Science.gov

Sample records for metal-binding silica materials

  1. Metal-binding silica materials for wastewater cleanup

    SciTech Connect

    Kroh, F.O.

    1997-10-01

    In this Phase I Small Business Innovation Research program, TPL, Inc. is developing two series of high-efficiency covalently modified silica materials for removing heavy metal ions from wastewater. These materials have metal ion capacities greatly exceeding those of commercial ion exchange resins. One series, containing thiol groups, has high capacity for {open_quotes}soft{close_quotes} heavy metal ions such as Hg, Pb, Ag, and Cd; the other, containing quaternary ammonium groups, has high capacity for anionic metal ions such as pertechnetate, arsenate, selenite, and chromate. These materials have high selectivity for the contaminant metals and will function well in harsh systems that inactivate other systems.

  2. Reusable silica surface-insulation material

    NASA Technical Reports Server (NTRS)

    Goldstein, H. E.; Smith, M.; Leiser, D.

    1973-01-01

    Material was specifically developed for manufacture of insulating tiles, but it can be molded into other shapes as required. Basic raw materials are high-purity silica fiber, fumed-silica powder, and reagent-grade starch. Only purest materials are used, and care must be taken to avoid contamination during processing.

  3. Metal-silica sol-gel materials

    NASA Technical Reports Server (NTRS)

    Stiegman, Albert E. (Inventor)

    2002-01-01

    The present invention relates to a single phase metal-silica sol-gel glass formed by the co-condensation of a transition metal with silicon atoms where the metal atoms are uniformly distributed within the sol-gel glass as individual metal centers. Any transition metal may be used in the sol-gel glasses. The present invention also relates to sensor materials where the sensor material is formed using the single phase metal-silica sol-gel glasses. The sensor materials may be in the form of a thin film or may be attached to an optical fiber. The present invention also relates to a method of sensing chemicals using the chemical sensors by monitoring the chromatic change of the metal-silica sol-gel glass when the chemical binds to the sensor. The present invention also relates to oxidation catalysts where a metal-silica sol-gel glass catalyzes the reaction. The present invention also relates to a method of performing oxidation reactions using the metal-silica sol-gel glasses. The present invention also relates to organopolymer metal-silica sol-gel composites where the pores of the metal-silica sol-gel glasses are filled with an organic polymer polymerized by the sol-gel glass.

  4. Fused Silica and Other Transparent Window Materials

    NASA Technical Reports Server (NTRS)

    Salem, Jon

    2016-01-01

    Several transparent ceramics, such as spinel and AlONs are now being produced in sufficient large areas to be used in space craft window applications. The work horse transparent material for space missions from Apollo to the International Space Station has been fused silica due in part to its low coefficient of expansion and optical quality. Despite its successful use, fused silica exhibits anomalies in its crack growth behavior, depending on environmental preconditioning and surface damage. This presentation will compare recent optical ceramics to fused silica and discuss sources of variation in slow crack growth behavior.

  5. Thermal pretreatment of silica composite filler materials

    PubMed Central

    Wan, Quan; Ramsey, Christopher

    2010-01-01

    Three different silica filler materials were thermally treated in order to effect dehydration, dehydroxylation, and rehydroxylation. Samples were characterized by thermogravimetry (TG), pycnometry, elemental analysis, and scanning electron microscopy (SEM). For all fillers, our results indicate incremental removal of silanol groups at higher heating temperatures and irreversible dehydroxylation at over 673 K. To remove the organic content and maintain adequate silanol density for subsequent silanization on Stöber-type silica, we suggest heating at 673 K followed by overnight boiling in water. PMID:20445821

  6. Improved Silica Aerogel Composite Materials

    NASA Technical Reports Server (NTRS)

    Paik, Jong-Ah; Sakamoto, Jeffrey; Jones, Steven

    2008-01-01

    A family of aerogel-matrix composite materials having thermal-stability and mechanical- integrity properties better than those of neat aerogels has been developed. Aerogels are known to be excellent thermal- and acoustic-insulation materials because of their molecular-scale porosity, but heretofore, the use of aerogels has been inhibited by two factors: (1) Their brittleness makes processing and handling difficult. (2) They shrink during production and shrink more when heated to high temperatures during use. The shrinkage and the consequent cracking make it difficult to use them to encapsulate objects in thermal-insulation materials. The underlying concept of aerogel-matrix composites is not new; the novelty of the present family of materials lies in formulations and processes that result in superior properties, which include (1) much less shrinkage during a supercritical-drying process employed in producing a typical aerogel, (2) much less shrinkage during exposure to high temperatures, and (3) as a result of the reduction in shrinkage, much less or even no cracking.

  7. Mesoporous silica-titania composed materials.

    PubMed

    Messina, Paula V; Morini, Marcela A; Sierra, María B; Schulz, Pablo C

    2006-08-01

    Titania mesosized particles were obtained by TiCl4 hydrolysis in Aerosol OT/water/n-hexane microemulsion. These particles were incorporated in surfactant templated silica mesoporous materials of MCM-41 and MCM-50 structures. Results depended on the surfactant: hexadecyltrimethylammonium bromide templated materials retained the honeycomb structure with small modifications in their characteristics. The dodecyltrimethylammonium bromide templated material changed from honeycomb to lamellar structure when the titania particles were included, with dramatic changes in the structure characteristics. The didodecyldimethylammonium bromide templated lamellar structure was retained after TIO2 inclusion, with a slight increase in the specific area, pore diameter and pore walls thickness. PMID:16600274

  8. Gated Silica Mesoporous Materials in Sensing Applications.

    PubMed

    Sancenón, Félix; Pascual, Lluís; Oroval, Mar; Aznar, Elena; Martínez-Máñez, Ramón

    2015-08-01

    Silica mesoporous supports (SMSs) have a large specific surface area and volume and are particularly exciting vehicles for delivery applications. Such container-like structures can be loaded with numerous different chemical substances, such as drugs and reporters. Gated systems also contain addressable functions at openings of voids, and cargo delivery can be controlled on-command using chemical, biochemical or physical stimuli. Many of these gated SMSs have been applied for drug delivery. However, fewer examples of their use in sensing protocols have been reported. The approach of applying SMSs in sensing uses another concept-that of loading pores with a reporter and designing a capping mechanism that is selectively opened in the presence of a target analyte, which results in the delivery of the reporter. According to this concept, we provide herein a complete compilation of published examples of probes based on the use of capped SMSs for sensing. Examples for the detection of anions, cations, small molecules and biomolecules are provided. The diverse range of gated silica mesoporous materials presented here highlights their usefulness in recognition protocols. PMID:26491626

  9. Gated Silica Mesoporous Materials in Sensing Applications

    PubMed Central

    Sancenón, Félix; Pascual, Lluís; Oroval, Mar; Aznar, Elena; Martínez-Máñez, Ramón

    2015-01-01

    Silica mesoporous supports (SMSs) have a large specific surface area and volume and are particularly exciting vehicles for delivery applications. Such container-like structures can be loaded with numerous different chemical substances, such as drugs and reporters. Gated systems also contain addressable functions at openings of voids, and cargo delivery can be controlled on-command using chemical, biochemical or physical stimuli. Many of these gated SMSs have been applied for drug delivery. However, fewer examples of their use in sensing protocols have been reported. The approach of applying SMSs in sensing uses another concept—that of loading pores with a reporter and designing a capping mechanism that is selectively opened in the presence of a target analyte, which results in the delivery of the reporter. According to this concept, we provide herein a complete compilation of published examples of probes based on the use of capped SMSs for sensing. Examples for the detection of anions, cations, small molecules and biomolecules are provided. The diverse range of gated silica mesoporous materials presented here highlights their usefulness in recognition protocols. PMID:26491626

  10. Material Properties for Fiber-Reinforced Silica Aerogels

    NASA Technical Reports Server (NTRS)

    White, Susan; Rouanet, Stephane; Moses, John; Arnold, James O. (Technical Monitor)

    1994-01-01

    Ceramic fiber-reinforced silica aerogels are novel materials for high performance insulation, including thermal protection materials. Experimental data are presented for the thermal and mechanical properties, showing the trends exhibited over a range of fiber loadings and silica aerogel densities. Test results are compared to that of unreinforced bulk aerogels.

  11. Functionalized mesoporous silica materials for molsidomine adsorption: Thermodynamic study

    SciTech Connect

    Alyoshina, Nonna A.; Parfenyuk, Elena V.

    2013-09-15

    A series of unmodified and organically modified mesoporous silica materials was prepared. The unmodified mesoporous silica was synthesized via sol–gel synthesis in the presence of D-glucose as pore-forming agent. The functionalized by phenyl, aminopropyl and mercaptopropyl groups silica materials were prepared via grafting. The fabricated adsorbent materials were characterized by Fourier transform infrared spectroscopy (FTIR) analysis, N{sub 2} adsorption/desorption and elemental analysis methods. Then their adsorption properties for mesoionic dug molsidomine were investigated at 290–313 K and physiological pH value. Thermodynamic parameters of molsidomine adsorption on the synthesized materials have been calculated. The obtained results showed that the adsorption process of molsidomine on the phenyl modified silica is the most quantitatively and energetically favorable. The unmodified and mercaptopropyl modified silica materials exhibit significantly higher adsorption capacities and energies for molsidomine than the aminopropyl modified sample. The effects are discussed from the viewpoint of nature of specific interactions responsible for the adsorption. - Graphical abstract: Comparative analysis of the thermodynamic characteristics of molsidomine adsorption showed that the adsorption process on mesoporous silica materials is controlled by chemical nature of surface functional groups. Molsidomine adsorption on the phenyl modified silica is the most quantitatively and energetically favorable. Taking into account ambiguous nature of mesoionic compounds, it was found that molsidomine is rather aromatic than dipolar. Display Omitted - Highlights: • Unmodified and organically modified mesoporous silica materials were prepared. • Molsidomine adsorption on the silica materials was studied. • Phenyl modified silica shows the highest adsorption capacity and favorable energy. • Molsidomine exhibits the lowest affinity to aminopropyl modified silica.

  12. Titania-Silica Materials for Enhanced Photocatalysis.

    PubMed

    Rico-Santacruz, Marisa; Serrano, Elena; Marcì, Giuseppe; García-López, Elisa I; García-Martínez, Javier

    2015-12-01

    Mesoporous titania-organosilica nanoparticles comprised of anatase nanocrystals crosslinked with organosilica moieties have been prepared by direct co-condensation of a titania precursor, tetrabuthylortotitanate (TBOT), with two organosilica precursors, 1,4-bis(triethoxysilyl) benzene (BTEB) and 1,2-bis(triethoxysilyl) ethane (BTEE), in mild conditions and in the absence of surfactant. These hybrid materials show both high surface areas (200-360 m(2)  g(-1) ) and pore volumes (0.3 cm(3)  g(-1) ) even after calcination, and excellent photoactivity in the degradation of rhodamine 6G and in the partial oxidation of propene under UV irradiation, especially after the calcination of the samples. During calcination, there is a change in the Ti(IV) coordination and an increase in the content of SiOTi moieties in comparison with the uncalcined materials, which seems to be responsible for the enhanced photocatalytic activity of hybrid titania-silica materials as compared to both uncalcined samples and the control TiO2 . PMID:26503306

  13. Developing improved silica materials and devices for integrated optics applications

    NASA Astrophysics Data System (ADS)

    Maker, Ashley Julia

    Due to their favorable optical and material properties, silica-based materials and devices have found many important applications throughout science and engineering, especially in sensing, communications, lasers, and integrated optics. Often, silica's properties ultimately limit the performance of these applications. To address this limitation, this thesis investigates the development of improved silica materials and optical devices, including silica films, coatings, waveguides, resonators, lasers, and sensors. Using sol-gel chemistry and microfabrication procedures, custom silica materials and devices are developed to benefit many applications. In this thesis, it is first demonstrated how the low optical loss of silica enables fabrication of low loss integrated waveguides and toroidal resonators with ultra-high quality factors. Then, by adding various rare earth and metal dopants to sol-gel silica, hybrid silica materials and devices are made with custom properties such as high refractive index and lasing capabilities. Finally, several applications are demonstrated, including the use of high refractive index coatings to control the behavior of light, development of Raman and ultra-low threshold rare earth microlasers, and a heterodyned microlaser sensor with significantly improved sensing performance. Future applications and directions of this research are also discussed.

  14. Water confinement in nanoporous silica materials

    SciTech Connect

    Renou, Richard; Szymczyk, Anthony; Ghoufi, Aziz

    2014-01-28

    The influence of the surface polarity of cylindrical silica nanopores and the presence of Na{sup +} ions as compensating charges on the structure and dynamics of confined water has been investigated by molecular dynamics simulations. A comparison between three different matrixes has been included: a protonated nanopore (PP, with SiOH groups), a deprotonated material (DP, with negatively charged surface groups), and a compensated-charge framework (CC, with sodium cations compensating the negative surface charge). The structure of water inside the different pores shows significant differences in terms of layer organization and hydrogen bonding network. Inside the CC pore the innermost layer is lost to be replaced by a quasi bulk phase. The electrostatic field generated by the DP pore is felt from the surface to the centre of pore leading to a strong orientation of water molecules even in the central part of the pore. Water dynamics inside both the PP and DP pores shows significant differences with respect to the CC pore in which the sub-diffusive regime of water is lost for a superdiffusive regime.

  15. Extensive hydrated silica materials in western Hellas Basin, Mars

    NASA Astrophysics Data System (ADS)

    Bandfield, Joshua L.; Amador, Elena S.; Thomas, Nancy H.

    2013-11-01

    Near-infrared spectral data indicate the presence of hydrated, poorly crystalline silica where high bulk silica contents have been previously identified in Hellas Basin. No other aqueous phases are identified in these regions and the deposits may be nearly pure. The silica-bearing surfaces are sporadically exposed along a 650 km stretch of the western basin rim within a limited elevation range and display a variety of surface textures suggesting that the materials have been reworked, but not transported large distances. The high abundances and lack of associated aqueous phases indicate that high water to rock ratios were present in the region during the Noachian period but without elevated temperatures or for durations necessary for quartz diagenesis. The silica-bearing materials may have formed via direct precipitation from silica saturated groundwater sources, although other formation mechanisms are also plausible.

  16. Nanodiamond-Decorated Silica Spheres as a Chromatographic Material.

    PubMed

    Xue, Zuqin; Vinci, John C; Colón, Luis A

    2016-02-17

    Nanodiamond (ND) particles (∼5 nm), obtained from detonation soot, were oxidized and/or thermally hydrogenated. Both, the non-hydrogenated and hydrogenated ND particles were successfully coupled to the surface of micrometer-size organo-silica particles. A thin layer of nanodiamonds (NDs) decorating the surface of the organo-silica particles was visible on transmission electron microscopy (TEM) images. X-ray photoelectron spectroscopy (XPS) and infrared spectroscopy (IR) were used to characterize the NDs prior to coupling and to confirm attachment onto the organo-silica particles. Both, ultraviolet (UV) radiation and a chemical initiator were proved to be effective radical initiators for the ND-silica coupling reaction, although for scale-up purposes the chemical initiation was more advantageous to produce the ND-silica composite. Commercially available nanodiamond primary particles were also coupled to the surface of silica particles. The ND-containing silica particles were packed into chromatographic columns to study their initial feasibility as adsorbent material for liquid chromatography. The organo-silica particles decorated with hydrogenated NDs were shown to possess reversed phase type (i.e., hydrophobic) behavior toward the probe compounds, whereas silica particles decorated with the non-hydrogenated NDs showed polar (i.e., hydrophilic) interactions, both under liquid chromatographic conditions. PMID:26790050

  17. Biotemplated diatom silica-titania materials for air purification.

    PubMed

    Van Eynde, Erik; Tytgat, Tom; Smits, Marianne; Verbruggen, Sammy W; Hauchecorne, Birger; Lenaerts, Silvia

    2013-04-01

    We present a novel manufacture route for silica-titania photocatalysts using the diatom microalga Pinnularia sp. Diatoms self-assemble into porous silica cell walls, called frustules, with periodic micro-, meso- and macroscale features. This unique hierarchical porous structure of the diatom frustule is used as a biotemplate to incorporate titania by a sol-gel methodology. Important material characteristics of the modified diatom frustules under study are morphology, crystallinity, surface area, pore size and optical properties. The produced biosilica-titania material is evaluated towards photocatalytic activity for NOx abatement under UV radiation. This research is the first step to obtain sustainable, well-immobilised silica-titania photocatalysts using diatoms. PMID:23128085

  18. Fluorescent Functionalized Mesoporous Silica for Radioactive Material Extraction

    SciTech Connect

    Li, Juan; Zhu, Kake; Shang, Jianying; Wang, Donghai; Nie, Zimin; Guo, Ruisong; Liu, Chongxuan; Wang, Zheming; Li, Xiaolin; Liu, Jun

    2012-08-01

    Mesoporous silica with covalently bound salicylic acid molecules incorporated in the structure was synthesized with a one-pot, co-condensation reaction at room temperature. The as-synthesized material has a large surface area, uniform particle size, and an ordered pore structure as determined by characterization with transmission electron microscopy, thermal gravimetric analysis, and infrared spectra, etc. Using the strong fluorescence and metal coordination capability of salicylic acid, functionalized mesoporous silica (FMS) was developed to track and extract radionuclide contaminants, such as uranyl [U(VI)] ions encountered in subsurface environments. Adsorption measurements showed a strong affinity of the FMS toward U(VI) with a Kd value of 105 mL/g, which is four orders of magnitude higher than the adsorption of U(VI) onto most of the sediments in natural environments. The new materials have a potential for synergistic environmental monitoring and remediation of the radionuclide U(VI) from contaminated subsurface environments.

  19. Preferred Metal Binding Site of Aniline

    NASA Astrophysics Data System (ADS)

    Kumari, Sudesh; Sohnlein, Brad; Yang, Dong-Sheng

    2012-06-01

    Group III metal-aniline complexes, M-aniline (M = Sc, Y, and La), were produced by interactions between laser-vaporized metal atoms and aniline vapor in a pulsed molecular beam source, identified by photoionization time-of-flight mass spectrometry, and studied by pulsed-field ionization zero electron kinetic energy (ZEKE) spectroscopy and density functional theory calculations. Adiabatic ionization energies and several vibrational intervals were measured from the ZEKE spectra. Metal binding sites and electronic states were determined by combining the ZEKE measurements and theoretical calculations. Although aniline has various possible sites for metal coordination, the preferred site was determined to be phenyl ring. The metal binding with the phenyl ring yields syn and anti conformers. In these conformers, the neutral complexes are in doublet ground states and the corresponding singly charged cations in singlet states.

  20. Development of novel delivery system for warfarin based on mesoporous silica: adsorption characteristics of silica materials for the anticoagulant.

