coinciding with Co3O4 formation; whereas, in the XG-series materials, these mesoporous characteristics were extensively suppressed. Based on an examination of the resultant materials a mechanism describing the pore size formation and modulation of the two systems was proposed. Pore size modulation in the XG-series was caused, in part, by the cobalt source acting as an autogenous template for the condensation of the silica network. These domains could be modified when wetted, allowing for the infiltration and subsequent condensation of silica oligomers into the pre-formed, mesoporous cages, leading to a reduction in the mesoporous content of the final product. PMID:25609189

  18. Mesoporous carbonates and method of making

    DOEpatents

    Fryxell, Glen; Liu, Jun; Zemanian, Thomas S.

    2004-06-15

    Mesoporous metal carbonate structures are formed by providing a solution containing a non-ionic surfactant and a calcium acetate salt, adding sufficient base to react with the acidic byproducts to be formed by the addition of carbon dioxide, and adding carbon dioxide, thereby forming a mesoporous metal carbonate structure containing the metal from said metal salt.

  19. Synthesis of hollow and mesoporous polycaprolactone nanocapsules,

    NASA Astrophysics Data System (ADS)

    Paik, Pradip; Zhang, Yong

    2011-05-01

    New polycaprolactone (PCL) nanocapsules with a hollow core and mesoporous shell have been synthesized. The PCL nanocapsules have an average size of about 100nm and a mesopores shell of about 20nm. The size of the mesopores on the shell is about 4nm. Fluorescent dye Rhodamin 6G was loaded into the nanocapsules to demonstrate the mesoporous structure of the capsules and their ability to load small molecules. The nanocapsules with such a structure can be used in many areas for various applications such as drug and gene delivery.New polycaprolactone (PCL) nanocapsules with a hollow core and mesoporous shell have been synthesized. The PCL nanocapsules have an average size of about 100nm and a mesopores shell of about 20nm. The size of the mesopores on the shell is about 4nm. Fluorescent dye Rhodamin 6G was loaded into the nanocapsules to demonstrate the mesoporous structure of the capsules and their ability to load small molecules. The nanocapsules with such a structure can be used in many areas for various applications such as drug and gene delivery. Dr. Pradip Paik is currently an assistant professor at the University of Hyderabad (Central University), India.

  20. Radially oriented mesoporous TiO2 microspheres with single-crystal–like anatase walls for high-efficiency optoelectronic devices

    PubMed Central

    Liu, Yong; Che, Renchao; Chen, Gang; Fan, Jianwei; Sun, Zhenkun; Wu, Zhangxiong; Wang, Minghong; Li, Bin; Wei, Jing; Wei, Yong; Wang, Geng; Guan, Guozhen; Elzatahry, Ahmed A.; Bagabas, Abdulaziz A.; Al-Enizi, Abdullah M.; Deng, Yonghui; Peng, Huisheng; Zhao, Dongyuan

    2015-01-01

    Highly crystalline mesoporous materials with oriented configurations are in demand for high-performance energy conversion devices. We report a simple evaporation-driven oriented assembly method to synthesize three-dimensional open mesoporous TiO2 microspheres with a diameter of ~800 nm, well-controlled radially oriented hexagonal mesochannels, and crystalline anatase walls. The mesoporous TiO2 spheres have a large accessible surface area (112 m2/g), a large pore volume (0.164 cm3/g), and highly single-crystal–like anatase walls with dominant (101) exposed facets, making them ideal for conducting mesoscopic photoanode films. Dye-sensitized solar cells (DSSCs) based on the mesoporous TiO2 microspheres and commercial dye N719 have a photoelectric conversion efficiency of up to 12.1%. This evaporation-driven approach can create opportunities for tailoring the orientation of inorganic building blocks in the assembly of various mesoporous materials. PMID:26601185

  1. Radially oriented mesoporous TiO2 microspheres with single-crystal-like anatase walls for high-efficiency optoelectronic devices.

    PubMed

    Liu, Yong; Che, Renchao; Chen, Gang; Fan, Jianwei; Sun, Zhenkun; Wu, Zhangxiong; Wang, Minghong; Li, Bin; Wei, Jing; Wei, Yong; Wang, Geng; Guan, Guozhen; Elzatahry, Ahmed A; Bagabas, Abdulaziz A; Al-Enizi, Abdullah M; Deng, Yonghui; Peng, Huisheng; Zhao, Dongyuan

    2015-05-01

    Highly crystalline mesoporous materials with oriented configurations are in demand for high-performance energy conversion devices. We report a simple evaporation-driven oriented assembly method to synthesize three-dimensional open mesoporous TiO2 microspheres with a diameter of ~800 nm, well-controlled radially oriented hexagonal mesochannels, and crystalline anatase walls. The mesoporous TiO2 spheres have a large accessible surface area (112 m(2)/g), a large pore volume (0.164 cm(3)/g), and highly single-crystal-like anatase walls with dominant (101) exposed facets, making them ideal for conducting mesoscopic photoanode films. Dye-sensitized solar cells (DSSCs) based on the mesoporous TiO2 microspheres and commercial dye N719 have a photoelectric conversion efficiency of up to 12.1%. This evaporation-driven approach can create opportunities for tailoring the orientation of inorganic building blocks in the assembly of various mesoporous materials. PMID:26601185

  2. Low-Temperature Fluorination of Soft-Templated Mesoporous Carbons for a High-Power Lithium/Carbon Fluoride Battery

    SciTech Connect

    Fulvio, Pasquale F; Dai, Sheng; Guo, Bingkun; Mahurin, Shannon Mark; Mayes, Richard T; Sun, Xiao-Guang; Veith, Gabriel M; Brown, Suree; Adcock, Jamie

    2011-01-01

    Soft-templated mesoporous carbons and activated mesoporous carbons were fluorinated using elemental fluorine between room temperature and 235 C. The mesoporous carbons were prepared via self-assembly synthesis of phloroglucinol formaldehyde as a carbon precursor in the presence of triblock ethylene oxide propylene oxide ethylene oxide copolymer BASF Pluronic F127 as the template. The F/C ratios ranged from 0.15 to 0.75 according to gravimetric, energy dispersive X-ray spectroscopy, and X-ray photoelectron spectroscopy analysis. Materials have mesopore diameters up to 11 nm and specific surface areas as high as 850 m2 g 1 after fluorination as calculated from nitrogen adsorption isotherms at 196 C. Furthermore, the materials exhibit higher discharge potentials and energy and power densities as well as faster reaction kinetics under high current densities than commercial carbon fluorides with similar fluorine contents when tested as cathodes for Li/CFx batteries.

  3. Hydrolysis of Cellulose by a Mesoporous Carbon-Fe₂(SO₄)₃/γ-Fe₂O₃ Nanoparticle-Based Solid Acid Catalyst.

    PubMed

    Yamaguchi, Daizo; Watanabe, Koki; Fukumi, Shinya

    2016-01-01

    Carbon-based solid acid catalysts have shown significant potential in a wide range of applications, and they have been successfully synthesized using simple processes. Magnetically separable mesoporous carbon composites also have enormous potential, especially in separation and adsorption technology. However, existing techniques have been unable to produce a magnetically separable mesoporous solid acid catalyst because no suitable precursors have been identified. Herein we describe a magnetically separable, mesoporous solid acid catalyst synthesized from a newly developed mesoporous carbon-γ-Fe2O3 nanoparticle composite. This material exhibits an equivalent acid density and catalytic activity in the hydrolysis of microcrystalline cellulose, to that of the cellulose-derived conventional catalyst. Since it is magnetically separable, this material can be readily recovered and reused, potentially reducing the environmental impact of industrial processes to which it is applied. PMID:26856604

  4. Non-destructively shattered mesoporous silica for protein drug delivery

    SciTech Connect

    Lei, Chenghong; Chen, Baowei; Li, Xiaolin; Qi, Wen N.; Liu, Jun

    2013-07-15

    Mesoporous silicas have been extensively used for entrapping small chemical molecules and biomacromolecules. We hypothesize that the loading density of biomacromlecules such as proteins in mesoporous silicas could be limited due to mesopore disorderness and depth because of some pore volume inaccessible. We innovatively shattered mesoporous silicas resulting in reduced particle sizes and improved intramesoporous structures in aqueous solution by a powerful sonication, where the mesoporous structures were still well maintained. The sonication-shattered mesoporous silicas can allow protein loading densities to be increased by more than 170%, demonstrating that significantly more mesoporous room of the silicas could become accessible for biomacromolecule loading after the sonication-shattering.

  5. Highly mesoporous single-crystalline zeolite beta synthesized using a nonsurfactant cationic polymer as a dual-function template.

    PubMed

    Zhu, Jie; Zhu, Yihan; Zhu, Liangkui; Rigutto, Marcello; van der Made, Alexander; Yang, Chengguang; Pan, Shuxiang; Wang, Liang; Zhu, Longfeng; Jin, Yinying; Sun, Qi; Wu, Qinming; Meng, Xiangju; Zhang, Daliang; Han, Yu; Li, Jixue; Chu, Yueying; Zheng, Anmin; Qiu, Shilun; Zheng, Xiaoming; Xiao, Feng-Shou

    2014-02-12

    Mesoporous zeolites are useful solid catalysts for conversion of bulky molecules because they offer fast mass transfer along with size and shape selectivity. We report here the successful synthesis of mesoporous aluminosilicate zeolite Beta from a commercial cationic polymer that acts as a dual-function template to generate zeolitic micropores and mesopores simultaneously. This is the first demonstration of a single nonsurfactant polymer acting as such a template. Using high-resolution electron microscopy and tomography, we discovered that the resulting material (Beta-MS) has abundant and highly interconnected mesopores. More importantly, we demonstrated using a three-dimensional electron diffraction technique that each Beta-MS particle is a single crystal, whereas most previously reported mesoporous zeolites are comprised of nanosized zeolitic grains with random orientations. The use of nonsurfactant templates is essential to gaining single-crystalline mesoporous zeolites. The single-crystalline nature endows Beta-MS with better hydrothermal stability compared with surfactant-derived mesoporous zeolite Beta. Beta-MS also exhibited remarkably higher catalytic activity than did conventional zeolite Beta in acid-catalyzed reactions involving large molecules. PMID:24450997

  6. Self-Templated Synthesis of Mesoporous Carbon from Carbon Tetrachloride Precursor for Supercapacitor Electrodes.

    PubMed

    Tang, Duihai; Hu, Shi; Dai, Fang; Yi, Ran; Gordin, Mikhail L; Chen, Shuru; Song, Jiangxuan; Wang, Donghai

    2016-03-23

    A high-surface-area mesoporous carbon material has been synthesized using a self-templating approach via reduction of carbon tetrachloride by sodium potassium alloy. The advantage is the reduction-generated salt templates can be easily removed with just water. The produced mesoporous carbon has a high surface area and a narrow pore size distribution. When used as a supercapacitor electrode, this material exhibits a high specific capacitance (259 F g(-1)) and excellent cycling performance (>92% capacitance retention for 6000 cycles). PMID:26913815

  7. Ionic liquid-templated preparation of mesoporous silica embedded with nanocrystalline sulfated zirconia

    NASA Astrophysics Data System (ADS)

    Ward, Antony J.; Pujari, Ajit A.; Costanzo, Lorenzo; Masters, Anthony F.; Maschmeyer, Thomas

    2011-12-01

    A series of mesoporous silicas impregnated with nanocrystalline sulphated zirconia was prepared by a sol-gel process using an ionic liquid-templated route. The physicochemical properties of the mesoporous sulphated zirconia materials were studied using characterisation techniques such as inductively coupled optical emission spectroscopy, X-ray diffraction, transmission electron microscopy, energy-dispersive X-ray microanalysis, elemental analysis and X-ray photoelectron spectroscopy. Analysis of the new silicas indicates isomorphous substitution of silicon with zirconium and reveals the presence of extremely small (< 10 nm) polydispersed zirconia nanoparticles in the materials with zirconium loadings from 27.77 to 41.4 wt.%.

  8. A Facile Synthesis of Mesoporous Sulfonated Carbon and Its Structural Properties.

    PubMed

    Prabhu, Azhagapillai; Al Shoaibi, Ahmed; Srinivasakannan, C

    2016-01-01

    Mesoporous sulfonated carbons (SC) have been synthesized using tetraethyl orthosilicate (TEOS) as a silica source and sucrose as carbon source. The synthesized SC samples were carbonized in N₂flow at various high temperatures and then passing high purity air at room temperature. In this study, we extended the idea to deposit more oxygen functional groups into the surface of SC being high micropores for the favorable adsorption applications. The resulting materials were characterized by using XRD, BET surface area, TPD, TEM, TGA and FTIR techniques. Mesoporous SC materials with controllable pore diameters are expected to be significant to future research concerning the improvement of catalysis, supercapacitors, fuel cells and adsorption. PMID:27398587

  9. Gravimetric chemical sensors based on silica-based mesoporous organic-inorganic hybrids.

    PubMed

    Xu, Jiaqiang; Zheng, Qi; Zhu, Yongheng; Lou, Huihui; Xiang, Qun; Cheng, Zhixuan

    2014-09-01

    Silica-based mesoporous organic-inorganic hybrid material modified quartz crystal microbalance (QCM) sensors have been examined for their ability to achieve highly sensitive and selective detection. Mesoporous silica SBA-15 serves as an inorganic host with large specific surface area, facilitating gas adsorption, and thus leads to highly sensitive response; while the presence of organic functional groups contributes to the greatly improved specific sensing property. In this work, we summarize our efforts in the rational design and synthesis of novel sensing materials for the detection of hazardous substances, including simulant nerve agent, organic vapor, and heavy metal ion, and develop high-performance QCM-based chemical sensors. PMID:25924299

  10. Removal of mercury from aqueous solution using mesoporous silica nanoparticles modified with polyamide receptor.

    PubMed

    He, Chunsheng; Ren, Long; Zhu, Weiping; Xu, Yufang; Qian, Xuhong

    2015-11-15

    Based on the principle of supramolecular recognition and fluorescent chemical sensors, a novel kind of material for the separation of toxic heavy metal ions was designed and synthesized. Mesoporous silica nanoparticles MCM-41 with high surface areas and large ordered pores were used as the supporting matrix. Poly-amide derivative, was grafted to the mesoporous silica nanoparticles for extracting and separating trace Hg(2+) from aqueous solution, with a short adsorption time (t=3min) and a wide range of pH application (pH 3-11). The separation material could also extract trace mercury from Traditional Chinese Medicine, and has no influence on their effective components. PMID:26232282

  11. Biological Applications and Transmission Electron Microscopy Investigations of Mesoporous Silica Nanoparticles

    SciTech Connect

    Brian G. Trewyn

    2006-05-01

    The research presented and discussed within involves the development of novel biological applications of mesoporous silica nanoparticles (MSN) and an investigation of mesoporous material by transmission electron microscopy (TEM). Mesoporous silica nanoparticles organically functionalized shown to undergo endocytosis in cancer cells and drug release from the pores was controlled intracellularly and intercellularly. Transmission electron microscopy investigations demonstrated the variety of morphologies produced in this field of mesoporous silica nanomaterial synthesis. A series of room-temperature ionic liquid (RTIL) containing mesoporous silica nanoparticle (MSN) materials with various particle morphologies, including spheres, ellipsoids, rods, and tubes, were synthesized. By changing the RTIL template, the pore morphology was tuned from the MCM-41 type of hexagonal mesopores to rotational moire type of helical channels, and to wormhole-like porous structures. These materials were used as controlled release delivery nanodevices to deliver antibacterial ionic liquids against Escherichia coli K12. The involvement of a specific organosiloxane function group, covalently attached to the exterior of fluorescein doped mesoporous silica nanoparticles (FITC-MSN), on the degree and kinetics of endocytosis in cancer and plant cells was investigated. The kinetics of endocystosis of TEG coated FITC-MSN is significantly quicker than FITC-MSN as determined by flow cytometry experiments. The fluorescence confocal microscopy investigation showed the endocytosis of TEG coated-FITC MSN triethylene glycol grafted fluorescein doped MSN (TEG coated-FITC MSN) into both KeLa cells and Tobacco root protoplasts. Once the synthesis of a controlled-release delivery system based on MCM-41-type mesoporous silica nanorods capped by disulfide bonds with superparamagnetic iron oxide nanoparticles was completed. The material was characterized by general methods and the dosage and kinetics of the

  12. Block copolymer self-assembly–directed synthesis of mesoporous gyroidal superconductors

    PubMed Central

    Robbins, Spencer W.; Beaucage, Peter A.; Sai, Hiroaki; Tan, Kwan Wee; Werner, Jörg G.; Sethna, James P.; DiSalvo, Francis J.; Gruner, Sol M.; Van Dover, Robert B.; Wiesner, Ulrich

    2016-01-01

    Superconductors with periodically ordered mesoporous structures are expected to have properties very different from those of their bulk counterparts. Systematic studies of such phenomena to date are sparse, however, because of a lack of versatile synthetic approaches to such materials. We demonstrate the formation of three-dimensionally continuous gyroidal mesoporous niobium nitride (NbN) superconductors from chiral ABC triblock terpolymer self-assembly–directed sol-gel–derived niobium oxide with subsequent thermal processing in air and ammonia gas. Superconducting materials exhibit a critical temperature (Tc) of about 7 to 8 K, a flux exclusion of about 5% compared to a dense NbN solid, and an estimated critical current density (Jc) of 440 A cm−2 at 100 Oe and 2.5 K. We expect block copolymer self-assembly–directed mesoporous superconductors to provide interesting subjects for mesostructure-superconductivity correlation studies. PMID:27152327

  13. Block copolymer self-assembly-directed synthesis of mesoporous gyroidal superconductors.

    PubMed

    Robbins, Spencer W; Beaucage, Peter A; Sai, Hiroaki; Tan, Kwan Wee; Werner, Jörg G; Sethna, James P; DiSalvo, Francis J; Gruner, Sol M; Van Dover, Robert B; Wiesner, Ulrich

    2016-01-01

    Superconductors with periodically ordered mesoporous structures are expected to have properties very different from those of their bulk counterparts. Systematic studies of such phenomena to date are sparse, however, because of a lack of versatile synthetic approaches to such materials. We demonstrate the formation of three-dimensionally continuous gyroidal mesoporous niobium nitride (NbN) superconductors from chiral ABC triblock terpolymer self-assembly-directed sol-gel-derived niobium oxide with subsequent thermal processing in air and ammonia gas. Superconducting materials exhibit a critical temperature (T c) of about 7 to 8 K, a flux exclusion of about 5% compared to a dense NbN solid, and an estimated critical current density (J c) of 440 A cm(-2) at 100 Oe and 2.5 K. We expect block copolymer self-assembly-directed mesoporous superconductors to provide interesting subjects for mesostructure-superconductivity correlation studies. PMID:27152327

  14. Imprint-coating synthesis of selective functionalized ordered mesoporous sorbents for separation and sensors

    DOEpatents

    Dai, Sheng; Burleigh, Mark C.; Shin, Yongsoon

    2001-01-01

    The present invention relates generally to mesoporous sorbent materials having high capacity, high selectivity, fast kinetics, and molecular recognition capability. The invention also relates to a process for preparing these mesoporous substrates through molecular imprinting techniques which differ from convention techniques in that a template molecule is bound to one end of bifunctional ligands to form a complex prior to binding of the bifunctional ligands to the substrate. The present invention also relates to methods of using the mesoporous sorbent materials, for example, in the separation of toxic metals from process effluents, paints, and other samples; detection of target molecules, such as amino acids, drugs, herbicides, fertilizers, and TNT, in samples; separation and/or detection of substances using chromatography; imaging agents; sensors; coatings; and composites.

  15. Hierarchical Zeolites with Amine-Functionalized Mesoporous Domains for Carbon Dioxide Capture.

    PubMed

    Nguyen, Tien Hoa; Kim, Sungjune; Yoon, Minyoung; Bae, Tae-Hyun

    2016-03-01

    To prepare materials with high CO2 adsorption, a series of hierarchical LTA zeolites possessing various mesopore spaces that are decorated with alkylamines was designed and synthesized. The highest CO2 uptake capacity was achieved when (3-aminopropyl)trimethoxysilane (APTMS) was grafted onto the hierarchical LTA zeolite having the largest mesopores. Owing to the contributions of both alkylamine groups grafted onto the mesopore surfaces and active sites in the LTA zeolites, the amount of CO2 that can be taken up on these materials is much higher than for conventional aminosilicas such SBA-15 and MCM-41. Furthermore, the adsorbent shows good CO2 uptake capacity and recyclability in dynamic flow conditions. PMID:26833434

  16. Mesoporous hybrid NiOx-MnOx nanoprisms for flexible solid-state asymmetric supercapacitors.

    PubMed

    Wei, Chengzhen; Cheng, Cheng; Ma, Lan; Liu, Mengna; Kong, Dechen; Du, Weimin; Pang, Huan

    2016-06-28

    Mesoporous hybrid NiOx-MnOx nanoprisms have been successfully prepared in this work. The synthesis process involves a facile solvothermal method for preparation of Ni-Mn precursor particles and a subsequent annealing treatment. These mesoporous hybrid NiOx-MnOx nanoprisms have a high surface area of 101.6 m(2) g(-1). When evaluated as electrode materials in supercapacitors, the as-prepared mesoporous hybrid NiOx-MnOx nanoprisms deliver a specific capacitance of 1218 F g(-1) at a current density of 2.0 A g(-1). More importantly, the mesoporous hybrid NiOx-MnOx nanoprisms were successfully used to construct flexible solid-state asymmetric supercapacitors. The device shows a specific capacitance of 149.1 mF cm(-2) at 2.0 mA cm(-2), a good cycling stability with only 2.9% loss of capacitance after 5000 charge-discharge cycles, and good mechanical flexibility under different bending angles. These results support the promising application of mesoporous hybrid NiOx-MnOx nanoprisms as advanced supercapacitor materials. PMID:27295406

  17. Synthesis and characterization of nanocrystalline and mesoporous zeolites

    NASA Astrophysics Data System (ADS)

    Petushkov, Anton

    2011-12-01

    Mesoporous aggregates of nanocrystalline zeolites with MFI and BEA frameworks have been synthesized using a one-pot and single structure directing agent. The effect of different reaction conditions, such as temperature, time, pH and water content, on the particle size, surface area and mesopore volume has been studied. Nanocrystalline and mesoporous ZSM-5, beta and Y zeolites were modified with different transition metals and the resulting single- and double metal containing catalyst materials were characterized. Nanocrystalline Silicalite-1 zeolite samples with varying particle size were functionalized with different organosilane groups and the cytotoxic activity of the zeolite nanocrystals was studied as a function of particle size, concentration, organic functional group type, as well as the type of cell line. Framework stability of nanocrystalline NaY zeolite was tested under different pH conditions. The synthesized zeolites used in this work were characterized using a variety of physico-chemical methods, including powder X-ray diffraction, Solid State NMR, nitrogen sorption, electron microscopy, Inductively Coupled Plasma -- Optical Emission Spectroscopy and X-ray Photoelectron Spectroscopy.

  18. Effect of polyvinylpyrrolidone on mesoporous silica morphology and esterification of lauric acid with 1-butanol catalyzed by immobilized enzyme

    SciTech Connect

    Zhang, Jinyu; Zhou, Guowei Jiang, Bin; Zhao, Minnan; Zhang, Yan

    2014-05-01

    Mesoporous silica materials with a range of morphology evolution, i.e., from curved rod-shaped mesoporous silica to straight rod-shaped mesoporous silica, were successfully prepared using polyvinylpyrrolidone (PVP) and triblock copolymer as dual template. The effects of PVP molecular weight and concentration on mesoporous silica structure parameters were studied. Results showed that surface area and pore volume continuously decreased with increased PVP molecular weight. Mesoporous silica prepared with PVP K30 also possessed larger pore diameter, interplanar spacing (d{sub 100}), and cell parameter (a{sub 0}) than that prepared with PVP K15 and PVP K90. In addition, with increased PVP concentration, d{sub 100} and a{sub 0} continuously decreased. The mechanism of morphology evolution caused by the change in PVP concentration was investigated. The conversion rate of lauric acid with 1-butanol catalyzed by immobilized Porcine pancreatic lipase (PPL) was also evaluated. Results showed that PPL immobilized on amino-functionalized straight rod-shaped mesoporous silica maintained 50% of its esterification conversion rate even after five cycles of use with a maximum conversion rate was about 90.15%. - Graphical abstract: Curved rod-shaped mesoporous silica can be obtained at low and the highest PVP concentration, while straight rod-shaped mesoporous silica can be obtained at higher PVP concentration. - Highlights: • Mesoporous silica with morphology evolution from CRMS to SRMS were prepared. • Effects of PVP molecular weight and concentration on silica morphology were studied. • A possible mechanism for the formation of morphology evolution SiO{sub 2} was proposed. • Esterification of lauric acid with 1-butanol catalyzed by immobilized PPL.