    PubMed

    Dolinina, Ekaterina S; Vorobyeva, Evgeniya V; Parfenyuk, Elena V

    2016-08-01

    The adsorption of the anticoagulant warfarin onto unmodified (UMS) and modified (phenyl (PhMS), methyl (MMS), mercaptopropyl (MPMS)) mesoporous silica materials was studied at pH 1.6 and 7.4 and in the temperature range of 293-325 K. The silica materials were prepared by sol-gel method for further characterization by FTIR spectroscopy, N2 adsorption/desorption method, transmission electron microscopy and zeta potential measurements. The effects of medium pH, temperature and surface modification of mesoporous silica material on their adsorption characteristics (adsorption capacity, thermodynamic parameters of adsorption) relative to anticoagulant warfarin were investigated. It was found that medium acid-base properties strongly affect the adsorption of warfarin due to the pH-dependent structural diversity of the drug and ionization state of the silica surfaces. The adsorption capacity of the silica materials at pH 1.6 decreases in the order: MMS > MPMS > UMS > PhMS. The influence of various non-covalent interactions on the adsorption capacity of the silica materials and energy of the drug-silica interactions is discussed. These results may be useful for the development of a novel delivery system of warfarin. PMID:26465269

  1. Solid state dye lasers: rhodamines in silica-zirconia materials.

    PubMed

    Schultheiss, Silke; Yariv, Eli; Reisfeld, Renata; Breuer, Hans Dieter

    2002-05-01

    Silica-zirconia materials as well as silica-zirconia ormosils prepared by the sol-gel technique were doped with the laser dyes Rhodamine B and Rhodamine 6G and used as solid state dye lasers. The photostability and efficiency of the solid state laser samples were measured in a transverse pumping configuration by either a nitrogen laser or the second harmonic of a Nd-YAG laser. Under the excitation of a nitrogen laser the photostability of Rhodamine B in silica-zirconia materials was low and decreased with a growing amount of zirconia. The photophysical properties of the incorporated dyes were studied by time-resolved fluorescence spectroscopy. The fluorescence lifetimes of both dyes increased when the matrix was modified by organic compounds Furthermore, the threshold energy of Rhodamine 6G in two ormosils containing 3 and 50% methylsilica was measured. The results revealed that the threshold energy was lower for the matrix with a higher amount of ormosil while the slope efficiency was higher in the matrix containing 30% ormosil. PMID:12653469

  2. Novel thermochromism in silica sol-gel materials

    NASA Astrophysics Data System (ADS)

    Gardener, Martin; Perry, Carole C.

    2000-05-01

    In this contribution we provide evidence for thermochromic color changes unique to silica based materials formed at low temperatures by the sol-gel process. The materials formed have potential application as temperature sensitive light filters, visual temperature indicators, self-diagnostic labels for electronic devices and IR recording media. The dopants, diamine complexes of copper(II)/nickel(II) chloride, change from purple to green following heating to 100 degrees C and revert to purple on cooling in the atmosphere. This color change has been explained by the substitution of water molecules by chloride ions in the first coordination sphere of the metal ions. When the same compounds are incorporated into a silica sol-gel matrix under acidic conditions the gel-glasses may be pale green, dark green, yellow, olive-yellow, blue or brown depending on the metal ion chosen and the extent of thermal treatment. Studies on the complexes themselves and on granular silicas doped with some of the complexes are assisting us in understanding the molecular mechanisms that give rise to these color changes.

  3. Polymer-Silica Nanocomposites: A Versatile Platform for Multifunctional Materials

    NASA Astrophysics Data System (ADS)

    Chiu, Chi-Kai

    Solution sol-gel synthesis is a versatile approach to create polymer-silica nanocomposite materials. The solution-to-solid transformation results in a solid consisting of interconnected nanoporous structure in 3D space, making it the ideal material for filtration, encapsulation, optics, electronics, drug release, and biomaterials, etc. Although the pore between nano and meso size may be tunable using different reaction conditions, the intrinsic properties such as limited diffusion within pore structure, complicated interfacial interactions at the pore surfaces, shrinkage and stress-induced cracking and brittleness have limited the applications of this material. To overcome these problems, diffusion, pore size, shrinkage and stress-induced defects need further investigation. Thus, the presented thesis will address these important questions such as whether these limitations can be utilized as the novel method to create new materials and lead to new applications. First, the behaviors of polymers such as poly(ethylene glycol) inside the silica pores are examined by studying the nucleation and growth of AgCl at the surface of the porous matrix. The pore structure and the pressure induced by the shrinkage affect have been found to induce the growth of AgCl nanocrystals. When the same process is carried out at 160 °C, silver metallization is possible. Due to the shrinkage-induced stresses, the polymer tends to move into open crack spaces and exterior surfaces, forming interconnected silver structure. This interconnected silver structure is very unique because its density is not related to the size scale of nanopore structures. These findings suggest that it is possible to utilize defect surface of silica material as the template to create interconnected silver structure. When the scale is small, polymer may no longer be needed if the diffusion length of Ag is more than the size of silica particles. To validate our assumption, monoliths of sol-gel sample containing AgNO3

  4. Solvent effects on silica domain growth in silica/siloxane composite materials

    SciTech Connect

    Ulibarri, T.A.; Bates, S.E.; Black, E.P.; Schaefer, D.W.; Beaucage, W.G.; Lee, M.K.; Moore, P.A.; Burns, G.T.

    1995-07-01

    The effect of solvent addition on the phase separation, mechanical Properties and thermal stability of silica/siloxane composite materials prepared by in situ reinforcement was examined. The addition of a solvent enhances the miscibility of the reinforcement precursor, a partial hydrolyzate of tetraethoxysilane (TEOS-PH), with the polydimethylsiloxane (PDMS) polymer. As a result, the phase separation at the micron level, termed the large-scale structure, diminished in size. This decrease in particle size resulting from the addition of moderate amounts of solvent was accompanied by an improvement in the mechanical properties. However, solvent addition in the excess of 50 weight percent led to a decrease in mechanical properties even though the large-scale structure continued to diminish in size. Small Angle X-Ray Scattering (SAXS) was used to examine the Angstrom level or small-scale structure. This small-scale structure was only affected by the presence of solvent, not the amount. The silica/siloxane composite materials showed the same thermal transition temperatures as the original PDMS material.

  5. Polyimide-silica composite materials: How does silica influence their microstructure and gas permeation properties?

    SciTech Connect

    Joly, C.; Smaihi, M.; Porcar, L.; Noble, R.D.

    1999-09-01

    Composite polyimide-silica materials have been synthesized via the sol-gel process and their gas transport properties studied. Structural characterizations have been performed showing that materials prepared with large concentration of silicon alkoxyde are composites made of silica particles embedded in the polyimide matrix while low-silicon alkoxyde concentration induces homogeneous materials. X-ray diffraction shows that the presence of silicon species induces modifications in the microstructure of the polyimide chains. These modifications have been confirmed by a shift of the glass transition temperature and density variations. Influence of the temperature and silicon species on the gas transport have been studied using various gases (nitrogen, oxygen, carbon dioxide, and methane) showing that gas permeation coefficients increase with the silicon species proportion. CO{sub 2} sorption measurements have been performed at various temperatures and the results have been analyzed in terms of the dual sorption theory. Activation energies have been calculated for the permeation and sorption mechanisms. The results show that silicon species contributes to the overall permeability.

  6. Synthesis of mesoporous silica materials from municipal solid waste incinerator bottom ash.

    PubMed

    Liu, Zhen-Shu; Li, Wen-Kai; Huang, Chun-Yi

    2014-05-01

    Incinerator bottom ash contains a large amount of silica and can hence be used as a silica source for the synthesis of mesoporous silica materials. In this study, the conditions for alkaline fusion to extract silica from incinerator bottom ash were investigated, and the resulting supernatant solution was used as the silica source for synthesizing mesoporous silica materials. The physical and chemical characteristics of the mesoporous silica materials were analyzed using BET, XRD, FTIR, SEM, and solid-state NMR. The results indicated that the BET surface area and pore size distribution of the synthesized silica materials were 992 m2/g and 2-3.8 nm, respectively. The XRD patterns showed that the synthesized materials exhibited a hexagonal pore structure with a smaller order. The NMR spectra of the synthesized materials exhibited three peaks, corresponding to Q(2) [Si(OSi)2(OH)2], Q(3) [Si(OSi)3(OH)], and Q(4) [Si(OSi)4]. The FTIR spectra confirmed the existence of a surface hydroxyl group and the occurrence of symmetric Si-O stretching. Thus, mesoporous silica was successfully synthesized from incinerator bottom ash. Finally, the effectiveness of the synthesized silica in removing heavy metals (Pb2+, Cu2+, Cd2+, and Cr2+) from aqueous solutions was also determined. The results showed that the silica materials synthesized from incinerator bottom ash have potential for use as an adsorbent for the removal of heavy metals from aqueous solutions. PMID:24656468

  7. Mesoporous silica as carrier of antioxidant for food packaging materials

    NASA Astrophysics Data System (ADS)

    Buonocore, Giovanna Giuliana; Gargiulo, Nicola; Verdolotti, Letizia; Liguori, Barbara; Lavorgna, Marino; Caputo, Domenico

    2014-05-01

    Mesoporous silicas have been long recognized as very promising materials for the preparation of drug delivery systems. In this work SBA-15 mesoporous silica has been functionalized with amino-silane to be used as carrier of antioxidant compound in the preparation of active food packaging materials exhibiting tailored release properties. Active films have been prepared by loading the antioxidant tocopherol, the purely siliceous SBA-15 and the aminofunctionalized SBA-15 loaded with tocopherol into LDPE matrix trough a two-step process (mixing+extrusion). The aim of the present work is the study of the effect of the pore size and of the chemical functionality of the internal walls of the mesophase on the migration of tocopherol from active LDPE polymer films. Moreover, it has been proved that the addition of the active compound do not worsen the properties of the film such as optical characteristic and water vapor permeability, thus leading to the development of a material which could be favorably used mainly, but not exclusively, in the sector of food packaging.

  8. Structure-property relationships in silica-siloxane nanocomposite materials

    SciTech Connect

    Ulibarri, T.A.; Derzon, D.K.; Wang, L.C.

    1997-03-01

    The simultaneous formation of a filler phase and a polymer matrix via in situ sol-gel techniques provides silica-siloxane nanocomposite materials of high strength. This study concentrates on the effects of temperature and relative humidity on a trimodal polymer system in an attempt to accelerate the reaction as well as evaluate subtle process- structure-property relations. It was found that successful process acceleration is only viable for high humidity systems when using the tin(IV) catalyst dibutyltin dilaurate. Processes involving low humidity were found to be very temperature and time dependent. Bimodal systems were investigated and demonstrated that the presence of a short-chain component led to enhanced material strength. This part of the study also revealed a link between the particle size and population density and the optimization of material properties.

  9. Characterization of silica quartz as raw material in photovoltaic applications

    NASA Astrophysics Data System (ADS)

    Boussaa, S. Anas; Kheloufi, A.; Zaourar, N. Boutarek; Kefaifi, A.; Kerkar, F.

    2016-07-01

    Raw materials are essential for the functioning of modern societies, and access to these raw materials is vital to the world economy. Sustainable development, both globally level, raises important new challenges associated with access and efficient use of raw materials. High purity quartz, is consider as a critical raw material and it is a rare commodity that only forms under geological conditions where a narrow set of chemical and physical parameters is fulfilled. When identified and following special beneficiation techniques, high purity quartz obtains very attractive prices and is applied in high technology sectors that currently are under rapid expansion such as photovoltaic solar cells, silicon metal - oxide wafers in the semiconductor industry and long distance optical fibers that are used in communication networks. Crystalline silicon remains the principal material for photovoltaic technology. Metallurgical silicon is produced industrially by the reduction of silica with carbon in an electric arc furnace at temperatures higher than 2000 °C in the hottest parts, by a reaction that can be written ideally as: SiO2 + 2C = Si + 2CO. The aim of this study has been to test experimental methods for investigating the various physical and chemical proprieties of Hoggar quartz with different techniques: X Ray Fluorescence, infra-red spectroscopy, Scanning Electron Microscopy, Optic Microscopy, Carbon Analyzer and Vickers Hardness. The results show finally that the quartz has got good result in purity but need enrichment for the photovoltaic application.

  10. Chemical Processing and Characterization of Fiber Reinforced Nanocomposite Silica Materials

    NASA Astrophysics Data System (ADS)

    Burnett, Steven Shannon

    Ultrasound techniques, acoustic and electroacoustic spectroscopy, are used to investigate and characterize concentrated fluid phase nanocomposites. In particular, the data obtained from ultrasound methods are used as tools to improve the understanding of the fundamental process chemistry of concentrated, multicomponent, nanomaterial dispersions. Silicon nitride nanofibers embedded in silica are particularly interesting for lightweight nanocomposites, because silicon nitride is isostructural to carbon nitride, a super hard material. However, the major challenge with processing these composites is retarding particle-particle aggregation, to maintain highly dispersed systems. Therefore, a systematic approach was developed to evaluate the affect of process parameters on particle-particle aggregation, and improving the chemical kinetics for gelation. From the acoustic analysis of the nanofibers, this thesis was able to deduce that changes in aspect ratio affects the ultrasound propagation. In particular, higher aspect ratio fibers attenuate the ultrasound wave greater than lower aspect fibers of the same material. Furthermore, our results confirm that changes in attenuation depend on the hydrodynamical interactions between particles, the aspect ratio, and the morphology of the dispersant. The results indicate that the attenuation is greater for fumed silica due to its elastic nature and its size, when compared to silica Ludox. Namely, the larger the size, the greater the attenuation. This attenuation is mostly the result of scattering loss in the higher frequency range. In addition, the silica nanofibers exhibit greater attenuation than their nanoparticle counterparts because of their aspect ratio influences their interaction with the ultrasound wave. In addition, this study observed how 3M NH 4 Cl's acoustic properties changes during the gelation process, and during that change, the frequency dependency deviates from the expected squared of the frequency, until the

  11. Mesoporous silica material TUD-1 as a drug delivery system.

    PubMed

    Heikkilä, T; Salonen, J; Tuura, J; Hamdy, M S; Mul, G; Kumar, N; Salmi, T; Murzin, D Yu; Laitinen, L; Kaukonen, A M; Hirvonen, J; Lehto, V-P

    2007-02-22

    For the first time the feasibility of siliceous mesoporous material TUD-1 (Technische Universiteit Delft) for drug delivery was studied. Model drug, ibuprofen, was adsorbed into TUD-1 mesopores via a soaking procedure. Characterizations with nitrogen adsorption, XRD, TG, HPLC and DSC demonstrated the successful inclusion of ibuprofen into TUD-1 host. The amount of ibuprofen adsorbed into the nanoreservoir of TUD-1 material was higher than reported for other mesoporous silica drug carriers (drug/carrier 49.5 wt.%). Drug release studies in vitro (HBSS buffer pH 5.5) demonstrated a fast and unrestricted liberation of ibuprofen, with 96% released at 210 min of the dissolution assay. The drug dissolution profile of TUD-1 material with the random, foam-like three-dimensional mesopore network and high accessibility to the dissolution medium was found to be much faster (kinetic constant k = 10.7) and more diffusion based (release constant n = 0.64) compared to a mesoporous MCM-41 material with smaller, unidirectional mesopore channels (k = 4.7, n = 0.71). Also, the mesoporous carriers were found to significantly increase the dissolution rate of ibuprofen, when compared to the pure crystalline form of the drug (k = 0.6, n = 0.96). TUD-1 was constituted as a potential drug delivery device with fast release property, with prospective applications in the formulation of poorly soluble drug compounds. PMID:17046183

  12. Silica scintillating materials prepared by sol-gel methods

    SciTech Connect

    Werst, D.W.; Sauer, M.C. Jr.; Cromack, K.R.; Lin, Y.; Tartakovsky, E.A.; Trifunac, A.D.

    1993-12-31

    Silica was investigated as a rad-hard alternative to organic polymer hosts for organic scintillators. Silica sol-gels were prepared by hydrolysis of tetramethoxysilane in alcohol solutions. organic dyes were incorporated into the gels by dissolving in methanol at the sol stage of gel formation. The silica sol-gel matrix is very rad-hard. The radiation stability of silica scintillators prepared by this method is dye-limited. Transient radioluminescence was measured following excitation with 30 ps pulses of 20 MeV electrons.

  13. Metal binding components in human amniotic fluid

    SciTech Connect

    Paterson, P.G.; Zlotkin, S.H.; Sarkar, B. )

    1990-02-26

    Amniotic fluid is a potential source of both nutritionally essential and toxic metals for the fetus. As the binding pattern of these metals in amniotic fluid may be one of the determining factors in their availability to the fetus, the objective of this study was to investigate metal binding in vitro. The binding of six trace metals, Mn(II), Ni(II), Zn(II), Cu(II), Cd(II), and Fe(III), to components of human amniotic fluid was studied by Sephadex G-100 gel filtration at physiological pH, using radioisotopes as tracers and 50 mM TRIS/HCl as the elution buffer. The amniotic fluid was collected at 16-16.5 weeks gestation by amniocentesis and pooled for analysis. Extensive amounts of Fe, Cu, Zn, and Cd and small amounts of Mn and Ni were bound to high molecular weight proteins with elution patterns similar to those seen for the binding of these metals in serum. In addition, large amounts of Fe, Mn, Ni and Cd and small amounts of Zn and Cu were associated with low molecular weight component(s). The identity of these latter components is unknown, but they play an important biological role in amniotic fluid.

  14. Polyanionic and polyzwitterionic azobenzene ionic liquid-functionalized silica materials and their chromatographic applications.