  19. Tailoring the mesoporous texture of graphitic carbon nitride.

    PubMed

    Yang, Jae-Hun; Kim, Gain; Domen, Kazunari; Choy, Jin-Ho

    2013-11-01

    Recently, graphitic carbon nitride (g-C3N4) materials have received a great attention from many researchers due to their various roles as a visible light harvesting photocatalyst, metal-free catalyst, reactive template, nitrogen source of nitridation reaction, etc. g-C3N4 could be prepared by temperature-induced polymerization of cyanamide or melamine. In this study, we report a preparation of mesoporous graphitic carbon nitrides with tailored porous texture including pore size, and specific surface area from cyanamide and colloidal silica nanoparticles (Ludox). At first, cyanamide-silica nanocomposites were prepared by mixing colloidal silica with different size in the range of 7-22 nm and cyanamide, followed by evaporating the solvent in the resulting mixture. Mesoporous g-C3N4 samples were prepared by calcining cyanamide-silica nanocomposite at 550 degrees C for 4 hrs and removing the silica nanoparticles by using ammonium hydrogen fluoride. The formation of g-C3N4 was confirmed by the sharp (002) peak (d = 3.25 A) of graphitic interlayer stacking, and the broad (100) peak (d = 6.86 A) of in-plane repeating unit in the X-ray diffraction patterns. According to N2 adsorption-desorption analysis, the pore size of mesoporous carbon nitrides was similar to the size of colloidal silica used as hard template (7-22 nm). The specific surface area of mesoporous g-C3N4 could be tailored in the range of 189 m2/g-288 m2/g. PMID:24245279

  20. Performance of mesoporous organosilicates on the adsorption of heavy oil from produced water

    NASA Astrophysics Data System (ADS)

    Twaiq, Farouq A.; Nasser, Mustafa S.; Al-Ryiami, Samyia; Al-Ryiami, Hanan

    2012-09-01

    The performance of mesoporous organosilicate materials in removal of soluble oil from wastewater is investigated. The aim of the study is to evaluate the oil adsorption over organosilicate prepared using pre-synthesis methods and compare the results with adsorption over pure siliceous mesoporous material. The materials were prepared using sol-gel technique using Dodecylamine (D) and Cetyltrimethylammonium bromide (CTAB) as surfactant templates, and Tetraethylorthosilicate (TEOS) as silica precursor. The as-synthesized mesoporous materials were treated using three different methods to remove the surfactant from the mesoporous silica including calcinations method for total removal of the surfactant, the water vapor stripping and ethanol vapor stripping were used for partial removal of the surfactants. The synthesized materials were characterized using X-ray diffraction (XRD) and nitrogen adsorption. The materials were tested for heavy oils removal from oil-water solution. The results showed that neutral surfactant organosilicates have less adsorption compare to cationic surfactant organosilicates. The results also showed that among organosilicates prepared using neutral surfactant, treated organosilicate by ethanol vapor have the highest activity in removing the oil from the oil-water solution.

  1. Facile fabrication of mesoporous iron modified Al2O3 nanoparticles pillared montmorillonite nanocomposite: a smart photo-Fenton catalyst for quick removal of organic dyes.

    PubMed

    Pradhan, Amaresh C; Varadwaj, G Bishwa Bidita; Parida, K M

    2013-11-14

    A mesoporous iron modified Al2O3 nanoparticle pillared montmorillonite nanocomposite (mesoporous Fe/APM nanocomposite) was synthesized by using sodium exchanged montmorillonite by cation-exchange, gallery-templated synthesis and impregnation method. Formation of Al2O3 nanoparticles (Al2O3 NPs) having average particle size 5.20-6.50 nm within montmorillonite, formation of mesoporous Al2O3 NPs pillared montmorillonite (mesoporous APM) from montmorillonite and formation of a mesoporous Fe/APM nanocomposite signifies the present investigation. The roles of ammonia, CTAB, octyl amine and calcination temperature for fabrication of mesoporous Fe/APM nanocomposite were highly significant. Ammonia was used for post-synthesis treatment, which helped in the formation of micellar assemblies in the interlayer space. The materials were characterized by different techniques such as N2 adsorption-desorption study, which demonstrated the mesoporosity of the material. A transmission electron microscopy (TEM) image proves the morphology and size of the Al2O3 NPs and mesoporous Fe/APM nanocomposites. X-ray diffraction technique (XRD) describes the formation of the pillaring of the Al2O3 NPs within montmorillonite (APM). It has been noted that pure montmorillonite is a micro/mesoporous material. But after pillaring of Al2O3 NPs within the montmorillonite, mesoporosity developed, which is the vital aspect of present investigation. It was observed that the mesoporous Fe/APM nanocomposite has high photo-Fenton activity towards degradation of organic dyes such as acid blue (AB) and reactive blue (RB). Nearly 100% degradation took place within 30 minutes with high concentration of dye (500 mg L(-1)) by mesoporous 5 Fe/APM nanocomposite under ambient conditions. Small particle sizes of nanocomposite, quick reduction of Fe(III) and mesoporosity are the key points for proficient degradation of AB and RB. PMID:24002045

  2. Multifunctional Mesoporous and Nanostructured Catalysts: Exploring Novel Synthetic Methods, Properties and Applications

    NASA Astrophysics Data System (ADS)

    Das, Sayantani

    Novel multifunctional mesoporous and nanostructured catalysts containing two or more different types of judiciously chosen functional / catalytic groups were developed and their unique and cooperative catalytic activities in various useful organic reactions were explored. First, mesoporous silica material containing tertiary amine/silanol groups was synthesized by simple postgrafting synthetic method. The material was found to exhibit efficient cooperative acid/base bifunctional catalytic activity towards Michael addition reactions between trans-β-nitrostyrene and various active methylene compounds such as malononitrile, acetylacetone and dimethylmalonate. Besides serving as a solid base catalyst, such organoamine-functionalized mesoporous silica materials can be utilized as effective support materials for catalytically active organometallic complexes. This was demonstrated by immobilizing ethylenediamine onto mesoporous silica via postgrafting synthetic method and then complexing Fe(III) onto the supported ethylenediamine groups. This yielded a bifunctional Fe(III)/silanol-based heterogeneous catalyst that showed efficient catalytic activity towards epoxide ring opening reactions. Next, the potential of these types of organic-functionalized mesoporous silicas for immobilization of metallic nanoparticle catalysts was investigated. Specifically, mercaptopropyl-functionalized mesoporous silica was synthesized and the material was then supported with ultrasmall Aun nanoclusters. The catalytic properties of the resulting materials in styrene oxidation were studied. Furthermore, the effect of the removal of the thiol groups from around the surfaces of the gold nanoclusters on catalytic activities of the mesoporous silica-supported nanoparticles was investigated. As mesoporous silica have some limitations of crowding in their pores and poor mass transport for reactants when they are functionalized with larger groups such as nanoparticles, a new strategy was developed

  3. Mesoporous gold sponges: electric charge-assisted seed mediated synthesis and application as surface-enhanced Raman scattering substrates

    PubMed Central

    Yi, Zao; Luo, Jiangshan; Tan, Xiulan; Yi, Yong; Yao, Weitang; Kang, Xiaoli; Ye, Xin; Zhu, Wenkun; Duan, Tao; Yi, Yougen; Tang, Yongjian

    2015-01-01

    Mesoporous gold sponges were prepared using 4-dimethylaminopyridine (DMAP)-stabilized Au seeds. This is a general process, which involves a simple template-free method, room temperature reduction of HAuCl4·4H2O with hydroxylamine. The formation process of mesoporous gold sponges could be accounted for the electrostatic interaction (the small Au nanoparticles (~3 nm) and the positively charged DMAP-stabilized Au seeds) and Ostwald ripening process. The mesoporous gold sponges had appeared to undergo electrostatic adsorption initially, sequentially linear aggregation, welding and Ostwald ripening, then, they randomly cross link into self-supporting, three-dimensional networks with time. The mesoporous gold sponges exhibit higher surface area than the literature. In addition, application of the spongelike networks as an active material for surface-enhanced Raman scattering has been investigated by employing 4-aminothiophenol (4-ATP) molecules as a probe. PMID:26538365

  4. Mesoporous gold sponges: electric charge-assisted seed mediated synthesis and application as surface-enhanced Raman scattering substrates

    NASA Astrophysics Data System (ADS)

    Yi, Zao; Luo, Jiangshan; Tan, Xiulan; Yi, Yong; Yao, Weitang; Kang, Xiaoli; Ye, Xin; Zhu, Wenkun; Duan, Tao; Yi, Yougen; Tang, Yongjian

    2015-11-01

    Mesoporous gold sponges were prepared using 4-dimethylaminopyridine (DMAP)-stabilized Au seeds. This is a general process, which involves a simple template-free method, room temperature reduction of HAuCl4·4H2O with hydroxylamine. The formation process of mesoporous gold sponges could be accounted for the electrostatic interaction (the small Au nanoparticles (~3 nm) and the positively charged DMAP-stabilized Au seeds) and Ostwald ripening process. The mesoporous gold sponges had appeared to undergo electrostatic adsorption initially, sequentially linear aggregation, welding and Ostwald ripening, then, they randomly cross link into self-supporting, three-dimensional networks with time. The mesoporous gold sponges exhibit higher surface area than the literature. In addition, application of the spongelike networks as an active material for surface-enhanced Raman scattering has been investigated by employing 4-aminothiophenol (4-ATP) molecules as a probe.

  5. Pair distribution function (PDF) analysis of mesoporous α-Fe2O3 and Cr2O3.

    PubMed

    Hill, Adrian H; Allieta, Mattia

    2013-06-14

    We have measured atomic pair distribution functions of novel mesoporous metal oxides, α-Fe2O3 and Cr2O3. These have an ordered pore mosaic as well as crystalline structure within the pore walls, making them an interesting class of materials to characterise. Comparison of "bulk" and mesoporous data sets has allowed an estimate of long range structural coherence to be derived; ≈125 Å and ≈290 Å for α-Fe2O3 and Cr2O3 respectively. Further "box-car" analysis has shown that above ≈40 Å both mesoporous samples deviate greatly from their bulk counterparts. This is attributed to the pores of the mesoporous structure creating voids in the pair-correlations, disrupting long range order. PMID:23619834

  6. Mesoporous gold sponges: electric charge-assisted seed mediated synthesis and application as surface-enhanced Raman scattering substrates.

    PubMed

    Yi, Zao; Luo, Jiangshan; Tan, Xiulan; Yi, Yong; Yao, Weitang; Kang, Xiaoli; Ye, Xin; Zhu, Wenkun; Duan, Tao; Yi, Yougen; Tang, Yongjian

    2015-01-01

    Mesoporous gold sponges were prepared using 4-dimethylaminopyridine (DMAP)-stabilized Au seeds. This is a general process, which involves a simple template-free method, room temperature reduction of HAuCl4·4H2O with hydroxylamine. The formation process of mesoporous gold sponges could be accounted for the electrostatic interaction (the small Au nanoparticles (~3 nm) and the positively charged DMAP-stabilized Au seeds) and Ostwald ripening process. The mesoporous gold sponges had appeared to undergo electrostatic adsorption initially, sequentially linear aggregation, welding and Ostwald ripening, then, they randomly cross link into self-supporting, three-dimensional networks with time. The mesoporous gold sponges exhibit higher surface area than the literature. In addition, application of the spongelike networks as an active material for surface-enhanced Raman scattering has been investigated by employing 4-aminothiophenol (4-ATP) molecules as a probe. PMID:26538365

  7. Surfactant-Templated Mesoporous Metal Oxide Nanowires

    DOE PAGESBeta

    Luo, Hongmei; Lin, Qianglu; Baber, Stacy; Naalla, Mahesh

    2010-01-01

    We demore » monstrate two approaches to prepare mesoporous metal oxide nanowires by surfactant assembly and nanoconfinement via sol-gel or electrochemical deposition. For example, mesoporous Ta 2 O 5 and zeolite nanowires are prepared by block copolymer Pluronic 123-templated sol-gel method, and mesoporous ZnO nanowires are prepared by electrodeposition in presence of anionic surfactant sodium dodecyl sulfate (SDS) surfactant, in porous membranes. The morphologies of porous nanowires are studied by scanning electron microscopy (SEM) and transmission electron microscopy (TEM) analyses.« less

  8. Mesoporous silica nanoparticles for biomedical and catalytical applications

    SciTech Connect

    Sun, Xiaoxing

    2011-01-01

    Mesoporous silica materials, discovered in 1992 by the Mobile Oil Corporation, have received considerable attention in the chemical industry due to their superior textual properties such as high surface area, large pore volume, tunable pore diameter, and narrow pore size distribution. Among those materials, MCM-41, referred to Mobile Composition of Matter NO. 41, contains honeycomb liked porous structure that is the most common mesoporous molecular sieve studied. Applications of MCM-41 type mesoporous silica material in biomedical field as well as catalytical field have been developed and discussed in this thesis. The unique features of mesoporous silica nanoparticles were utilized for the design of delivery system for multiple biomolecules as described in chapter 2. We loaded luciferin into the hexagonal channels of MSN and capped the pore ends with gold nanoparticles to prevent premature release. Luciferase was adsorbed onto the outer surface of the MSN. Both the MSN and the gold nanoparticles were protected by poly-ethylene glycol to minimize nonspecific interaction of luciferase and keep it from denaturating. Controlled release of luciferin was triggered within the cells and the enzymatic reaction was detected by a luminometer. Further developments by varying enzyme/substrate pairs may provide opportunities to control cell behavior and manipulate intracellular reactions. MSN was also served as a noble metal catalyst support due to its large surface area and its stability with active metals. We prepared MSN with pore diameter of 10 nm (LP10-MSN) which can facilitate mass transfer. And we successfully synthesized an organo silane, 2,2'-Bipyridine-amide-triethoxylsilane (Bpy-amide-TES). Then we were able to functionalize LP10-MSN with bipyridinyl group by both post-grafting method and co-condensation method. Future research of this material would be platinum complexation. This Pt (II) complex catalyst has been reported for a C-H bond activation reaction as an

  9. Sponge mesoporous silica formation using disordered phospholipid bilayers as template.

    PubMed

    Galarneau, Anne; Sartori, Federica; Cangiotti, Michela; Mineva, Tzonka; Di Renzo, Francesco; Ottaviani, M Francesca

    2010-02-18

    Lecithin/dodecylamine/lactose mixtures in ethanol/aqueous media led to the formation of sponge mesoporous silica (SMS) materials by means of tetraethoxysilane (TEOS) as silica source. SMS materials show a "sponge-mesoporous" porosity with a pore diameter of about 5-6 nm, in accordance to the length of a lecithin bilayer. SMS synthesis was developed to create a new class of powerful biocatalysts able to efficiently encapsulate enzymes by adding a porosity control to the classical sol-gel synthesis and by using phospholipids and lactose as protecting agents for the enzymes. In the present study, the formation of SMS was investigated by using electron paramagnetic resonance (EPR) probes inserted inside phospholipid bilayers. The influence of progressive addition of each component (ethanol, dodecylamine, lactose, TEOS) on phospholipid bilayers was first examined; then, the time evolution of EPR spectra during SMS synthesis was studied. Parameters informative of mobility, structure, order, and polarity around the probes were extracted by computer analysis of the EPR line shape. The results were discussed on the basis of solids characterization by X-ray diffraction, nitrogen isotherm, transmission electron microscopy, and scanning electron microscopy. The results, together with the well-known ability of ethanol to promote membrane hemifusion, suggested that the templating structure is a bicontinuous phospholipid bilayer phase, shaped as a gyroid, resulting of multiple membrane hemifusions induced by the high alcohol content used in SMS synthesis. SMS synthesis was compared to hexagonal mesoporous silica (HMS) synthesis accomplished by adding TEOS to a dodecylamine/EtOH/water mixture. EPR evidenced the difference between HMS and SMS synthesis; the latter uses an already organized but slowly growing mesophase of phospholipids, never observed before, whereas the former shows a progressive elongation of micelles into wormlike structures. SMS-type materials represent a new

  10. Flash freezing route to mesoporous polymer nanofibre networks

    PubMed Central

    Samitsu, Sadaki; Zhang, Rui; Peng, Xinsheng; Krishnan, Mohan Raj; Fujii, Yoshihisa; Ichinose, Izumi

    2013-01-01

    There are increasing requirements worldwide for advanced separation materials with applications in environmental protection processes. Various mesoporous polymeric materials have been developed and they are considered as potential candidates. It is still challenging, however, to develop economically viable and durable separation materials from low-cost, mass-produced materials. Here we report the fabrication of a nanofibrous network structure from common polymers, based on a microphase separation technique from frozen polymer solutions. The resulting polymer nanofibre networks exhibit large free surface areas, exceeding 300 m2 g−1, as well as small pore radii as low as 1.9 nm. These mesoporous polymer materials are able to rapidly adsorb and desorb a large amount of carbon dioxide and are also capable of condensing organic vapours. Furthermore, the nanofibres made of engineering plastics with high glass transition temperatures over 200 °C exhibit surprisingly high, temperature-dependent adsorption of organic solvents from aqueous solution. PMID:24145702

  11. Controlled Synthesis of Pt Nanowires with Ordered Large Mesopores for Methanol Oxidation Reaction.

    PubMed

    Zhang, Chengwei; Xu, Lianbin; Yan, Yushan; Chen, Jianfeng

    2016-01-01

    Catalysts for methanol oxidation reaction (MOR) are at the heart of key green-energy fuel cell technology. Nanostructured Pt materials are the most popular and effective catalysts for MOR. Controlling the morphology and structure of Pt nanomaterials can provide opportunities to greatly increase their activity and stability. Ordered nanoporous Pt nanowires with controlled large mesopores (15, 30 and 45 nm) are facilely fabricated by chemical reduction deposition from dual templates using porous anodic aluminum oxide (AAO) membranes with silica nanospheres self-assembled in the channels. The prepared mesoporous Pt nanowires are highly active and stable electrocatalysts for MOR. The mesoporous Pt nanowires with 15 nm mesopores exhibit a large electrochemically active surface area (ECSA, 40.5 m(2) g(-1)), a high mass activity (398 mA mg(-1)) and specific activity (0.98 mA cm(-2)), and a good If/Ib ratio (1.15), better than the other mesoporous Pt nanowires and the commercial Pt black catalyst. PMID:27550737

  12. Controlled Synthesis of Pt Nanowires with Ordered Large Mesopores for Methanol Oxidation Reaction

    PubMed Central

    Zhang, Chengwei; Xu, Lianbin; Yan, Yushan; Chen, Jianfeng

    2016-01-01

    Catalysts for methanol oxidation reaction (MOR) are at the heart of key green-energy fuel cell technology. Nanostructured Pt materials are the most popular and effective catalysts for MOR. Controlling the morphology and structure of Pt nanomaterials can provide opportunities to greatly increase their activity and stability. Ordered nanoporous Pt nanowires with controlled large mesopores (15, 30 and 45 nm) are facilely fabricated by chemical reduction deposition from dual templates using porous anodic aluminum oxide (AAO) membranes with silica nanospheres self-assembled in the channels. The prepared mesoporous Pt nanowires are highly active and stable electrocatalysts for MOR. The mesoporous Pt nanowires with 15 nm mesopores exhibit a large electrochemically active surface area (ECSA, 40.5 m2 g−1), a high mass activity (398 mA mg−1) and specific activity (0.98 mA cm−2), and a good If/Ib ratio (1.15), better than the other mesoporous Pt nanowires and the commercial Pt black catalyst. PMID:27550737

  13. Magnetic Fluorescent Delivery Vehicle using Uniform Mesoporous Silica Spheres Embedded with Monodisperse Magnetic and Semiconductor Nanocrystals

    SciTech Connect

    Kim, Jaeyun; Lee, Ji Eun; Lee, Jinwoo; Yu, Jung Ho; Kim, Byoung Chan; An, Kwangjin; Hwang, Yosun; Shin, Chae-Ho; Park, Je-Geun; Kim, Jungbae; Hyeon, Taeghwan

    2006-01-25

    Uniform sized colloidal nanocrystals have attracted much attention, because of their unique magnetic and optical properties, as compared with those of their bulk counterparts. Especially magnetic nanocrystals and quantum dots have been intensively pursued for biomedical applications such as contrast enhancement agents in magnetic resonance imaging, magnetic carriers for drug delivery system, biological labeling and diagnostics. Due to their large pore sizes and high surface areas, mesoporous materials and its composites with nanocrystals have attracted considerable attention. In order to use the nanocrystals as functional delivery carriers and catalytic supports, nanocrystals coated with porous silica shells are desirable. Herein, we report a synthetic procedure for the fabrication of monodisperse nanocrystals embedded in uniform pore-sized mesoporous silica spheres. As a representative example, we synthesized monodisperse magnetite (Fe3O4) nanocrystals embedded in mesoporous silica spheres and both magnetite nanocrystals and CdSe/ZnS quantum dots embedded in mesoporous silica spheres. Furthermore, these mesoporous silica spheres were applied to the uptake and controlled release of drugs.

  14. Synthesis of manganese oxide supported on mesoporous titanium oxide: Influence of the block copolymer

    SciTech Connect

    Schmit, F.; Bois, L.; Chiriac, R.; Toche, F.; Chassagneux, F.; Besson, M.; Descorme, C.; Khrouz, L.

    2015-01-15

    Manganese oxides supported on mesoporous titanium oxides were synthesized via a sol–gel route using block copolymer self-assembly. The oxides were characterized by X-ray diffraction, infrared spectroscopy, thermal analyses, nitrogen adsorption/desorption, electron microscopy and electronic paramagnetic resonance. A mesoporous anatase containing amorphous manganese oxide particles could be obtained with a 0.2 Mn:Ti molar ratio. At higher manganese loading (0.5 Mn:Ti molar ratio), segregation of crystalline manganese oxide occurred. The influence of block copolymer and manganese salt on the oxide structure was discussed. The evolution of the textural and structural characteristics of the materials upon hydrothermal treatment was also investigated. - Graphical abstract: One-pot amorphous MnO{sub 2} supported on mesoporous anataseTiO{sub 2}. - Highlights: • Mesoporous manganese titanium oxides were synthesized using block copolymer. • Block copolymers form complexes with Mn{sup 2+} from MnCl{sub 2}. • With block copolymer, manganese oxide can be dispersed around the titania crystallites. • With Mn(acac){sub 2}, manganese is dispersed inside titania. • MnOOH crystallizes outside mesoporous titania during hydrothermal treatment.

  15. Graphitic Mesoporous Carbon Loaded with Iron-Nickel Hydroxide for Superior Oxygen Evolution Reactivity.

    PubMed

    Wang, Ling; Huang, Xiaolei; Xue, Junmin

    2016-07-21

    Earth-abundant transition metal oxides and hydroxides have been intensively investigated as promising catalysts for the oxygen evolution reaction (OER). However, the overall OER performance of the transition metal oxides/hydroxides is largely jeopardized by their inherent low electrical conductivity. Mesoporous carbon has been a commonly used as a carrier material for these oxides/hydroxides to promote the electrical conductivity and provide a large specific surface area. However, most of the available mesoporous carbon carriers are amorphous. It has been very challenging to synthesize graphitic mesoporous carbon owing to the extremely high graphitization temperature. In this work, we report a new strategy used to prepare graphitic mesoporous carbon (GMC) by employing Fe metal as the graphitization catalyst. The graphitic carbon was obtained at 1000 °C, at which it retained its mesoporous structure. The conductivity of the obtained GMC was approximately 550 S m(-1) , which was almost ten times higher than that of amorphous carbon. The GMC was further loaded with Fe-Ni hydroxide to fabricate the OER catalyst. The obtained catalyst showed good OER activity with an overpotential of 320 mV at a current density of 10 mA cm(-2) and a low Tafel slope of 57 mV dec(-1) . The synthesized catalyst also possessed excellent stability, with almost no current drop even after 2000 cycles and at a constant voltage for 2 h. PMID:27312811

  16. Synthesis of ZSM-5 with intracrystal or intercrystal mesopores by polyvinyl butyral templating method.

    PubMed

    Zhu, Haibo; Liu, Zhicheng; Kong, Dejin; Wang, Yangdong; Yuan, Xiaohong; Xie, Zaiku

    2009-03-15

    Three facile routes were utilized to synthesize ZSM-5 materials with intracrystal or intercrystal mesopores, where the polyvinyl butyral gel served as mesopore directing template. The three routes were divided into two synthesis strategies: the hydrothermal treatment of silica/PVB composite and re-crystallization of preformed zeolite precursor with the assistance of PVB gel. The fabrication of silica/PVB composite was accomplished by two routes including sol-gel process and impregnation method. The resulting composite was undergone hydrothermal treatment. During the crystallization PVB was occluded in the ZSM-5 crystal, creating intracrystal mesopores in the zeolite. The last route for the synthesis of mesoporous ZSM-5 was realized by re-crystallization of preformed ZSM-5 zeolite in the presence of PVB. This route involved the pre-crystallization of the amorphous aluminosilicate to produce the pre-formed ZSM-5 precursor. Upon further crystallization of the mixture of PVB gel and pre-formed ZSM-5, the ZSM-5 precursor was transformed into ZSM-5 aggregate of nanocrystals, while the PVB gel was occluded in the ZSM-5 particles. Removal of the template generated the typical microporosity associated with ZSM-5 structure along with intercrystal mesoporosity produced from the PVB. The mesoporous ZSM-5 exhibited enhanced catalytic activity in the toluene disproportionation and transalkylation with C(9) and C(10) aromatics. PMID:19101681

  17. Preparation, characterization and oxygen sensing properties of luminescent carbon dots assembled mesoporous silica microspheres.

    PubMed

    Wang, Li; Zhang, Haoran; Zhou, Xiaohua; Liu, Yingliang; Lei, Bingfu

    2016-09-15

    In this paper, our effort was focused on preparation and oxygen sensing of luminescence carbon dots (CDs) assembled hollow mesoporous silica microspheres (HMSMs) and mesoporous silica microspheres (MSMs). MSMs doped with CDs showed shorter response time and recovery time comparing with HMSMs doped with CDs. This feature can be attributed to ordered channel structure of mesoporous carrier which can promote the gas diffusion effectively. While HMSMs doped with CDs shows a higher oxygen quenching response and the degree of quenching reach 80.35%. The response time was determined to be about 7s and the emission intensities of the samples were effectively reduced as the concentration of oxygen increased. These results indicate that the system we have developed can be used for oxygen detection in wide concentration range and is especially accurate for very low oxygen concentrations. The obtained CDs grafted hollow mesoporous silica microspheres (HMSMs) and mesoporous silica microspheres (MSMs) samples appears to be a promising sensing material for environmental detection application and would also find applications in catalyst, electrode, or related fields. PMID:27309945

  18. Hierarchical porous silicon carbide with controlled micropores and mesopores for electric double layer capacitors

    NASA Astrophysics Data System (ADS)

    Kim, Myeongjin; Oh, Ilgeun; Kim, Jooheon

    2015-05-01

    Three-dimensional hierarchical micro and mesoporous silicon carbide spheres (MMPSiC) are prepared by the template method and carbonization reaction via the aerosol spray drying method. The mesopores are generated by the self-assembly of the structure-directing agents, whereas the micropores are derived from the partial evaporation of Si atoms during carbonization. To investigate the effect of mesopore size on electrochemical performance, three types of MMPSiC with different mesopore size were fabricated by using three different structure directing agents (cetyltriethylammonium bromide (CTAB), Polyethylene glycol hexadecyl ether (Brij56), and Poly(ethylene glycol)-block-poly(propylene glycol)-block-poly(ethylene glycol) (P123)). The MMPSiC electrode prepared with Brij56 exhibits the highest charge storage capacity with a specific capacitance of 253.7 F g-1 at a scan rate of 5 mV s-1 and 87.9% rate performance from 5 to 500 mV s-1 in 1 M Na2SO4 aqueous electrolyte. The outstanding electrochemical performance might be because of the ideal mesopore size, which effectively reduces the resistant pathways for ion diffusion in the pores and provides a large accessible surface area for ion transport/charge storage. These encouraging results demonstrate that the MMPSiC prepared with Brij56 is a promising candidate for high performance electrode materials for supercapacitors.

  19. Electrodeposition of mesoporous manganese dioxide supercapacitor electrodes through self-assembled triblock copolymer templates

    NASA Astrophysics Data System (ADS)

    Xue, Tong; Xu, Cai-Ling; Zhao, Dan-Dan; Li, Xiao-Hong; Li, Hu-Lin

    Mesoporous manganese dioxide supercapcitor electrode materials were electrochemically deposited onto silicon substrates coated with Pt using triblock copolymer species (Pluronic P123 and F127) as the structure-directing agents. Deposited electrodes of manganese dioxide film were physically characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM) and transmission electron microscopy (TEM), and were electrochemically characterized by cyclic voltammetry (CV) in 0.5 M Na 2SO 4 electrolyte. Maximum specific capacitance (SC) values of 449 F g -1 was obtained at a scan rate of 10 mV s -1 from F127 templated mesoporous MnO 2.

  20. Synthesis and optical behaviour of mesoporous silica functionalized by organometallic molecules

    NASA Astrophysics Data System (ADS)

    Laskowski, L.; Kassiba, A.; Makowska-Janusik, M.; Errien, N.; Mehdi, A.; Swiatek, J.

    2011-04-01

    Mesoporous silica SBA-15 functionalized by (1,4,8,11-tetraazacyclotetradecane) cyclam groups chelating nickel ions (Ni-cyclam) were synthesized by two different approaches. Characterizations by transmission electron microscopy TEM and UV-VIS absorption spectroscopy were performed to monitor the structure and optical properties of the material with regard to the used synthesis methods. The assignment of the experimental UV-VIS absorption spectra is carried out by using the support of suitable numerical simulations based on quantum chemistry DFT codes developed on the modelled (Ni-cyclam) system as free molecule and also constrained in the pores of mesoporous silica matrices.

  1. Lanthanide Selective Sorbents: Self-Assembled Monolayers on Mesoporous Supports (SAMMS)

    SciTech Connect

    Fryxell, Glen E.; Wu, Hong; Lin, Yuehe; Shaw, Wendy J.; Birnbaum, Jerome C.; Linehan, John C.; Nie, Zimin; Kemner, Kenneth M.; Kelly, Shelley

    2004-11-01

    Through the marriage of mesoporous ceramics with self-assembled monolayer chemistry, the genesis of a powerful new class of environmental sorbent materials has been realized. By coating the mesoporous ceramic backbone with a monolayer terminated with a lanthanide-specific ligand, it is possible to couple high lanthanide binding affinity with the high loading capacity (resulting from the extremely high surface area of the support). This lanthanide-specific ligand field is created by pairing a “hard” anionic Lewis base with a suitable synergistic ligand, in a favorable chelating geometry. Details of the synthesis, characterization, lanthanide binding studies, binding kinetics, competition experiments and sorbent regeneration studies are summarized.

  2. Lanthanide Selective Sorbents: Self-Assembled Monolayers on Mesoporous Supports (SAMMS)

    SciTech Connect

    Fryxell, Glen E.; Wu, Hong; Lin, Yuehe; Shaw, Wendy J.; Birnbaum, Jerome C.; Linehan, John C.; Nie, Zimin; Kemner, K. M.; Kelly, Shelley

    2004-11-01

    Through the marriage of mesoporous ceramics with self-assembled monolayer chemistry, the genesis of a powerful new class of environmental sorbent materials has been realized. By coating the mesoporous ceramic backbone with a monolayer terminated with a lanthanide-specific ligand, it is possible to couple high lanthanide binding affinity with the high loading capacity (resulting from the extremely high surface area of the support). This lanthanide-specific ligand field is created by pairing a ''hard'' anionic Lewis base with a suitable synergistic ligand, in a favorable chelating geometry. Details of the synthesis, characterization, lanthanide binding studies, binding kinetics, competition experiments and sorbent regeneration studies are summarized

  3. Soft-Templating Synthesis and Properties of Mesoporous Alumina-Titania

    SciTech Connect

    Morris, Stacy M; Horton, Jr, Joe A; Jaroniec, Mietek

    2010-01-01

    Mesoporous alumina-titania materials, having various molar compositions of aluminum and titanium, were synthesized via cooperative self-assembly of the corresponding metal alkoxides and Pluronic P123 triblock copolymer (soft template) in ethanolic solution under acidic conditions. The resulting mixed metal oxides possess ordered mesopores at low to equal molar compositions of titanium in relation to aluminum (up to 50%) and worm-like mesostructures at higher molar compositions of titanium (50-75%). In addition, these mesoporous oxides exhibit high BET surface areas (up to 438 m2/g), large pore widths (from 7.37 to 18.55 nm) and pore volumes (from 0.16 to 0.64 cm3/g), narrow pore size distributions, crystalline pore walls and high thermal stability.

  4. Preparing mesoporous carbon and silica with rosin-silica composite gel.

    PubMed

    Liu, Haidi; Du, Shangfeng; Chen, Yunfa

    2009-02-01

    Mesoporous carbon and mesoporous silica were prepared respectively with a same rosin-silica nanocomposite gel which was synthesized by cogelating tetra-ethyl-oxy-silane (silica source) and rosin (carbon source). Carbonizing the gel in nitrogen and then etching away silica with alkaline solution, mesoporous carbon with specific surface area larger than 800 m2/g was obtained. If calcining the gel at high temperature in air for given time, porous silica with surface area higher than 700 m2/g was done. BET measurement was employed to investigate the pore distribution and surface area of the samples. Most of the pores in both the porous carbon and porous silica were mesoscale, which makes the materials potential in enzyme supports for bio-catalyzed reaction or adsorbents for contaminants with large molecular size. PMID:19441395

  5. Foamed mesoporous carbon/silicon composite nanofiber anode for lithium ion batteries

    NASA Astrophysics Data System (ADS)

    Wang, Yuxin; Wen, Xiufang; Chen, Juan; Wang, Shengnian

    2015-05-01

    A new porous composite nanofiber manufacturing route, combining electrospinning and foaming processes, was developed. In this process, aluminum acetylacetonate (AACA) was introduced as the foaming agent in nanofibers made of polyacrylonitrile (PAN)/silicon (Si) nanoparticles. PAN/Si composite nanofibers were first produced through an electrospinning process and mesopores were then generated by foaming nanofibers via AACA sublimation. After further carbonization, the obtained mesoporous carbon/silicon composite nanofiber mats were tested as the anode material for lithium ion batteries. Within this composite anode, mesopores provide needed buffering space to accommodate the large volume expansion and consequent stress induced inside silicon during lithiation. This effectively mitigates silicon pulverization issue and helps achieve higher reversible capacity and better capacity retention in later battery tests when compared with anodes made of nonporous composites nanofibers and carbon nanofibers alone.

  6. Fabrication of ordered mesoporous carbon film supporting vanadium oxides for electrochemical supercapacitor

    NASA Astrophysics Data System (ADS)

    Zhao, Chunxia; Li, Junshen; Cao, Jinqiao; Chen, Wen

    2015-11-01

    Ordered mesoporous carbon film supporting vanadium oxide nanoparticles has been synthesized via ultrasound-assistant impregnation method with ordered mesoporous carbon C-FDU15 film as the host and V2O5 sol as the guest precursor. The hybrids exhibit type IV sorption isotherms with H2 hysteresis loop, indicating the well-retained characteristics of ordered mesoporous structure. The capacitance of the materials is enhanced with V2O5 loading. Particularly, the hybrids with 32.26 wt.% V2O5 loading yield an important capacitance of 128 F/g in 1 mol/L KNO3 electrolyte under a potential range from -0.6 V to 0.6 V. The improved specific capacitance of the hybrids is proposed to be the combination of the double-layer capacitance of ordered porous structure and the pseudocapacitance derived from V2O5.

  7. Transcription of G-quartet supramolecular aggregates into hierarchical mesoporous silica nanotubes.

    PubMed

    Min, Liang; Li, Tao; Tan, Qi; Tan, Xiaoping; Pan, Wu; He, Li; Zhang, Jie; Ou, Encai; Xu, Weijian

    2016-05-01

    The use of 5-guanosine monophosphate (GMP) with Sr(2+) ions to form G-quadruplex bundles as supramolecular templates for the preparation of hierarchical mesoporous silica nanotube materials is reported here, and some mesopores with a diameter of 4-22 nm were obtained. Furthermore, some mesopore channels which run perpendicularly to the center axis of the tube and penetrate right through the outer wall of the nanotubes were achieved by removing the templates. Besides, porous hollow silica spheres were obtained by changing some of the reaction conditions during the process of preparation. Their structures are stable even after high temperature calcination. A formation mechanism was proposed and discussed, and their structures were characterized using a number of means including X-ray diffraction, IR spectra, N2 adsorption-desorption isotherms, scanning electron microscopy (SEM) and transmission electron microscopy (TEM). PMID:27068442

  8. A general strategy for the rational design of size-selective mesoporous catalysts.

    PubMed

    Zapilko, Clemens; Liang, Yucang; Nerdal, Willy; Anwander, Reiner

    2007-01-01

    A series of functionalized mesoporous silicas with cagelike pore topology has been synthesized and screened for size-selective catalytic transformations. The aluminum-catalyzed Meerwein-Ponndorf-Verley (MPV) reduction of differently sized aromatic aldehydes (benzaldehyde and 1-pyrenecarbox-aldehyde) has been investigated as a test reaction. The catalysts were synthesized in a two-step grafting sequence comprising pore-size engineering of mesoporous silicas (SBA-1, SBA-2, SBA-16) with long-chain alkyl dimethylaminosilanes and surface organoaluminum chemistry with triethylaluminum [{Al(CH(2)CH(3))3}2]. Size-selective reaction behavior was found for small pore SBA-1 materials, and the selectivity could be efficiently tuned by selecting a silylating reagent of appropriate size. The results are compared with the catalytic performance of a large-pore periodic mesoporous organosilica PMO[SBA-1] and the nonporous high-surface-area silicas Aerosil 300/380. PMID:17203494

  9. Mesoporous NiO crystals with dominantly exposed {110} reactive facets for ultrafast lithium storage

    PubMed Central

    Su, Dawei; Ford, Mike; Wang, Guoxiu

    2012-01-01

    Faceted crystals with exposed highly reactive planes have attracted intensive investigations for applications such as hydrogen production, enhanced catalytic activity, and electrochemical energy storage and conversion. Herein, we report the synthesis of mesoporous NiO crystals with dominantly exposed {110} reactive facets by the thermal conversion of hexagonal Ni(OH)2 nanoplatelets. When applied as anode materials in lithium-ion batteries, mesoporous NiO crystals exhibit a high reversible lithium storage capacity of 700 mAh g−1 at 1 C rate in 100 cycles and an excellent cyclability. In particular, the dominantly exposed {110} reactive facets and mesoporous nanostructure of NiO crystals lead to ultrafast lithium storage, which mimics the high power delivery of supercapacitors. PMID:23226591

  10. Sample Desorption/Onization From Mesoporous Silica

    DOEpatents

    Iyer, Srinivas; Dattelbaum, Andrew M.

    2005-10-25

    Mesoporous silica is shown to be a sample holder for laser desorption/ionization of mass spectrometry. Supported mesoporous silica was prepared by coating an ethanolic silicate solution having a removable surfactant onto a substrate to produce a self-assembled, ordered, nanocomposite silica thin film. The surfactant was chosen to provide a desired pore size between about 1 nanometer diameter and 50 nanometers diameter. Removal of the surfactant resulted in a mesoporous silica thin film on the substrate. Samples having a molecular weight below 1000, such as C.sub.60 and tryptophan, were adsorbed onto and into the mesoporous silica thin film sample holder and analyzed using laser desorption/ionization mass spectrometry.

  11. Incorporation of well-dispersed sub-5-nm graphitic pencil nanodots into ordered mesoporous frameworks

    NASA Astrophysics Data System (ADS)

    Kong, Biao; Tang, Jing; Zhang, Yueyu; Jiang, Tao; Gong, Xingao; Peng, Chengxin; Wei, Jing; Yang, Jianping; Wang, Yongcheng; Wang, Xianbiao; Zheng, Gengfeng; Selomulya, Cordelia; Zhao, Dongyuan

    2016-02-01

    Over the past few decades the direct assembly of optical nanomaterials into ordered mesoporous frameworks has proved to be a considerable challenge. Here we propose the incorporation of ultrasmall (sub-5-nm) graphitic pencil nanodots into ordered mesoporous frameworks for the fabrication of optoelectronic materials. The nanodots, which were prepared from typical commercial graphite pencils by an electrochemical tailoring process, combine properties such as uniform size (˜3 nm), excellent dispersibility and high photoconversion efficiency (˜27%). These nanodots were incorporated into a variety of ordered mesoporous frameworks (TiO2, silica, carbon and silica-carbon materials) by co-assembly, driven by hydrogen bonding, with the frameworks' precursors. The resulting materials showed a high degree of ordering, and a sharp increase in their optical performance (for example, photocurrent density). We envisage that the large-scale synthesis of ultrasmall carbon nanodots and their incorporation into ordered mesoporous frameworks may facilitate the preparation of materials with a variety of optical properties.

  12. Incorporation of well-dispersed sub-5-nm graphitic pencil nanodots into ordered mesoporous frameworks.

    PubMed

    Kong, Biao; Tang, Jing; Zhang, Yueyu; Jiang, Tao; Gong, Xingao; Peng, Chengxin; Wei, Jing; Yang, Jianping; Wang, Yongcheng; Wang, Xianbiao; Zheng, Gengfeng; Selomulya, Cordelia; Zhao, Dongyuan

    2016-02-01

    Over the past few decades the direct assembly of optical nanomaterials into ordered mesoporous frameworks has proved to be a considerable challenge. Here we propose the incorporation of ultrasmall (sub-5-nm) graphitic pencil nanodots into ordered mesoporous frameworks for the fabrication of optoelectronic materials. The nanodots, which were prepared from typical commercial graphite pencils by an electrochemical tailoring process, combine properties such as uniform size (∼3 nm), excellent dispersibility and high photoconversion efficiency (∼27%). These nanodots were incorporated into a variety of ordered mesoporous frameworks (TiO2, silica, carbon and silica-carbon materials) by co-assembly, driven by hydrogen bonding, with the frameworks' precursors. The resulting materials showed a high degree of ordering, and a sharp increase in their optical performance (for example, photocurrent density). We envisage that the large-scale synthesis of ultrasmall carbon nanodots and their incorporation into ordered mesoporous frameworks may facilitate the preparation of materials with a variety of optical properties. PMID:26791901

  13. Large pore mesoporous silica nanomaterials for application in delivery of biomolecules

    NASA Astrophysics Data System (ADS)

    Knežević, Nikola Ž.; Durand, Jean-Olivier

    2015-01-01

    Various approaches for the synthesis of mesoporous silicate nanoparticles (MSN) with large pore (LP) diameters (in the range of 3-50 nm) are reviewed in this article. The work also covers the construction of magnetic analogues of large pore-mesoporous silica nanoparticles (LPMMSN) and their biomedical applications. The constructed materials exhibit vast potential for application in the loading and delivery of large drug molecules and biomolecules. Literature reports on the application of LPMSN and LPMMSN materials for the adsorption and delivery of proteins, enzymes, antibodies, and nucleic acids are covered in depth, which exemplify their highly potent characteristics for use in drug and biomolecule delivery to diseased tissues.Various approaches for the synthesis of mesoporous silicate nanoparticles (MSN) with large pore (LP) diameters (in the range of 3-50 nm) are reviewed in this article. The work also covers the construction of magnetic analogues of large pore-mesoporous silica nanoparticles (LPMMSN) and their biomedical applications. The constructed materials exhibit vast potential for application in the loading and delivery of large drug molecules and biomolecules. Literature reports on the application of LPMSN and LPMMSN materials for the adsorption and delivery of proteins, enzymes, antibodies, and nucleic acids are covered in depth, which exemplify their highly potent characteristics for use in drug and biomolecule delivery to diseased tissues. Dedicated to Professor Jeffrey I. Zink on the occasion of his 70th birthday.

  14. Alendronate functionalized mesoporous hydroxyapatite nanoparticles for drug delivery

    SciTech Connect

    Li, Dongdong; Zhu, Yuntao; Liang, Zhiqiang

    2013-06-01

    Highlights: ► The synthesized mesoporous hydroxyapatite has nanostructure and bioactivity. ► The materials have high surface area and amino group. ► The materials show higher drug loading and slower release rate than pure HAP. - Abstract: Mesoporous nanosized hydroxyapatite (HAP) functionalized by alendronate (ALN) was synthesized using cationic surfactant CTAB as template. The structural, morphological and textural properties were fully characterized by X-ray diffraction (XRD), transmission electron microscopy (TEM), Fourier transform infrared spectroscopy (FT-IR) and N{sub 2} adsorption/desorption. Then the obtained materials were performed as drug delivery carriers using ibuprofen (IBU) as a model drug to investigate their drug storage/release properties in simulated body fluid (SBF). The materials showed relatively slower release rate compared with HAP due to the ionic interaction between -NH{sub 3}{sup +} on the matrix and -COO{sup −}belongs to IBU. The system provides a new concept for improving the drug loading or slowing down the release rate.

  15. Cellulose conjugated FITC-labelled mesoporous silica nanoparticles: intracellular accumulation and stimuli responsive doxorubicin release

    NASA Astrophysics Data System (ADS)

    Hakeem, Abdul; Zahid, Fouzia; Duan, Ruixue; Asif, Muhammad; Zhang, Tianchi; Zhang, Zhenyu; Cheng, Yong; Lou, Xiaoding; Xia, Fan

    2016-02-01

    Herein, we design novel cellulose conjugated mesoporous silica nanoparticle (CLS-MSP) based nanotherapeutics for stimuli responsive intracellular doxorubicin (DOX) delivery. DOX molecules are entrapped in pores of the fabricated mesoporous silica nanoparticles (MSPs) while cellulose is used as an encapsulating material through esterification on the outlet of the pores of the MSPs to avoid premature DOX release under physiological conditions. In in vitro studies, stimuli responsive DOX release is successfully achieved from DOX loaded cellulose conjugated mesoporous silica nanoparticles (DOX/CLS-MSPs) by pH and cellulase triggers. Intracellular accumulation of DOX/CLS-MSPs in human liver cancer cells (HepG2 cells) is investigated through confocal microscope magnification. Cell viability of HepG2 cells is determined as the percentage of the cells incubated with DOX/CLS-MSPs compared with that of non-incubated cells through an MTT assay.Herein, we design novel cellulose conjugated mesoporous silica nanoparticle (CLS-MSP) based nanotherapeutics for stimuli responsive intracellular doxorubicin (DOX) delivery. DOX molecules are entrapped in pores of the fabricated mesoporous silica nanoparticles (MSPs) while cellulose is used as an encapsulating material through esterification on the outlet of the pores of the MSPs to avoid premature DOX release under physiological conditions. In in vitro studies, stimuli responsive DOX release is successfully achieved from DOX loaded cellulose conjugated mesoporous silica nanoparticles (DOX/CLS-MSPs) by pH and cellulase triggers. Intracellular accumulation of DOX/CLS-MSPs in human liver cancer cells (HepG2 cells) is investigated through confocal microscope magnification. Cell viability of HepG2 cells is determined as the percentage of the cells incubated with DOX/CLS-MSPs compared with that of non-incubated cells through an MTT assay. Electronic supplementary information (ESI) available. See DOI: 10.1039/c5nr08753h

  16. Mesoporous tertiary oxides via a novel amphiphilic approach

    SciTech Connect

    Bennett, Natasha; Hall, Simon R. E-mail: Annela.Seddon@bristol.ac.uk; Seddon, Annela M. E-mail: Annela.Seddon@bristol.ac.uk; Hallett, James E.; Kockelmann, Winfried; Ting, Valeska P.; Sadasivan, Sajanikumari; Tooze, Robert P.

    2016-01-01

    We report a facile biomimetic sol-gel synthesis using the sponge phase formed by the lipid monoolein as a structure-directing template, resulting in high phase purity, mesoporous dysprosium- and gadolinium titanates. The stability of monoolein in a 1,4-butanediol and water mixture complements the use of a simple sol-gel metal oxide synthesis route. By judicious control of the lipid/solvent concentration, the sponge phase of monoolein can be directly realised in the pyrochlore material, leading to a porous metal oxide network with an average pore diameter of 10 nm.

  17. Synthesis of mesoporous silica nanoparticles.

    PubMed

    Wu, Si-Han; Mou, Chung-Yuan; Lin, Hong-Ping

    2013-05-01

    Good control of the morphology, particle size, uniformity and dispersity of mesoporous silica nanoparticles (MSNs) is of increasing importance to their use in catalyst, adsorption, polymer filler, optical devices, bio-imaging, drug delivery, and biomedical applications. This review discusses different synthesis methodologies to prepare well-dispersed MSNs and hollow silica nanoparticles (HSNs) with tunable dimensions ranging from a few to hundreds of nanometers of different mesostructures. The methods include fast self-assembly, soft and hard templating, a modified Stöber method, dissolving-reconstruction and modified aerogel approaches. In practical applications, the MSNs prepared by these methods demonstrate good potential for use in high-performance catalysis, antireflection coating, transparent polymer-MSNs nanocomposites, drug-release and theranostic systems. PMID:23403864

  18. Zirconia-silica based mesoporous desulfurization adsorbents

    NASA Astrophysics Data System (ADS)

    Palomino, Jessica M.; Tran, Dat T.; Kareh, Ana R.; Miller, Christopher A.; Gardner, Joshua M. V.; Dong, Hong; Oliver, Scott R. J.

    2015-03-01

    We report a series of mesoporous silicate sorbent materials templated by long-chain primary alkylamines that display record level of desulfurization of the jet fuel JP-8. Pure silica frameworks and those with a Si:Zr synthesis molar ratio ranging from 44:1 to 11:1 were investigated. The optimum sorbent was identified as dodecylamine-templated silica-zirconia synthesized from a gel with Si:Zr molar ratio of 15:1. With an optimized silver loading of 11 wt.%, a saturation adsorption capacity of 39.4 mgS g-1 and a silver efficiency of 1.21 molS mol Ag-1 were observed for JP-8. This sorbent displayed exceptional regenerability, maintaining 86% of its initial capacity in model fuel after solvent regeneration with diethyl ether. Low-cost, portable and reusable sorbents for the desulfurization of JP-8 jet fuel are needed to make solid oxide fuel cells (SOFCs) a reality for military power needs. SOFCs require ultra-low sulfur content fuel, which traditional desulfurization methods cannot achieve.

  19. Enzyme-Powered Hollow Mesoporous Janus Nanomotors.

    PubMed

    Ma, Xing; Jannasch, Anita; Albrecht, Urban-Raphael; Hahn, Kersten; Miguel-López, Albert; Schäffer, Erik; Sánchez, Samuel

    2015-10-14

    The development of synthetic nanomotors for technological applications in particular for life science and nanomedicine is a key focus of current basic research. However, it has been challenging to make active nanosystems based on biocompatible materials consuming nontoxic fuels for providing self-propulsion. Here, we fabricate self-propelled Janus nanomotors based on hollow mesoporous silica nanoparticles (HMSNPs), which are powered by biocatalytic reactions of three different enzymes: catalase, urease, and glucose oxidase (GOx). The active motion is characterized by a mean-square displacement (MSD) analysis of optical video recordings and confirmed by dynamic light scattering (DLS) measurements. We found that the apparent diffusion coefficient was enhanced by up to 83%. In addition, using optical tweezers, we directly measured a holding force of 64 ± 16 fN, which was necessary to counteract the effective self-propulsion force generated by a single nanomotor. The successful demonstration of biocompatible enzyme-powered active nanomotors using biologically benign fuels has a great potential for future biomedical applications. PMID:26437378

  20. Microwave synthesis and electrochemical characterization of mesoporous carbon@Bi{sub 2}O{sub 3} composites

    SciTech Connect

    Xia, Nannan; Yuan, Dingsheng; Zhou, Tianxiang; Chen, Jingxing; Mo, Shanshan; Liu, Yingliang

    2011-05-15

    Graphical abstract: An efficient and quick microwave method has been employed to prepare worm-like mesoporous carbon@Bi{sub 2}O{sub 3} composites for the first time. The electrochemical measurement shows the worm-like mesoporous carbon@Bi{sub 2}O{sub 3} composites exhibits excellent capacitance performance and the maximum specific capacitance is up to 386 F g{sup -1}. Research highlights: {yields} An efficient and quick microwave method has been employed. {yields} A worm-like mesoporous carbon@Bi{sub 2}O{sub 3} composites have been successfully prepared. {yields} This composite exhibits excellent capacitance performance. {yields} This composite could be a potential electrode material for the supercapacitors. -- Abstract: An efficient and quick microwave method has been employed to prepare worm-like mesoporous carbon@Bi{sub 2}O{sub 3} composites for the first time. As-prepared products have been characterized by X-ray diffraction, N{sub 2} adsorption-desorption, scanning electron microscopy, transmission electron microscopy and inductive coupled plasma atomic emission spectroscopy. The electrochemical measurement shows the worm-like mesoporous carbon@Bi{sub 2}O{sub 3} composites exhibits excellent capacitance performance and the maximum specific capacitance reaches 386 F g{sup -1}, three times more than the pure worm-like mesoporous carbon.