    PubMed

    Qiu, Hongdeng; Jiang, Shengxiang; Takafuji, Makoto; Ihara, Hirotaka

    2013-03-25

    New polyanionic and polyzwitterionic azobenzene ionic liquid-functionalized silica materials were designed based on the preparation of a new polymerizable azobenzene anionic monomer and either its cation-exchange with alkylimidazolium after grafting or the formation of an ionic liquid monomer pair before grafting onto silica. PMID:23417018

  15. Synthesis of mesoporous silica materials from municipal solid waste incinerator bottom ash

    SciTech Connect

    Liu, Zhen-Shu Li, Wen-Kai; Huang, Chun-Yi

    2014-05-01

    Highlights: • The optimal alkaline agent for the extraction of silica from bottom ash was Na{sub 2}CO{sub 3}. • The pore sizes for the mesoporous silica synthesized from bottom ash were 2–3.8 nm. • The synthesized materials exhibited a hexagonal pore structure with a smaller order. • The materials have potential for the removal of heavy metals from aqueous solutions. - Abstract: Incinerator bottom ash contains a large amount of silica and can hence be used as a silica source for the synthesis of mesoporous silica materials. In this study, the conditions for alkaline fusion to extract silica from incinerator bottom ash were investigated, and the resulting supernatant solution was used as the silica source for synthesizing mesoporous silica materials. The physical and chemical characteristics of the mesoporous silica materials were analyzed using BET, XRD, FTIR, SEM, and solid-state NMR. The results indicated that the BET surface area and pore size distribution of the synthesized silica materials were 992 m{sup 2}/g and 2–3.8 nm, respectively. The XRD patterns showed that the synthesized materials exhibited a hexagonal pore structure with a smaller order. The NMR spectra of the synthesized materials exhibited three peaks, corresponding to Q{sup 2} [Si(OSi){sub 2}(OH){sub 2}], Q{sup 3} [Si(OSi){sub 3}(OH)], and Q{sup 4} [Si(OSi){sub 4}]. The FTIR spectra confirmed the existence of a surface hydroxyl group and the occurrence of symmetric Si–O stretching. Thus, mesoporous silica was successfully synthesized from incinerator bottom ash. Finally, the effectiveness of the synthesized silica in removing heavy metals (Pb{sup 2+}, Cu{sup 2+}, Cd{sup 2+}, and Cr{sup 2+}) from aqueous solutions was also determined. The results showed that the silica materials synthesized from incinerator bottom ash have potential for use as an adsorbent for the removal of heavy metals from aqueous solutions.

  16. Slow dynamics of supercooled water confined in nanoporous silica materials

    NASA Astrophysics Data System (ADS)

    Liu, L.; Faraone, A.; Mou, C.-Y.; Yen, C.-W.; Chen, S.-H.

    2004-11-01

    We review our incoherent quasielastic neutron scattering (QENS) studies of the dynamics of supercooled water confined in nanoporous silica materials. QENS data were analysed by using the relaxing cage model (RCM) previously developed by us. We first use molecular dynamics (MD) simulation of the extended simple point charge model (SPC/E) for bulk supercooled water to establish the validity of the RCM, which applies to both the translational and rotational motion of water molecules. We then assume that the dynamics of water molecules in the vicinity of a hydrophilic surface is similar to a bulk water at an equivalent lower supercooled temperature. This analogy was experimentally demonstrated in previous investigations of water in Vycor glasses and near hydrophilic protein surfaces. Studies were made of supercooled water in MCM-41-S (pore sizes 25, 18, and 14 Å) and MCM-48-S (pore size 22 Å) using three QENS spectrometers of respective energy resolutions 1, 30, and 60 µeV, covering the temperature range from 325 to 200 K. Five quantities are extracted from the analysis: they are β, the stretch exponent characterizing the α-relaxation βγ, the exponent determining the power-law dependence of the relaxation time on Q; \\langle \\tau_{0} \\rangle , the Q-independent pre-factor for the average translational relaxation time; \\langle \\tau _{{\\mathrm {R}}_{1}} \\rangle , the relaxation time for the first-order rotational correlation function; and \\langle \\tau _{{\\mathrm {R}}_{2}} \\rangle , the relaxation time for the second-order rotational correlation function. We discuss the temperature dependence of these parameters and note that, in particular, the dynamics is rapidly slowing down at temperature around 220 K, signalling the onset of a structural arrest transition of liquid water into an amorphous solid water.

  17. Effect of Cristobalite on the Mechanical Properties of Silica RSI Materials

    NASA Technical Reports Server (NTRS)

    Khandelwal, P. K.; Scott, W. D.

    1973-01-01

    The strength of various silica surface insulation materials was measured after high temperature heat treatment to develop substantial crystalline phases, and after low temperature thermal cycling through the alpha-beta cristobalite transformation. It appears that the presence of cristobalite in the structural elements (the fibers) is highly detrimental to tensile strength. When crystallization does not occur in silica material, the strength improves with heat treatment.

  18. Study of silica sol-gel materials for sensor development

    NASA Astrophysics Data System (ADS)

    Lei, Qiong

    Silica sol-gel is a transparent, highly porous silicon oxide glass made at room temperature by sol-gel process. The name of silica sol-gel comes from the observable physical phase transition from liquid sol to solid gel during its preparation. Silica sol-gel is chemically inert, thermally stable, and photostable, it can be fabricated into different desired shapes during or after gelation, and its porous structure allows encapsulation of guest molecules either before or after gelation while still retaining their functions and sensitivities to surrounding environments. All those distinctive features make silica sol-gel ideal for sensor development. Study of guest-host interactions in silica sol-gel is important for silica-based sensor development, because it helps to tailor local environments inside sol-gel matrix so that higher guest loading, longer shelf-life, higher sensitivity and faster response of silica gel based sensors could be achieved. We focused on pore surface modification of two different types of silica sol-gel by post-grafting method, and construction of stable silica hydrogel-like thin films for sensor development. By monitoring the mobility and photostability of rhodamine 6G (R6G) molecules in silica alcogel thin films through single molecule spectroscopy (SMS), the guest-host interactions altered by post-synthesis grafting were examined. While physical confinement remains the major factor that controls mobility in modified alcogels, both R6G mobility and photostability register discernable changes after surface charges are respectively reversed and neutralized by aminopropyltriethoxysilane (APTS) and methyltriethoxysilane (MTES) grafting. The change in R6G photostability was found to be more sensitive to surface grafting than that of mobility. In addition, silica film modification by 0.4% APTS is as efficient as that by pure MTES in lowering R6G photostability, which suggests that surface charge reversal is more effective than charge neutralization

  19. Impact of pore characteristics of silica materials on loading capacity and release behavior of ibuprofen.

    PubMed

    Numpilai, Thanapha; Muenmee, Suthaporn; Witoon, Thongthai

    2016-02-01

    Impact of pore characteristics of porous silica supports on loading capacity and release behavior of ibuprofen was investigated. The porous silica materials and ibuprofen-loaded porous silica materials were thoroughly characterized by N2-sorption, thermal gravimetric and derivative weight analyses (TG-DTW), X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FT-IR), scanning electron microscope (SEM), transmission electron microscope (TEM) to determine the physical properties of materials, amount of ibuprofen adsorbed and position of ibuprofen. The detailed characterization reveals that the ibuprofen molecules adsorbed inside the mesopores. Increasing the mesopore size from 5nm to 10nm increased the ibuprofen loading from 0.74 to 0.85mmol/g, respectively. Incorporation of macropore into the structure of porous silica materials enhanced the ibuprofen loading capacity of 11.8-20.3%. The ibuprofen-loaded bimodal meso-macroporous silica materials exhibited the highest dissolution of 92wt.% within an hour. The ibuprofen particles deposited on the external surface of the porous silica materials showed a lower dissolution rate than the ibuprofen adsorbed inside the mesopores due to the formation of ibuprofen crystalline. PMID:26652347

  20. Bio-templated synthesis of highly ordered macro-mesoporous silica material for sustained drug delivery

    NASA Astrophysics Data System (ADS)

    Qu, Fengyu; Lin, Huiming; Wu, Xiang; Li, Xiaofeng; Qiu, Shilun; Zhu, Guangshan

    2010-05-01

    The bimodal porous structured silica materials consisting of macropores with the diameter of 5-20 μm and framework-like mesopores with the diameter of 4.7-6.0 nm were prepared using natural Manchurian ash and mango linin as macropored hard templates and P123 as mesopore soft templates, respectively. The macroporous structures of Manchurian ash and mango linin were replicated with the walls containing highly ordered mesoporous silica as well. As-synthesized dual porous silica was characterized by scanning electron microscope (SEM), powder X-ray diffraction (XRD), transmission electron microscope (TEM) and nitrogen adsorption/desorption, fourier transform IR (FTIR) spectroscopy, and thermo-gravimetric analyzer (TGA). Ibuprofen (Ibu) was employed as a model drug and the release profiles showed that the dual porous material had a sustained drug delivery capability. And such highly ordered dual pore silica materials may have potential applications for bimolecular adsorption/separation and tissue repairing.

  1. Hierarchical mesoporous silica nanoparticles as superb light scattering materials.

    PubMed

    Ryu, Jaehoon; Yun, Juyoung; Lee, Jungsup; Lee, Kisu; Jang, Jyongsik

    2016-02-01

    A novel approach to enhance the light scattering effect was explored by applying hierarchical silica nanoparticles in DSSCs as scattering layers. The WSN-incorporated cells showed a PCE value of 9.53% and a PCE enhancement of 30.19% compared with those of the reference cells. PMID:26699659

  2. Metal-binding proteins as metal pollution indicators

    SciTech Connect

    Hennig, H.F.

    1986-03-01

    The fact that metal-binding proteins are a consequence of elevated metal concentration in organisms is well known. What has been overlooked is that the presence of these proteins provides a unique opportunity to reformulate the criteria of metal pollution. The detoxification effect of metal-binding proteins in animals from polluted areas has been cited, but there have been only very few studies relating metal-binding proteins to pollution. This lack is due partly to the design of most experiments, which were aimed at isolation of metal-binding proteins and hence were of too short duration to allow for correlation to adverse physiological effects on the organism. In this study metal-binding proteins were isolated and characterized from five different marine animals (rock lobster, Jasus lalandii; hermit crab, Diogenes brevirostris; sandshrimp, Palaemon pacificus; black mussel, Choromytilus meridionalis; and limpet, Patella granularis). These animals were kept under identical metal-enriched conditions, hence eliminating differences in method and seasons. The study animals belonged to different phyla; varied in size, mass, age, behavior, food requirements and life stages; and accumulated metals at different rates. It is possible to link unseasonal moulting in crustacea, a known physiological effect due to a metal-enriched environment, to the production of the metal-binding protein without evidence of obvious metal body burden. Thus a new concept of pollution is defined: the presence of metal-binding proteins confirms toxic metal pollution. This concept was then tested under field conditions in the whelk Bullia digitalis and in metal-enriched grass.

  3. Corundum ceramic materials modified with silica nanopowders: structure and mechanical properties

    NASA Astrophysics Data System (ADS)

    Kostytsyn, M. A.; Muratov, D. S.; Lysov, D. V.; Chuprunov, K. O.; Yudin, A. G.; Leybo, D. V.

    2016-01-01

    Filtering elements are often used in the metallurgy of rare earth metals. Corundum ceramic is one of the most suitable materials for this purpose. The process of formation and the properties of nanomodified ceramic materials, which are proposed as filtering materials with tunable effective porosity, are described. A silica nanopowder is used as a porosity-increasing agent. Vortex layer apparatus is used for mixing of precursor materials. The obtained results show that nanomodification with the vortex layer apparatus using 0.04 wt. % silica nanopowder as a modifying agent leads to an increase in the compression strength of corundum ceramic by the factor of 1.5.

  4. Metal binding stoichiometry and isotherm choice in biosorption

    SciTech Connect

    Schiewer, S.; Wong, M.H.

    1999-11-01

    Seaweeds that possess a high metal binding capacity may be used as biosorbents for the removal of toxic heavy metals from wastewater. The binding of Cu and Ni by three brown algae (Sargassum, Colpomenia, Petalonia) and one green alga (Ulva) was investigated at pH 4.0 and pH 3.0. The greater binding strength of Cu is reflected in a binding constant that is about 10 times as high as that of Ni. The extent of metal binding followed the order Petalonia {approximately} Sargassum > Colpomenia > Ulva. This was caused by a decreasing number of binding sites and by much lower metal binding constants for Ulva as compared to the brown algae. Three different stoichiometric assumptions are compared for describing the metal binding, which assume either that each metal ion M binds to one binding site B forming a BM complex or that a divalent metal ion M binds to two monovalent sites B forming BM{sub 0.5} or B{sub 2}M complexes, respectively. Stoichiometry plots are proposed as tools to discern the relevant binding stoichiometry. The pH effect in metal binding and the change in proton binding were well predicted for the B{sub 2}M or BM{sub 0.5} stoichiometries with the former being better for Cu and the latter preferable for Ni. Overall, the BM{sub 0.5} model is recommended because it avoids iterations.

  5. The dynamic association processes leading from a silica precursor to a mesoporous SBA-15 material.

    PubMed

    Alfredsson, Viveka; Wennerström, Håkan

    2015-07-21

    During the last two decades, the synthesis of silica with an ordered mesoporous structure has been thoroughly explored. The basis of the synthesis is to let silica monomers polymerize in the presence of an amphiphilic template component. In the first studies, cationic surfactants were used as structure inducer. Later it was shown that pluronic copolymers also could have the role. One advantage with the pluronics copolymers is that they allow for a wider variation in the radius of pores in the resulting silica material. Another advantage lies in the higher stability resulting from the thicker walls between the pores. Mesoporous silica has a very high area to volume ratio, and the ordered structure ensures surface homogeneity. There are a number of applications of this type of material. It can be used as support for catalysts, as templates to produces other mesoporous inorganic materials, or in controlled release applications. The synthesis of mesoporous silica is, from a practical point of view, simple, but there are significant possibilities to vary synthesis conditions with a concomitant effect on the properties of the resulting material. It is clear that the structural properties on the nanometer scale are determined by the self-assembly properties of the amphiphile, and this knowledge has been used to optimize pore geometry and pore size. To have a practical functional material it is desirable to also control the structure on a micrometer scale and larger. In practice, one has largely taken an empirical approach in optimizing reaction conditions, paying less attention to underlying chemical and physicochemical mechanisms that lead from starting conditions to the final product. In this Account, we present our systematic studies of the processes involved not only in the formation of the mesoporous structure as such, but also of the formation of structures on the micrometer scale. The main point is to show how the ongoing silica polymerization triggers a sequence

  6. Effect of amino-modified silica nanoparticles on the corrosion protection properties of epoxy resin-silica hybrid materials.

    PubMed

    Chang, Kung-Chin; Lin, Hui-Fen; Lin, Chang-Yu; Kuo, Tai-Hung; Huang, Hsin-Hua; Hsu, Sheng-Chieh; Yeh, Jui-Ming; Yang, Jen-Chang; Yu, Yuan-Hsiang

    2008-06-01

    In this paper, a series of organic-inorganic hybrid materials consisting of epoxy resin frameworks and dispersed nanoparticles of amino-modified silica (AMS) were successfully prepared. First of all, the AMS nanoparticles were synthesized by carrying out the conventional acid-catalyzed sol-gel reactions of tetraethyl orthosilicate (TEOS) in the presence of (3-aminopropyl)-trimethoxysilane (APTES) molecules. The as-prepared AMS nanoparticles were then characterized by FTIR, 13C-NMR and 29Si-NMR spectroscopy. Subsequently, a series of hybrid materials were prepared by performing in-situ thermal ring-opening polymerization reactions of epoxy resin in the presence of as-prepared AMS nanoparticles and raw silica (RS) particles. The as-prepared epoxy-silica hybrid materials with AMS nanoparticles were found to show better dispersion capability than that of RS particles existed in hybrid materials based on the morphological observation of transmission electron microscopy (TEM). The hybrid materials containing AMS nanoparticles in the form of coating on cold-rolled steel (CRS) were found to be much superior in corrosion protection over those of hybrid materials with RS particles when tested by a series of electrochemical measurements of potentiodynamic and impedance spectroscopy in 5 wt% aqueous NaCI electrolyte. The increase of corrosion protection effect of hybrid coatings may have probably resulted from the enhancement of the adhesion strength of the hybrid coatings on CRS coupons, which may be attributed to the formation of Fe-O-Si covalent bond at the interface of coating/CRS system based on the FTIR-RAS (reflection absorption spectroscopy) studies. The better dispersion capability of AMS nanoparticles in hybrid materials were found to lead more effectively enhanced molecular barrier property, mechanical strength, surface hydrophobicity and optical clarity as compared to that of RS particles, in the form of coating and membrane, based on the measurements of molecular

  7. Optically active silica and polymeric materials for microcavity lasers and sensors

    NASA Astrophysics Data System (ADS)

    Armani, A. M.; Deka, N.; Mehrabani, S.; Shi, C.; Maker, A.; Lee, M.; Kovach, A.; Gungor, E.; Kuo, K.; Diep, V.

    2015-03-01

    Silica and silica-doped high quality factor (Q) optical resonators have demonstrated ultra-low threshold lasers based on numerous mechanisms (eg rare earth dopants, Raman). To date, the key focus has been on maintaining a high Q, as that determines the lasing threshold and linewidth. However, equally important criteria are lasing efficiency and wavelength. These parameters are governed by the material, not the cavity Q. Therefore, to fully address this challenge, it is necessary to develop new materials. We have synthesized a suite of silica and polymeric materials with nanoparticle and rare-earth dopants to enable the development of microcavity lasers with emission from the near-IR to the UV. Additionally, the efficiencies and thresholds of many of these devices surpass the previous work. Specifically, the silica sol-gel lasers are co- and tri-doped with metal nanoparticles (eg Ti, Al) and rare-earth materials (eg Yb, Nb, Tm) and are fabricated using conventional micro/nanofabrication methods. The intercalation of the metal in the silica matrix reduces the clustering of the rare-earth ions and reduces the phonon energy of the glass, improving efficiency and overall device performance. Additionally, the silica Raman gain coefficient is enhanced due to the inclusion of the metal nanoparticles, which results in a lower threshold and a higher efficiency silica Raman laser. Finally, we have synthesized several polymer films doped with metal (eg Au, Ag) nanoparticles and deposited them on the surface of our microcavity devices. By pumping on the plasmonic resonant wavelength of the particle, we are able to achieve plasmonic-enhanced upconversion lasing.

  8. Synthesis and characterization of large specific surface area nanostructured amorphous silica materials.

    PubMed

    Marquez-Linares, Francisco; Roque-Malherbe, Rolando M A

    2006-04-01

    Large specific surface area materials attract wide attention because of their applications in adsorption, catalysis, and nanotechnology. In the present study, we describe the synthesis and characterization of nanostructured amorphous silica materials. These materials were obtained by means of a modification of the Stobe-Fink-Bohn (SFB) method. The morphology and essential features of the synthesized materials have been studied using an automated surface area and pore size analyzer and scanning electron microscopy. The existence of a micro/mesoporous structure in the obtained materials has been established. It was also found that the obtained particle packing materials show large specific surface area up to 1,600 m2/g. (To our best knowledge, there is no any reported amorphous silica material with such a higher specific surface area.) The obtained materials could be useful in the manufacture of adsorbents, catalyst supports, and other nanotechnological applications. PMID:16736774

  9. Synthesis and solid state NMR characterization of novel peptide/silica hybrid materials.

    PubMed

    Werner, Mayke; Heil, Andreas; Rothermel, Niels; Breitzke, Hergen; Groszewicz, Pedro Braga; Thankamony, Aany Sofia; Gutmann, Torsten; Buntkowsky, Gerd

    2015-11-01

    The successful synthesis and solid state NMR characterization of silica-based organic-inorganic hybrid materials is presented. For this, collagen-like peptides are immobilized on carboxylate functionalized mesoporous silica (COOH/SiOx) materials. A pre-activation of the silica material with TSTU (O-(N-Succinimidyl)-N,N,N',N'-tetramethyluronium tetrafluoroborate) is performed to enable a covalent binding of the peptides to the linker. The success of the covalent immobilization is indicated by the decrease of the (13)C CP-MAS NMR signal of the TSTU moiety. A qualitative distinction between covalently bound and adsorbed peptide is feasible by (15)N CP-MAS Dynamic Nuclear Polarization (DNP). The low-field shift of the (15)N signal of the peptide's N-terminus clearly identifies it as the binding site. The DNP enhancement allows the probing of natural abundance (15)N nuclei, rendering expensive labeling of peptides unnecessary. PMID:26411982

  10. NiO-silica based nanostructured materials obtained by microemulsion assisted sol-gel procedure

    SciTech Connect

    Mihaly, M.; Comanescu, A.F.; Rogozea, A.E.; Vasile, E.; Meghea, A.