  1. Nitrogen-enriched carbon with extremely high mesoporosity and tunable mesopore size for high-performance supercapacitors

    NASA Astrophysics Data System (ADS)

    Yang, Xiaoqing; Li, Chengfei; Fu, Ruowen

    2016-07-01

    As one of the most potential electrode materials for supercapacitors, nitrogen-enriched nanocarbons are still facing challenge of constructing developed mesoporosity for rapid mass transportation and tailoring their pore size for performance optimization and expanding their application scopes. Herein we develop a series of nitrogen-enriched mesoporous carbon (NMC) with extremely high mesoporosity and tunable mesopore size by a two-step method using silica gel as template. In our approach, mesopore size can be easily tailored from 4.7 to 35 nm by increasing the HF/TEOS volume ratio from 1/100 to 1/4. The NMC with mesopores of 6.2 nm presents the largest mesopore volume, surface area and mesopore ratio of 2.56 cm3 g-1, 1003 m2 g-1 and 97.7%, respectively. As a result, the highest specific capacitance of 325 F g-1 can be obtained at the current density of 0.1 A g-1, which can stay over 88% (286 F g-1) as the current density increases by 100 times (10 A g-1). This approach may open the doors for preparation of nitrogen-enriched nanocarbons with desired nanostructure for numerous applications.

  2. Effect of polyvinylpyrrolidone on mesoporous silica morphology and esterification of lauric acid with 1-butanol catalyzed by immobilized enzyme

    NASA Astrophysics Data System (ADS)

    Zhang, Jinyu; Zhou, Guowei; Jiang, Bin; Zhao, Minnan; Zhang, Yan

    2014-05-01

    Mesoporous silica materials with a range of morphology evolution, i.e., from curved rod-shaped mesoporous silica to straight rod-shaped mesoporous silica, were successfully prepared using polyvinylpyrrolidone (PVP) and triblock copolymer as dual template. The effects of PVP molecular weight and concentration on mesoporous silica structure parameters were studied. Results showed that surface area and pore volume continuously decreased with increased PVP molecular weight. Mesoporous silica prepared with PVP K30 also possessed larger pore diameter, interplanar spacing (d100), and cell parameter (a0) than that prepared with PVP K15 and PVP K90. In addition, with increased PVP concentration, d100 and a0 continuously decreased. The mechanism of morphology evolution caused by the change in PVP concentration was investigated. The conversion rate of lauric acid with 1-butanol catalyzed by immobilized Porcine pancreatic lipase (PPL) was also evaluated. Results showed that PPL immobilized on amino-functionalized straight rod-shaped mesoporous silica maintained 50% of its esterification conversion rate even after five cycles of use with a maximum conversion rate was about 90.15%.

  3. Magnetic γ-Fe2O3, Fe3O4, and Fe nanoparticles confined within ordered mesoporous carbons as efficient microwave absorbers.

    PubMed

    Wang, Jiacheng; Zhou, Hu; Zhuang, Jiandong; Liu, Qian

    2015-02-01

    A series of magnetic γ-Fe2O3, Fe3O4, and Fe nanoparticles have been successfully introduced into the mesochannels of ordered mesoporous carbons by the combination of the impregnation of iron salt precursors and then in situ hydrolysis, pyrolysis and reduction processes. The magnetic nanoparticles are uniformly dispersed and confined within the mesopores of mesoporous carbons. Although the as-prepared magnetic mesoporous carbon composites have high contents of magnetic components, they still possess very high specific surface areas and pore volumes. The magnetic hysteresis loops measurements indicate that the magnetic constituents are poorly-crystalline nanoparticles and their saturation magnetization is evidently smaller than bulky magnetic materials. The confinement of magnetic nanoparticles within the mesopores of mesoporous carbons results in the decrease of the complex permittivity and the increase of the complex permeability of the magnetic nanocomposites. The maximum reflection loss (RL) values of -32 dB at 11.3 GHz and a broad absorption band (over 2 GHz) with RL values <-10 dB are obtained for 10-Fe3O4-CMK-3 and 10-γ-Fe2O3-CMK-3 composites in a frequency range of 8.2-12.4 GHz (X-band), showing their great potentials in microwave absorption. This research opens a new method and idea for developing novel magnetic mesoporous carbon composites as high-performance microwave absorbing materials. PMID:25562071

  4. Synthesis of Xylylene-Bridged Periodic Mesoporous Organosilicas and Related Hollow Spherical Nanoparticles.

    PubMed

    Manchanda, Amanpreet S; Kruk, Michal

    2016-01-26

    A variety of organosilicas with p-xylylene bridging groups in the framework were synthesized using Pluronic F127 triblock copolymer as a micellar template under moderately acidic conditions in the presence of xylene as a micelle swelling agent. The resulting materials were characterized by using nitrogen adsorption, small-angle X-ray scattering, transmission electron microscopy, and (29)Si and (13)C cross-polarization magic angle spinning NMR. As the ratio of the organosilica precursor to Pluronic F127 was decreased, the structure evolved from highly ordered periodic mesoporous organosilica (PMO) to weakly ordered PMO, loosely aggregated hollow organosilica nanospheres, and finally to a significantly aggregated disordered structure. The highly ordered PMO with primarily face-centered cubic structure was effectively a closed-pore material. However, the weakly ordered variant exhibited large-diameter (∼15 nm) spherical mesopores, which were accessible after calcination under appropriate conditions or after extraction. The hollow nanospheres had readily accessible, uniform inner cavities whose size was readily tunable by adjusting the amount of the swelling agent used. It was also possible to convert the organosilica nanospheres into hollow silica nanospheres with inaccessible (closed) mesopores. The formation of distinct well-defined morphologies with spherical mesopores for an organosilica with large bridging groups in the framework shows that block-copolymer-surfactant templating is a powerful and versatile method for controlling the nanoscale structures of these remarkable materials. PMID:26714054

  5. Synthesis of 5-hydroxymethylfurural from carbohydrates using large-pore mesoporous tin phosphate.

    PubMed

    Dutta, Arghya; Gupta, Dinesh; Patra, Astam K; Saha, Basudeb; Bhaumik, Asim

    2014-03-01

    A large-pore mesoporous tin phosphate (LPSnP-1) material has been synthesized hydrothermally by using Pluronic P123 as the structure-directing agent. The material is composed of aggregated nanoparticles of 10-15 nm in diameter and has a BET surface area of 216 m(2)  g(-1) with an average pore diameter of 10.4 nm. This pore diameter is twice as large as that of mesoporous tin phosphate materials synthesized through the surfactant-templating pathways reported previously. LPSnP-1 shows excellent catalytic activity for the conversion of fructose, glucose, sucrose, cellobiose, and cellulose to 5-hydroxymethylfurfural (HMF) in a water/methyl isobutyl ketone biphasic solvent to give maximum yields of HMF of 77, 50, 51, 39, and 32 mol %, respectively, under microwave-assisted heating at 423 K. Under comparable reaction conditions, LPSnP-1 gives 12 % more HMF yield than a small-pore mesoporous tin phosphate catalyst that has an identical framework composition. This confirms the beneficial role of large mesopores and nanoscale particle morphology in catalytic reactions that involve bulky natural carbohydrate molecules. PMID:24474710

  6. Silver nanoparticles incorporated onto ordered mesoporous silica from Tollen's reagent

    NASA Astrophysics Data System (ADS)

    Zienkiewicz-Strzałka, M.; Pasieczna-Patkowska, S.; Kozak, M.; Pikus, S.

    2013-02-01

    Noble metal nanostructures supported on mesoporous silica are bridge between traditional silica adsorbents and modern catalysts. In this work the Ag/SBA-15 mesoporous materials were synthesized and characterized. Various forms of nanosilver supported on ordered mesoporous template have been successfully obtained via proposed procedures. In all synthesized materials, Tollen's reagent (diammine silver complex [Ag(NH3)2]+) was used as a silver source. Silver nanoparticles were prepared by reduction of ammoniacal silver complex by formaldehyde in the solution of stabilizer. After reduction, Ag nanoparticles could be deposited on SBA-15, or added during traditional synthesis of SBA-15 giving silver or silver chloride nanoparticles in the combination with porous silica. Silver nanostructures as nanoparticles or nanowires were also embedded onto the SBA-15 by incipient wetness impregnation of silver ions. Absorbed silver ions were next reduced under hydrogen at high temperature. There are many advantages of utilized ammoniacal silver complex as a silver source. Proposed method is capable to synthesis of various metal nanostructures with controlled composition and morphology. The silver ammonia complex is composed of two ions surrounding and protecting the central silver ion, so it is possible to obtain very small nanoparticles using simple approach without any functionalization of external and internal surface of SBA-15. This approach allows obtaining greatly small silver nanoparticles on SBA-15 (4 nm) or nanowires depending on the metal loading amount. Moreover, the colloidal silver solution prepared from Tollen's reagent, in the presence of triblock copolymer, remains stable for a long time. Reduction of Tollen's reagent to silver colloidal solution seems to be efficient, fast and interesting approach for the preparation of supported silver nanostructures Obtained samples were characterized by powder X-ray diffraction, small angle X-ray scattering (SAXS), UV

  7. Carbon functionalized mesoporous silica-based gas sensors for indoor volatile organic compounds.

    PubMed

    Liu, Yupu; Chen, Junchen; Li, Wei; Shen, Dengke; Zhao, Yujuan; Pal, Manas; Yu, Haijun; Tu, Bo; Zhao, Dongyuan

    2016-09-01

    Indoor organic gaseous pollution is a global health problem, which seriously threats the health and life of human all over the world. Hence, it is important to fabricate new sensing materials with high sensitivity and efficiency for indoor volatile organic compounds. In this study, a series of ordered mesoporous silica-based nanocomposites with uniform carbon coatings on the internal surface of silica mesopore channels were synthesized through a simple template-carbonization strategy. The obtained mesoporous silica-carbon nanocomposites not only possess ordered mesostructures, high surface areas (up to ∼759m(2)g(-1)), large and tunable pore sizes (2.6-10.2nm), but also have the improved hydrophobicity and anti-interference capability to environmental humidity. The sensing performances of the mesoporous silica-carbon nanocomposites to volatile organic compounds, such as ethylbenzene, methylbenzene, benzene, methanol, acetone, formaldehyde, dichloromethane and tetrahydrofuran, were systematically investigated. The relationships between the sensing performances and their properties, including mesostructures, surface areas, pore sizes, carbon contents and surface hydrophilic/hydrophobic interactions, have been achieved. The mesoporous silica-carbon nanocomposites with hexagonal mesostructure exhibit outstanding performance at room temperature to benzene and acetone with high responses, short response (2-3s) and recovery (16-19s) time, strong anti-interference to environmental humidity, and long-term stability (less than ∼5% loss of the frequency shifts after 42days). Therefore, the obtained mesoporous silica-carbon nanocomposites have a hopeful prospect in the field of environmental air quality monitoring. PMID:27240244

  8. The intracellular controlled release from bioresponsive mesoporous silica with folate as both targeting and capping agent

    NASA Astrophysics Data System (ADS)

    Guo, Rui; Li, Le-Le; Zhao, Wen-Hua; Chen, Yu-Xi; Wang, Xiao-Zhu; Fang, Chen-Jie; Feng, Wei; Zhang, Tian-Lan; Ma, Xiang; Lu, Meng; Peng, Shi-Qi; Yan, Chun-Hua

    2012-05-01

    A smart mesoporous silica nanocarrier with intracellular controlled release is fabricated, with folic acid as dual-functional targeting and capping agent. The folate not only improves the efficiency of the nanocarrier internalized by the cancer cells, but also blocks the pores of the mesoporous silica to eliminate premature leakage of the drug. With disulfide bonds as linkers to attach the dual-functional folate within the surface of mesoporous silica, the controlled release can be triggered in the presence of reductant dithiothreitol (DTT) or glutathione (GSH). The cellular internalization via folate-receptor-mediated endocytosis and the intracellular controlled release of highly toxic anticancer drug DOX were demonstrated with an in vitro HeLa cell culture, indicating an efficient cancer-targeted drug delivery.A smart mesoporous silica nanocarrier with intracellular controlled release is fabricated, with folic acid as dual-functional targeting and capping agent. The folate not only improves the efficiency of the nanocarrier internalized by the cancer cells, but also blocks the pores of the mesoporous silica to eliminate premature leakage of the drug. With disulfide bonds as linkers to attach the dual-functional folate within the surface of mesoporous silica, the controlled release can be triggered in the presence of reductant dithiothreitol (DTT) or glutathione (GSH). The cellular internalization via folate-receptor-mediated endocytosis and the intracellular controlled release of highly toxic anticancer drug DOX were demonstrated with an in vitro HeLa cell culture, indicating an efficient cancer-targeted drug delivery. Electronic supplementary information (ESI) available: the details of XRD patterns and HRTEM images of the materials, release profile of F⊂M-F in an acidic solution, intracellular uptake measurement with flow cytometry, intracellular release measurement with confocal fluorescence microscopy, selected distance of folate derivatives. See DOI: 10

  9. Synthesis of ordered mesoporous silica and alumina with controlled macroscopic morphologies

    NASA Astrophysics Data System (ADS)

    Alsyouri, Hatem Mohammad Sadi

    The ability to synthesize nanostructured inorganic materials with controlled microstructural and morphological features will provide materials with unique characteristics in unprecedented ways. This thesis investigates the synthesis of porous silica and alumina materials with controlled microstructures and desirable shapes using novel approaches based on template-assisted synthesis and chemical vapor deposition (CVD) techniques. It primarily focuses on fabricating mesoporous materials with unique microstructures and different morphologies (particles and membranes) and exploring the potential of the particle morphology in a polymer reaction application. The template-assisted growth of mesoporous silica under acidic and quiescent conditions at an oil-water interface can generate mesostructured silica at the interface with fibrous, gyroidal, spherical, and film morphologies. Synthesis conditions can be used to alter the growth environment and control the product morphology. Fiber morphology is obtained at narrow range of experimental conditions due to slow and one-dimensional diffusion of silicon alkoxide through the interface. Variation in these conditions can alter the axial growth of silica and yield non-fibrous shapes. The fibers grow from their base attached to the interface and coalesce to form fibers with larger diameters. Gas transport in the mesoporous silica fibers is governed by combination of Knudsen and surface diffusion mechanisms. Surface diffusion contributes to 40% of the net flow reflecting a highly smooth pore surfaces. Real Knudsen and surface diffusivities are in the order of 10-3 and 10 -5 cm2/s respectively. The one-dimensional mesopores are 45 time longer than the macroscopic fiber length and align helically around the fiber axis, confirming the literature observations, with a pitch value of 1.05 micron. For preparation of mesoporous silica materials as membranes, a novel counter diffusion self assembly (CDSA) approach is demonstrated. This

  10. High-resolution electron microscopy study of mesoporous dichalcogenides and their hydrogen storage properties

    NASA Astrophysics Data System (ADS)

    She, Lan; Li, Jing; Gu, Dong; Shi, Yifeng; Che, Renchao; Zhao, Dongyuan

    2011-02-01

    In this work, we report a detailed investigation on the surface topology of ordered mesoporous WS2 nanoarrays nanocast from the silica SBA-15 template. Using a high-resolution scanning electron microscopy (HRSEM) technique, we acquire distinguishably clear images of the WS2 surface. A large number of small nanorods are found to be evenly distributed among the nanowire arrays, supporting their ordered mesostructures. Based on these observations, tunnel-like connecting pores are proposed to have a similar distribution in the mother mesoporous silica SBA-15 template. Interestingly, we observe the atomic crystal lattices of the layered WS2 on the HRSEM image. To the best of our knowledge, this is the first time that atomic crystal lattices have been directly observed using a SEM technique. In addition, both materials show good adsorption-desorption capabilities with hydrogen, and the maximum amount of hydrogen that can be taken up is 0.34 wt% for mesoporous WS2 and 0.52 wt% for mesoporous MoS2 at a pressure of 10 bar, indicating that both are potential hydrogen storage materials.

  11. Single-phased luminescent mesoporous nanoparticles for simultaneous cell imaging and anticancer drug delivery.

    PubMed

    Di, Weihua; Ren, Xinguang; Zhao, Haifeng; Shirahata, Naoto; Sakka, Yoshio; Qin, Weiping

    2011-10-01

    Multifunctional materials for biological use have mostly been designed with composite or hybrid nanostructures in which two or more components are incorporated. The present work reports on a multifunctional biomaterial based on single-phased luminescent mesoporous lanthanide oxide nanoparticles that combine simultaneous drug delivery and cell imaging. A simple strategy based on solid-state-chemistry thermal decomposition process was employed to fabricate the spherical mesoporous Gd(2)O(3):Eu nanoparticles with homogeneous size distribution. The porous nanoparticles developed by this strategy possess well-defined mesopores, large pore size and volume, and high specific surface area. The mesoporous features of nanoparticles impart the material with capabilities of loading and releasing the drug with a relatively high loading efficiency and a sustained release behavior of drugs. The DOX-loaded porous Gd(2)O(3) nanoparticles are able to kill the cancer cells efficiently upon incubation with the human cervical carcinoma (HeLa) cells, indicating the potential for treatment of cancer cells. Meanwhile, the intrinsic luminescence of Gd(2)O(3):Eu nanoparticles gives the function of optical imaging. Therefore, the drug release activity and effect of drugs on the cells can be effectively monitored via luminescence of nanoparticles themselves, realizing multifunctionality of simultaneous cell imaging and anticancer drug delivery in a single-phased nanoparticle. PMID:21745687

  12. Effect of multi-walled carbon nanotubes and conducting polymer on capacitance of mesoporous carbon electrode.

    PubMed

    Wang, Anmiao; Cheng, Yingwen; Zhang, Hongbo; Hou, Ye; Wang, Yanqin; Liu, Jie

    2014-09-01

    Porous carbon is the most widely used electrode materials in energy storage devices. It is generally accepted that in such electrodes, mesoporosity is more desired in supercapacitor than microporosity for the ions tranportation. However, the relatively poor conductivity of porous carbon often leads to low capacitance. To improve the capacity of mesoporous carbon based electrode, we designed a composite film composed of mesoporous carbon, multiwalled carbon nanotubes (MWNTs) and conducting polymer, Poly-3,4-ethylenedioxythiophene/poly(styrenesulfonate) (PEDOT-PSS), and hoped that each component in the composed film could contribute synergetically to improve electrochemical properties. The electrochemical performance of the film was evaluated by cyclic voltammetry and constant current charge/discharge method. With the assistance of MWNTs and conducting polymer, the specific capacitance of the mesoporous carbon based electrode was amplified six times. The electrode also presented excellent charge/discharge rate and good cycling stability, retaining about 94% of its initial capacitance after 1000 cycles. The results demonstrated that mesoporous carbon is more effectively utilized with assistance of MWNTs and conducting polymer in the electrode. Such method is very promising for the future applications of the porous carbon in electrode materials for high performance electrochemical supercapacitors. PMID:25924364

  13. Exoelectrogenic biofilm as a template for sustainable formation of a catalytic mesoporous structure.

    PubMed

    Yates, Matthew D; Cusick, Roland D; Ivanov, Ivan; Logan, Bruce E

    2014-11-01

    Mesoporous structures can increase catalytic activity by maximizing the ratio of surface area to volume, but current synthesis techniques utilize expensive polymers and toxic chemicals. A Geobacter sulfurreducens biofilm was used as a sustainable template to form mesoporous Pd structures while eliminating the need for synthetic chemicals. The bulk of the biofilm material was removed by thermal treatments after nanoparticle formation, producing a catalytic Pd mesoporous (pore size 9.7 ± 0.1 nm) structure attached to the graphite electrode with a 1.5-2 µm thick backbone composed of nanoparticles (∼200 nm). A control electrode electrochemically plated with Pd in the absence of a biofilm exhibited a variable planar Pd base (∼0.5-3 µm thick) with sporadic Pd extrusions (∼2 µm across, 1-5 µm tall) from the surface. The biotemplated mesoporous structure produced 15-20% higher stable current densities during H2 oxidation tests than the electrochemically plated control electrode, even though 30% less Pd was present in the biotemplated catalyst. These results indicate that electroactive biofilms can be used as a sustainable base material to produce nanoporous structures without the need for synthetic polymers. Biotechnol. Bioeng. 2014;111: 2349-2354. © 2014 Wiley Periodicals, Inc. PMID:24771104

  14. Electrochemical characteristics of discrete, uniform, and monodispersed hollow mesoporous carbon spheres in double-layered supercapacitors.

    PubMed

    Chen, Xuecheng; Kierzek, Krzysztof; Wenelska, Karolina; Cendrowski, Krzystof; Gong, Jiang; Wen, Xin; Tang, Tao; Chu, Paul K; Mijowska, Ewa

    2013-11-01

    Core-shell-structured mesoporous silica spheres were prepared by using n-octadecyltrimethoxysilane (C18TMS) as the surfactant. Hollow mesoporous carbon spheres with controllable diameters were fabricated from core-shell-structured mesoporous silica sphere templates by chemical vapor deposition (CVD). By controlling the thickness of the silica shell, hollow carbon spheres (HCSs) with different diameters can be obtained. The use of ethylene as the carbon precursor in the CVD process produces the materials in a single step without the need to remove the surfactant. The mechanism of formation and the role played by the surfactant, C18TMS, are investigated. The materials have large potential in double-layer supercapacitors, and their electrochemical properties were determined. HCSs with thicker mesoporous shells possess a larger surface area, which in turn increases their electrochemical capacitance. The samples prepared at a lower temperature also exhibit increased capacitance as a result of the Brunauer-Emmett-Teller (BET) area and larger pore size. PMID:23929713

  15. EPR in functional structures based on doped (nano, meso)-porous silica and titanium dioxide

    NASA Astrophysics Data System (ADS)

    Kassiba, A.; Makowska-Janusik, M.; Mehdi, A.

    2011-04-01

    EPR investigations are performed on mesoporous silica (SBA15) functionalized by Nickel-cyclam complexes (1,4,8,11-tetraazacyclotetradecane groups chelating nickel ions) and on mesoporous titanium dioxide with nitrogen doping. For functionalized silica, the magnetic behaviour of organometallic groups, their mutual interactions and dispersion in the host matrices are compared with respect to the doping rates and the synthesis procedures. The relaxation processes were analyzed from the thermal evolution of the paramagnetic spin susceptibilities and EPR line-widths. Particularly, some samples show the formation of clusters where phonon assisted one dimensional (1D) ferromagnetic ordering occurs below 45 K. For the mesoporous TiO2, systematic EPR investigations were performed on two main classes of materials with regard to the porosity degrees. The EPR experiments point out the efficiency of EPR method to probe the degree of functionalization of mesoporous silica or the nitrogen doping achievement in TiO2, and in general to give a valuable feedback to improve the synthesis routes of smart materials.

  16. Facile fabrication and supercapacitive properties of mesoporous zinc cobaltite microspheres

    NASA Astrophysics Data System (ADS)

    Wang, Qinghong; Du, Jialu; Zhu, Yuxuan; Yang, Jiaqin; Chen, Juan; Wang, Chao; Li, Liang; Jiao, Lifang

    2015-06-01

    Mesoporous zinc cobaltite (ZnCo2O4) microspheres have been successfully prepared by a facile solvothermal method followed by an annealing process. The as-prepared ZnCo2O4 displays uniform sphere-like morphology composed of interconnected ZnCo2O4 nanoparticles. The Brunauer-Emmett-Teller (BET) surface area of mesoporous ZnCo2O4 microspheres is about 51.4 m2 g-1 with dominant pore diameter of 7.5 nm. The novel ZnCo2O4 material exhibits high specific capacitance of 953.2 F g-1 and 768.5 F g-1 at discharge current densities of 4 A g-1 and 30 A g-1, respectively. The energy density can be estimated to be 26.68 Wh kg-1 at a power density of 8 kW kg-1. The specific capacitance retention is 97.8% after 3000 cycles, suggesting its excellent cycling stability. The superior electrochemical performance is mainly attributed to the uniformity of the surface structure and the porosity of the microspheres, which benefit electrons and ions transportation, provide large electrode-electrolyte contact area, and meanwhile reduce volume change during the charge-discharge process. This method of constructing porous microspheres is very effective, yet simple, and it could be applied in other high-performance metal oxide electrode materials for electrochemical capacitors, as well as in Li-ion batteries.

  17. Hydrolysis of Cellulose by a Mesoporous Carbon-Fe2(SO4)3/γ-Fe2O3 Nanoparticle-Based Solid Acid Catalyst

    NASA Astrophysics Data System (ADS)

    Yamaguchi, Daizo; Watanabe, Koki; Fukumi, Shinya

    2016-02-01

    Carbon-based solid acid catalysts have shown significant potential in a wide range of applications, and they have been successfully synthesized using simple processes. Magnetically separable mesoporous carbon composites also have enormous potential, especially in separation and adsorption technology. However, existing techniques have been unable to produce a magnetically separable mesoporous solid acid catalyst because no suitable precursors have been identified. Herein we describe a magnetically separable, mesoporous solid acid catalyst synthesized from a newly developed mesoporous carbon-γ-Fe2O3 nanoparticle composite. This material exhibits an equivalent acid density and catalytic activity in the hydrolysis of microcrystalline cellulose, to that of the cellulose-derived conventional catalyst. Since it is magnetically separable, this material can be readily recovered and reused, potentially reducing the environmental impact of industrial processes to which it is applied.