    2011-10-15

    Graphical abstract: TEM micrograph of NiO/SiO{sub 2} nanoparticles. Highlights: {yields} Microemulsion assisted sol-gel procedure for NiO silica nanomaterials synthesis. {yields} Controlling the size and shape of nanoparticles and avoiding their aggregation. {yields} Narrow band-gap semiconductors (energies <3 eV) absorbing VIS or near-UV light biologically and chemically inert semiconductors entrapping/coating in silica network. {yields} Low cost as the microemulsion is firstly used in water metallic cation extraction. -- Abstract: NiO-silica based materials have been synthesized by microemulsion assisted sol-gel procedure. The versatility of these soft nanotechnology techniques has been exploited in order to obtain different types of nanostructures, such as NiO nanoparticles, NiO silica coated nanoparticles and NiO embedded in silica matrix. These materials have been characterized by adequate structural and morphology techniques: DLS, HR-TEM/SAED, BET, AFM. Optical and semiconducting properties (band-gap values) of the synthesized materials have been quantified by means of VIS-NIR diffuse reflectance spectra, thus demonstrating their applicative potential in various electron transfer phenomena such as photocatalysis, electrochromic thin films, solid oxide fuel cells.

  11. Some thermal and optical properties of a new transparent silica xerogel material with low density

    NASA Astrophysics Data System (ADS)

    Einarsrud, Mari-Ann; Farbrodt, Lucie E.; Haereid, Siv; Wittwer, Volker

    1992-11-01

    Monolithic silica aerogel is a transparent material with very low thermal conductivity. These properties make the material interesting for use as insulation in, for example, windows, solar collectors, and solar walls. To produce silica aerogel it is necessary to circumvent the high capillary forces working when the solvent is being removed from the gel structure during drying. Supercritical drying has successfully achieved this. However, supercritical drying with an alcohol might be a dangerous and expensive way to produce the aerogel material. In this work we have studied a new type of monolithic silica xerogels made without supercritical drying. The xerogels are produced by strengthening the gel structure before drying, and low densities in the range 0.42 - 0.73 g/cm3 have been obtained. Properties of this new type of silica xerogels have been compared to the properties of silica aerogel made by supercritical drying. Density, pore size, surface area, thermal conductivity, and optical transmittance are reported in this work and some application advantages are discussed.

  12. Development of construction materials using nano-silica and aggregates recycled from construction and demolition waste.

    PubMed

    Mukharjee, Bibhuti Bhusan; Barai, Sudhirkumar V

    2015-06-01

    The present work addresses the development of novel construction materials utilising commercial grade nano-silica and recycled aggregates retrieved from construction and demolition waste. For this, experimental work has been carried out to examine the influence of nano-silica and recycled aggregates on compressive strength, modulus of elasticity, water absorption, density and volume of voids of concrete. Fully natural and recycled aggregate concrete mixes are designed by replacing cement with three levels (0.75%, 1.5% and 3%) of nano-silica. The results of the present investigation depict that improvement in early days compressive strength is achieved with the incorporation of nano-silica in addition to the restoration of reduction in compressive strength of recycled aggregate concrete mixes caused owing to the replacement of natural aggregates by recycled aggregates. Moreover, the increase in water absorption and volume of voids with a reduction of bulk density was detected with the incorporation of recycled aggregates in place of natural aggregates. However, enhancement in density and reduction in water absorption and volume of voids of recycled aggregate concrete resulted from the addition of nano-silica. In addition, the results of the study reveal that nano-silica has no significant effect on elastic modulus of concrete. PMID:25986048

  13. Mixed surfactants-directed the mesoporous silica materials with various morphologies and structures

    SciTech Connect

    Lin Huiming; Qu Fengyu; Wu Xiang; Xue Ming; Zhu Guangshan; Qiu Shilun

    2011-06-15

    A new mixed surfactants system using alkyl carboxylic acids and quaternized poly[bis(2-chloroethyl)ether-alt-1,3-bis[3-(dimethylamino)propyl] urea] (PEPU) as the co-template was used to synthesize mesoporous silica materials with various morphologies and structures, including flakes, regular spheres, nanoparticles, and tube-spheres. The cationic polymer connected the anionic surfactant micelle to the anionic polysilicate species to induce the synthesis of the mesoporous silica materials. The structure and property of the surfactant and the cationic polymer determined the formation of mesoporous silica, and also had a signification influence on the morphology and structure of the final materials. To further explore the possible formation mechanism of these mesoporous materials, zeta potential was utilized to evaluate the interaction between the anionic surfactant and the cationic co-template. In addition, the structure, morphology, and porosity of these materials were characterized by powder X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), and N{sub 2} adsorption-desorption measurements. - Graphical abstract: A new mixed surfactants system using alkyl carboxylic acids and PEPU as the co-template was used to synthesize mesoporous silica materials with various morphologies and structures. Highlights: {yields}A new mixed surfactants system induced the mesoporous silica materials with various morphologies and structure. > It is a development of the type S{sup -}N{sup +}I{sup -} route of the mesoporous formation. > Zeta potential was utilized to evaluate the interaction between the anionic surfactant and the cationic co-template. > The property and amount of surfactant and polymer determined the formation of the mesoporous materials.

  14. Effect of electrolytes on proteins physisorption on ordered mesoporous silica materials.

    PubMed

    Salis, Andrea; Medda, Luca; Cugia, Francesca; Monduzzi, Maura

    2016-01-01

    This short review highlights the effect of electrolytes on the performance of proteins-mesoporous silica conjugates which can open interesting perspectives in biotechnological fields, particularly nanomedicine and biocatalysis. Indeed therapeutic proteins and peptides represent a challenging innovation for several kinds of diseases, but since their self-life in biological fluids is very short, they need a stealth protective carrier. Similarly, enzymes need a solid support to improve thermal stability and to allow for recycling. Ordered mesoporous silica materials represent a valid choice as widely demonstrated. Both proteins and silica mesoporous materials possess charged surfaces, and here, the crucial role of pH, buffer, ionic strength and electrolyte type is posed in relation with loading/release of proteins onto/from the silica support through the analysis of adsorption and release processes. A delicate interplay of electrostatic and van der Waals interactions arises from considering electrolytes' effects on the two different charged surfaces. Clear outcomes concern the effect of pH and ionic strength. Protein loading onto the silica matrix is favored by an adsorbing solution having a pH close to the protein pI, and by a high ionic strength that reduces the Debye length. Release is instead favored by an adsorbing solution characterized by an intermediate ionic strength, close to the physiological values. Significant specific ions effects are shown to affect both proteins and silica matrices, as well as protein adsorption onto silica matrices. Further work is needed to quantify specific ion effects on the preservation of the biological activity, and on the release performance. PMID:26009265

  15. Use of ground clay brick as a pozzolanic material to reduce the alkali-silica reaction

    SciTech Connect

    Turanli, L.; Bektas, F.; Monteiro, P.J.M

    2003-10-01

    The objective of this experimental study was to use ground clay brick (GCB) as a pozzolanic material to minimize the alkali-silica reaction expansion. Two different types of clay bricks were finely ground and their activity indices were determined. ASTM accelerated mortar bar tests were performed to investigate the effect of GCB when used to replace cement mass. The microstructure of the mortar was investigated using scanning electron microscopy (SEM). The results showed that the GCBs meet the strength activity requirements of ASTM. In addition, the GCBs were found to be effective in suppressing the alkali-silica reaction expansion. The expansion decreased as the amount of GCBs in the mortar increased.

  16. Molecular Dynamics Study on the Particle Dispersion Mechanism of Polyamide-imide/Silica Nano-composite Materials

    NASA Astrophysics Data System (ADS)

    Kikuchi, Hideyuki; Iwasaki, Tomio; Hanawa, Hidehito; Honda, Yuki

    We studied the particle dispersion mechanism of polyamide-imide/silica nano-composite material by using molecular-dynamics simulation technique based on Newtonian dynamics and quantum mechanics. In simulations, adhesive fracture energies at the interfaces between silica and solvents were calculated, and Brownian motions of silica particles were simulated to clarify dispersion properties. The simulation results showed that the colloidal state of silica was maintained by covering the silica surface with a new low hygroscopicity solvent and that the chemical structure of polymer contributed to the dispersion of silica. It is found that the results obtained from molecular dynamics agree well with those obtained by experiments, and that molecular-dynamics simulation technique will become very useful for the development of nano-composite materials in the future.

  17. Evaluation of the acid properties of porous zirconium-doped and undoped silica materials

    SciTech Connect

    Fuentes-Perujo, D.; Santamaria-Gonzalez, J.; Merida-Robles, J.; Rodriguez-Castellon, E.; Jimenez-Lopez, A.; Maireles-Torres, P. . E-mail: maireles@uma.es; Moreno-Tost, R.

    2006-07-15

    A series of porous silica and Zr-doped silica molecular sieves, belonging to the MCM-41 and MSU families, were prepared and characterized by X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS) and N{sub 2} adsorption at 77 K. Their acid properties have been evaluated by NH{sub 3}-TPD, adsorption of pyridine and deuterated acetonitrile coupled to FT-IR spectroscopy and the catalytic tests of isopropanol decomposition and isomerization of 1-butene. The acidity of purely siliceous solids were, in all cases, very low, while the incorporation of Zr(IV) into the siliceous framework produced an enhancement of the acidity. The adsorption of basic probe molecules and the catalytic behaviour revealed that Zr-doped MSU-type silica was more acidic than the analogous Zr-MCM-41 solid, with a similar Zr content. This high acidity observed in the case of Zr-doped silica samples is due to the presence of surface zirconium atoms with a low coordination, mainly creating Lewis acid sites. - Graphical abstract: The adsorption of basic probe molecules and the catalytic behaviour have revealed that MSU-type materials are more acidic than the analogous MCM-41 solids, mainly after the incorporation of zirconium into the silica framework.

  18. Kraft lignin/silica-AgNPs as a functional material with antibacterial activity.

    PubMed

    Klapiszewski, Łukasz; Rzemieniecki, Tomasz; Krawczyk, Magdalena; Malina, Dagmara; Norman, Małgorzata; Zdarta, Jakub; Majchrzak, Izabela; Dobrowolska, Anna; Czaczyk, Katarzyna; Jesionowski, Teofil

    2015-10-01

    Advanced functional silica/lignin hybrid materials, modified with nanosilver, were obtained. The commercial silica Syloid 244 was used, modified with N-(2-aminoethyl)-3-aminopropyltrimethoxysilane to increase its chemical affinity to lignin. Similarly, kraft lignin was oxidized using a solution of sodium periodate to activate appropriate functional groups on its surface. Silver nanoparticles were grafted onto the resulting silica/lignin hybrids. The systems obtained were comprehensively tested using available techniques and methods, including transmission electron microscopy, Fourier transform infrared spectroscopy, energy-dispersive X-ray spectroscopy, elemental analysis and atomic absorption spectroscopy. An evaluation was also made of the electrokinetic stability of the systems with and without silver nanoparticles. Conclusions were drawn concerning the chemical nature of the bonds between the precursors and the effectiveness of the method of binding nanosilver to the hybrid materials. The antimicrobial activity of the studied materials was tested against five species of Gram-positive and Gram-negative bacteria. The addition of silver nanoparticles to the silica/lignin hybrids led to inhibition of the growth of the analyzed bacteria. The best results were obtained against Pseudomonas aeruginosa, a dangerous human pathogen. PMID:26204502

  19. A silica sol-gel design strategy for nanostructured metallic materials

    NASA Astrophysics Data System (ADS)

    Warren, Scott C.; Perkins, Matthew R.; Adams, Ashley M.; Kamperman, Marleen; Burns, Andrew A.; Arora, Hitesh; Herz, Erik; Suteewong, Teeraporn; Sai, Hiroaki; Li, Zihui; Werner, Jörg; Song, Juho; Werner-Zwanziger, Ulrike; Zwanziger, Josef W.; Grätzel, Michael; Disalvo, Francis J.; Wiesner, Ulrich

    2012-05-01

    Batteries, fuel cells and solar cells, among many other high-current-density devices, could benefit from the precise meso- to macroscopic structure control afforded by the silica sol-gel process. The porous materials made by silica sol-gel chemistry are typically insulators, however, which has restricted their application. Here we present a simple, yet highly versatile silica sol-gel process built around a multifunctional sol-gel precursor that is derived from the following: amino acids, hydroxy acids or peptides; a silicon alkoxide; and a metal acetate. This approach allows a wide range of biological functionalities and metals—including noble metals—to be combined into a library of sol-gel materials with a high degree of control over composition and structure. We demonstrate that the sol-gel process based on these precursors is compatible with block-copolymer self-assembly, colloidal crystal templating and the Stöber process. As a result of the exceptionally high metal content, these materials can be thermally processed to make porous nanocomposites with metallic percolation networks that have an electrical conductivity of over 1,000 S cm-1. This improves the electrical conductivity of porous silica sol-gel nanocomposites by three orders of magnitude over existing approaches, opening applications to high-current-density devices.

  20. Metal binding to porcine pancreatic elastase: calcium or not calcium.

    PubMed

    Weiss, Manfred S; Panjikar, Santosh; Nowak, Elzbieta; Tucker, Paul A

    2002-09-01

    Porcine pancreatic elastase has been crystallized at slightly acidic pH under two similar but slightly different conditions. Diffraction data were collected at a wavelength of 1.5 A to a maximum resolution of 1.7 A. Both difference electron-density maps and anomalous difference electron-density maps suggest that in crystals grown from a sodium sulfate solution PPE binds Na(+) in its metal-binding site. In contrast, PPE binds Ca(2+) in crystals grown from a solution containing sodium citrate and calcium chloride. This observation is in contradiction to most PPE structures reported in the PDB. In addition to the metal-binding site, up to three other binding sites, which appear to be anion-binding sites, could be identified based on the observed anomalous intensity differences. PMID:12198296

  1. Staphylococcal surface display of metal-binding polyhistidyl peptides

    SciTech Connect

    Samuelson, P.; Wernerus, H.; Svedberg, M.; Staahl, S.

    2000-03-01

    Recombinant Staphylococcus xylosus and Staphylococcus carnosus strains were generated with surface-exposed chimeric proteins containing polyhistidyl peptides designed for binding to divalent metal ions. Surface accessibility of the chimeric surface proteins was demonstrated and the chimeric surface proteins were found to be functional in terms of metal binding, since the recombinant staphylococcal cells were shown to have gained Ni{sup 2+}- and Cd{sup 2+}-binding capacity, suggesting that such bacteria could find use in bioremediation of heavy metals. This is, to their knowledge, the first time that recombinant, surface-exposed metal-binding peptides have been expressed on gram-positive bacteria. Potential environmental or biosensor applications for such recombinant staphylococci as biosorbents are discussed.

  2. Pharmacological activity of metal binding agents that alter copper bioavailability

    PubMed Central

    Helsel, Marian E.

    2015-01-01

    Iron, copper and zinc are required nutrients for many organisms but also potent toxins if misappropriated. An overload of any of these metals can be cytotoxic and ultimately lead to organ failure, whereas deficiencies can result in anemia, weakened immune system function, and other medical conditions. Cellular metal imbalances have been implicated in neurodegenerative diseases, cancer and infection. It is therefore critical for living organisms to maintain careful control of both the total levels and subcellular distributions of these metals to maintain healthy function. This perspective explores several strategies envisioned to alter the bioavailability of metal ions by using synthetic metal-binding agents targeted for diseases where misappropriated metal ions are suspected of exacerbating cellular damage. Specifically, we discuss chemical properties that influence the pharmacological outcome of a subset of metal-binding agents known as ionophores, and review several examples that have shown multiple pharmacological activities in metal-related diseases, with a specific focus on copper. PMID:25797044

  3. High-performance light-emitting diodes encapsulated with silica-filled epoxy materials.

    PubMed

    Li, Tian; Zhang, Jie; Wang, Huiping; Hu, Zhongnan; Yu, Yingfeng

    2013-09-25

    Packaging materials have a great impact on the performance and reliability of light-emitting diodes (LEDs). In this study, we have prepared high performance LED devices through encapsulating LEDs by epoxy materials incorporated with filler powders. A set of evaluation methods have also been established to characterize the reliability of LED devices. No delamination or internal cracking between packaging materials and lead frames has been found for the encapsulated high performance LED devices after the package saturation with moisture and subsequent exposure to high-temperature solder reflow and thermal cycling. Four kinds of inorganic silica fillers, namely, quartz, fused silica, cristobalite, and spherical silica, and one kind of organic filler, that is, spherical silicone powder, were incorporated into the epoxy packaging materials to compare their effects on performance of LED devices. The properties of epoxy packaging materials and LED devices were studied by differential scanning calorimetry (DSC), thermogravimetric analyses (TGA), dynamic mechanical analysis (DMA), thermomechanical analyzer (TMA), ultravioletvisible spectrophotometer (UV-vis), scanning acoustic microscopy (SAM), and scanning electron microscopy (SEM). Except the spherical silicone powder filled epoxy materials, all the other filled systems showed lower equilibrium water sorption content and smaller water diffusion coefficient in both water sorption and moisture sorption tests. The coefficient of thermal expansion (CTE) values were also decreased with the addition of fillers, and the systems filled with quartz, fused, and filled with spherical silica gave the best performance, which exhibited the reduced CTE values both below and above Tg. The results of TGA essentially showed no difference between filled and unfilled systems. The glass transition temperature changed little for all the filled systems, except the one incorporated with spherical silicone. The modulus at room temperature

  4. Molecular Simulation Study of the Early Stages of Formation of Bioinspired Mesoporous Silica Materials.

    PubMed

    Centi, Alessia; Jorge, Miguel

    2016-07-19

    The use of bioinspired templates, such as polyamines and polypeptides, could lead to significant improvements in the synthesis conditions under which mesoporous materials are traditionally produced, removing the need for strong pH as well as high temperature or pressure. In this work, we perform atomistic molecular dynamics simulations of 1,12-diaminododecane surfactants, in water and in the presence of silica monomers, to investigate the early stages of synthesis of one of the first examples of bioinspired silica materials. Different surfactant concentrations and pH were considered, clarifying the influence of the charge state of the molecules on the self-assembly process. We show that the amphiphilic amines form stable lamellar structures at equilibrium in the range from intermediate to high pH values. In a later stage, when silica species are added to the system, our results reveal that, in the same range of pH, silicates strongly adsorb around these aggregates at the interface with water. This causes a considerable modification of the curvature of the layer, which suggests a tendency for the system to evolve from a lamellar phase to the formation of vesicle structures. Furthermore, we show that silica monomers are able to penetrate the layer spontaneously when defects are created as a result of surfactants' head-to-head repulsion. These findings are in agreement with experimental observations and support the pillaring mechanism postulated for this class of materials. However, our simulations indicate that the aggregation process is driven by charge matching between surfactant heads and silica monomers rather than by hydrogen bond interactions between neutral species, as had been previously hypothesized. PMID:27340948

  5. Mixed surfactants-directed the mesoporous silica materials with various morphologies and structures

    NASA Astrophysics Data System (ADS)

    Lin, Huiming; Qu, Fengyu; Wu, Xiang; Xue, Ming; Zhu, Guangshan; Qiu, Shilun

    2011-06-01

    A new mixed surfactants system using alkyl carboxylic acids and quaternized poly[bis(2-chloroethyl)ether-alt-1,3-bis[3-(dimethylamino)propyl] urea] (PEPU) as the co-template was used to synthesize mesoporous silica materials with various morphologies and structures, including flakes, regular spheres, nanoparticles, and tube-spheres. The cationic polymer connected the anionic surfactant micelle to the anionic polysilicate species to induce the synthesis of the mesoporous silica materials. The structure and property of the surfactant and the cationic polymer determined the formation of mesoporous silica, and also had a signification influence on the morphology and structure of the final materials. To further explore the possible formation mechanism of these mesoporous materials, zeta potential was utilized to evaluate the interaction between the anionic surfactant and the cationic co-template. In addition, the structure, morphology, and porosity of these materials were characterized by powder X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), and N 2 adsorption-desorption measurements.

  6. Adsorption of Methyl Blue on Mesoporous Materials Using Rice Husk Ash as Silica Source.

    PubMed

    Nguyen, Nhat Thien; Chen, Shiao-shing; Nguyen, Nguyen Cong; Nguyen, Hau Thi; Tsai, Hsiao Hsin; Chang, Chang Tang

    2016-04-01

    It is recognized that recycling and reuse of waste can result in significant savings in materials and energy. In this research, the adsorption of methyl blue (MB) using waste rice husk ash (Rha) and mesoporous silica materials made from Rha (R-MCM) were analyzed. Mesoporous silica materials were synthesized using cetyltrimethyl ammonium bromide (CTAB) as a cationic surfactant and Rha as the silica source. The prepared samples were characterized by Brunnaur-Emmet-Teller (BET) adsorption isotherm analyzer and transmission electron microscope (TEM) analysis. The results showed the surface area of R-MCM materials was 1347 m2g-1 and the pore volume was 0.906 cm3g-1. TEM analysis showed that the mesoporous materials generally exhibited ordered hexagonal arrays of mesopores with a uniform pore size. The effects on adsorption performance under different initial dye concentrations, different pH values and different dosages of adsorbent were also studied. Both Langmuir and Freundlich adsorption models were applied to describe the equilibrium isotherms. The results show that the maximum removal efficiency of MB more than 99%. PMID:27451772

  7. Structured material combined HMO-silica fibers: preparation, optical and mechanical behavior

    NASA Astrophysics Data System (ADS)

    Schuster, K.; Kobelke, J.; Litzkendorf, D.; Schwuchow, A.; Lindner, F.; Kirchhof, J.; Bartelt, H.; Auguste, J.-L.; Humbert, G.; Blondy, J.-M.

    2011-03-01

    We report about preparation technique and characterization of structured fibers composed of HMO core glasses and silica cladding. Two processes as material preparation techniques have been developed based on glasses prepared by melting of SAL (e.g. 70SiO2-20Al2O3-10La2O3) glasses and the reactive powder sintering (REPUSIL) method. The melted glasses have been characterized by dilatometrical methods to find Tg values of 827-875°C and expansion coefficients between 4.3 and 7.0×10-6 K-1. The latter is one order of magnitude higher than the expansion coefficient of pure silica glass. Structured fibers (SAL core, silica cladding) were fabricated following the Rod-in-Tube (RIT) and Granulate-in-Tube (GIT) process. The HMO glasses were chosen due du their high lanthanum content and the expected high nonlinearity, suitable for nonlinear applications (e.g. supercontinuum sources). The partial substitution of lanthanum by other rare earth elements (e.g. Ytterbium) allows the preparation of fibers with extremely high rare earth concentration up to 5 mol% Yb2O3. The concentration of alumina in the HMO glasses as "solubilizer" for lanthanide was adjusted to about 20 mol%. So we overcame the concentration limits of rare earth doping of MCVD (maximum ca. 2 mol% RE2O3). Nevertheless, the investigated HMO glasses show their limits by integration in structured silica based fibers: Optical losses are typically in the dB/m range, best value of this work is about 600 dB/km. The mechanical stability of fibers is influenced by mechanical strain caused by the high thermal expansion of the core material and the lower network bonding stability of the HMO glasses, but partially compensated by the silica cladding.

  8. Shear bond strengths of an indirect composite layering material to a tribochemically silica-coated zirconia framework material.

    PubMed

    Iwasaki, Taro; Komine, Futoshi; Fushiki, Ryosuke; Kubochi, Kei; Shinohara, Mitsuyo; Matsumura, Hideo

    2016-01-01

    This study evaluated shear bond strengths of a layering indirect composite material to a zirconia framework material treated with tribochemical silica coating. Zirconia disks were divided into two groups: ZR-PRE (airborne-particle abrasion) and ZR-PLU (tribochemical silica coating). Indirect composite was bonded to zirconia treated with one of the following primers: Clearfil Ceramic Primer (CCP), Clearfil Mega Bond Primer with Clearfil Porcelain Bond Activator (MGP+Act), ESPE-Sil (SIL), Estenia Opaque Primer, MR. Bond, Super-Bond PZ Primer Liquid A with Liquid B (PZA+PZB), and Super-Bond PZ Primer Liquid B (PZB), or no treatment. Shear bond testing was performed at 0 and 20,000 thermocycles. Post-thermocycling shear bond strengths of ZR-PLU were higher than those of ZR-PRE in CCP, MGP+Act, SIL, PZA+PZB, and PZB groups. Application of silane yielded better durable bond strengths of a layering indirect composite material to a tribochemically silica-coated zirconia framework material. PMID:27252003

  9. Switching behavior of thermochromic copper and silver tetraiodomercurate embedded in silica hybrid materials

    NASA Astrophysics Data System (ADS)

    Raditoiu, Valentin; Radovici, Constantin; Raditoiu, Alina; Nicolae, Cristian Andi; Culita, Daniela Cristina; Fierascu, Radu Claudiu; Amariutei, Viorica; Wagner, Luminita Eugenia

    2013-10-01

    Thermochromic silica hybrids containing copper or silver mercuric iodides and cetyltrimethylammonium bromide (CTAB) were obtained and characterized. The color and switching behavior of the materials was studied in relationship with the structure of the thermochromic composites and silica network modifiers. In order to evidence the presence of the components and possible interactions governing the thermochromic transition, ultraviolet-visible diffuse reflectance spectroscopy (UV-Vis - DR), Fourier transform infrared spectroscopy - attenuated reflection (FTIR-ATR), X-ray diffraction spectroscopy (XRD) and X-ray fluorescence (XRF) analysis were performed. The dynamic behavior was studied by UV-Vis reflectance spectra, FTIR and differential thermal analysis (DTA) analysis. Results confirm that during the embedding of thermochromic compounds in silica hybrid matrices, in the presence of CTAB, some interactions are established between thermochromic compounds and CTAB. These interactions determine the parameters of thermochromic transition in all cases of thermochromic composites. Hysteresis during the repetitive heating-cooling cycles was also observed. Thermal stability of the thermochromic compounds was enhanced after embedding in silica hybrids.

  10. Synthesis and characterization of surface modified SBA-15 silica materials and their application in chromatography.

    PubMed

    Yasmin, Tahira; Müller, Klaus

    2011-09-16

    Hexagonally ordered SBA-15 mesoporous silica spheres with large uniform pore diameters are obtained using the triblock copolymer, Pluronic P123, as template with a cosurfactant cetyltrimethylammonium bromide (CTAB) and the cosolvent ethanol in acidic media. A series of surface modified SBA-15 silica materials is prepared in the present work using mono- and trifunctional alkyl chains of various lengths which improves the hydrothermal and mechanical stability. Several techniques, such as element analysis, nitrogen sorption analysis, small angle X-ray diffraction, scanning electron microscopy (SEM), FTIR, solid-state (29)Si and (13)C NMR spectroscopy are employed to characterize the SBA-15 materials before and after surface modification with the organic components. Nitrogen sorption analysis is performed to calculate specific surface area, pore volume and pore size distribution. By surface modification with organic groups, the mesoporous SBA-15 silica spheres are potential materials for stationary phases in HPLC separation of small aromatic molecules and biomolecules. The HPLC performance of the present SBA-15 samples is therefore tested by means of a suitable test mixture. PMID:21835411

  11. A novel composite material based on antimony(III) oxide and amorphous silica

    SciTech Connect

    Zemnukhova, Ludmila A.; Panasenko, Alexander E.

    2013-05-01

    The composite material nSb₂O₃·mSiO₂·xH₂O was prepared by hydrolysis of SbCl₃ and Na₂SiO₃ in an aqueous medium. It has been shown that the composition of the material is influenced by the ratio of the initial components and the acidity of the reaction medium. The morphology of the material particles and its specific surface area have been determined. The thermal and optic properties were also investigated. - Graphical abstract: Novel composite material containing amorphous silica and crystal antimony(III) oxide has been synthesized by hydrolysis of SbCl₃ and Na₂SiO₃ in an aqueous medium. Highlights: • The composite material nSb₂O₃·mSiO₂·xH₂O was prepared in an aqueous medium. • The composition of the material is controllable by a synthesis conditions. • The morphology of the material and its optic properties have been determined.

  12. Antiradiation compounds XIX: metal-binding abilities of thioureas.

    PubMed

    Foye, W O; Chao, C C

    1984-09-01

    Metal-binding stability constants for a series of N- and N,N'-substituted thioureas with Cu(II), Ni(II), Al(III), and Fe(III) ions were determined by potentiometric titration. The sequence of constants for thiourea, N-methylthiourea, and N,N'-dimethylthiourea indicated steric effects of the methyl groups and that both nitrogen and sulfur were involved in the complexation. The magnitude of the constants was somewhat lower than those of the simple peptides. The mechanism of protection against ionizing radiation by thioureas is probably due to hydrogen-atom transfer rather than binding of metal ions that catalyze cellular oxidations. PMID:6436467

  13. Antiradiation compounds XIX: metal-binding abilities of thioureas

    SciTech Connect

    Foye, W.O.; Chao, C.C.

    1984-09-01

    Metal-binding stability constants for a series of N- and N,N'-substituted thioureas with Cu(II), Ni(II), Al(III), and Fe(III) ions were determined by potentiometric titration. The sequence of constants for thiourea, N-methylthiourea, and N,N'-dimethylthiourea indicated steric effects of the methyl groups and that both nitrogen and sulfur were involved in the complexation. The magnitude of the constants was somewhat lower than those of the simple peptides. The mechanism of protection against ionizing radiation by thioureas is probably due to hydrogen-atom transfer rather than binding of metal ions that catalyze cellular oxidations.

  14. Enantioselectively controlled release of chiral drug (metoprolol) using chiral mesoporous silica materials

    NASA Astrophysics Data System (ADS)

    Guo, Zhen; Du, Yu; Liu, Xianbin; Ng, Siu-Choon; Chen, Yuan; Yang, Yanhui

    2010-04-01

    Chiral porous materials have attracted burgeoning attention on account of their potential applications in many areas, such as enantioseparation, chiral catalysis, chemical sensors and drug delivery. In this report, chiral mesoporous silica (CMS) materials with various pore sizes and structures were prepared using conventional achiral templates (other than chiral surfactant) and a chiral cobalt complex as co-template. The synthesized CMS materials were characterized by x-ray diffraction, nitrogen physisorption, scanning electron microscope and transmission electron microscope. These CMS materials, as carriers, were demonstrated to be able to control the enantioselective release of a representative chiral drug (metoprolol). The release kinetics, as modeled by the power law equation, suggested that the release profiles of metoprolol were remarkably dependent on the pore diameter and pore structure of CMS materials. More importantly, R- and S-enantiomers of metoprolol exhibited different release kinetics on CMS compared to the corresponding achiral mesoporous silica (ACMS), attributable to the existence of local chirality on the pore wall surface of CMS materials. The chirality of CMS materials on a molecular level was further substantiated by vibrational circular dichroism measurements.

  15. Sol-gel derived silica/siloxane composite materials: The effect of loading level and catalyst activity on silica domain formation

    SciTech Connect

    Black, E.P.; Ulibarri, T.A.; Beaucage, G.; Schaefer, D.W.; Assink, R.A.; Bergstrom, D.F.; Giwa-Agbomeirele, P.A.; Burns, G.T.

    1993-11-01

    Currently, the production of in situ reinforcement in polymeric systems by sol-gel methods is undergoing rapid development. However, understanding of synthesis/structure/property relationships is still lacking. In order to produce sol-gel derived composite materials with sufficient mechanical properties for commercial applications, this deficit of information must be addressed. We have completed a detailed investigation of in situ silica growth in polydimethylsiloxane (PDMS)/tetraethylorthosilicate (TEOS) systems. Factors which affect the domain growth, such as catalyst activity and silica loading, have been examined by solid state {sup 29}Si NMR, SEM, mechanical testing and small angle neutron scattering.

  16. Effect of silica fume on the characterization of the geopolymer materials

    NASA Astrophysics Data System (ADS)

    Khater, Hisham M.

    2013-12-01

    The influence of silica fume (SF) addition on properties of geopolymer materials produced from alkaline activation of alumino-silicates metakaolin and waste concrete produced from demolition works has been studied through the measurement of compressive strength, Fourier transform infrared spectroscopy, X-ray diffraction, and scanning electron microscopy (SEM) analysis. Alumino-silicate materials are coarse aggregate included waste concrete and fired kaolin (metakaolin) at 800°C for 3 h, both passing a sieve of 90 μm. Mix specimens containing silica fume were prepared at water/binder ratios in a range of 0.30 under water curing. The used activators are an equal mix of sodium hydroxide and silicate in the ratio of 3:3 wt.%. The control geopolymer mix is composed of metakaolin and waste concrete in an equal mix (50:50, wt.%). Waste concrete was partially replaced by silica fume by 1 to 10 wt.%. The results indicated that compressive strengths of geopolymer mixes incorporating SF increased up to 7% substitution and then decreased up to 10% but still higher than that of the control mix. Results indicated that compressive strengths of geopolymer mixes incorporating SF increases up to 7% substitution and then decreases up to 10% but still higher than the control mix, where 7% SF-digested calcium hydroxide (CH) crystals, decreased the orientation of CH crystals, reduced the crystal size of CH gathered at the interface, and improved the interface more effectively.

  17. Silica Polyamine Composites: New Supramolecular Materials for Cation and Anion Recovery and Remediation

    SciTech Connect

    Hughes, Mark; Miranda, Paul; Nielsen, Daniel J.; Rosenberg, Edward; Gobetto, Roberto; Viale, Alessandra; Burton, Sarah D.

    2006-03-01

    The surface coverage of amorphous silica gels used in the synthesis of silica polyamine composites has been investigated by 29Si NMR. By diluting the polyamine anchor silane, chloropropyl trichlorosilane, with methyl trichlorosilane it was found that surface coverage could be markedly improved for a range of amine polymers after grafting to the silica surface. The commensurate decrease in the number of anchor points and increase in the number of free amines results in an increase in metal capacity and/or an improvement in capture kinetics. Solid state CPMAS-13C NMR has been employed to investigate the structure and metal ion binding of a series of these composite materials. It is reported that the highly branched polymer, poly(ethyleneimine) (PEI) exhibits much broader 13C NMR resonances than the linear polymers poly(allylamine) (PAA) and poly(vinylamine) (PVA). These results are understood in terms of the low energy conformations calculated from molecular modeling studies. Three new applications of the technology are also presented: (1) separation of lanthanides as a group from ferric ion and all other divalent ions; (2) a multi step process for recovering and concentrating the valuable metals in acid mine drainage; (3) a process for removing low level arsenic and selenium in the presence of sulfate using immobilized cations on the composite materials.

  18. Preparation of resveratrol-loaded nanoporous silica materials with different structures

    SciTech Connect

    Popova, Margarita; Szegedi, Agnes; Mavrodinova, Vesselina; Novak Tušar, Natasa; Mihály, Judith; Klébert, Szilvia; Benbassat, Niko; Yoncheva, Krassimira

    2014-11-15

    Solid, nanoporous silica-based spherical mesoporous MCM-41 and KIL-2 with interparticle mesoporosity as well as nanosized zeolite BEA materials differing in morphology and pore size distribution, were used as carriers for the preparation of resveratrol-loaded delivery systems. Two preparation methods have been applied: (i) loading by mixing of resveratrol and mesoporous carrier in solid state and (ii) deposition in ethanol solution. The parent and the resveratrol loaded carriers were characterized by XRD, TEM, N2 physisorption, thermal analysis, and FT-IR spectroscopy. The influence of the support structure on the adsorption capacity and the release kinetics of this poorly soluble compound were investigated. Our results indicated that the chosen nanoporous silica supports are suitable for stabilization of trans-resveratrol and reveal controlled release and ability to protect the supported compound against degradation regardless of loading method. The solid-state dry mixing appears very effective for preparation of drug formulations composed of poorly soluble compound. - Graphical abstract: trans-Resveratrol was stabilized in the pores of BEA zeolite, MCM-41and KIL2 mesoporous silicas. - Highlights: • BEA, KIL-2 and MCM-41 materials were used as carriers for resveratrol loading. • Resveratrol encapsulation in ethanol solution and solid state procedure were applied. • The solid-state preparation appears very effective for stabilization of trans-resveratrol.