  18. Hydrolysis of Cellulose by a Mesoporous Carbon-Fe2(SO4)3/γ-Fe2O3 Nanoparticle-Based Solid Acid Catalyst

    PubMed Central

    Yamaguchi, Daizo; Watanabe, Koki; Fukumi, Shinya

    2016-01-01

    Carbon-based solid acid catalysts have shown significant potential in a wide range of applications, and they have been successfully synthesized using simple processes. Magnetically separable mesoporous carbon composites also have enormous potential, especially in separation and adsorption technology. However, existing techniques have been unable to produce a magnetically separable mesoporous solid acid catalyst because no suitable precursors have been identified. Herein we describe a magnetically separable, mesoporous solid acid catalyst synthesized from a newly developed mesoporous carbon-γ-Fe2O3 nanoparticle composite. This material exhibits an equivalent acid density and catalytic activity in the hydrolysis of microcrystalline cellulose, to that of the cellulose-derived conventional catalyst. Since it is magnetically separable, this material can be readily recovered and reused, potentially reducing the environmental impact of industrial processes to which it is applied. PMID:26856604

  19. Carbon Nanotube Synthesis Using Mesoporous Silica Templates

    SciTech Connect

    Zheng, Feng; Liang, Liang; Gao, Yufei; Sukamto, Johanes H.; Aardahl, Chris L.

    2002-07-01

    Well-aligned carbon nanotubes (CNTs) were grown on mesoporous silica films by chemical vapor deposition (CVD). Ethylene was used as the carbon source and CVD was performed at 1023 K and atmospheric pressure. The films were doped with Fe during gelation, and three different structure directing agents were used for mesoporous silica synthesis: polyoxyethylene (10) cetyl ether (C16EO10), Pluronic tri-block copolymer (P123), and cetyltriethylammonium chloride (CTAC). A high degree of CNT alignment on C16EO10-mesoporous silica films was produced at Fe:Si molar ratio of 1.80. Similar alignment of CNTs was achieved on the other two types of films but on CTAC-mesoporous silica films, CNTs only grew parallel to the substrate surface from the cracks in the films because of the in-plane arrangement of the mesopores in such films. Considerable progress has been made in producing multi-walled carbon nanotubes (CNTs) by catalytic CVD techniques. If CNTs are to be integrated into certain useful devices, it is critical to be able to grow highly aligned arrays of CNTs with narrow size distribution and at specific locations on a substrate. Long-range alignment normal to the substrate results from steric crowding if the initial catalyst sites are sufficiently dense. Alignment may be improved with better control of the density of catalytic sites by means of a template of appropriate pore structure. The confinement of CNTs by the pores during the initial growth may also help align CNTs.

  20. Mesoporous organosilicas functionalized by alkyl groups: Synthesis, structure and adsorption properties

    NASA Astrophysics Data System (ADS)

    Barczak, M.; Dąbrowski, A.; Iwan, M.; Rzączyńska, Z.

    2009-01-01

    Mesoporous organosilicas were synthesized by sol-gel co-condensation of tetraethoxysilane and appropriate alkoxysilanes in the presence of Pluronic P123 surfactant. Hexyl, dodecyl, and octadecyl alkyl chains have been incorporated into mesopores by such co-condensation. Obtained materials were characterized by X-ray diffraction, FTIR spectroscopy, nitrogen adsorption measurements and thermogravimetry. Two resulted materials have highly ordered SBA-15 structure (p6m symmetry), other two are less ordered. All the materials exhibit well-developed porous structure (surface areas 500 to 830m2/g, pore volumes 0.65-1.32 cm3/g) and a high content of organic pendant groups introduced during co-condensation. All materials are thermally stable to 180°C, after that thermal decomposition of alkyl pendant groups starts.

  1. Sol-gel synthesis and characterization of mesoporous manganese oxide

    SciTech Connect

    Hong Xinlin; Zhang Gaoyong; Zhu Yinyan; Yang Hengquan

    2003-10-30

    Mesoporous manganese oxide (MPMO) from reduction of KMnO{sub 4} with maleic acid, was obtained and characterized in detail. The characterization of the material was confirmed by high-resolution transmission electron microscopy (HRTEM), X-ray powder diffractometry (XRD) and N{sub 2} sorptometry. The results showed that MPMO is a pseudo-crystalline material with complex network pore structure, of which BET specific surface area is 297 m{sup 2}/g and pore size distribution is approximately in the range of 0.7-6.0 nm. The MPMO material turns to cryptomelane when the calcinating temperature rises to 400 deg. C. The optimum sol-gel reaction conditions are KMnO{sub 4}/C{sub 4}H{sub 4}O{sub 4} molar ratio=3, pH=7 and gelation time>6 h.

  2. Carbon spheres-assisted strategy to prepare mesoporous manganese dioxide for supercapacitor applications

    SciTech Connect

    Li Siheng; Qi Li; Lu Lehui; Wang Hongyu

    2013-01-15

    Mesoporous MnO{sub 2} microstructures with large specific surface area have been successfully synthesized by an in-situ redox precipitation method in the presence of colloidal carbon spheres. The samples of them had much higher specific surface area, pore size and pore volume than those obtained via routes without carbon spheres. The morphology, chemical compositions and porous nature of products were fully characterized. Electrochemical measurements showed that these mesoporous MnO{sub 2} could function well when used as positive electrode materials for supercapacitor. Ideal electrochemical capacitive performances and cyclic stability after 2000 galvanostatic charge-discharge cycles could be observed in 1 M neutral Na{sub 2}SO{sub 4} aqueous electrolyte with a working voltage of 1.7 V. - Graphical Abstract: Mesoporous MnO{sub 2} microstructures with large S{sub BET} were successfully synthesized by in-situ redox precipitation method in the presence of colloidal carbon spheres. Electrochemical measurements showed that these mesoporous MnO{sub 2} could be well used as electrode materials for supercapacitor. Highlights: Black-Right-Pointing-Pointer Mesoporous MnO{sub 2} was prepared by in-situ redox method assisted by carbon spheres. Black-Right-Pointing-Pointer S{sub BET}, pore size and volume were higher than MnO{sub 2} obtained without carbon spheres. Black-Right-Pointing-Pointer They could function well when used as electrode materials for supercapacitor. Black-Right-Pointing-Pointer Ideal capacitive behaviors and long cycling life showed after 2000 charge-discharge.

  3. Low temperature synthesis and visible light driven photocatalytic activity of highly crystalline mesoporous TiO2 particles.

    PubMed

    Gujar, Tanaji P; Anand, Chokkalingam; Shinde, Vaishali R; Ye, Jinhua; Ariga, Katsuhiko; Vinu, Ajayan

    2010-12-01

    Mesoporous TiO2 powder materials with a high crystallinity have been prepared by evaporation induced self assembly (EISA) process using titanium tetraisopropoxide (TTIP) and pluronic P123 surfactant (EO20PO70EO20) as titanium source and structure-directing reagent, respectively. The prepared materials were characterized by low and wide-angle X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), optical absorption, and N2 adsorption-desorption experiments. The crystallinity of the materials was controlled by varying the calcination temperature. The resulting TiO2 materials showed highly crystalline structure with uniform particle size which increases from 11.8 to 23.8 nm with increasing the calcination temperature from 400 to 600 degrees C, respectively, whereas the specific surface area decreases from 125 to 40 m2/g. TEM and XRD results revealed that the calcination temperature of 600 degrees C is the best condition to obtain highly crystalline mesoporous TiO2. The photocatalytic activity of the TiO2 mesoporous materials with different crystallinity and textural parameters has been studied in the decomposition of methylene blue (MB) dye molecules under visible light irradiation. Among the mesoporous TiO2 materials studied, the material with the highest crystallinity, prepared at 600 degrees C, showed the best photocatalytic performance in the decomposition of MB under visible light in a short time. PMID:21121305

  4. Biological applications and transmission electron microscopy investigation of mesoporous silica nanoparticles

    NASA Astrophysics Data System (ADS)

    Trewyn, Brian G.

    The research presented and discussed within involves the development of novel biological applications of mesoporous silica nanoparticles (MSN) and an investigation of mesoporous material by transmission electron microscopy (TEM). A series of room-temperature ionic liquid (RTIL) containing mesoporous silica nanoparticle (MSN) materials with various particle morphologies, including spheres, ellipsoids, rods, and tubes, were synthesized. By changing the RTIL template, the pore morphology was tuned from the MCM-41 type of hexagonal mesopores to rotational moire type of helical channels, and to wormhole-like porous structures. These materials were used as controlled release delivery nanodevices to deliver antibacterial ionic liquids against Escherichia coli K12. The involvement of a specific organosiloxane function group, covalently attached to the exterior of fluorescein doped mesoporous silica nanoparticles (FITC-MSN), on the degree and kinetics of endocytosis in cancer and plant cells was investigated. The kinetics of endocystosis of TEG coated FITC-MSN is significantly quicker than FITC-MSN as determined by flow cytometry experiments. The fluorescence confocal microscopy investigation showed the endocytosis of TEG coated-FITC MSN triethylene glycol grafted fluorescein doped MSN (TEG coated-FITC MSN) into both HeLa cells and Tobacco root protoplasts. Once the synthesis of a controlled-release delivery system based on MCM-41-type mesoporous silica nanorods capped by disulfide bonds with superparamagnetic iron oxide nanoparticles was completed. The material was characterized by general methods and the dosage and kinetics of the antioxidant dependent release was measured. Finally, the biological interaction of the material was determined along with TEM measurements. An electron microscopy investigation proved that the pore openings of the MSN were indeed blocked by the Fe 3O4 nanoparticles. The biological interaction investigation demonstrated Fe3O4-capped MSN

  5. Mesoporous Nb and Ta Oxides: Synthesis, Characterization and Applications in Heterogeneous Acid Catalysis

    NASA Astrophysics Data System (ADS)

    Rao, Yuxiang Tony

    In this work, a series of mesoporous Niobium and Tantalum oxides with different pore sizes (C6, C12, C18 , ranging from 12A to 30 A) were synthesized using the ligand-assisted templating approach and investigated for their activities in a wide range of catalytic applications including benzylation, alkylation and isomerization. The as-synthesized mesoporous materials were characterized by nitrogen adsorption, powder X-ray diffraction, transmission electron microscopy (TEM), scanning electron microscopy (SEM), thermo gravimetric analysis (TGA), differential scanning calorimetry (DSC), and solid-state Nuclear magnetic resonance (NMR) techniques. In order to probe into the structural and coordination geometry of mesoporous Nb oxide and in efforts to make meaningful comparisons of mesoporous niobia prepared by the amine-templating method with the corresponding bulk sol-gel prepared Nb2O5 phase, 17O magic-angle-spinning solid-state NMR studies were conducted. The results showed a very high local order in the mesoporous sample. The oxygen atoms are coordinated only as ONb 2 in contrast with bulk phases in which the oxygen atoms are always present in a mixture of ONb2 and ONb3 coordination environments. To enhance their surface acidities and thus improve their performance as solid acid catalysts in the acid-catalyzed reactions mentioned above, pure mesoporous Nb and Ta oxides were further treated with 1M sulfuric acid or phosphoric acid. Their surface acidities before and after acid treatment were measured by Fourier transform infraRed (FT IR), amine titration and temperature programmed desorption of ammonia (NH3-TPD). Results obtained in this study showed that sulfated mesoporous Nb and Ta oxides materials possess relative high surface areas (up to 612 m 2/g) and amorphous wormhole structure. These mesoporous structures are thus quite stable to acid treatment. It was also found that Bronsted (1540 cm-1) and Lewis (1450 cm-1) acid sites coexist in a roughly 50:50 mixture

  6. Peptide-laden mesoporous silica nanoparticles with promoted bioactivity and osteo-differentiation ability for bone tissue engineering.

    PubMed

    Luo, Zuyuan; Deng, Yi; Zhang, Ranran; Wang, Mengke; Bai, Yanjie; Zhao, Qiang; Lyu, Yalin; Wei, Jie; Wei, Shicheng

    2015-07-01

    Combination of mesoporous silica materials and bioactive factors is a promising niche-mimetic solution as a hybrid bone substitution for bone tissue engineering. In this work, we have synthesized biocompatible silica-based nanoparticles with abundant mesoporous structure, and incorporated bone-forming peptide (BFP) derived from bone morphogenetic protein-7 (BMP-7) into the mesoporous silica nanoparticles (MSNs) to obtain a slow-release system for osteogenic factor delivery. The chemical characterization demonstrates that the small osteogenic peptide is encapsulated in the mesoporous successfully, and the nitrogen adsorption-desorption isotherms suggest that the peptide encapsulation has no influence on mesoporous structure of MSNs. In the cell experiment, the peptide-laden MSNs (p-MSNs) show higher MG-63 cell proliferation, spreading and alkaline phosphatase (ALP) activity than the bare MSNs, indicating good in vitro cytocompatibility. Simultaneously, the osteogenesis-related proteins expression and calcium mineral deposition disclose enhanced osteo-differentiation of human mesenchymal stem cells (hMSCs) under the stimulation of the p-MSNs, confirming that BFP released from MSNs could significantly promote the osteogenic differentiation of hMSCs, especially at 500μg/mL of p-MSNs concentration. The peptide-modified MSNs with better bioactivity and osteogenic differentiation make it a potential candidate as bioactive material for bone repairing, bone regeneration, and bio-implant coating applications. PMID:25969416

  7. Magnetic spherical cores partly coated with periodic mesoporous organosilica single crystals

    NASA Astrophysics Data System (ADS)

    Li, Jing; Wei, Yong; Li, Wei; Deng, Yonghui; Zhao, Dongyuan

    2012-02-01

    Core-shell structured materials are of special significance in various applications. Until now, most reported core-shell structures have polycrystalline or amorphous coatings as their shell layers, with popular morphologies of microspheres or quasi-spheres. However, the single crystals, either mesoscale or atomic ones, are still rarely reported as shell layers. If single crystals can be coated on core materials, it would result in a range of new type core-shell structures with various morphologies, and probably more potential applications. In this work, we demonstrate that periodic mesoporous organosilica (PMO) single crystals can partly grow on magnetic microspheres to form incomplete Fe3O4@nSiO2@PMO core-shell materials in aqueous solution, which indeed is the first illustration that mesoporous single-crystal materials can be used as shell layers for preparation of core-shell materials. The achieved materials have advantages of high specific surface areas, good magnetic responses, embedded functional groups and cubic mesopore channels, which might provide them with various application conveniences. We suppose the partial growth is largely decided by the competition between growing tendency of single crystals and the resistances to this tendency. In principle, other single crystals, including a range of atomic single crystals, such as zeolites, are able to be developed into such core-shell structures.

  8. Synthesis of Mesoporous Single Crystal Co(OH)2 Nanoplate and Its Topotactic Conversion to Dual-Pore Mesoporous Single Crystal Co3O4.

    PubMed

    Jia, Bao-Rui; Qin, Ming-Li; Li, Shu-Mei; Zhang, Zi-Li; Lu, Hui-Feng; Chen, Peng-Qi; Wu, Hao-Yang; Lu, Xin; Zhang, Lin; Qu, Xuan-Hui

    2016-06-22

    A new class of mesoporous single crystalline (MSC) material, Co(OH)2 nanoplates, is synthesized by a soft template method, and it is topotactically converted to dual-pore MSC Co3O4. Most mesoporous materials derived from the soft template method are reported to be amorphous or polycrystallined; however, in our synthesis, Co(OH)2 seeds grow to form single crystals, with amphiphilic block copolymer F127 colloids as the pore producer. The single-crystalline nature of material can be kept during the conversion from Co(OH)2 to Co3O4, and special dual-pore MSC Co3O4 nanoplates can be obtained. As the anode of lithium-ion batteries, such dual-pore MSC Co3O4 nanoplates possess exceedingly high capacity as well as long cyclic performance (730 mAh g(-1) at 1 A g(-1) after the 350th cycle). The superior performance is because of the unique hierarchical mesoporous structure, which could significantly improve Li(+) diffusion kinetics, and the exposed highly active (111) crystal planes are in favor of the conversion reaction in the charge/discharge cycles. PMID:27250515

  9. Nonenzymatic glucose detection using mesoporous platinum.

    PubMed

    Park, Sejin; Chung, Taek Dong; Kim, Hee Chan

    2003-07-01

    Roughness of nanoscopic dimensions can be used to selectively enhance the faradaic current of a sluggish reaction. Using this principle, we constructed mesoporous structures on the surfaces of pure platinum electrodes responding even more sensitively to glucose than to common interfering species, such as L-ascorbic acid and 4-acetamidophenol. Good sensitivities, as high as 9.6 microA cm(-2) mM(-1), were reproducibly observed in the presence of high concentration of chloride ion. The selectivities, sensitivities, and stabilities determined experimentally have demonstrated the potential of mesoporous platinum as a novel candidate for nonenzymatic glucose sensors. PMID:12964749

  10. Orientation specific deposition of mesoporous particles

    NASA Astrophysics Data System (ADS)

    Kjellman, Tomas; Bodén, Niklas; Wennerström, Hâkan; Edler, Karen J.; Alfredsson, Viveka

    2014-11-01

    We present a protocol for a facile orientation specific deposition of plate-like mesoporous SBA-15 silica particles onto a surface (mesopores oriented normal to surface). A drop of an aqueous dispersion of particles is placed on the surface and water vaporizes under controlled relative humidity. Three requirements are essential for uniform coverage: particle dispersion should not contain aggregates, a weak attraction between particles and surface is needed, and evaporation rate should be low. Aggregates are removed by stirring/sonication. Weak attraction is realized by introducing cationic groups to the surface. Insight into the mechanisms of the so-called coffee stain effect is also provided.

  11. A Single-Crystalline Mesoporous Quartz Superlattice.

    PubMed

    Matsuno, Takamichi; Kuroda, Yoshiyuki; Kitahara, Masaki; Shimojima, Atsushi; Wada, Hiroaki; Kuroda, Kazuyuki

    2016-05-10

    There has been significant interest in the crystallization of nanostructured silica into α-quartz because of its physicochemical properties. We demonstrate a single-crystalline mesoporous quartz superlattice, a silica polymorph with unprecedentedly ordered hierarchical structures on both the several tens of nanometers scale and the atomic one. The mesoporous quartz superlattice consists of periodically arranged α-quartz nanospheres whose crystalline axes are mostly oriented in an assembly. The superlattice is prepared by thermal crystallization of amorphous silica nanospheres constituting a colloidal crystal. We found that the deposition of a strong flux of Li(+) only on the surface of silica nanospheres is effective for crystallization. PMID:27060365

  12. Thermal switching of the reflection in chiral nematic mesoporous organosilica films infiltrated with liquid crystals.

    PubMed

    Giese, Michael; De Witt, Joanna C; Shopsowitz, Kevin E; Manning, Alan P; Dong, Ronald Y; Michal, Carl A; Hamad, Wadood Y; MacLachlan, Mark J

    2013-08-14

    Materials that undergo stimulus-induced optical changes are important for many new technologies. In this paper, we describe a new free-standing silica-based composite film that exhibits reversible thermochromic reflection, induced by a liquid crystalline guest in the pores of iridescent mesoporous films. We demonstrate that selective reflection from the novel mesoporous organosilica material with chiral nematic organization can be reversibly switched by thermal cycling of the 8CB guest between its isotropic and liquid crystalline states, which was proven by solid-state NMR experiments. The switching of the optical properties of the chiral solid-state host by stimulus-induced transitions of the guest opens the possibility of applications for these novel materials in sensors and displays. PMID:23859140

  13. Wet powder processing of sol-gel derived mesoporous silica-hydroxyapatite hybrid powders.

    PubMed

    Andersson, Jenny; Johannessen, Espen; Areva, Sami; Järn, Mikael; Lindén, Mika

    2006-08-01

    This paper describes a method by which a porous silica coating layer can be obtained on different apatite particles through a simple sol-gel synthesis route. Sol-gel derived powders of hydroxyapatite (HAP) and beta tricalciumphosphate (beta-TCP) were coated with a mesoporous silica using C16TAB (hexadecyltrimethylammonium bromide) as a template in order to induce mesophase formation. Further calcination of the material removes the template from the mesophase and leaves a highly ordered hexagonal arranged mesoporous silica structure with a core of HAP/beta-TCP. The phase purity of the SiO2/apatite composites has been thoroughly investigated by the means of FT-IR, XRD, and solid state 31P MAS NMR. The phase purity of these materials is shown to be dependent on the solubility properties of the used apatites. The hybrid materials are suitable as a multifunctional biomaterial where osteoconductive properties can be combined with drug delivery. PMID:17037853

  14. The adsorption of gold, palladium and platinum from acidic chloride solutions on mesoporous carbons.

    SciTech Connect

    Zalupski, Peter R.; McDowell, Rocklan; Dutech, Guy

    2014-08-05

    Studies on the adsorption characteristics of gold, palladium and platinum on mesoporous carbon (CMK-3) and sulfur-impregnated mesoporous carbon (CMK-3/S) evaluated the benefits/drawbacks of the presence of a layer of elemental sulfur inside mesoporous carbon structures. Adsorption isotherms collected for Au(III), Pd(II) and Pt(IV) on those materials suggest that sulfur does enhance the adsorption of those metal ions in mildly acidic environment (pH 3). The isotherms collected in 1 M HCl show that the benefit of sulfur disappears due to the competing influence of large concentration of hydrogen ions on the ion-exchanging mechanism of metal ions sorption on mesoporous carbon surfaces. The collected acid dependencies illustrate similar adsorption characteristics for CMK-3 and CMK-3/S in 1-5 M HCl concentration range. Sorption of metal ions from diluted aqueous acidic mixtures of actual leached electronic waste demonstrated the feasibility of recovery of gold from such liquors.

  15. The adsorption of gold, palladium and platinum from acidic chloride solutions on mesoporous carbons.

    DOE PAGESBeta

    Zalupski, Peter R.; McDowell, Rocklan; Dutech, Guy

    2014-08-05

    Studies on the adsorption characteristics of gold, palladium and platinum on mesoporous carbon (CMK-3) and sulfur-impregnated mesoporous carbon (CMK-3/S) evaluated the benefits/drawbacks of the presence of a layer of elemental sulfur inside mesoporous carbon structures. Adsorption isotherms collected for Au(III), Pd(II) and Pt(IV) on those materials suggest that sulfur does enhance the adsorption of those metal ions in mildly acidic environment (pH 3). The isotherms collected in 1 M HCl show that the benefit of sulfur disappears due to the competing influence of large concentration of hydrogen ions on the ion-exchanging mechanism of metal ions sorption on mesoporous carbon surfaces.more » The collected acid dependencies illustrate similar adsorption characteristics for CMK-3 and CMK-3/S in 1-5 M HCl concentration range. Sorption of metal ions from diluted aqueous acidic mixtures of actual leached electronic waste demonstrated the feasibility of recovery of gold from such liquors.« less

  16. Highly active Pd-In/mesoporous alumina catalyst for nitrate reduction.

    PubMed

    Gao, Zhenwei; Zhang, Yonggang; Li, Deyi; Werth, Charles J; Zhang, Yalei; Zhou, Xuefei

    2015-04-01

    The catalytic reduction of nitrate is a promising technology for groundwater purification because it transforms nitrate into nitrogen and water. Recent studies have mainly focused on new catalysts with higher activities for the reduction of nitrate. Consequently, metal nanoparticles supported on mesoporous metal oxides have become a major research direction. However, the complex surface chemistry and porous structures of mesoporous metal oxides lead to a non-uniform distribution of metal nanoparticles, thereby resulting in a low catalytic efficiency. In this paper, a method for synthesizing the sustainable nitrate reduction catalyst Pd-In/Al2O3 with a dimensional structure is introduced. The TEM results indicated that Pd and In nanoparticles could efficiently disperse into the mesopores of the alumina. At room temperature in CO2-buffered water and under continuous H2 as the electron donor, the synthesized material (4.9 wt% Pd) was the most active at a Pd-In ratio of 4, with a first-order rate constant (k(obs) = 0.241 L min(-1) g(cata)(-1)) that was 1.3× higher than that of conventional Pd-In/Al2O3 (5 wt% Pd; 0.19 L min(-1) g(cata)(-1)). The Pd-In/mesoporous alumina is a promising catalyst for improving the catalytic reduction of nitrate. PMID:25600582

  17. Hierarchical micro & mesoporous silicon carbide flakes for high-performance electrochemical capacitive energy storage

    NASA Astrophysics Data System (ADS)

    Kim, Myeongjin; Oh, Ilgeun; Kim, Jooheon

    2016-03-01

    Hierarchical micro/mesoporous silicon carbide flakes (SiCF) with a high surface area of about 1376 m2 g-1 are obtained by one-step carbonization of waste Si wafer without any chemical or physical activation. The micropores are derived from the partial evaporation of Si atoms during the carbonization process and mesopores are formed by the integration of neighboring micropores. During carbonization process, the proportion of micro and mesopores in SiCF can be controlled by carbonization time by controlling the amount of partial evaporation of Si atoms. The SiCF electrode carbonized for 8 h at 1250 °C exhibits high charge storage capacity with a specific capacitance of 203.7 F g-1 at a scan rate of 5 mV s-1 with 87.3% rate performance from 5 to 500 mV s-1 in 1 M KCl aqueous electrolyte. The outstanding electrochemical performance can be the synergistic effect of both enhanced electric double layer properties caused by micropores and reduced resistant pathways for ions diffusion in the pores as well as a large accessible surface area for ion transport/charge storage caused by mesopores. These encouraging results demonstrate that the SiCF carbonized for 8 h at 1250 °C can be promising candidate for high performance electrode materials for supercapacitors.

  18. Biodegradable mesoporous bioactive glass nanospheres for drug delivery and bone tissue regeneration.

    PubMed

    Wang, Xiaojian; Li, Wei

    2016-06-01

    Bioactive inorganic materials are attractive for hard tissue regeneration, and they are used as delivery vehicles for pharmaceutical molecules, scaffolds and components for bio-composites. We demonstrated mesoporous bioactive glass (BG) nanospheres that exhibited the capacity to deliver pharmaceutical molecules. Mesoporous BG nanospheres with variable Ca to Si ratios were synthesized using sol-gel chemistry. By controlling the hydrolysis and condensation conditions, the diameter of the mesoporous BG nanospheres was changed from 300 nm to 1500 nm. The porous structure and surface area of the BG nanospheres were shown to be dependent on their composition. The surface area of the BG nanospheres decreased from 400 ± 2 m(2) g(-1) to 56 ± 0.1 m(2) g(-1) when the Ca/Si ratio increased from 5 to 50 at.%. When the mesoporous BG nanospheres were loaded with ibuprofen (IBU), they exhibited a sustained release profile in simulated body fluid (SBF). In the meantime, the IBU-loaded BG nanospheres degraded in SBF, and induced apatite layer formation on the surface as a result of their good bioactivity. When the BG nanospheres were used as a composite filler to poly (ε-caprolactone) (PCL), they were shown to be effective at improving the in vitro bioactivity of PCL microspheres. PMID:27102805

  19. Ti containing mesoporous silica submicrometer-sphere, with tunable particle size for styrene oxidation

    NASA Astrophysics Data System (ADS)

    Wang, Jingjing; Lu, Jinming; Yang, Jianhua; Chen, Rui; Zhang, Yan; Yin, Dehong; Wang, Jinqu

    2013-10-01

    Ti-containing mesoporous silica materials with size-tunable mesopores and isolated tetrahedrally coordinated Ti species have widely applications in bulk molecular catalysis. Herein, mesoporous titanium silica submicrometer-spheres (Ti-MSSs) with tunable outer particle diameter were synthesized based on developed Stober method using nonionic surfactant P123 as particle dispersing agent at room temperature. P123 molecular assembled structures will interact with silica species through interface hydrogen bond leading to the formation of tunable sized particles. The particle size was controlled ranging from 400 to 80 nm by adjusting the P123 concentration. The influence of Ti-MSSs particle size on the oxidation of styrene with aqueous H2O2 as oxidant was investigated in detail. Ti-MSSs showed better catalytical performance compared to mesoporous titanium silica large particles. Moreover, the catalyst activity increased with decrease in particle size of Ti-MSSs. Nano-sized Ti-MSSs of about 80 nm demonstrated the optimized performance for styrene oxidation with styrene conversion 44.7%, benzaldehyde selectivity 82.2% and styrene oxide 17.7% while the reaction time was 6 h.

  20. Highly mesoporous metal–organic framework assembled in a switchable solvent

    PubMed Central

    Peng, Li; Zhang, Jianling; Xue, Zhimin; Han, Buxing; Sang, Xinxin; Liu, Chengcheng; Yang, Guanying

    2014-01-01

    The mesoporous metal–organic frameworks are a family of materials that have pore sizes ranging from 2 to 50 nm, which have shown promising applications in catalysis, adsorption, chemical sensing and so on. The preparation of mesoporous metal–organic frameworks usually needs the supramolecular or cooperative template strategy. Here we report the template-free assembly of mesoporous metal–organic frameworks by using CO2-expanded liquids as switchable solvents. The mesocellular metal–organic frameworks with large mesopores (13–23 nm) are formed, and their porosity properties can be easily adjusted by controlling CO2 pressure. Moreover, the use of CO2 can accelerate the reaction for metal–organic framework formation from metal salt and organic linker due to the viscosity-lowering effect of CO2, and the product can be recovered through CO2 extraction. The as-synthesized mesocellular metal–organic frameworks are highly active in catalysing the aerobic oxidation of benzylic alcohols under mild temperature at atmospheric pressure. PMID:25047059

  1. Hierarchical Mesoporous Metal-Organic Frameworks for Enhanced CO2 Capture.

    PubMed

    Mao, Yiyin; Chen, Danke; Hu, Pan; Guo, Yi; Ying, Yulong; Ying, Wen; Peng, Xinsheng

    2015-10-19

    Hierarchical porous materials are promising for catalyst, separation and sorption applications. A ligand-assisted etching process is developed for template-free synthesis of hierarchical mesoporous MOFs as single crystals and well-intergrown membranes at 40 °C. At 223 K, the hierarchical porous structures significantly improve the CO2 capture capacity of HKUST-1 by more than 44 % at pressures up to 20 kPa and 13 % at 100 kPa. Even at 323 K, the enhancement of CO2 uptake is above 25 % at pressures up to 20 kPa and 7 % at 100 kPa. The mesoporous structures not only enhance the CO2 uptake capacity but also improve the diffusion and mass transportation of CO2 . Similarly, well-intergrown mesoporous HKUST-1 membranes are synthesized, which hold the potential for film-like porous devices. Mesoporous MOF-5 crystals are also obtained by a similar ligand-assisted etching process. This may provide a facile way to prepare hierarchical porous MOF single crystals and membranes for wide-ranging applications. PMID:26471435

  2. Biodegradable mesoporous bioactive glass nanospheres for drug delivery and bone tissue regeneration

    NASA Astrophysics Data System (ADS)

    Wang, Xiaojian; Li, Wei

    2016-06-01

    Bioactive inorganic materials are attractive for hard tissue regeneration, and they are used as delivery vehicles for pharmaceutical molecules, scaffolds and components for bio-composites. We demonstrated mesoporous bioactive glass (BG) nanospheres that exhibited the capacity to deliver pharmaceutical molecules. Mesoporous BG nanospheres with variable Ca to Si ratios were synthesized using sol–gel chemistry. By controlling the hydrolysis and condensation conditions, the diameter of the mesoporous BG nanospheres was changed from 300 nm to 1500 nm. The porous structure and surface area of the BG nanospheres were shown to be dependent on their composition. The surface area of the BG nanospheres decreased from 400 ± 2 m2 g‑1 to 56 ± 0.1 m2 g‑1 when the Ca/Si ratio increased from 5 to 50 at.%. When the mesoporous BG nanospheres were loaded with ibuprofen (IBU), they exhibited a sustained release profile in simulated body fluid (SBF). In the meantime, the IBU-loaded BG nanospheres degraded in SBF, and induced apatite layer formation on the surface as a result of their good bioactivity. When the BG nanospheres were used as a composite filler to poly (ε-caprolactone) (PCL), they were shown to be effective at improving the in vitro bioactivity of PCL microspheres.

  3. Capillary Condensation Pathways of CO2 under Templated Mesoporous Silica Confinement

    NASA Astrophysics Data System (ADS)

    Wang, Bo; Sokol, Paul

    2014-03-01

    Adsorption of CO2 in porous medium has been of great current interest due to its potential for mitigating the global warming caused by greenhouse gases. In particular, the behavior of confined CO2 in mesoporous media near room temperature is particularly relevant to sequestration efforts. Realistic mesoporous systems, such as shales and coals, represent a complex fractal pore structure that complicates the interpretation of adsorption studies. We present the results of a study focused on the adsorption of CO2 in model mesoporous media with well-defined pore structures. Templated porous glasses, such as MCM-41 which has a regular network of 1D pores, provide an ideal system for fundamental studies of the adsorption process. In this study, we focus on the structure of adsorbed CO2 films which evolves in a mixture of phases and the development of nucleation occurs during the formation of high density liquid CO2 inside the confining matrix. We have used Small Angle Neutron Scattering to study the spatial distribution of material radially and transversely within the pores. The 30m SANS NG7 at NIST was used to map out the details of CO2 condensation pathway under mesoporous silica confinement.

  4. Highly mesoporous metal-organic framework assembled in a switchable solvent

    NASA Astrophysics Data System (ADS)

    Peng, Li; Zhang, Jianling; Xue, Zhimin; Han, Buxing; Sang, Xinxin; Liu, Chengcheng; Yang, Guanying

    2014-07-01

    The mesoporous metal-organic frameworks are a family of materials that have pore sizes ranging from 2 to 50 nm, which have shown promising applications in catalysis, adsorption, chemical sensing and so on. The preparation of mesoporous metal-organic frameworks usually needs the supramolecular or cooperative template strategy. Here we report the template-free assembly of mesoporous metal-organic frameworks by using CO2-expanded liquids as switchable solvents. The mesocellular metal-organic frameworks with large mesopores (13-23 nm) are formed, and their porosity properties can be easily adjusted by controlling CO2 pressure. Moreover, the use of CO2 can accelerate the reaction for metal-organic framework formation from metal salt and organic linker due to the viscosity-lowering effect of CO2, and the product can be recovered through CO2 extraction. The as-synthesized mesocellular metal-organic frameworks are highly active in catalysing the aerobic oxidation of benzylic alcohols under mild temperature at atmospheric pressure.

  5. Mesoporous Phosphate Heterostructures: Synthesis and Application on Adsorption and Catalysis

    NASA Astrophysics Data System (ADS)

    Moreno-Tost, Ramón; Jiménez-Jiménez, José; Infantes-Molina, Antonia; Cavalcante, Celio L.; Azevedo, Diana C. S.; Soriano, María Dolores; López Nieto, José Manuel; Jiménez-López, Antonio; Rodríguez-Castellón, Enrique

    Porous phosphate heterostructures (PPHs) are solids formed by a layered metal(IV) phosphate expanded with silica galleries obtained by combining the two main strategies for obtaining mesoporous materials [pillared layered structures (PLS') and MCM-41]. The different synthetic pathways for obtaining mesoporous phosphate structures with silica galleries with Zr- or Ti-doped silica, the study of their structural, textural and acid properties, its functionalisation with different organic substances such as propionitrile, 3-aminopropyl triethoxysilane, (3-mercaptopropyl)trimethoxysilane, vinyltrimethoxysilane, phenyltriethoxysilane and 3-(triethoxysilyl)propionitrile are discussed. The preparation of metal-supported catalysts and their application in gas separation, adsorption and catalysis are reviewed. Specifically, the use of Cu- and Fe-exchanged PPH for the adsorption of benzothiophene and the separation of propane/propene is the main application as adsorbent. The hydrotreating of aromatic hydrocarbons using ruthenium-impregnated catalysts via hydrogenation and hydrogenolysis/hydrocracking for the production of clean diesel fuels, the selective catalytic reduction of NO from stationary and mobile sources by using Cu-PPH with 1, 3 and 7 wt% of Cu and the selective oxidation of hydrogen sulphide to sulphur with vanadium-containing PPH are the three catalytic reactions of environmental interest studied.

  6. Nitrogen-doped mesoporous carbons for high performance supercapacitors

    NASA Astrophysics Data System (ADS)

    Wu, Kai; Liu, Qiming

    2016-08-01

    The mesoporous carbons have been synthesized by using α-D(+)-Glucose, D-Glucosamine hydrochloride or their mixture as carbon precursors and mesoporous silicas (SBA-15 or MCF) as hard templates. The as-prepared products show a large pore volume (0.59-0.97 cm3 g-1), high surface areas (352.72-1152.67 m2 g-1) and rational nitrogen content (ca. 2.5-3.9 wt.%). The results of electrochemical tests demonstrate that both heteroatom doping and suitable pore structure play a decisive role in the performance of supercapacitors. The representative sample of SBA-15 replica obtained using D-Glucosamine hydrochloride only exhibits high specific capacitance (212.8 F g-1 at 0.5 A g-1) and good cycle durability (86.1% of the initial capacitance after 2000 cycles) in 6 M KOH aqueous electrolyte, which is attributed to the contribution of double layer capacitance and pseudo-capacitance. The excellent electrochemical performance makes it a promising electrode material for supercapacitors.

  7. Synthesis and textural evolution of alumina particles with mesoporous structures

    SciTech Connect

    Liu Xun; Peng Tianyou; Yao Jinchun; Lv Hongjin; Huang Cheng

    2010-06-15

    Alumina particles with mesostructures were synthesized through a chemical precipitation method by using different inorganic aluminum salts followed by a heterogeneous azeotropic distillation and calcination process. The obtained mesoporous {gamma}-alumina particles were systematically characterized by the X-ray diffraction, transmission electron microscopy and nitrogen adsorption-desorption measurement. Effects of the aluminum salt counter anion, pH value and the azeotropic distillation process on the structural or textural evolution of alumina particles were investigated. It is found that Cl{sup -} in the reaction solution can restrain the textural evolution of the resultant precipitates into two-dimensional crystallized pseudoboehmite lamellae during the heterogeneous azeotropic distillation, and then transformed into {gamma}-Al{sub 2}O{sub 3} particles with mesostructures after further calcination at 1173 K, whereas coexisting SO{sub 4}{sup 2-} can promote above morphology evolution and then transformed into {gamma}-Al{sub 2}O{sub 3} nanofibers after calcination at 1173 K. Moreover nearly all materials retain relatively high specific surface areas larger than 100 m{sup 2} g{sup -1} even after calcinations at 1173 K. - Graphical abstract: Co-existing Cl{sup -} is beneficial for the formation of {gamma}-alumina nanoparticles with mesostructures during the precipitation process. Interparticle and intraparticle mesopores can be derived from acidic solution and near neutral solution, respectively.

  8. Extreme Light Management in Mesoporous Wood Cellulose Paper for Optoelectronics.

    PubMed

    Zhu, Hongli; Fang, Zhiqiang; Wang, Zhu; Dai, Jiaqi; Yao, Yonggang; Shen, Fei; Preston, Colin; Wu, Wenxin; Peng, Peng; Jang, Nathaniel; Yu, Qingkai; Yu, Zongfu; Hu, Liangbing

    2016-01-26

    Wood fibers possess natural unique hierarchical and mesoporous structures that enable a variety of new applications beyond their traditional use. We dramatically modulate the propagation of light through random network of wood fibers. A highly transparent and clear paper with transmittance >90% and haze <1.0% applicable for high-definition displays is achieved. By altering the morphology of the same wood fibers that form the paper, highly transparent and hazy paper targeted for other applications such as solar cell and antiglare coating with transmittance >90% and haze >90% is also achieved. A thorough investigation of the relation between the mesoporous structure and the optical properties in transparent paper was conducted, including full-spectrum optical simulations. We demonstrate commercially competitive multitouch touch screen with clear paper as a replacement for plastic substrates, which shows excellent process compatibility and comparable device performance for commercial applications. Transparent cellulose paper with tunable optical properties is an emerging photonic material that will realize a range of much improved flexible electronics, photonics, and optoelectronics. PMID:26673796

  9. Selective functionalization of the mesopores of SBA-15

    DOE PAGESBeta

    Webb, Jonathan D.; Seki, Tomohiro; Goldston, Jennifer F.; Pruski, Marek; Crudden, Cathleen M.

    2014-10-23

    In this study, a method has been developed that permits the highly selective functionalization of the interior and exterior surfaces of the ubiquitous mesoporous material, SBA-15. The key step is reloading the as-synthesized material with structure-directing agent, Pluronic® P123, prior to selective functionalization of the external surface with a silylating agent. This new approach represents a significant improvement over literature procedures. Results from physisorption analyses as well as solid-state NMR permit a detailed, quantitative assessment of functionalized SBA-15. This work also provides insight into the stability of the silyl layer during extraction procedures – an issue often neglected in othermore » studies but of significant importance as decomposition of this layer could result in the introduction of new silanols and reduce the effectiveness of any selective grafting procedure.« less

  10. Selective functionalization of the mesopores of SBA-15

    SciTech Connect

    Webb, Jonathan D.; Seki, Tomohiro; Goldston, Jennifer F.; Pruski, Marek; Crudden, Cathleen M.

    2014-10-23

    In this study, a method has been developed that permits the highly selective functionalization of the interior and exterior surfaces of the ubiquitous mesoporous material, SBA-15. The key step is reloading the as-synthesized material with structure-directing agent, Pluronic® P123, prior to selective functionalization of the external surface with a silylating agent. This new approach represents a significant improvement over literature procedures. Results from physisorption analyses as well as solid-state NMR permit a detailed, quantitative assessment of functionalized SBA-15. This work also provides insight into the stability of the silyl layer during extraction procedures – an issue often neglected in other studies but of significant importance as decomposition of this layer could result in the introduction of new silanols and reduce the effectiveness of any selective grafting procedure.

  11. Periodic Mesoporous Organosilica Nanocubes with Ultrahigh Surface Areas for Efficient CO2 Adsorption

    NASA Astrophysics Data System (ADS)

    Wei, Yong; Li, Xiaomin; Zhang, Renyuan; Liu, Yong; Wang, Wenxing; Ling, Yun; El-Toni, Ahmed Mohamed; Zhao, Dongyuan

    2016-02-01

    Ultrahigh surface area single-crystals of periodic mesoporous organosilica (PMOs) with uniform cubic or truncated-cubic morphology and organic/inorganic components homogeneously distributed over the whole frameworks have successfully been prepared by a sol-gel surfactant-templating method. By tuning the porous feature and polymerization degree, the surface areas of the obtained PMO nanocubes can reach as high as 2370 m2/g, which is the highest for silica-based mesoporous materials. The ultrahigh surface area of the obtained PMO single crystals is mainly resulted from abundant micropores in the mesoporous frameworks. Furthermore, the diameter of the nanocubes can also be well controlled from 150 to 600 nm. The materials show ultrahigh CO2 adsorption capacity (up to 1.42 mmol/g at 273 K) which is much higher than other porous silica materials and comparable to some carbonaceous materials. The adsorption of CO2 into the PMO nanocubes is mainly in physical interaction, therefore the adsorption-desorption process is highly reversible and the adsorption capacity is much dependent on the surface area of the materials. Moreover, the selectivity is also very high (~11 times to N2) towards CO2 adsorption.

  12. Periodic Mesoporous Organosilica Nanocubes with Ultrahigh Surface Areas for Efficient CO2 Adsorption

    PubMed Central

    Wei, Yong; Li, Xiaomin; Zhang, Renyuan; Liu, Yong; Wang, Wenxing; Ling, Yun; El-Toni, Ahmed Mohamed; Zhao, Dongyuan

    2016-01-01

    Ultrahigh surface area single-crystals of periodic mesoporous organosilica (PMOs) with uniform cubic or truncated-cubic morphology and organic/inorganic components homogeneously distributed over the whole frameworks have successfully been prepared by a sol-gel surfactant-templating method. By tuning the porous feature and polymerization degree, the surface areas of the obtained PMO nanocubes can reach as high as 2370 m2/g, which is the highest for silica-based mesoporous materials. The ultrahigh surface area of the obtained PMO single crystals is mainly resulted from abundant micropores in the mesoporous frameworks. Furthermore, the diameter of the nanocubes can also be well controlled from 150 to 600 nm. The materials show ultrahigh CO2 adsorption capacity (up to 1.42 mmol/g at 273 K) which is much higher than other porous silica materials and comparable to some carbonaceous materials. The adsorption of CO2 into the PMO nanocubes is mainly in physical interaction, therefore the adsorption-desorption process is highly reversible and the adsorption capacity is much dependent on the surface area of the materials. Moreover, the selectivity is also very high (~11 times to N2) towards CO2 adsorption. PMID:26868049

  13. Triblock siloxane copolymer surfactant: template for spherical mesoporous silica with a hexagonal pore ordering.

    PubMed

    Stébé, M J; Emo, M; Forny-Le Follotec, A; Metlas-Komunjer, L; Pezron, I; Blin, J L

    2013-02-01

    Ordered mesoporous silica materials with a spherical morphology have been prepared for the first time through the cooperative templating mechanism (CTM) by using a silicone triblock copolymer as template. The behavior of the pure siloxane copolymer amphiphile in water was first investigated. A direct micellar phase (L(1)) and a hexagonal (H(1)) liquid crystal were found. The determination of the structural parameters by SAXS measurements leads us to conclude that in the hexagonal liquid crystal phase a part of the ethylene oxide group is not hydrated as observed for the micelles. Mesoporous materials were then synthesized from the cooperative templating mechanism. The recovered materials were characterized by SAXS measurements, nitrogen adsorption-desorption analysis, and transmission and scanning electron microscopy. The results clearly evidence that one can control the morphology and the nanostructuring of the resulting material by modifying the synthesis parameters. Actually, highly ordered mesoporous materials with a spherical morphology have been obtained with a siloxane copolymer/tetramethoxysilane molar ratio of 0.10 after hydrothermal treatment at 100 °C. Our study also supports the fact that the interactions between micelles and the hydrolyzed precursor are one of the key parameters governing the formation of ordered mesostructures through the cooperative templating mechanism. Indeed, we have demonstrated that when the interactions between micelles are important, only wormhole-like structures are recovered. PMID:23305163

  14. Periodic Mesoporous Organosilica Nanocubes with Ultrahigh Surface Areas for Efficient CO₂ Adsorption.

    PubMed

    Wei, Yong; Li, Xiaomin; Zhang, Renyuan; Liu, Yong; Wang, Wenxing; Ling, Yun; El-Toni, Ahmed Mohamed; Zhao, Dongyuan

    2016-01-01

    Ultrahigh surface area single-crystals of periodic mesoporous organosilica (PMOs) with uniform cubic or truncated-cubic morphology and organic/inorganic components homogeneously distributed over the whole frameworks have successfully been prepared by a sol-gel surfactant-templating method. By tuning the porous feature and polymerization degree, the surface areas of the obtained PMO nanocubes can reach as high as 2370 m(2)/g, which is the highest for silica-based mesoporous materials. The ultrahigh surface area of the obtained PMO single crystals is mainly resulted from abundant micropores in the mesoporous frameworks. Furthermore, the diameter of the nanocubes can also be well controlled from 150 to 600 nm. The materials show ultrahigh CO2 adsorption capacity (up to 1.42 mmol/g at 273 K) which is much higher than other porous silica materials and comparable to some carbonaceous materials. The adsorption of CO2 into the PMO nanocubes is mainly in physical interaction, therefore the adsorption-desorption process is highly reversible and the adsorption capacity is much dependent on the surface area of the materials. Moreover, the selectivity is also very high (~11 times to N2) towards CO2 adsorption. PMID:26868049

  15. Synthesis and characterization of mesoporous poly(N-vinyl-2-pyrrolidone) containing palladium nanoparticles as a novel heterogeneous organocatalyst for Heck reaction

    NASA Astrophysics Data System (ADS)

    Kalbasi, Roozbeh Javad; Negahdari, Meysam

    2014-04-01

    Mesoporous poly(N-vinyl-2-pyrrolidone) (MPVP) was prepared through a nanocasting technique based on mesoporous silica KIT-6 as sacrificial templates, and served as an efficient scaffold for supporting Pd nanoparticles. The physical and chemical properties of Pd-MPVP were characterized using FT-IR, XRD, BET, DRS UV-Vis, SEM, TEM and TGA techniques. The application of this novel purely organic heterogeneous catalyst, which combine the advantage of organic polymers and mesoporous materials, was investigated for Csbnd C bond formation through the Heck coupling reaction of aryl iodides, bromides and chlorides with styrene. It was observed that the activity of this catalyst decreased just 5% after nine regeneration processes were performed. This unique result opens new perspectives for application of purely organic mesoporous polymers as structurally defined hydrophobic catalyst in catalytic reactions.

  16. A simple route to synthesize mesoporous titania from TiOSO4: Influence of the synthesis conditions on the structural, pigments and photocatalytic properties

    NASA Astrophysics Data System (ADS)

    Yang, Guang; Ding, Hao; Chen, Daimei; Ao, Weihua; Wang, Jian; Hou, Xifeng

    2016-07-01

    The work obtained mesoporous TiO2 white pigments using titanyl sulfate as titanium source with a simple, low-temperature method simplifying the synthesis process and reducing the energy consumption. We investigated the effects of the aging temperature and aging time on the structure and pigments properties of the samples. The structure and morphology of mesoporous samples were characterized by X-ray diffraction and transmission electron microscopy. The obtained mesoporous TiO2 showed excellent pigments properties of whiteness (93.91%), hiding power (12.37 g m-2), and lightness value (97.89), respectively. Moreover, such materials showed outstanding photodegradation performance of organic dyes under UV light irradiation. The current research provided an alternative route to prepare mesoporous TiO2 micspheres white pigments with well photocatalytic performance for indoor purification on industrial scale. It has great significance in titania white pigments field.

  17. Nanocrystalline Heterojunction Materials

    DOEpatents

    Elder, Scott H.; Su, Yali; Gao, Yufei; Heald, Steve M.

    2004-02-03

    Mesoporous nanocrystalline titanium dioxide heterojunction materials and methods of making the same are disclosed. In one disclosed embodiment, materials comprising a core of titanium dioxide and a shell of a molybdenum oxide exhibit a decrease in their photoadsorption energy as the size of the titanium dioxide core decreases.

  18. Nanocrystalline heterojunction materials

    DOEpatents

    Elder, Scott H.; Su, Yali; Gao, Yufei; Heald, Steve M.

    2003-07-15

    Mesoporous nanocrystalline titanium dioxide heterojunction materials are disclosed. In one disclosed embodiment, materials comprising a core of titanium dioxide and a shell of a molybdenum oxide exhibit a decrease in their photoadsorption energy as the size of the titanium dioxide core decreases.