  19. Rapid synthesis of a versatile organic/inorganic hybrid material based on pyrogenic silica.

    PubMed

    Becuwe, M; Cazier, F; Woisel, P; Landy, D; Delattre, F

    2010-10-01

    An efficient approach has been developed to synthesize a new versatile organo-silica material by non-conventional method (microwave irradiation and ultrasonic vibration) from amorphous pyrogenic silica and has been compared with thermic procedure. The samples were fully characterized by FTIR, solid-state (29)Si and (13)C CP/MAS NMR, thermogravimetric analysis (TGA), elemental analysis, scanning electron microscopy (SEM) and by N(2)-sorption isotherms measurements. The functionalization of silicon dioxide by 4-(chloromethylphenyl) trichlorosilane has been easily achieved by ultrasound irradiation in a very short time with high loading of organic fragments. Significant different sizes of pores were observed according to conventional or non-conventional synthesis procedure. In addition, new structural properties have been created with the emergence of a mesoporosity. PMID:20580377

  20. Preparation of resveratrol-loaded nanoporous silica materials with different structures

    NASA Astrophysics Data System (ADS)

    Popova, Margarita; Szegedi, Agnes; Mavrodinova, Vesselina; Novak Tušar, Natasa; Mihály, Judith; Klébert, Szilvia; Benbassat, Niko; Yoncheva, Krassimira

    2014-11-01

    Solid, nanoporous silica-based spherical mesoporous MCM-41 and KIL-2 with interparticle mesoporosity as well as nanosized zeolite BEA materials differing in morphology and pore size distribution, were used as carriers for the preparation of resveratrol-loaded delivery systems. Two preparation methods have been applied: (i) loading by mixing of resveratrol and mesoporous carrier in solid state and (ii) deposition in ethanol solution. The parent and the resveratrol loaded carriers were characterized by XRD, TEM, N2 physisorption, thermal analysis, and FT-IR spectroscopy. The influence of the support structure on the adsorption capacity and the release kinetics of this poorly soluble compound were investigated. Our results indicated that the chosen nanoporous silica supports are suitable for stabilization of trans-resveratrol and reveal controlled release and ability to protect the supported compound against degradation regardless of loading method. The solid-state dry mixing appears very effective for preparation of drug formulations composed of poorly soluble compound.

  1. Oxidation of a Silica-Containing Material in a Mach 0.3 Burner Rig

    NASA Technical Reports Server (NTRS)

    Nguyen, QuynhGiao N.; Cuy, Michael D.; Gray, Hugh R. (Technical Monitor)

    2002-01-01

    A primarily silica-containing material with traces of organic compounds, as well as aluminum and calcium additions, was exposed to a Mach 0.3 burner rig at atmospheric pressure using jet fuel. The sample was exposed for 5 continuous hours at 1370 C. Post exposure x-ray diffraction analyses indicate formation of cristobalite, quartz, NiO and Spinel (Al(Ni)CR2O4). The rig hardware is composed of a nickel-based superalloy with traces of Fe. These elements are indicated in the energy dispersive spectroscopy (EDS) results. This material was studied as a candidate for high temperature applications under an engine technology program.

  2. Biomimetic synthesis of shaped and chiral silica entities templated by organic objective materials.

    PubMed

    Jin, Ren-Hua; Yao, Dong-Dong; Levi, Rumi Tamoto

    2014-06-10

    Organic molecules with accompanying self-organization have been a great subject in chemistry, material science and nanotechnology in the past two decades. One of the most important roles of organized organic molecules is the capability of templating complexly structured inorganic materials. The focus of this Minireview is on nanostructured silica with divergent morphologies and/or integrated chirality directed by organic templates of self-assembled polyamine/polypeptides/block copolymers, chiral organogels, self-organized chiral amphiphiles and chiral crystalline complexes, etc., by biomimetic silicification and conventional sol-gel reaction. Among them, biosilica (diatoms and sponges)-inspired biomimetic silicifications are particularly highlighted. PMID:24861362

  3. The surface of ordered mesoporous benzene-silica hybrid material: an infrared and ab initio molecular modeling study.

    PubMed

    Onida, Barbara; Borello, Luisa; Busco, Claudia; Ugliengo, Piero; Goto, Yasutomo; Inagaki, Shinji; Garrone, Edoardo

    2005-06-23

    Joint IR and computational results allow a detailed characterization of the surface properties of a mesoporous benzene-silica hybrid material with crystal-like wall structure. After outgassing at 450 degrees C, hydroxyl species mainly consist of noninteracting silanols, with both O-H and Si-O stretching modes at lower frequencies than those of SiOH in silica. Interaction with several probe molecules, followed both by experiment and calculus, shows that the aryl group in the coordination sphere of Si imparts a lesser acidity with respect to the isolated silanol in silica. In contrast, adsorption isotherms indicate that the interaction with acetone is stronger with benzene-silica than with silica: this is interpreted in terms of secondary interactions taking place between the slightly acidic CH in acetone and the electronic cloud in benzene-like rings. This suggests that both the inorganic component and the organic one play a role in dictating the surface behavior. PMID:16852474

  4. Power scaling analysis of fiber lasers and amplifiers based on non-silica materials

    SciTech Connect

    Dawson, J W; Messerly, M J; Heebner, J E; Pax, P H; Sridharan, A K; Bullington, A L; Beach, R J; Siders, C W; Barty, C P; Dubinskii, M

    2010-03-30

    A developed formalism for analyzing the power scaling of diffraction limited fiber lasers and amplifiers is applied to a wider range of materials. Limits considered include thermal rupture, thermal lensing, melting of the core, stimulated Raman scattering, stimulated Brillouin scattering, optical damage, bend induced limits on core diameter and limits to coupling of pump diode light into the fiber. For conventional fiber lasers based upon silica, the single aperture, diffraction limited power limit was found to be 36.6kW. This is a hard upper limit that results from an interaction of the stimulated Raman scattering with thermal lensing. This result is dependent only upon physical constants of the material and is independent of the core diameter or fiber length. Other materials will have different results both in terms of ultimate power out and which of the many limits is the determining factor in the results. Materials considered include silica doped with Tm and Er, YAG and YAG based ceramics and Yb doped phosphate glass. Pros and cons of the various materials and their current state of development will be assessed. In particular the impact of excess background loss on laser efficiency is discussed.

  5. Asymmetric bioreduction of acetophenones by Baker's yeast and its cell-free extract encapsulated in sol-gel silica materials

    NASA Astrophysics Data System (ADS)

    Kato, Katsuya; Nakamura, Hitomi; Nakanishi, Kazuma

    2014-02-01

    Baker's yeast (BY) encapsulated in silica materials was synthesized using a yeast cell suspension and its cell-free extract during a sol-gel reaction of tetramethoxysilane with nitric acid as a catalyst. The synthesized samples were fully characterized using various methods, such as scanning electron microscopy, nitrogen adsorption-desorption, Fourier transform infrared spectroscopy, thermogravimetry, and differential thermal analysis. The BY cells were easily encapsulated inside silica-gel networks, and the ratio of the cells in the silica gel was approximately 75 wt%, which indicated that a large volume of BY was trapped with a small amount of silica. The enzyme activity (asymmetric reduction of prochiral ketones) of BY and its cell-free extract encapsulated in silica gel was investigated in detail. The activities and enantioselectivities of free and encapsulated BY were similar to those of acetophenone and its fluorine derivatives, which indicated that the conformation structure of BY enzymes inside silica-gel networks did not change. In addition, the encapsulated BY exhibited considerably better solvent (methanol) stability and recyclability compared to free BY solution. We expect that the development of BY encapsulated in sol-gel silica materials will significantly impact the industrial-scale advancement of high-efficiency and low-cost biocatalysts for the synthesis of valuable chiral alcohols.

  6. Curcumin-loaded silica-based mesoporous materials: Synthesis, characterization and cytotoxic properties against cancer cells.

    PubMed

    Bollu, Vishnu Sravan; Barui, Ayan Kumar; Mondal, Sujan Kumar; Prashar, Sanjiv; Fajardo, Mariano; Briones, David; Rodríguez-Diéguez, Antonio; Patra, Chitta Ranjan; Gómez-Ruiz, Santiago

    2016-06-01

    Two different silica based (MSU-2 and MCM-41) curcumin loaded mesoporous materials V3 and V6 were synthesized and characterized by several physico-chemical techniques. Release kinetic study revealed the slow and sustained release of curcumin from those materials in blood simulated fluid (pH: 7.4). The materials V3 and V6 were found to be biocompatible in non-cancerous CHO cell line while exhibiting significant cytotoxicity in different cancer cells (human lung carcinoma cells: A549, human breast cancer cells: MCF-7, mouse melanoma cells: B16F10) compared to pristine curcumin indicating the efficacy of the mesoporous silica materials based drug delivery systems (DDSs). The generation of intracellular reactive oxygen species (ROS) and down regulation of anti-apoptotic protein leading to the induction of apoptosis were found to be the plausible mechanisms behind the anti-cancer activity of these DDSs. These results suggest that curcumin-loaded drug delivery system may be successfully employed as an alternative treatment strategy for cancer therapeutics through a nanomedicine approach in near future. PMID:27040234

  7. Hydrogen generation systems and methods utilizing sodium silicide and sodium silica gel materials

    DOEpatents

    Wallace, Andrew P.; Melack, John M.; Lefenfeld, Michael

    2015-08-11

    Systems, devices, and methods combine thermally stable reactant materials and aqueous solutions to generate hydrogen and a non-toxic liquid by-product. The reactant materials can sodium silicide or sodium silica gel. The hydrogen generation devices are used in fuels cells and other industrial applications. One system combines cooling, pumping, water storage, and other devices to sense and control reactions between reactant materials and aqueous solutions to generate hydrogen. Springs and other pressurization mechanisms pressurize and deliver an aqueous solution to the reaction. A check valve and other pressure regulation mechanisms regulate the pressure of the aqueous solution delivered to the reactant fuel material in the reactor based upon characteristics of the pressurization mechanisms and can regulate the pressure of the delivered aqueous solution as a steady decay associated with the pressurization force. The pressure regulation mechanism can also prevent hydrogen gas from deflecting the pressure regulation mechanism.

  8. Spherical β-cyclodextrin-silica hybrid materials for multifunctional chiral stationary phases.

    PubMed

    Wang, Litao; Dong, Shuqing; Han, Feng; Zhao, Yingwei; Zhang, Xia; Zhang, Xiaoli; Qiu, Hongdeng; Zhao, Liang

    2015-02-27

    Spherical β-CD-silica hybrid materials have been prepared successfully by simple one-pot polymerization, which provide a new strategy to construct new type of HPLC chiral stationary phases. Various β-CD, ethane, triazinyl and 3,5-dimethylphenyl functional groups that can provide multiple interactions were introduced into the pore channels and pore wall framework of mesoporous materials, respectively. The materials towards some chiral, acidic, anilines and phenols compounds showed multiple chromatographic separation functions including racemic resolution, anion exchange and achiral separations with a typical feature of normal/reversed phase chromatography. Multi-tasking including racemic resolution and achiral separations for selected compounds were performed simultaneously on a chiral chromatographic column. The multifunctional character of materials arises from the multiple interactions including hydrophobic interaction, π-π interaction, anion exchange, inclusion interaction and hydrogen bonding interaction. PMID:25637012

  9. Hydrogen generation systems utilizing sodium silicide and sodium silica gel materials

    DOEpatents

    Wallace, Andrew P.; Melack, John M.; Lefenfeld, Michael

    2015-07-14

    Systems, devices, and methods combine reactant materials and aqueous solutions to generate hydrogen. The reactant materials can sodium silicide or sodium silica gel. The hydrogen generation devices are used in fuels cells and other industrial applications. One system combines cooling, pumping, water storage, and other devices to sense and control reactions between reactant materials and aqueous solutions to generate hydrogen. Multiple inlets of varied placement geometries deliver aqueous solution to the reaction. The reactant materials and aqueous solution are churned to control the state of the reaction. The aqueous solution can be recycled and returned to the reaction. One system operates over a range of temperatures and pressures and includes a hydrogen separator, a heat removal mechanism, and state of reaction control devices. The systems, devices, and methods of generating hydrogen provide thermally stable solids, near-instant reaction with the aqueous solutions, and a non-toxic liquid by-product.

  10. Optical nonlinearity and structural phase-transition observation of organic dye-doped polymer silica hybrid material.

    PubMed

    Xu, L; Hou, Z; Liu, L; Xu, Z; Wang, W; Li, F; Ye, M

    1999-10-01

    The optical nonlinearity of organic dye-doped poly(methyl methacrylate) (PMMA)-silica-gel hybrid material was investigated by second-harmonic-generation measurement. We found that incorporation of in situ polymerized solgel precursors into the organic dye-doped PMMA significantly improved the nonlinear optical stability of the system. However, improvement of thermal stability occurred only when a sufficient amount of silica gel was incorporated. A structural phase transition from pure polymer to a hybrid system was found near a 10-mol.% silica-gel concentration. The optimum polymer/tetraethoxysilane molar ratio is 2:1 to 1:1. PMID:18079805

  11. A new method for synthesizing fluid inclusions in fused silica capillaries containing organic and inorganic material

    USGS Publications Warehouse

    Chou, I.-Ming; Song, Y.; Burruss, R.C.

    2008-01-01

    Considerable advances in our understanding of physicochemical properties of geological fluids and their roles in many geological processes have been achieved by the use of synthetic fluid inclusions. We have developed a new method to synthesize fluid inclusions containing organic and inorganic material in fused silica capillary tubing. We have used both round (0.3 mm OD and 0.05 or 0.1 mm ID) and square cross-section tubing (0.3 ?? 0.3 mm with 0.05 ?? 0.05 mm or 0.1 ?? 0.1 mm cavities). For microthermometric measurements in a USGS-type heating-cooling stage, sample capsules must be less than 25 mm in length. The square-sectioned capsules have the advantage of providing images without optical distortion. However, the maximum internal pressure (P; about 100 MPa at 22 ??C) and temperature (T; about 500 ??C) maintained by the square-sectioned capsules are less than those held by the round-sectioned capsules (about 300 MPa at room T, and T up to 650 ??C). The fused silica capsules can be applied to a wide range of problems of interest in fluid inclusion and hydrothermal research, such as creating standards for the calibration of thermocouples in heating-cooling stages and frequency shifts in Raman spectrometers. The fused silica capsules can also be used as containers for hydrothermal reactions, especially for organic samples, including individual hydrocarbons, crude oils, and gases, such as cracking of C18H38 between 350 and 400 ??C, isotopic exchanges between C18H38 and D2O and between C19D40 and H2O at similar temperatures. Results of these types of studies provide information on the kinetics of oil cracking and the changes of oil composition under thermal stress. When compared with synthesis of fluid inclusions formed by healing fractures in quartz or other minerals or by overgrowth of quartz at elevated P-T conditions, the new fused-silica method has the following advantages: (1) it is simple; (2) fluid inclusions without the presence of water can be formed; (3

  12. Metal binding proteins, recombinant host cells and methods

    DOEpatents

    Summers, Anne O.; Caguiat, Jonathan J.

    2004-06-15

    The present disclosure provides artificial heavy metal binding proteins termed chelons by the inventors. These chelons bind cadmium and/or mercuric ions with relatively high affinity. Also disclosed are coding sequences, recombinant DNA molecules and recombinant host cells comprising those recombinant DNA molecules for expression of the chelon proteins. In the recombinant host cells or transgenic plants, the chelons can be used to bind heavy metals taken up from contaminated soil, groundwater or irrigation water and to concentrate and sequester those ions. Recombinant enteric bacteria can be used within the gastrointestinal tracts of animals or humans exposed to toxic metal ions such as mercury and/or cadmium, where the chelon recombinantly expressed in chosen in accordance with the ion to be rededicated. Alternatively, the chelons can be immobilized to solid supports to bind and concentrate heavy metals from a contaminated aqueous medium including biological fluids.

  13. Dimensional stability of fused silica, Invar, and several ultralow thermal expansion materials

    NASA Technical Reports Server (NTRS)

    Berthold, J. W., III; Jacobs, S. F.; Norton, M. A.

    1976-01-01

    A method is developed for testing the long-term dimensional stability of an iodine-stabilized He-Ne laser, using a technique whereby thermal expansion coefficients are measured by forming a Fabry-Perot etalon from the sample and monitoring the optical resonant frequencies with tunable sidebands impressed on a laser beam from a frequency-stabilized He-Ne laser. A change of 1 ppm over a 3-yr period on the part of fused silica dimensions and the differential thermal expansion of Invar LR-35 and Super Invar materials are noted. The method is of interest for the metrology of extremely stable structures such as telescopes and optical resonators.

  14. Reflectance Spectra Diversity of Silica-Rich Materials: Sensitivity to Environment and Implications for Detections on Mars

    NASA Technical Reports Server (NTRS)

    Rice, M. S.; Cloutis, E. A.; Bell, J. F., III; Bish, D. L.; Horgan, B. H.; Mertzman, S. A.; Craig, M. A.; Renault, R. W.; Gautason, B.; Mountain, B.

    2013-01-01

    Hydrated silica-rich materials have recently been discovered on the surface of Mars by the Mars Exploration Rover (MER) Spirit, the Mars Reconnaissance Orbiter (MRO) Compact Reconnaissance Imaging Spectrometer for Mars (CRISM), and the Mars Express Observatoire pour la Mineralogie, l'Eau, les Glaces, et l'Activite'(OMEGA) in several locations. Having been interpreted as hydrothermal deposits and aqueous alteration products, these materials have important implications for the history of water on the martian surface. Spectral detections of these materials in visible to near infrared (Vis NIR) wavelengths have been based on a H2O absorption feature in the 934-1009 nm region seen with Spirit s Pancam instrument, and on SiOH absorption features in the 2.21-2.26 micron range seen with CRISM. Our work aims to determine how the spectral reflectance properties of silica-rich materials in Vis NIR wavelengths vary as a function of environmental conditions and formation. Here we present laboratory reflectance spectra of a diverse suite of silica-rich materials (chert, opal, quartz, natural sinters and synthetic silica) under a range of grain sizes and temperature, pressure, and humidity conditions. We find that the H2O content and form of H2O/OH present in silica-rich materials can have significant effects on their Vis NIR spectra. Our main findings are that the position of the approx.1.4 microns OH feature and the symmetry of the approx.1.9 microns feature can be used to discern between various forms of silica-rich materials, and that the ratio of the approx.2.2 microns (SiOH) and approx.1.9 microns (H2O) band depths can aid in distinguishing between silica phases (opal-A vs. opal-CT) and formation conditions (low vs. high temperature). In a case study of hydrated silica outcrops in Valles Marineris, we show that careful application of a modified version of these spectral parameters to orbital near-infrared spectra (e.g., from CRISM and OMEGA) can aid in characterizing the

  15. Fumed silica nanoparticle mediated biomimicry for optimal cell-material interactions for artificial organ development.