  19. Influence of spatial configurations on electromagnetic interference shielding of ordered mesoporous carbon/ordered mesoporous silica/silica composites

    PubMed Central

    Wang, Jiacheng; Zhou, Hu; Zhuang, Jiandong; Liu, Qian

    2013-01-01

    Ordered mesoporous carbons (OMCs), obtained by nanocasting using ordered mesoporous silicas (OMSs) as hard templates, exhibit unique arrangements of ordered regular nanopore/nanowire mesostructures. Here, we used nanocasting combined with hot-pressing to prepare 10 wt% OMC/OMS/SiO2 ternary composites possessing various carbon mesostructure configurations of different dimensionalities (1D isolated CS41 carbon nanowires, 2D hexagonal CMK-3 carbon, and 3D cubic CMK-1 carbon). The electric/dielectric properties and electromagnetic interference (EMI) shielding efficiency (SE) of the composites were influenced by spatial configurations of carbon networks. The complex permittivity and the EMI SE of the composites in the X-band frequency range decreased for the carbon mesostructures in the following order: CMK-3-filled > CMK-1-filled > CS41-filled. Our study provides technical directions for designing and preparing high-performance EMI shielding materials. Our OMC-based silica composites can be used for EMI shielding, especially in high-temperature or corrosive environments, owing to the high stability of the OMC/OMS fillers and the SiO2 matrix. Related shielding mechanisms are also discussed. PMID:24248277

  20. Influence of spatial configurations on electromagnetic interference shielding of ordered mesoporous carbon/ordered mesoporous silica/silica composites.

    PubMed

    Wang, Jiacheng; Zhou, Hu; Zhuang, Jiandong; Liu, Qian

    2013-01-01

    Ordered mesoporous carbons (OMCs), obtained by nanocasting using ordered mesoporous silicas (OMSs) as hard templates, exhibit unique arrangements of ordered regular nanopore/nanowire mesostructures. Here, we used nanocasting combined with hot-pressing to prepare 10 wt% OMC/OMS/SiO2 ternary composites possessing various carbon mesostructure configurations of different dimensionalities (1D isolated CS41 carbon nanowires, 2D hexagonal CMK-3 carbon, and 3D cubic CMK-1 carbon). The electric/dielectric properties and electromagnetic interference (EMI) shielding efficiency (SE) of the composites were influenced by spatial configurations of carbon networks. The complex permittivity and the EMI SE of the composites in the X-band frequency range decreased for the carbon mesostructures in the following order: CMK-3-filled > CMK-1-filled > CS41-filled. Our study provides technical directions for designing and preparing high-performance EMI shielding materials. Our OMC-based silica composites can be used for EMI shielding, especially in high-temperature or corrosive environments, owing to the high stability of the OMC/OMS fillers and the SiO2 matrix. Related shielding mechanisms are also discussed. PMID:24248277

  1. Influence of spatial configurations on electromagnetic interference shielding of ordered mesoporous carbon/ordered mesoporous silica/silica composites

    NASA Astrophysics Data System (ADS)

    Wang, Jiacheng; Zhou, Hu; Zhuang, Jiandong; Liu, Qian

    2013-11-01

    Ordered mesoporous carbons (OMCs), obtained by nanocasting using ordered mesoporous silicas (OMSs) as hard templates, exhibit unique arrangements of ordered regular nanopore/nanowire mesostructures. Here, we used nanocasting combined with hot-pressing to prepare 10 wt% OMC/OMS/SiO2 ternary composites possessing various carbon mesostructure configurations of different dimensionalities (1D isolated CS41 carbon nanowires, 2D hexagonal CMK-3 carbon, and 3D cubic CMK-1 carbon). The electric/dielectric properties and electromagnetic interference (EMI) shielding efficiency (SE) of the composites were influenced by spatial configurations of carbon networks. The complex permittivity and the EMI SE of the composites in the X-band frequency range decreased for the carbon mesostructures in the following order: CMK-3-filled > CMK-1-filled > CS41-filled. Our study provides technical directions for designing and preparing high-performance EMI shielding materials. Our OMC-based silica composites can be used for EMI shielding, especially in high-temperature or corrosive environments, owing to the high stability of the OMC/OMS fillers and the SiO2 matrix. Related shielding mechanisms are also discussed.

  2. Facile synthesis of water-soluble luminescent mesoporous Tb(OH)3@SiO2 core-shell nanospheres

    PubMed Central

    2013-01-01

    Luminescent mesoporous Tb(OH)3@SiO2 core-shell nanospheres were synthesized through W/O microemulsion process at ambient temperature. The negatively charged silica favors a coating of the positively charged Tb3+ composite. Thus, silicon layer was adsorbed on the surface of Tb(OH)3 groups to form Tb-O-Si through electrostatic interaction. X-ray diffraction, field emission transmission electron microscopy (FE-TEM), energy-dispersive X-ray spectrometry, and Fourier transform infrared, UV/Visible, and photoluminescence spectroscopies were applied to examine the phase purity, crystallinity, surface morphology, and optical properties of the core-shell nanospheres. The FE-TEM results have revealed typically ordered mesoporous characteristics of the material with monodisperse spherical morphology in a narrow size distribution. The luminescent mesoporous core-shell nanospheres exposed remarkable splitting with broadening in the emission transition 5D4 → 7F5 (543 nm). In addition, the luminescent mesoporous core-shell nanospheres emit strong green fluorescence (from Tb3+) in the middle of the visible region under 325 nm (3.8) excitation. The luminescent mesoporous Tb(OH)3@SiO2 core-shell nanospheres can therefore be exploited as fluorescent probes in biomarkers or biolabeling, optical sensing, and drug delivery system. Further, these nanospheres could have potential use as scattering layers in dye-sensitized solar cells. PMID:23574757

  3. Electrografting of 3-Aminopropyltriethoxysilane on a Glassy Carbon Electrode for the Improved Adhesion of Vertically Oriented Mesoporous Silica Thin Films.

    PubMed

    Nasir, Tauqir; Zhang, Lin; Vilà, Neus; Herzog, Grégoire; Walcarius, Alain

    2016-05-01

    Vertically oriented mesoporous silica has proven to be of interest for applications in a variety of fields (e.g., electroanalysis, energy, and nanotechnology). Although glassy carbon is widely used as an electrode material, the adherence of silica deposits is rather poor, causing mechanical instability. A solution to improve the adhesion of mesoporous silica films onto glassy carbon electrodes without compromising the vertical orientation and the order of the mesopores will greatly contribute to the use of this kind of modified carbon electrode. We propose here the electrografting of 3-aminopropyltriethoxysilane on glassy carbon as a molecular glue to improve the mechanical stability of the silica film on the electrode surface without disturbing the vertical orientation and the order of the mesoporous silica obtained by electrochemically assisted self-assembly. These findings are supported by a series of surface chemistry techniques such as X-ray photoelectron spectroscopy, scanning and transmission electron microscopy, and cyclic voltammetry. Finally, methylviologen was used as a model redox probe to investigate the cathodic potential region of both glassy carbon and indium tin oxide electrodes modified with mesoporous silica in order to demonstrate further the interest in the approach developed here. PMID:27065214

  4. Facile synthesis of water-soluble luminescent mesoporous Tb(OH)3@SiO2 core-shell nanospheres

    NASA Astrophysics Data System (ADS)

    Ansari, Anees A.; Labis, Joselito; Aldwayyan, Abdullah S.; Hezam, Mahmoud

    2013-04-01

    Luminescent mesoporous Tb(OH)3@SiO2 core-shell nanospheres were synthesized through W/O microemulsion process at ambient temperature. The negatively charged silica favors a coating of the positively charged Tb3+ composite. Thus, silicon layer was adsorbed on the surface of Tb(OH)3 groups to form Tb-O-Si through electrostatic interaction. X-ray diffraction, field emission transmission electron microscopy (FE-TEM), energy-dispersive X-ray spectrometry, and Fourier transform infrared, UV/Visible, and photoluminescence spectroscopies were applied to examine the phase purity, crystallinity, surface morphology, and optical properties of the core-shell nanospheres. The FE-TEM results have revealed typically ordered mesoporous characteristics of the material with monodisperse spherical morphology in a narrow size distribution. The luminescent mesoporous core-shell nanospheres exposed remarkable splitting with broadening in the emission transition 5D4 → 7F5 (543 nm). In addition, the luminescent mesoporous core-shell nanospheres emit strong green fluorescence (from Tb3+) in the middle of the visible region under 325 nm (3.8) excitation. The luminescent mesoporous Tb(OH)3@SiO2 core-shell nanospheres can therefore be exploited as fluorescent probes in biomarkers or biolabeling, optical sensing, and drug delivery system. Further, these nanospheres could have potential use as scattering layers in dye-sensitized solar cells.

  5. Surface engineering on mesoporous silica chips for enriching low molecular weight phosphorylated proteins

    NASA Astrophysics Data System (ADS)

    Hu, Ye; Peng, Yang; Lin, Kevin; Shen, Haifa; Brousseau, Louis C., III; Sakamoto, Jason; Sun, Tong; Ferrari, Mauro

    2011-02-01

    Phosphorylated peptides and proteins play an important role in normal cellular activities, e.g., gene expression, mitosis, differentiation, proliferation, and apoptosis, as well as tumor initiation, progression and metastasis. However, technical hurdles hinder the use of common fractionation methods to capture phosphopeptides from complex biological fluids such as human sera. Herein, we present the development of a dual strategy material that offers enhanced capture of low molecular weight phosphoproteins: mesoporous silica thin films with precisely engineered pore sizes that sterically select for molecular size combined with chemically selective surface modifications (i.e. Ga3+, Ti4+ and Zr4+) that target phosphoroproteins. These materials provide high reproducibility (CV = 18%) and increase the stability of the captured proteins by excluding degrading enzymes, such as trypsin. The chemical and physical properties of the composite mesoporous thin films were characterized by X-ray diffraction, transmission electron microscopy, X-ray photoelectron spectroscopy, energy dispersive X-ray spectroscopy and ellipsometry. Using mass spectroscopy and biostatistics analysis, the enrichment efficiency of different metal ions immobilized on mesoporous silica chips was investigated. The novel technology reported provides a platform capable of efficiently profiling the serum proteome for biomarker discovery, forensic sampling, and routine diagnostic applications.Phosphorylated peptides and proteins play an important role in normal cellular activities, e.g., gene expression, mitosis, differentiation, proliferation, and apoptosis, as well as tumor initiation, progression and metastasis. However, technical hurdles hinder the use of common fractionation methods to capture phosphopeptides from complex biological fluids such as human sera. Herein, we present the development of a dual strategy material that offers enhanced capture of low molecular weight phosphoproteins: mesoporous

  6. The study of palladium ions incorporation into the mesoporous ordered silicates

    NASA Astrophysics Data System (ADS)

    Zienkiewicz-Strzałka, M.; Pikus, S.

    2012-11-01

    In this work mesoporous ordered silica materials containing palladium species were prepared using of tetraammine palladium chloride ([Pd(NH3)4]Cl2) complex as a palladium source during synthesis and by wetness impregnation of pure support by solution containing dissolved metal salt. The ammonia ligands from tetraammine palladium chloride were removed during calcination or during thermal treatment at 300 °C in oxygen atmosphere. For reduction of palladium ions to metallic state as prepared materials were treated by hydrogen at high temperature. In this work the locations of palladium atoms in silica lattice were considered by study of binding energy changes of cardinal atoms of mesoporous ordered silica. Ordered mesoporous silicates (MCM-41 and SBA-15) are very promising materials for a wide range of industrial applications due to their unique properties as well-defined ordered structure and excellent textural properties. They exhibit high surface area with high pore volume. Such supports ensure a high dispersion of the metal nanoparticles or other active phases providing the high activity of solid catalysts. The obtained materials were characterized primarily by X-ray diffraction (XRD) technique, X-ray photoelectron spectroscopy (XPS), nitrogen adsorption-desorption isotherms, and infrared spectroscopy. The proportional content of palladium was controlled by X-ray fluorescence technique.

  7. A co-sol-emulsion-gel synthesis of tunable and uniform hollow carbon nanospheres with interconnected mesoporous shells

    NASA Astrophysics Data System (ADS)

    Hou, Jianhua; Cao, Tai; Idrees, Faryal; Cao, Chuanbao

    2015-12-01

    Monodispersed mesoporous hollow spheres of polymer-silica and carbon-silica nanocomposites with an ``interpenetration twin'' nanostructure have been successfully synthesized by a co-sol-emulsion-gel method. The obtained mesoporous hollow carbon spheres (MHCSs) exhibited an open interconnected mesoporous shell that is endowed with high specific surface area (SBET, 2106-2225 m2 g-1) and large pore volume (1.95-2.53 cm3 g-1). Interestingly, the diameter of the uniform MHCSs could be precisely tuned on demand, as an effective electrode material in supercapacitors, MHCSs with a diameter of 90 nm deliver the shortest time constant (τ0 = 0.75 s), which is highly beneficial for rate capacitance (180 F g-1 at 100 A g-1, a full charge-discharge within 0.9 s) and cyclic retainability (3% loss after 20 000 cycles). The newly developed synthesis route leads to unique interconnected mesoporous hollow carbonaceous spheres with open-framework structures, providing a new material platform in energy storage.Monodispersed mesoporous hollow spheres of polymer-silica and carbon-silica nanocomposites with an ``interpenetration twin'' nanostructure have been successfully synthesized by a co-sol-emulsion-gel method. The obtained mesoporous hollow carbon spheres (MHCSs) exhibited an open interconnected mesoporous shell that is endowed with high specific surface area (SBET, 2106-2225 m2 g-1) and large pore volume (1.95-2.53 cm3 g-1). Interestingly, the diameter of the uniform MHCSs could be precisely tuned on demand, as an effective electrode material in supercapacitors, MHCSs with a diameter of 90 nm deliver the shortest time constant (τ0 = 0.75 s), which is highly beneficial for rate capacitance (180 F g-1 at 100 A g-1, a full charge-discharge within 0.9 s) and cyclic retainability (3% loss after 20 000 cycles). The newly developed synthesis route leads to unique interconnected mesoporous hollow carbonaceous spheres with open-framework structures, providing a new material platform in

  8. Synthesis, characterization, and catalytic application of ordered mesoporous carbon–niobium oxide composites

    SciTech Connect

    Gao, Juan-Li; Gao, Shuang; Liu, Chun-Ling; Liu, Zhao-Tie; Dong, Wen-Sheng

    2014-11-15

    Graphical abstract: The ordered mesoporous carbon–niobium oxide composites have been synthesized by a multi-component co-assembly method associated with a carbonization process. - Highlights: • Ordered mesoporous carbon–niobium oxide composites were synthesized. • The content of Nb{sub 2}O{sub 5} in the composites could be tuned from 38 to 75%. • Niobium species were highly dispersed in amorphous carbon framework walls. • The composites exhibited good catalytic performance in the dehydration of fructose. - Abstract: Ordered mesoporous carbon–niobium oxide composites have been synthesized by a multi-component co-assembly method associated with a carbonization process using phenolic resol as carbon source, niobium chloride as precursor and amphiphilic triblock copolymer Pluronic F127 as template. The resulting materials were characterized using a combination of techniques including differential scanning calorimetry–thermogravimetric analysis, N{sub 2} physical adsorption, X-ray diffraction, transmission electron microscopy, and X-ray photoelectron spectroscopy. The results show that with increasing the content of Nb{sub 2}O{sub 5} from 38 to 75% the specific surface area decreases from 306.4 to 124.5 m{sup 2} g{sup −1}, while the ordered mesoporous structure is remained. Niobium species is well dispersed in the amorphous carbon framework. The mesoporous carbon–niobium oxide composites exhibit high catalytic activity in the dehydration of fructose to 5-hydroxymethylfurfural. A 100% conversion of fructose and a 76.5% selectivity of 5-hydroxymethylfurfural were obtained over the carbon–niobium oxide composite containing 75% Nb{sub 2}O{sub 5} under the investigated reaction conditions.

  9. Facile Fabrication of Well-Dispersed Pt Nanoparticles in Mesoporous Silica with Large Open Spaces and Their Catalytic Applications.

    PubMed

    Liu, Xianchun; Chen, Dashu; Chen, Lin; Jin, Renxi; Xing, Shuangxi; Xing, Hongzhu; Xing, Yan; Su, Zhongmin

    2016-06-27

    In this paper, a facile strategy is reported for the preparation of well-dispersed Pt nanoparticles in ordered mesoporous silica (Pt@OMS) by using a hybrid mesoporous phenolic resin-silica nanocomposite as the parent material. The phenolic resin polymer is proposed herein to be the key in preventing the aggregation of Pt nanoparticles during their formation process and making contributions both to enhance the surface area and enlarge the pore size of the support. The Pt@OMS proves to be a highly active and stable catalyst for both gas-phase oxidation of CO and liquid-phase hydrogenation of 4-nitrophenol. This work might open new avenues for the preparation of noble metal nanoparticles in mesoporous silica with unique structures for catalytic applications. PMID:27245766

  10. One-pot synthesis of macro-mesoporous bioactive glasses/polylactic acid for bone tissue engineering.

    PubMed

    Han, Xiao; Wang, Dan; Chen, Xiang; Lin, Huiming; Qu, Fengyu

    2014-10-01

    The macro-mesoporous bioactive glasses/polylactic acid nanofibers were synthesized via electrospun method followed by acid treatment processing. It was identified to be an effective and simple synthetic strategy to form the uniform nanofibers about 350 nm in size. The non-ionic triblock copolymer, poly(ethylene glycol)-block-poly(propylene glycol)-block-poly(ethylene glycol) (P123), was used as the template for mesoporous structure (5 nm) and the macroporous structure about 10 μm in size derived from the overlapping of the nanofibers. Furthermore, the surface hydrophilic-hydrophobic property can be adjusted by varying the amount of mesoporous bioglass precursor (MBG-p). With the outstanding structure characters and the suitable hydrophilic property, these nanofiber composites show controlled drug release and the fast hydroxyapatite (HAP) mineralization performance. Herein, the novel materials are expected to have potential application for bone tissue engineering. PMID:25175225

  11. Mesoporous delafossite CuCrO2 and spinel CuCr2O4: synthesis and catalysis

    NASA Astrophysics Data System (ADS)

    Zhang, Peng; Shi, Yifeng; Chi, Miaofang; Park, Jung-Nam; Stucky, Galen D.; McFarland, Eric W.; Gao, Lian

    2013-08-01

    Delafossite CuCrO2 and spinel CuCr2O4 with mesoporous structures have been successfully synthesized using nanocasting methods based on a KIT-6 template. The functional activity of the mesoporous materials was evaluated in applications as heterogeneous catalysts. The activity for photocatalytic hydrogen production of the delafossite structures with different morphologies was characterized and the oxidation state changes associated with photocorrosion of Cu+ investigated using electron energy loss spectroscopy (EELS). Mg2+ doping was found to facilitate the casting of ordered structures for CuCrO2 and improves the photocorrosion resistance of delafossite structures. The mesoporous spinel CuCr2O4 nanostructures were found to be active for low temperature CO oxidation.

  12. Characteristics of the mass transfer of phosphatidylcholine during its sorption on mesoporous composites based on MCM-41

    NASA Astrophysics Data System (ADS)

    Sinyaeva, L. A.; Karpov, S. I.; Belanova, N. A.; Roessner, F.; Selemenev, V. F.

    2015-12-01

    The kinetic parameters of sorption of phosphatidylcholine on mesoporous composites based on MCM-41 are considered. It is noted that the possibility of both the diffusion and adsorption rate limitations of the process should be taken into account in the description of the kinetics of sorption of non-polar fat-soluble physiologically active compounds (PACs) from hexane solutions onto mesoporous materials of MCM- 41 type. The adequacy of using the Boyd diffusion model and the Lagergren, Ho and McKay, and Elovich models to describe the kinetics of sorption of phosphatidylcholine on mesoporous composites based on MCM-41 is shown. The contributions from diffusion limitation (internal and external) and the rate of the chemical step of adsorption to the overall rate of the sorption process are determined. It is found that the sorption of the phospholipid is a mixed diffusion process.

  13. Atomically Thin Mesoporous Nanomesh of Graphitic C3N4 for High-Efficiency Photocatalytic Hydrogen Evolution.

    PubMed

    Han, Qing; Wang, Bing; Gao, Jian; Cheng, Zhihua; Zhao, Yang; Zhang, Zhipan; Qu, Liangti

    2016-02-23

    Delamination of layer materials into two-dimensional single-atom sheets has induced exceptional physical properties, including large surface area, ultrahigh intrinsic carrier mobility, pronounced changes in the energy band structure, and other properties. Here, atomically thin mesoporous nanomesh of graphitic carbon nitride (g-C3N4) is fabricated by solvothermal exfoliation of mesoporous g-C3N4 bulk made from thermal polymerization of freeze-drying assembled Dicyandiamide nanostructure precursor. With the unique structural advantages for aligned energy levels, electron transfer, light harvesting, and the richly available reaction sites, the as-prepared monolayer of mesoporous g-C3N4 nanomesh exhibits a superior photocatalytic hydrogen evolution rate of 8510 μmol h(-1) g(-1) under λ > 420 nm and an apparent quantum efficiency of 5.1% at 420 nm, the highest of all the metal-free g-C3N4 nanosheets photocatalysts. PMID:26766237

  14. Microwave assisted N-alkylation of amine functionalized crystal-like mesoporous phenylene-silica.

    PubMed

    Lourenço, Mirtha A O; Siegel, Renée; Mafra, Luís; Ferreira, Paula

    2013-04-28

    N-alkylation reaction of amine functionalized phenylene moieties in crystal-like mesoporous silica is successfully achieved with about 87% of conversion in two reaction cycles. A potassium iodide catalyzed method commonly used for the selective N-monoalkylation of aniline is adapted and optimized to the N-monoalkylation reactions of the amine functionalized periodic mesoporous phenylene-silica (NH2-PMO) under microwave irradiation with preservation of the ordered mesostructure and of the crystal-like molecular scale periodicity of the material. This functionalization opens an avenue for the preparation of new materials with different amino-alkyl groups specially designed for a desired application, namely on the adsorption or catalytic fields. PMID:23508286

  15. Periodic mesoporous organosilica with molecular-scale ordering self-assembled by hydrogen bonds.

    PubMed

    Mizoshita, Norihiro; Inagaki, Shinji

    2015-10-01

    Nanoporous materials with functional frameworks have attracted attention because of their potential for various applications. Silica-based mesoporous materials generally consist of amorphous frameworks, whereas a molecular-scale lamellar ordering within the pore wall has been found for periodic mesoporous organosilicas (PMOs) prepared from bridged organosilane precursors. Formation of a "crystal-like" framework has been expected to significantly change the physical and chemical properties of PMOs. However, until now, there has been no report on other crystal-like arrangements. Here, we report a new molecular-scale ordering induced for a PMO. Our strategy is to form pore walls from precursors exhibiting directional H-bonding interaction. We demonstrate that the H-bonded organosilica columns are hexagonally packed within the pore walls. We also show that the H-bonded pore walls can stably accommodate H-bonding guest molecules, which represents a new method of modifying the PMO framework. PMID:26310201

  16. Synthesis and Characterization of Bionanoparticle-Silica Composites and Mesoporous Silica with Large Pores

    SciTech Connect

    Niu, Z.; Yang, L.; Kabisatpathy, S.; He, J.; Lee, A.; Ron, J.; Sikha, G.; Popov, B.N.; Emrick, T.; Russell, T. P.; Wang. Q.

    2009-03-24

    A sol-gel process has been developed to incorporate bionanoparticles, such as turnip yellow mosaic virus, cowpea mosaic virus, tobacco mosaic virus, and ferritin into silica, while maintaining the integrity and morphology of the particles. The structures of the resulting materials were characterized by transmission electron microscopy, small angle X-ray scattering, and N{sub 2} adsorption-desorption analysis. The results show that the shape and surface morphology of the bionanoparticles are largely preserved after being embedded into silica. After removal of the bionanoparticles by calcination, mesoporous silica with monodisperse pores, having the shape and surface morphology of the bionanoparticles replicated inside the silica, was produced,. This study is expected to lead to both functional composite materials and mesoporous silica with structurally well-defined large pores.

  17. A carbon-free ruthenium oxide/mesoporous titanium dioxide electrode for lithium-oxygen batteries

    NASA Astrophysics Data System (ADS)

    Park, Jin-Bum; Belharouak, Ilias; Lee, Yun Jung; Sun, Yang-Kook

    2015-11-01

    Mesoporous TiO2 with well-distributed RuO2 catalysts is considered in this paper as a carbon-free cathode material replacement. Benefiting from the highly-porous TiO2 support structure and high catalytic activity of RuO2, the Li-O2 cells with composite RuO2/mesoporous TiO2 cathodes show low charge potentials with a high cell capacity. The stability of the TiO2 materials was verified by investigating stable cell performance as well as through structural and chemical characterization via X-ray diffraction and X-ray photoelectron spectroscopy. This study demonstrates the possibility of achieving high energy at the cell level, free of carbon instability.

  18. Elongated silica nanoparticles with a mesh phase mesopore structure by fluorosurfactant templating.

    PubMed

    Tan, Bing; Dozier, Alan; Lehmler, Hans-Joachim; Knutson, Barbara L; Rankin, Stephen E

    2004-08-17

    Mesoporous silica materials with pore structures such as 2D hexagonal close packed, bicontinuous cubic, lamellar, sponge, wormhole-like, and rectangular have been made by using surfactant templating sol-gel processes. However, there are still some "intermediate" phases, in particular mesh phases, that are formed by surfactants but which have not been made into analogous silica pore structures. Here, we describe the one-step synthesis of mesoporous silica with a mesh phase pore structure. The cationic fluorinated surfactant 1,1,2,2-tetrahydroperfluorodecylpyridinium chloride (HFDePC) is used as the template. Like many fluorinated surfactants, HFDePC forms intermediate phases in water (including a mesh phase) over a wider range of compositions than do hydrocarbon surfactants. The materials produced by this technique are novel elongated particles in which the layers of the mesh phase are oriented orthogonal to the main axis of the particles. PMID:15301475

  19. Mesoporous aluminium organophosphonates: a reusable chemsensor for the detection of explosives

    NASA Astrophysics Data System (ADS)

    Li, Dongdong; Yu, Xiang

    2016-07-01

    Rapid and sensitive detection of explosives is in high demand for homeland security and public safety. In this work, electron-rich of anthracene functionalized mesoporous aluminium organophosphonates (En-AlPs) were synthesized by a one-pot condensation process. The mesoporous structure and strong blue emission of En-AlPs were confirmed by the N2 adsorption-desorption isotherms, transmission electron microscopy images and fluorescence spectra. The materials En-AlPs can serve as sensitive chemosensors for various electron deficient nitroderivatives, with the quenching constant and the detection limit up to 1.5×106 M-1 and 0.3 ppm in water solution. More importantly, the materials can be recycled for many times by simply washed with ethanol, showing potential applications in explosives detection.