    PubMed

    de Mel, Achala; Ramesh, Bala; Scurr, David J; Alexander, Morgan R; Hamilton, George; Birchall, Martin; Seifalian, Alexander M

    2014-03-01

    Replacement of irreversibly damaged organs due to chronic disease, with suitable tissue engineered implants is now a familiar area of interest to clinicians and multidisciplinary scientists. Ideal tissue engineering approaches require scaffolds to be tailor made to mimic physiological environments of interest with specific surface topographical and biological properties for optimal cell-material interactions. This study demonstrates a single-step procedure for inducing biomimicry in a novel nanocomposite base material scaffold, to re-create the extracellular matrix, which is required for stem cell integration and differentiation to mature cells. Fumed silica nanoparticle mediated procedure of scaffold functionalization, can be potentially adapted with multiple bioactive molecules to induce cellular biomimicry, in the development human organs. The proposed nanocomposite materials already in patients for number of implants, including world first synthetic trachea, tear ducts and vascular bypass graft. PMID:24243739

  16. Silk-silica composites from genetically engineered chimeric proteins: materials properties correlate with silica condensation rate and colloidal stability of the proteins in aqueous solution

    PubMed Central

    Belton, David J.; Mieszawska, Aneta J.; Currie, Heather A.; Kaplan, David L.; Perry, Carole C.

    2012-01-01

    The aim of the study was to determine the extent and mechanism of influence on silica condensation that is presented by a range of known silicifying recombinant chimeras (R5- SSKKSGSYSGSKGSKRRIL; A1- SGSKGSKRRIL; and Si4-1- MSPHPHPRHHHT and repeats thereof) attached at the N-terminus end of a 15 mer repeat of the 32 amino acid consensus sequence of the major ampullate dragline Spindroin 1 (Masp1) Nephila clavipes spider silk sequence ([SGRGGLGGQG AGAAAAAGGA GQGGYGGLGSQG]15X). The influence of the silk/chimera ratio was explored through the adjustment of the type and number of silicifying domains, (denoted X above), and the results were compared with their non chimeric counterparts and the silk from Bombyx mori. The effect of pH (3–9) on reactivity was also explored. Optimum conditions for rate and control of silica deposition were determined and the solution properties of the silks were explored to determine their mode(s) of action. For the silica-silk-chimera materials formed there is a relationship between the solution properties of the chimeric proteins (ability to carry charge), the pH of reaction and the solid state materials that are generated. The region of colloidal instability correlates with the pH range observed for morphological control and coincides with the pH range for the highest silica condensation rates. With this information it should be possible to predict how chimeric or chemically modified proteins will affect structure and morphology of materials produced under controlled conditions and extend the range of composite materials for a wide spectrum of uses in the biomedical and technology fields. PMID:22313382

  17. Influence of geometry on mechanical properties of bio-inspired silica-based hierarchical materials.

    PubMed

    Dimas, Leon S; Buehler, Markus J

    2012-09-01

    Diatoms, bone, nacre and deep-sea sponges are mineralized natural structures found abundantly in nature. They exhibit mechanical properties on par with advanced engineering materials, yet their fundamental building blocks are brittle and weak. An intriguing characteristic of these structures is their heterogeneous distribution of mechanical properties. Specifically, diatoms exhibit nanoscale porosity in specific geometrical configurations to create regions with distinct stress strain responses, notably based on a single and simple building block, silica. The study reported here, using models derived from first principles based full atomistic studies with the ReaxFF reactive force field, focuses on the mechanics and deformation mechanisms of silica-based nanocomposites inspired by mineralized structures. We examine single edged notched tensile specimens and analyze stress and strain fields under varied sample size in order to gain fundamental insights into the deformation mechanisms of structures with distinct ordered arrangements of soft and stiff phases. We find that hierarchical arrangements of silica nanostructures markedly change the stress and strain transfer in the samples. The combined action of strain transfer in the deformable phase, and stress transfer in the strong phase, acts synergistically to reduce the intensity of stress concentrations around a crack tip, and renders the resulting composites less sensitive to the presence of flaws, for certain geometrical configurations it even leads to stable crack propagation. A systematic study allows us to identify composite structures with superior fracture mechanical properties relative to their constituents, akin to many natural biomineralized materials that turn the weaknesses of building blocks into a strength of the overall system. PMID:22740585

  18. Evaluation and optimization of the metal-binding properties of a complex ligand for immobilized metal affinity chromatography.

    PubMed

    Chen, Bin; Li, Rong; Li, Shiyu; Chen, Xiaoli; Yang, Kaidi; Chen, Guoliang; Ma, Xiaoxun

    2016-02-01

    The simultaneous determination of two binding parameters for metal ions on an immobilized metal affinity chromatography column was performed by frontal chromatography. In this study, the binding parameters of Cu(2+) to l-glutamic acid were measured, the metal ion-binding characteristics of the complex ligand were evaluated. The linear correlation coefficients were all greater than 99%, and the relative standard deviations of two binding parameters were 0.58 and 0.059%, respectively. The experiments proved that the frontal chromatography method was accurate, reproducible, and could be used to determine the metal-binding parameters of the affinity column. The effects of buffer pH, type, and concentration on binding parameters were explored by uniform design experiment. Regression, matching and residual analyses of the models were performed. Meanwhile, the optimum-binding conditions of Cu(2+) on the l-glutamic acid-silica column were obtained. Under these binding conditions, observations and regression values of two parameters were similar, and the observation values were the best. The results demonstrated that high intensity metal affinity column could be effectively prepared by measuring and evaluating binding parameters using frontal chromatography combined with a uniform design experiment. The present work provided a new mode for evaluating and preparing immobilized metal affinity column with good metal-binding behaviors. PMID:26632098

  19. Structural investigation of nonionic fluorinated micelles by SANS in relation to mesoporous silica materials.

    PubMed

    Michaux, Florentin; Blin, Jean-Luc; Teixeira, José; Stébé, Marie José

    2012-01-12

    In an attempt to answer the question if there is dependence between the pore ordering of the mesoporous silica, obtained through the cooperative template mechanism, and the shape of the micellar aggregates of the surfactant solutions, the micellar structures of two nonionic fluorinated surfactant based-systems are studied by SANS. By fitting the experimental spectra with theoretical models, the structural evolution of the molecular aggregates can be described, and some important parameters can be obtained, such as the water and eventually oil penetration into the surfactant film, the aggregation number, the area per polar head of the surfactant, and the surfactant chain conformations. We have shown that for the C(8)F(17)C(2)H(4)(OC(2)H(4))(9)OH system, the micelles are prolate spheroids. The increase of the surfactant concentration in water does not change the characteristics of the interfacial film, but the aggregation number raises and the particles become more elongated. By contrast, the experimental curves of C(7)F(15)C(2)H(4)(OC(2)H(4))(8)OH cannot be fitted considering a small particle model. However, progressive incorporation of fluorocarbon induces a change of size and shape of the globules, which become smaller and more and more spherical. Regarding the material mesopore ordering, it appears that the micelles that lead to hexagonal mesoporous silica materials are described with a model of quasi-spherical globules. On the contrary, when large micelles are found, only wormhole-like structures are obtained. PMID:22145934

  20. A novel mesoporous carbon-silica-titania nanocomposite as a high performance anode material in lithium ion batteries.

    PubMed

    Zhou, Yuanyuan; Kim, Younghun; Jo, Changshin; Lee, Jinwoo; Lee, Chul Wee; Yoon, Songhun

    2011-05-01

    An ordered mesoporous carbon-silica-titania material was prepared using the tetra-constituents co-assembly method. As regards its anode performance in lithium ion batteries, the composite material anode exhibited a high capacity (875 mAh g(-1)), a higher initial efficiency (56%) and an improved rate. PMID:21424009

  1. Identification and characterization of a novel high affinity metal-binding site in the hammerhead ribozyme.

    PubMed Central

    Hansen, M R; Simorre, J P; Hanson, P; Mokler, V; Bellon, L; Beigelman, L; Pardi, A

    1999-01-01

    A novel metal-binding site has been identified in the hammerhead ribozyme by 31P NMR. The metal-binding site is associated with the A13 phosphate in the catalytic core of the hammerhead ribozyme and is distinct from any previously identified metal-binding sites. 31P NMR spectroscopy was used to measure the metal-binding affinity for this site and leads to an apparent dissociation constant of 250-570 microM at 25 degrees C for binding of a single Mg2+ ion. The NMR data also show evidence of a structural change at this site upon metal binding and these results are compared with previous data on metal-induced structural changes in the core of the hammerhead ribozyme. These NMR data were combined with the X-ray structure of the hammerhead ribozyme (Pley HW, Flaherty KM, McKay DB. 1994. Nature 372:68-74) to model RNA ligands involved in binding the metal at this A13 site. In this model, the A13 metal-binding site is structurally similar to the previously identified A(g) metal-binding site and illustrates the symmetrical nature of the tandem G x A base pairs in domain 2 of the hammerhead ribozyme. These results demonstrate that 31P NMR represents an important method for both identification and characterization of metal-binding sites in nucleic acids. PMID:10445883

  2. Rational Catalyst Design of Titanium-Silica Materials Aided by Site-Specific Titration Tools

    NASA Astrophysics Data System (ADS)

    Eaton, Todd Robert

    Silica-supported titanium materials are widely used for thermocatalytic applications such as hydroxylation of alkanes and aromatics, oxidation of alcohols and ethers, ammoximation of carbonyls, and sulfoxidations, while Ti-based materials are widely studied for photocatalytic applications such as photo-oxidation of organic substrates and photo-reduction of CO 2. However, the underlying phenomena of how to synthesize, identify, and control the active structures in these materials is not well understood because of the narrow scope of previous work. Studies of titanium-based catalysts typically focus on materials where the metal is present as either highly-dispersed Ti cations or in bulk crystalline TiO2 form, neglecting the numerous and potentially useful intermediate structures. Furthermore, these works typically focus on a single synthesis technique and rely upon bulk characterization techniques to understand the materials. Here rigorous titanium-silica synthesis-structure-function relationships are established by examining several different synthetic method and utilizing characterization techniques that enable an atomic-level understanding of the materials. The materials studied span the range from isolated Ti cations to clustered TiOx domains, polymeric TiO x domains, anatase-like 2D TiO2 domains, and 3D crystalline TiO2. Tools to quantify accessible TiO x and tetrahedral Ti sites are developed, utilizing the selective titration of titanium with phenylphosphonic acid (PPA). Catalytic properties are probed with the photocatalytic oxidation of benzyl alcohol and the thermocatalytic epoxidation of cis-cyclooctene with H2O2 . PPA titration data indicate that the rate of benzyl alcohol photo-oxidation is independent of titanium coordination, while the rate of alkene epoxidation with H2O2 is proportional to the number of tetrahedral titanium sites on the catalyst. PPA titration data also enables the estimation of TiO2 particle size and reveals an important distinction

  3. Lanthano phosphomolybdate-decorated silica nanoparticles: novel hybrid materials with photochromic properties.

    PubMed

    Pinto, Tânia V; Fernandes, Diana M; Pereira, Clara; Guedes, Alexandra; Blanco, Ginesa; Pintado, Jose M; Pereira, Manuel F R; Freire, Cristina

    2015-03-14

    Novel photochromic hybrid nanomaterials were prepared through the immobilization of the lacunary Keggin-type phosphomolybdate (TBA4H3[PMo11O39]·xH2O, denoted as PMo11) and sandwich-type lanthano phosphomolybdates (K11[Ln(III)(PMo11O39)2]·xH2O, denoted as Ln(PMo11)2, where Ln(III) = Sm, Eu, Gd, Tb and Dy) onto positively-charged functionalized silica nanoparticles. The functionalized silica nanoparticles were prepared by a one-step co-condensation route between tetraethyl orthosilicate and dimethyloctadecyl[3-(trimethoxysilyl)propyl]ammonium chloride, presenting an average particle size of 95 ± 26 nm, a spherical morphology and a pore diameter of 13.7 nm. All characterization techniques proved the successful immobilization of the phosphomolybdates. The photochromic properties of the resulting hybrid nanomaterials in the solid state were evaluated by UV-Vis spectroscopy and colorimetry. All materials revealed promising photochromic properties under UV irradiation (λ = 254 nm). The lacunary phosphomolybdate anchored onto the silica nanoparticles, C18-SiO2@PMo11, showed the best photoswitching properties, with the color changing from green to dark-blue (ΔE* = 26.8). Among the Ln(PMo11)2-based hybrid nanomaterials, those containing higher Mo loadings--Eu(III)- and Tb(III)-based samples--presented more significant color changes from green to dark-blue (ΔE* = 18.8-18.9). These results revealed that the optical properties of the as-prepared hybrid nanomaterials did not depend directly on the type of Ln(III) cation, but only on the amount of Mo, which was the target element responsible for the photochromic behavior. PMID:25652698

  4. QM/MM Molecular Dynamics Studies of Metal Binding Proteins

    PubMed Central

    Vidossich, Pietro; Magistrato, Alessandra

    2014-01-01

    Mixed quantum-classical (quantum mechanical/molecular mechanical (QM/MM)) simulations have strongly contributed to providing insights into the understanding of several structural and mechanistic aspects of biological molecules. They played a particularly important role in metal binding proteins, where the electronic effects of transition metals have to be explicitly taken into account for the correct representation of the underlying biochemical process. In this review, after a brief description of the basic concepts of the QM/MM method, we provide an overview of its capabilities using selected examples taken from our work. Specifically, we will focus on heme peroxidases, metallo-β-lactamases, α-synuclein and ligase ribozymes to show how this approach is capable of describing the catalytic and/or structural role played by transition (Fe, Zn or Cu) and main group (Mg) metals. Applications will reveal how metal ions influence the formation and reduction of high redox intermediates in catalytic cycles and enhance drug metabolism, amyloidogenic aggregate formation and nucleic acid synthesis. In turn, it will become manifest that the protein frame directs and modulates the properties and reactivity of the metal ions. PMID:25006697

  5. Metals and Neuronal Metal Binding Proteins Implicated in Alzheimer's Disease

    PubMed Central

    2016-01-01

    Alzheimer's disease (AD) is the most prevalent age-related dementia affecting millions of people worldwide. Its main pathological hallmark feature is the formation of insoluble protein deposits of amyloid-β and hyperphosphorylated tau protein into extracellular plaques and intracellular neurofibrillary tangles, respectively. Many of the mechanistic details of this process remain unknown, but a well-established consequence of protein aggregation is synapse dysfunction and neuronal loss in the AD brain. Different pathways including mitochondrial dysfunction, oxidative stress, inflammation, and metal metabolism have been suggested to be implicated in this process. In particular, a body of evidence suggests that neuronal metal ions such as copper, zinc, and iron play important roles in brain function in health and disease states and altered homeostasis and distribution as a common feature across different neurodegenerative diseases and aging. In this focused review, we overview neuronal proteins that are involved in AD and whose metal binding properties may underlie important biochemical and regulatory processes occurring in the brain during the AD pathophysiological process. PMID:26881049

  6. Sorptive removal of trinitroglycerin (TNG) from water using nanostructured silica-based materials.

    PubMed

    Saad, Rabih; Thibutot, Sonia; Ampleman, Guy; Hawari, Jalal

    2010-01-01

    Trinitroglycerin (TNG), a nitrate ester, is widely used in the pharmaceutical industry for the treatment of angina pectoris (chest pain) and by the military for the manufacturing of dynamite and propellants. Currently, TNG is considered as a key environmental contaminant due to the discharge of wastewater tainted with the chemical from various military and pharmaceutical industries. The present study describes the use of a nanostructured silica material (Mobil Composite Material no. 48 [MCM-48]) prepared by mixing tetraethylorthosilicate (TEOS) and cetyltrimethylammonium bromide (CTAB) to remove TNG from water. The sorption of TNG onto MCM-48 rapidly reached equilibrium within 1 h. Sorption kinetics were best described using a pseudo-second order model, whereas sorption isotherms were best interpreted using the Langmuir model. The latter gave a maximum sorption capacity of 55.2 mg g(-1) at 40 degrees C. The enthalpy and entropy of TNG sorption onto MCM-48 were 1.89 kJ mol(-1) and 79.0 J mol(-1).K(-1), indicating the endothermic nature of the TNG sorption onto MCM-48. When MCM-48 was heated at 540 degrees C for 5 h, the resulting calcined material (absence of the surfactant) did not sorb TNG, suggesting that the surfactant component of the nanomaterial was responsible for TNG sorption. Finally, we found that MCM-48 lost approximately 30% of its original sorption capacity after five sorption-desorption cycles. In conclusion, the nanostructured silica based sorbent, with high sorption capacity and remarkable reusability, should constitute the basis for the development of an effective technology for the removal of TNG from contaminated water. PMID:20176831

  7. Entrapping quercetin in silica/polyethylene glycol hybrid materials: Chemical characterization and biocompatibility.

    PubMed

    Catauro, Michelina; Bollino, Flavia; Nocera, Paola; Piccolella, Simona; Pacifico, Severina

    2016-11-01

    Sol-gel synthesis was exploited to entrap quercetin, a natural occurring antioxidant polyphenol, in silica-based hybrid materials, which differed in their polyethylene glycol (PEG) content (6, 12, 24 and 50wt%). The materials obtained, whose nano-composite nature was ascertained by Scanning Electron Microscopy (SEM), were chemically characterized by Fourier Transform InfraRed (FT-IR) and UV-Vis spectroscopies. The results prove that a reaction between the polymer and the drug occurred. Bioactivity tests showed their ability to induce hydroxyapatite nucleation on the sample surfaces. The direct contact method was applied to screen the cytotoxicity of the synthetized materials towards fibroblast NIH 3T3 cells, commonly used for in vitro biocompatibility studies, and three nervous system cell lines (neuroblastoma SH-SY5Y, glioma U251, and pheochromocytoma PC12 cell lines), adopted as models in oxidative stress related studies. Using the MTT (3-[4,5-dimethylthiazol-2-yl]-2,5-diphenyltetrazolium bromide) assay NIH 3T3 proliferation was assessed and the morphology was not compromised by direct exposure to the materials. Analogously, PC-12, and U-251 cell lines were not affected by new materials. SH-SY5Y appeared to be the most sensitive cell line with cytotoxic effects of 20-35%. PMID:27524014

  8. Material removal and surface figure during pad polishing of fused silica

    SciTech Connect

    Suratwala, T I; Feit, M D; Steele, W A

    2009-05-04

    The material removal and surface figure after ceria pad polishing of fused silica glass have been measured and analyzed as a function of kinematics, loading conditions, and polishing time. Also, the friction at the workpiece/lap interface, the slope of the workpiece relative to the lap plane, and lap viscoelastic properties have been measured and correlated to material removal. The results show that the relative velocity between the workpiece & lap (determined by the kinematics) and the pressure distribution determine the spatial and temporal material removal and hence the final surface figure of the workpiece. In the case where the applied loading and relative velocity distribution over the workpiece are spatially uniform, a significant non-uniform spatial material removal from the workpiece surface is observed. This is due to a non-uniform pressure distribution resulting from: (1) a moment caused by a pivot point and interface friction forces; (2) viscoelastic relaxation of the polyurethane lap; and (3) a physical workpiece/lap interface mismatch. Both the kinematics and these contributions to the pressure distribution are quantitatively described, and then combined to form a spatial and temporal Preston model & code for material removal (called Surface Figure or SurF{copyright}). The surface figure simulations are consistent with the experiment for a wide variety of polishing conditions. This study is an important step towards deterministic full-aperture polishing, which would allow optical glass fabrication to be performed in a more repeatable, less iterative, and hence more economical manner.