  20. New triethoxysilylated 10-vertex closo-decaborate clusters. Synthesis and controlled immobilization into mesoporous silica.

    PubMed

    Abi-Ghaida, Fatima; Laila, Zahra; Ibrahim, Ghassan; Naoufal, Daoud; Mehdi, Ahmad

    2014-09-14

    Novel silylated hydroborate clusters comprising the closo-decaborate cage were prepared and characterized by (1)H, (13)C, (11)B, (29)Si NMR and mass spectroscopy ESI. The synthesis of such silylated clusters was achieved using reactive derivatives of [B10H10](2-), [1-B10H9N2](-) and [2-B10H9CO](-). These silylated decaborate clusters constitute a new class of precursors that can be covalently anchored onto various silica supports without any prior surface modification. As a proof of concept, the synthesized precursors were successfully anchored on mesoporous silica, SBA-15 type, in different percentages, where the mesoporous material retained its structure. All materials modified with closo-decaborate were characterized by (11)B and (29)Si solid state NMR, XRD, TEM and nitrogen sorption. PMID:25042868

  1. Mesoporous carbide-derived carbon with porosity tuned for efficient adsorption of cytokines.

    PubMed

    Yushin, Gleb; Hoffman, Elizabeth N; Barsoum, Michel W; Gogotsi, Yury; Howell, Carol A; Sandeman, Susan R; Phillips, Gary J; Lloyd, Andrew W; Mikhalovsky, Sergey V

    2006-12-01

    Porous carbons can be used for the purification of various bio-fluids, including the cleansing blood of inflammatory mediators in conditions such as sepsis or auto-immune diseases. Here we show that the control of pore size in carbons is a key factor to achieving efficient removal of cytokines. In particular, the surface area accessible by the protein governs the rate and effectiveness of the adsorption process. We demonstrate that novel mesoporous carbon materials synthesized from ternary MAX-phase carbides can be optimized for efficient adsorption of large inflammatory proteins. The synthesized carbons, having tunable pore size with a large volume of slit-shaped mesopores, outperformed all other materials or methods in terms of efficiency of TNF-alpha removal and the results are comparable only with highly specific antibody-antigen interactions. PMID:16914195

  2. Synthesis of magnetic, macro/mesoporous bioactive glasses based on coral skeleton for bone tissue engineering.

    PubMed

    Bian, Chunhui; Lin, Huiming; Zhang, Feng; Ma, Jie; Li, Fengxiao; Wu, Xiaodan; Qu, Fengyu

    2014-12-01

    The magnetic and macro/mesoporous bioactive glasses scaffolds are synthesised successfully by the combination of coral and P123 as co-templates through an evaporation-induced self-assembly process. The prepared material can induce the precipitation of hydroxyapatite layers on their surface in SBF only within 12 h. At the same time, the material exhibited excellent super-paramagnetic and mechanical property. Furthermore, the biocompatible assessment confirmed that the obtained material presented the good biocompatibility and the enhanced adherence of HeLa cells. Herein, the novel materials are expected to have potential application for bone tissue engineering. PMID:25429508

  3. Encapsulating Palladium Nanoparticles Inside Mesoporous MFI Zeolite Nanocrystals for Shape-Selective Catalysis.

    PubMed

    Cui, Tian-Lu; Ke, Wen-Yu; Zhang, Wen-Bei; Wang, Hong-Hui; Li, Xin-Hao; Chen, Jie-Sheng

    2016-08-01

    Pd nanoparticles were successfully encapsulated inside mesoporous silicalite-1 nanocrystals (Pd@mnc-S1) by a one-pot method. The as-synthesized Pd@mnc-S1 with excellent stability functioned as an active and reusable heterogeneous catalyst. The unique porosity and nanostructure of silicalite-1 crystals endowed the Pd@mnc-S1 material general shape-selectivity for various catalytic reactions, including selective hydrogenation, oxidation, and carbon-carbon coupling reactions. PMID:27346582

  4. Studies of adsorption equilibria and kinetics in the systems: Aqueous solution of dyes-mesoporous carbons

    NASA Astrophysics Data System (ADS)

    Derylo-Marczewska, A.; Marczewski, A. W.; Winter, Sz.; Sternik, D.

    2010-06-01

    Two carbonaceous materials were synthesized by using the method of impregnation of mesoporous silicas obtained by applying the Pluronic copolymers as pore-creating agents. The isotherms of adsorption of methylene blue and methyl orange from aqueous solutions were measured by the static method. The profiles of adsorbate concentration change in time were obtained from the UV-vis spectra. The adsorption isotherms and kinetic dependence were discussed in the terms of theory of adsorption on heterogeneous surfaces.

  5. Tunable mesoporous bilayer photonic resins with chiral nematic structures and actuator properties.

    PubMed

    Khan, Mostofa K; Hamad, Wadood Y; Maclachlan, Mark J

    2014-04-16

    Chiral nematic structures with different helical pitch from layer to layer are embedded into phenol-formaldehyde bilayer resin composite films using cellulose nanocrystals (CNCs) as templates. Selective removal of CNCs results in mesoporous resins with different pore size and helical pitch between the layers. Consequently, these materials exhibit photonic properties by selectively reflecting lights of two different wavelengths and concomitant actuation properties. PMID:24446312

  6. A simple method to ordered mesoporous carbons containing nickel nanoparticles

    SciTech Connect

    Dai, Sheng; Wang, Xiqing

    2009-01-01

    A series of ordered mesoporous carbons containing magnetic Ni nanoparticles (Ni-OMCs) with a variety of Ni loadings was made by a simple one-pot synthetic procedure through carbonization of phenolic resin-Pluronic block copolymer composites containing various amount of nickel nitrate. Such composite materials were characterized by N{sub 2} sorption, XRD, and STEM. Ni-OMCs exhibited high BET surface area, uniform pore size, and large pore volume without obvious pore blockage with a Ni loading as high as 15 wt%. Ni nanoparticles were crystalline with a face-center-cubic phase and observed mainly in the carbon matrix and on the outer surface as well. The average particle size of Ni nanoparticles was dependent on the preparation (carbonization) temperature and Ni loading; the higher the temperature was used and the more the Ni was incorporated, the larger the Ni nanoparticles were observed. One of the applications of Ni-OMCs was demonstrated as magnetically separable adsorbents.

  7. Mesoporous-Silica-Functionalized Nanoparticles for Drug Delivery.

    PubMed

    Giret, Simon; Wong Chi Man, Michel; Carcel, Carole

    2015-09-28

    The ever-growing interest for finding efficient and reliable methods for treatment of diseases has set a precedent for the design and synthesis of new functional hybrid materials, namely porous nanoparticles, for controlled drug delivery. Mesoporous silica nanoparticles (MSNPs) represent one of the most promising nanocarriers for drug delivery as they possess interesting chemical and physical properties, thermal and mechanical stabilities, and are biocompatibile. In particular, their easily functionalizable surface allows a large number of property modifications further improving their efficiency in this field. This Concept article deals with the advances on the novel methods of functionalizing MSNPs, inside or outside the pores, as well as within the walls, to produce efficient and smart drug carriers for therapy. PMID:26250991

  8. Porous thin films of functionalized mesoporous silica nanoparticles.

    PubMed

    Kobler, Johannes; Bein, Thomas

    2008-11-25

    The synthesis of extremely small mesoporous silica nanoparticles via a specific co-condensation process with phenyl groups is demonstrated. The suspensions are ideally suited for the production of nanoscale thin films by spin-coating. Thanks to the small particle size and the resulting low surface roughness, the films show excellent optical qualities and exhibit good diffusion properties and a highly accessible pore system. The availability of such homogeneous porous thin films made it possible to use ellipsometric porosimetry (EP) as a convenient method to determine the effective porosity of the films on their original support without destroying it. It was possible to record sorption isotherms of the thin films with ellipsometry and to correlate the data with nitrogen sorption data of dried powders of the same material. The thin films showed very low refractive indices of around 1.2. PMID:19206399

  9. Breakable mesoporous silica nanoparticles for targeted drug delivery.

    PubMed

    Maggini, Laura; Cabrera, Ingrid; Ruiz-Carretero, Amparo; Prasetyanto, Eko A; Robinet, Eric; De Cola, Luisa

    2016-04-01

    "Pop goes the particle". Here we report on the preparation of redox responsive mesoporous organo-silica nanoparticles containing disulfide (S-S) bridges (ss-NPs) that, even upon the exohedral grafting of targeting ligands, retained their ability to undergo structural degradation, and increase their local release activity when exposed to a reducing agent. This degradation could be observed also inside glioma C6 cancer cells. Moreover, when anticancer drug-loaded pristine and derivatized ss-NPs were fed to glioma C6 cells, the responsive hybrids were more effective in their cytotoxic action compared to non-breakable particles. The possibility of tailoring the surface functionalization of this hybrid, yet preserving its self-destructive behavior and enhanced drug delivery properties, paves the way for the development of effective biodegradable materials for in vivo targeted drug delivery. PMID:26974603

  10. TiO2-coated mesoporous carbon: conventional vs. microwave-annealing process.

    PubMed

    Coromelci-Pastravanu, Cristina; Ignat, Maria; Popovici, Evelini; Harabagiu, Valeria

    2014-08-15

    The study of coating mesoporous carbon materials with titanium oxide nanoparticles is now becoming a promising and challenging area of research. To optimize the use of carbon materials in various applications, it is necessary to attach functional groups or other nanostructures to their surface. The combination of the distinctive properties of mesoporous carbon materials and titanium oxide is expected to be applied in field emission displays, nanoelectronic devices, novel catalysts, and polymer or ceramic reinforcement. But, their synthesis is still largely based on conventional techniques, such as wet impregnation followed by chemical reduction of the metal nanoparticle precursors, which takes time and money. The thermal heating based techniques are time consuming and often lack control of particle size and morphology. Hence, since there is a growing interest in microwave technology, an alternative way of power input into chemical reactions through dielectric heating is the use of microwaves. This work is focused on the advantages of microwave-assisted synthesis of TiO2-coated mesoporous carbon over conventional thermal heating method. The reviewed studies showed that the microwave-assisted synthesis of such composites allows processes to be completed within a shorter reaction time allowing the nanoparticles formation with superior properties than that obtained by conventional method. PMID:24997254

  11. One-pot synthesis of magnetic, macro/mesoporous bioactive glasses for bone tissue engineering

    NASA Astrophysics Data System (ADS)

    Wang, Dan; Lin, Huiming; Jiang, Jingjie; Han, Xiao; Guo, Wei; Wu, Xiaodan; Jin, Yingxue; Qu, Fengyu

    2013-04-01

    Magnetic and macro/mesoporous bioactive glasses were synthesized by a one-pot method via a handy salt leaching technique. It was identified to be an effective and simple synthetic strategy. The non-ionic triblock copolymer, poly(ethylene glycol)-block-poly(propylene glycol)-block-poly(ethylene glycol) (P123), was used as the structure directing agent for mesoporous structure but also as the reductant to reduce the iron source into magnetic iron oxide. The prepared materials exhibited excellent super-paramagnetic property with interconnected macroporous (200-300 μm) and mesoporous (3.4 nm) structure. Furthermore, their outstanding drug storage/release properties and rapid (5) induction of hydroxyapatite growth ability were investigated after immersing in simulated body fluid solution at 37 °C. Notably, the biocompatibility assessment confirmed that the materials obtained presented good biocompatibility and enhanced adherence of HeLa cells. Herein, the novel materials are expected to have potential application for bone tissue engineering.

  12. Electrical Relaxation in ULTEM® and ULTEM® Containing Mesoporous Silica

    NASA Astrophysics Data System (ADS)

    Turo, Andrew; Edmondson, Charles E.; Lomax, Joseph F.; Bendler, John T.; Fontanella, John J.; Wintersgill, Mary C.

    2008-08-01

    Mesoporous silica has been added to Ultem® 1000 polyetherimide using solution casting. The mesoporous silica that was added was either uncoated or coated with polystyrene. Audio frequency dielectric relaxation studies were then carried out over the temperature range 5.5 to 550 K. Several interesting results were obtained. First, the uncoated mesoporous silica caused essentially no change in the relaxation spectrum of pure Ultem®. The polystyrene coated mesoporous silica caused rather large changes. The most striking example is the introduction of a new relaxation. This relaxation occurs at about 150 K and 1000 Hz as showing in fig. 1 via the open circles.

  13. Preparation of Carbon Nanotube/TiO2 Mesoporous Hybrid Photoanode with Iron Pyrite (FeS2) Thin Films Counter Electrodes for Dye-Sensitized Solar Cell

    NASA Astrophysics Data System (ADS)

    Kilic, Bayram; Turkdogan, Sunay; Astam, Aykut; Ozer, Oguz Can; Asgin, Mansur; Cebeci, Hulya; Urk, Deniz; Mucur, Selin Pravadili

    2016-05-01

    Multi-walled carbon nanotube (MWCNT)/TiO2 mesoporous networks can be employed as a new alternative photoanode in dye-sensitized solar cells (DSSCs). By using the MWCNT/TiO2 mesoporous as photoanodes in DSSC, we demonstrate that the MWCNT/TiO2 mesoporous photoanode is promising alternative to standard FTO/TiO2 mesoporous based DSSC due to larger specific surface area and high electrochemical activity. We also show that iron pyrite (FeS2) thin films can be used as an efficient counter electrode (CE), an alternative to the conventional high cost Pt based CE. We are able to synthesis FeS2 nanostructures utilizing a very cheap and easy hydrothermal growth route. MWCNT/TiO2 mesoporous based DSSCs with FeS2 CE achieved a high solar conversion efficiency of 7.27% under 100 mW cm‑2 (AM 1.5G 1-Sun) simulated solar irradiance which is considerably (slightly) higher than that of A-CNT/TiO2 mesoporous based DSSCs with Pt CE. Outstanding performance of the FeS2 CE makes it a very promising choice among the various CE materials used in the conventional DSSC and it is expected to be used more often to achieve higher photon-to-electron conversion efficiencies.

  14. 3D Mesoporous Graphene: CVD Self-Assembly on Porous Oxide Templates and Applications in High-Stable Li-S Batteries.

    PubMed

    Shi, Jia-Le; Tang, Cheng; Peng, Hong-Jie; Zhu, Lin; Cheng, Xin-Bing; Huang, Jia-Qi; Zhu, Wancheng; Zhang, Qiang

    2015-10-21

    A nanostructured carbon with high specific surface area (SSA), tunable pore structure, superior electrical conductivity, mechanically robust framework, and high chemical stability is an important requirement for electrochemical energy storage. Porous graphene fabricated by chemical activation and liquid etching has a high surface area but very limited volume of electrochemically accessible mesopores. Herein, an effective strategy of in situ formation of hierarchically mesoporous oxide templates with small pores induced by Kirkendall diffusion and large pores attributed to evaporation of deliberately introduced volatile metal is proposed for chemical vapor deposition assembly of porous graphene frameworks (PGFs). The PGFs inherit the hierarchical mesoporous structure of the templates. A high SSA of 1448 m(2) g(-1), 91.6% of which is contributed by mesopores, and a mesopore volume of 2.40 cm(3) g(-1) are attained for PGFs serving as reservoirs of ions or active materials in electrochemical energy storage applications. When the PGFs are applied in lithium-sulfur batteries, a very high sulfur utilization of 71% and a very low fading rate of ≈0.04% per cycle after the second cycle are achieved at a current rate of 1.0 C. This work provides a general strategy for the rational construction of mesoporous structures induced by a volatile metal, with a view toward the design of hierarchical nanomaterials for advanced energy storage. PMID:26265205

  15. Preparation of Carbon Nanotube/TiO2 Mesoporous Hybrid Photoanode with Iron Pyrite (FeS2) Thin Films Counter Electrodes for Dye-Sensitized Solar Cell

    PubMed Central

    Kilic, Bayram; Turkdogan, Sunay; Astam, Aykut; Ozer, Oguz Can; Asgin, Mansur; Cebeci, Hulya; Urk, Deniz; Mucur, Selin Pravadili

    2016-01-01

    Multi-walled carbon nanotube (MWCNT)/TiO2 mesoporous networks can be employed as a new alternative photoanode in dye-sensitized solar cells (DSSCs). By using the MWCNT/TiO2 mesoporous as photoanodes in DSSC, we demonstrate that the MWCNT/TiO2 mesoporous photoanode is promising alternative to standard FTO/TiO2 mesoporous based DSSC due to larger specific surface area and high electrochemical activity. We also show that iron pyrite (FeS2) thin films can be used as an efficient counter electrode (CE), an alternative to the conventional high cost Pt based CE. We are able to synthesis FeS2 nanostructures utilizing a very cheap and easy hydrothermal growth route. MWCNT/TiO2 mesoporous based DSSCs with FeS2 CE achieved a high solar conversion efficiency of 7.27% under 100 mW cm−2 (AM 1.5G 1-Sun) simulated solar irradiance which is considerably (slightly) higher than that of A-CNT/TiO2 mesoporous based DSSCs with Pt CE. Outstanding performance of the FeS2 CE makes it a very promising choice among the various CE materials used in the conventional DSSC and it is expected to be used more often to achieve higher photon-to-electron conversion efficiencies. PMID:27243374

  16. Preparation of Carbon Nanotube/TiO2 Mesoporous Hybrid Photoanode with Iron Pyrite (FeS2) Thin Films Counter Electrodes for Dye-Sensitized Solar Cell.

    PubMed

    Kilic, Bayram; Turkdogan, Sunay; Astam, Aykut; Ozer, Oguz Can; Asgin, Mansur; Cebeci, Hulya; Urk, Deniz; Mucur, Selin Pravadili

    2016-01-01

    Multi-walled carbon nanotube (MWCNT)/TiO2 mesoporous networks can be employed as a new alternative photoanode in dye-sensitized solar cells (DSSCs). By using the MWCNT/TiO2 mesoporous as photoanodes in DSSC, we demonstrate that the MWCNT/TiO2 mesoporous photoanode is promising alternative to standard FTO/TiO2 mesoporous based DSSC due to larger specific surface area and high electrochemical activity. We also show that iron pyrite (FeS2) thin films can be used as an efficient counter electrode (CE), an alternative to the conventional high cost Pt based CE. We are able to synthesis FeS2 nanostructures utilizing a very cheap and easy hydrothermal growth route. MWCNT/TiO2 mesoporous based DSSCs with FeS2 CE achieved a high solar conversion efficiency of 7.27% under 100 mW cm(-2) (AM 1.5G 1-Sun) simulated solar irradiance which is considerably (slightly) higher than that of A-CNT/TiO2 mesoporous based DSSCs with Pt CE. Outstanding performance of the FeS2 CE makes it a very promising choice among the various CE materials used in the conventional DSSC and it is expected to be used more often to achieve higher photon-to-electron conversion efficiencies. PMID:27243374

  17. Development of novel mesoporous silicates for bioseparations and biocatalysis

    NASA Astrophysics Data System (ADS)

    Katiyar, Amit

    The recent growth of the biopharmaceutical industry is due to the discovery of monoclonal antibodies and recombinant DNA technologies. Large-scale production of therapeutic proteins and monoclonal antibodies requires efficient technologies to separate products from complex synthesis mixtures. Chromatography is widely used for this purpose at both the analytical and process scales. Research in the last three decades has provided an improved understanding of the thermodynamic and mass transfer effects underlying the chromatographic behavior of biomolecules, leading to improvements in chromatographic equipment, separation media, and operating procedures. This dissertation reports on the development of ordered mesoporous silica-based adsorbents for chromatographic protein separations. The synthesis of mesoporous materials with different structural properties is reported here. Protein adsorption and enzymatic catalysis studies were conducted to evaluate the chromatographic performance of these materials. Initial studies focused on small pore materials (MCM-41), which had high protein adsorption capacities. These high protein loadings were attributed to high external surface area (˜600 m 2/g), meaning that MCM-41 materials are of limited use for size-selective chromatographic protein separation. Synthesis strategies were developed to produce large pore fibrous and spherical SBA-15 particles. The effects of synthesis conditions on particle properties are presented. Large pore Spherical ordered SBA-15 materials were used to demonstrate for the first time the size-selective separation of proteins. BSA and lysozyme were tagged with fluorescent molecules, allowing direct visualization of the size selective separation of these proteins. Flow microcalorimetry (FMC) results were used to interpret the size-selective behavior of these materials. The potential of siliceous SBA-15 materials to serve as hosts for enzymes in biocatalytic transformations was also explored. Materials

  18. Breakable mesoporous silica nanoparticles for targeted drug delivery

    NASA Astrophysics Data System (ADS)

    Maggini, Laura; Cabrera, Ingrid; Ruiz-Carretero, Amparo; Prasetyanto, Eko A.; Robinet, Eric; de Cola, Luisa

    2016-03-01

    ``Pop goes the particle''. Here we report on the preparation of redox responsive mesoporous organo-silica nanoparticles containing disulfide (S-S) bridges (ss-NPs) that, even upon the exohedral grafting of targeting ligands, retained their ability to undergo structural degradation, and increase their local release activity when exposed to a reducing agent. This degradation could be observed also inside glioma C6 cancer cells. Moreover, when anticancer drug-loaded pristine and derivatized ss-NPs were fed to glioma C6 cells, the responsive hybrids were more effective in their cytotoxic action compared to non-breakable particles. The possibility of tailoring the surface functionalization of this hybrid, yet preserving its self-destructive behavior and enhanced drug delivery properties, paves the way for the development of effective biodegradable materials for in vivo targeted drug delivery.``Pop goes the particle''. Here we report on the preparation of redox responsive mesoporous organo-silica nanoparticles containing disulfide (S-S) bridges (ss-NPs) that, even upon the exohedral grafting of targeting ligands, retained their ability to undergo structural degradation, and increase their local release activity when exposed to a reducing agent. This degradation could be observed also inside glioma C6 cancer cells. Moreover, when anticancer drug-loaded pristine and derivatized ss-NPs were fed to glioma C6 cells, the responsive hybrids were more effective in their cytotoxic action compared to non-breakable particles. The possibility of tailoring the surface functionalization of this hybrid, yet preserving its self-destructive behavior and enhanced drug delivery properties, paves the way for the development of effective biodegradable materials for in vivo targeted drug delivery. Electronic supplementary information (ESI) available: Full experimental procedures, additional SEM and TEM images of particles, complete UV-Vis and PL-monitored characterization of the breakdown of

  19. Mesoporous ZnAl2O4: an efficient adsorbent for the removal of arsenic from contaminated water.

    PubMed

    Kumari, Vandana; Bhaumik, Asim

    2015-07-14

    We report, for the first time, an efficient soft-templating strategy for the synthesis of mesoporous ZnAl2O4 using the supramolecular assembly of lauric acid (surfactant) as a template under alkaline pH conditions. A 50 : 50 (v/v) mixture of water-ethanol has been found to be a very efficient synthesis medium for the dissolution of inorganic precursors, retaining the supramolecular assembly of the lauric acid surfactant and adjusting the necessary pH of the synthesis gel, which are very crucial parameters to obtain the stable mesophase of zinc aluminate. This mesoporous ZnAl2O4 material has retained the mesophase upon calcination, showed good BET surface area and electron microscopic results revealed that the material is composed of tiny spherical nanoparticles of dimensions ca. 5-7 nm size. Mesoporous ZnAl2O4 showed very good adsorption efficiency for the removal of arsenic from contaminated water. An efficient synthesis strategy, high BET surface area, stable mesophase and good adsorption efficiency for AsO4(3-) from arsenic-contaminated water by the mesoporous ZnAl2O4 material have huge potential to be explored in the large scale purification of groundwater. PMID:26053110

  20. Aerosol-assisted controlled packing of silica nanocolloids: templateless synthesis of mesoporous silicates with structural tunability and complexity.

    PubMed

    Min, Kyungmin; Choi, Chang Hyuck; Kim, Myoung Yeob; Choi, Minkee

    2015-01-01

    A template-free synthesis method for mesoporous and macro-/mesoporous hierarchically porous silicates with remarkable structural tunability and complexity is presented. SiO2 nanocolloids having diameters of 3.0-29 nm were prepared as a primary building block by using extended Stöber synthesis, and they were subsequently assembled by an aerosol-assisted drying. The silica pore structure can be rationally controlled depending on the initial diameter of SiO2 colloids and the aerosol-assembly temperature that determines the packing density of SiO2 colloids (i.e., amounts of packing defects) in the resultant materials. The present method could produce mesoporous silica spheres with remarkable pore-structural tunability (291 < BET surface area <807 m(2) g(-1), 0.42 < pore volume <0.92 cm(3) g(-1), 3.1 < pore size <26 nm). Hierarchically porous materials can also be synthesized by the evaporation-induced phase separation of solvent medium during the aerosol-assisted assembly of SiO2 colloids. By adding aluminum and Pt precursors into the SiO2 colloid suspensions before the aerosol-assisted assembly, mesoporous aluminosilicates supporting uniform Pt nanoclusters (∼2 nm) can also be synthesized. This indicates that the synthesis strategy can be used for the direct synthesis of functional silicate materials. PMID:25517201