  9. Catalytic performance of subtilisin immobilized without covalently attachment on surface-functionalized mesoporous silica materials

    NASA Astrophysics Data System (ADS)

    Murai, K.; Nonoyama, T.; Ando, F.; Kato, K.

    2011-10-01

    Mesoporous silica (MPS) materials were synthesized using cetyltrimethylammonium bromide or amphiphilic pluronic polymer P123 (EO20PO70EO20) as structure-directing agent. MPS samples were characterized by FE-SEM and N2 adsorption-desorption isotherms, respectively. Subtilisin from Bacillus licheiformis (4.1 × 7.8 × 3.7 nm) was easily immobilized by a direct one-step immobilization process onto MPS with different organo-functinalized surfaces. However, enzyme immobilized on MPS modified with 3-mercaptopropyl group strongly reduced its enantioselectivity. Denaturation temperature of immobilized subtilisin shifted to a high temperature compared to free-enzyme. These biocatalysts on MPS particles retained about 30% of original activity even after 5 cycles of recycle use.

  10. Elaboration and Characterization of High Silica ZSM-5 and Mordenite Solid Microporous Materials

    NASA Astrophysics Data System (ADS)

    Khemaissia, Sihem; Nibou, Djamel; Amokrane, Samira; Lebaili, Nemcha

    In this study, we were interested to use a hydrothermally method of elaboration of ZSM-5 and Mordenite solid microporous materials. This method is based on crystallization of amorphous gels composed of silicon and aluminium solutions. The elaborations were carried out in stainless steel Teflon lined autoclave over different operation conditions: heating temperature, contact time, pH and agitation of the reactional medium. After crystallization, samples were characterized by several techniques as X ray diffraction, scanning microscopy, infrared spectroscopy. The used method was allowed the obtaining of pure phases of solids belonging to ZSM-5 and mordenite structures respectively. The crystal growth environment during nucleation and crystallization was occurred at the liquid-gel interface in the dispersed gel-solution mixtures. The composition of these structures was found as high silica zeolites.

  11. Silica hollow nanospheres as new nanoscaffold materials to enhance hydrogen releasing from ammonia borane.

    PubMed

    Zhang, Tianran; Yang, Xiaojing; Yang, Siqi; Li, Daixin; Cheng, Fangyi; Tao, Zhanliang; Chen, Jun

    2011-11-01

    Silica hollow nanospheres (SHNS) are used as new nanoscaffold materials to confine ammonia borane (NH(3)BH(3), AB) for enhancing the dehydrogenation process. Different loading levels of AB in SHNS are considered and AB/4SHNS (with AB content of approximately 20 wt%) shows the best result. The onset temperature of the dehydrogenation of AB in SHNS is as low as 70 °C with the peak temperature at 99 °C and no other gases such as borazine and ammonia are detected. Furthermore, within 60 min at 85 °C, 0.53 equivalent of hydrogen is released and the activation energy is 97.6 kJ mol(-1). Through FT-IR, Raman spectrum and density functional theory (DFT) calculation, it is found that nanoconfinement effect combined with SiO-HH-B interaction is essential for the enhancement of hydrogen releasing. PMID:21947307

  12. Photovoltaic's silica-rich waste sludge as supplementary cementitious material (SCM)

    SciTech Connect

    Quercia, G.; Putten, J.J.G. van der; Hüsken, G.; Brouwers, H.J.H.

    2013-12-15

    Waste sludge, a solid recovered from wastewater of photovoltaic-industries, composes of agglomerates of nano-particles like SiO{sub 2} and CaCO{sub 3}. This sludge deflocculates in aqueous solutions into nano-particles smaller than 1 μm. Thus, this sludge constitutes a potentially hazardous waste when it is improperly disposed. Due to its high content of amorphous SiO{sub 2}, this sludge has a potential use as supplementary cementitious material (SCM) in concrete. In this study the main properties of three different samples of photovoltaic's silica-rich waste sludge (nSS) were physically and chemically characterized. The characterization techniques included: scanning electron microscopy (SEM), X-ray energy dispersive spectroscopy (EDS), X-ray diffraction (XRD), nitrogen physical adsorption isotherm (BET method), density by Helium pycnometry, particle size distribution determined by laser light scattering (LLS) and zeta-potential measurements by dynamic light scattering (DLS). In addition, a dispersability study was performed to design stable slurries to be used as liquid additives for the concrete production on site. The effects on the hydration kinetics of cement pastes by the incorporation of nSS in the designed slurries were determined using an isothermal calorimeter. A compressive strength test of standard mortars with 7% of cement replacement was performed to determine the pozzolanic activity of the waste nano-silica sludge. Finally, the hardened system was fully characterized to determine the phase composition. The results demonstrate that the nSS can be utilized as SCM to replace portion of cement in mortars, thereby decreasing the CO{sub 2} footprint and the environmental impact of concrete. -- Highlights: •Three different samples of PV nano-silica sludge (nSS) were fully characterized. •nSS is composed of agglomerates of nano-particles like SiO{sub 2} and CaCO{sub 3}. •Dispersability studies demonstrated that nSS agglomerates are broken to nano

  13. The macro- and micro properties of cement pastes with silica-rich materials cured by wet-mixed steaming injection

    SciTech Connect

    Wu, D.S.; Peng, Y.N

    2003-09-01

    This research used cement pastes with a low water/blaine ratio (W/b=0.27). Rice husk ashes (RHA) burned at 700 and 850 deg. C, silica fume, silica sand (Ottawa standard sand), etc., were the added ingredients. Wet-mixed steam injection (WMSI) was at five different temperatures: 65, 80, 120, 150 and 180 deg. C. We investigated cement pastes with added silica-rich materials. For different WMSI temperatures and times, we explored the relations between compressive strength, hydration products, and pozzolanic reaction mechanism. From scanning electron microscopy (SEM) and EDS, we know that hydration products become very complicated, depending on the WMSI temperatures and times. It is difficult to determine the direct effects on the strength based on changes in the products. Experimental results, however, clearly showed that the compressive strength was worst for 80 deg. C and best for 180 deg. C. High-temperature WMSI is best with 4-h presteaming period and 8-h retention time. Curing in saturated limewater for 28 days did not increase the strength. The three types of silica-rich materials used in this research all participated in the reaction during high-temperature WMSI; they helped to increase the strength. Addition of Ottawa standard sand resulted in the best strength, followed by addition of RHA, while addition of silica fume was worse than the others. Specimens treated with high-temperature WMSI would swell slightly if they were placed in air. This was different from normal-temperature curing.

  14. Fluorescent chelates for monitoring metal binding with macromolecules.

    PubMed

    Islam, M; Khanin, M; Sadik, O A

    2003-01-01

    Metals and radionuclides are usually coupled with proteins together with suitable ligands for therapeutic, tumor-imaging, pharmaceuticals, and biocompatibility applications. Several ligands that can strongly coordinate a given nuclide in a specific valency are already known. However, the demand for bifunctionality has limited the applications of these ligands. We hereby report the molecular design of a receptor system based on the linkage of protein to monoazo ligands. By use of basic coordination chemistry, 4-(3-quinolinoazo)hydroxybenzoic acid (QABA) and derivatives were successfully conjugated to ovalbumin, bovine serum albumin, and alkaline phosphatase at a site that was distinct from the metal binding site. The presence of carboxylic acid linkage in the QABA served as a convenient bridge for protein conjugation and may allow the generic application of these ligands for bioconjugate synthesis while ensuring a high in vivo stability. The ligand-protein conjugates were characterized using UV-vis spectroscopy, Fourier transform infrared spectroscopy, thin layer chromatography, NMR, and surface-enhanced laser desorption ionization time-of-flight mass spectrometry. The conjugate was tested for the ability to recognize nonradioactive Ga(3+) at a physiological pH, and a binding constant of 1 x 10(20) was recorded. Also, the in vitro testing results indicated that the fluorescent conjugates exhibited significant selectivity for gallium compared to Pb(2+), Hg(2+), Zn(2+), Cu(2+), Fe(3+), and Co(2+) while no responses were obtained for alkaline and alkaline earth metals. These attributes could allow these conjugates to be used as a model for imaging sensors and for metal detection. PMID:12523855

  15. Barcoded materials based on photoluminescent hybrid system of lanthanide ions-doped metal organic framework and silica via ion exchange.

    PubMed

    Shen, Xiang; Yan, Bing

    2016-04-15

    A multicolored photoluminescent hybrid system based on lanthanide ions-doped metal organic frameworks/silica composite host has potential in display and barcode applications. By controlling the stoichiometry of the lanthanides via cation exchange, proportional various lanthanide ions are successfully introduced into metal organic frameworks, whose emission intensity is correspondingly proportional to its amount. The resulting luminescent barcodes depend on the lanthanide ions ratios and compositions. Subsequently, the lanthanide ions located in the channels of metal organic frameworks are protected from any interaction with the environment after the modification of silica on the surface. The optical and thermal stability of the hybrid materials are improved for technological application. PMID:26852345

  16. Imaging the early material response associated with exit surface damage in fused silica

    SciTech Connect

    Demos, S G; Raman, R N; Negres, R A

    2010-11-05

    The processes involved at the onset of damage initiation on the surface of fused silica have been a topic of extensive discussion and thought for more than four decades. Limited experimental results have helped develop models covering specific aspects of the process. In this work we present the results of an experimental study aiming at imaging the material response from the onset of the observation of material modification during exposure to the laser pulse through the time point at which material ejection begins. The system involves damage initiation using a 355 nm pulse, 7.8 ns FWHM in duration and imaging of the affected material volume with spatial resolution on the order of 1 {micro}m using as strobe light a 150 ps laser pulse that is appropriately timed with respect to the pump pulse. The observations reveal that the onset of material modification is associated with regions of increased absorption, i.e., formation of an electronic excitation, leading to a reduction in the probe transmission to only a few percent within a time interval of about 1 ns. This area is subsequently rapidly expanding with a speed of about 1.2 {micro}m/ns and is accompanied by the formation and propagation of radial cracks. These cracks appear to initiate about 2 ns after the start of the expansion of the modified region. The damage sites continue to grow for about 25 ns but the mechanism of expansion after the termination of the laser pulse is via formation and propagation of lateral cracks. During this time, the affected area of the surface appears to expand forming a bulge of about 40 {micro}m in height. The first clear observation of material cluster ejection is noted at about 50 ns delay.

  17. Multifunctional mesoporous silica catalyst

    DOEpatents

    Lin, Victor Shang-Yi; Tsai, Chih-Hsiang; Chen, Hung-Ting; Pruski, Marek; Kobayashi, Takeshi

    2015-03-31

    The present invention provides bifunctional silica mesoporous materials, including mesoporous silica nanoparticles ("MSN"), having pores modified with diarylammonium triflate and perfluoroaryl moieties, that are useful for the acid-catalyzed esterification of organic acids with organic alcohols.

  18. What Is Crystalline Silica?

    MedlinePlus

    ... silica, and requires a repirator protection program until engineering controls are implemented. Additionally, OSHA has a National ... silica materials with safer substitutes, whenever possible. ■ Provide engineering or administrative controls, where feasible, such as local ...

  19. FUNCTIONALIZED SILICA AEROGELS: ADVANCED MATERIALS TO CAPTURE AND IMMOBILIZE RADIOACTIVE IODINE

    SciTech Connect

    Matyas, Josef; Fryxell, Glen E.; Busche, Brad J.; Wallace, Krys; Fifield, Leonard S.

    2011-11-16

    To support the future expansion of nuclear energy, an effective method is needed to capture and safely store radiological iodine-129 released during reprocessing of spent nuclear fuel. Various materials have been investigated to capture and immobilize iodine. In most cases, however, the materials that are effective for capturing iodine cannot subsequently be sintered/densified to create a stable composite that could be a viable waste form. We have developed chemically modified, highly porous, silica aerogels that show sorption capacities higher than 440 mg of I2 per gram at 150 C. An iodine uptake test in dry air containing 4.2 ppm of iodine demonstrated no breakthrough after 3.5 h and indicated a decontamination factor in excess of 310. Preliminary densification tests showed that the I2-loaded aerogels retained more than 92 wt% of I2 after thermal sintering with pressure assistance at 1200 C for 30 min. These high capture and retention efficiencies for I2 can be further improved by optimizing the functionalization process and the chemistry as well as the sintering conditions.

  20. Silica-Ceria Hybrid Nanostructures

    SciTech Connect

    Munusamy, Prabhakaran; Sanghavi, Shail P.; Nachimuthu, Ponnusamy; Baer, Donald R.; Thevuthasan, Suntharampillai

    2012-04-25

    A new hybrid material system that consists of ceria attached silica nanoparticles has been developed. Because of the versatile properties of silica and versatile properties of silica and versatile properties of silica and versatile properties of silica and versatile properties of silica and versatile properties of silica and versatile properties of silica and versatile properties of silica and versatile properties of silica and versatile properties of silica and versatile properties of silica and versatile properties of silica and antioxidant properties of ceria nanoparticles, this material system is ideally suited for biomedical applications. The silica particles of size ~50nm were synthesized by the Stöber synthesis method and ceria nanoparticles of size ~2-3nm was attached to the silica surface using a hetrocoagulation method. The presence of silanol groups on the surface of silica particles mediated homogenous nucleation of ceria which were attached to silica surface by Si-O-Ce bonding. The formations of silica-ceria hybrid nanostructures were characterized by X-photoelectron spectroscopy (XPS) and high resolution transmission electron microscopy (HRTEM). The HRTEM image confirms the formation of individual crystallites of ceria nanoparticles attached to the silica surface. The XPS analysis indicates that ceria nanoparticles are chemically bonded to surface of silica and possess mixture of +3 and +4 chemical states.

  1. Silica/quercetin sol-gel hybrids as antioxidant dental implant materials

    NASA Astrophysics Data System (ADS)

    Catauro, Michelina; Papale, Ferdinando; Bollino, Flavia; Piccolella, Simona; Marciano, Sabina; Nocera, Paola; Pacifico, Severina

    2015-06-01

    The development of biomaterials with intrinsic antioxidant properties could represent a valuable strategy for preventing the onset of peri-implant diseases. In this context, quercetin, a naturally occurring flavonoid, has been entrapped at different weight percentages in a silica-based inorganic material by a sol-gel route. The establishment of hydrogen bond interactions between the flavonol and the solid matrix was ascertained by Fourier transform infrared spectroscopy. This technique also evidenced changes in the stretching frequencies of the quercetin dienonic moiety, suggesting that the formation of a secondary product occurs. Scanning electron microscopy was applied to detect the morphology of the synthesized materials. Their bioactivity was shown by the formation of a hydroxyapatite layer on sample surface soaked in a fluid that simulates the composition of human blood plasma. When the potential release of flavonol was determined by liquid chromatography coupled with ultraviolet and electrospray ionization tandem mass spectrometry techniques, the eluates displayed a retention time that was 0.5 min less than quercetin. Collision-activated dissociation mass spectrometry and untraviolet-visible spectroscopy were in accordance with the release of a quercetin derivative. The antiradical properties of the investigated systems were evaluated by DPPH and ABTS methods, whereas the 2,7-dichlorofluorescein diacetate assay highlighted their ability to inhibit the H2O2-induced intracellular production of reactive oxygen species in NIH-3T3 mouse fibroblast cells. Data obtained, along with data gathered from the MTT cytotoxicity test, revealed that the materials that entrapped the highest amount of quercetin showed notable antioxidant effectiveness.

  2. The Influence of Cadmium Stress on the Content of Mineral Nutrients and Metal-Binding Proteins in Arabidopsis halleri.

    PubMed

    Przedpełska-Wąsowicz, Ewa; Polatajko, Aleksandra; Wierzbicka, Małgorzata

    2012-09-01

    We investigated the influence of cadmium stress on zinc hyperaccumulation, mineral nutrient uptake, and the content of metal-binding proteins in Arabidopsis halleri. The experiments were carried out using plants subjected to long-term cadmium exposure (40 days) in the concentrations of 45 and 225 μM Cd(2+). Inductively coupled plasma-mass spectrometry, size exclusion chromatography coupled with plasma-mass spectrometry, and laser ablation inductively coupled plasma-mass spectrometry used for ablation of polyacylamide gels were employed to assess the content of investigated elements in plants as well as to identify metal-binding proteins. We found that A. halleri is able to translocate cadmium to the aerial parts in high amounts (translocation index >1). We showed that Zn content in plants decreased significantly with the increase of cadmium content in the growth medium. Different positive and negative correlations between Cd content and mineral nutrients were evidenced by our study. We identified more than ten low-molecular-weight (<100 kDa) Cd-binding proteins in Cd-treated plants. These proteins are unlikely to be phytochelatins or metallothioneins. We hypothesize that low-molecular-weight Cd-binding proteins can be involved in cadmium resistance in A. halleri. ELECTRONIC SUPPLEMENTARY MATERIAL: The online version of this article (doi:10.1007/s11270-012-1292-4) contains supplementary material, which is available to authorized users. PMID:23002314

  3. Quercetin conjugated silica particles as novel biofunctional hybrid materials for biological applications.

    PubMed

    Vergara-Castañeda, Hayde; Hernandez-Martinez, Angel R; Estevez, Miriam; Mendoza, Sandra; Luna-Barcenas, Gabriel; Pool, Héctor

    2016-03-15

    The aim of this work is to formulate biofunctional hybrid materials (HMs) with quercetin (QC) and silica particles (SiPs) by simple methods such as sol-gel and QC conjugation. Physicochemical characterization included particle size, zeta potential (ζ), FTIR and SEM imaging. Spherical particles with ca. 115 nm in diameter were produced, ζ and FTIR demonstrated that QC conjugation was successfully achieved. Electrochemical analyses performed by cyclic voltammetry (CV) suggested that potential binding sites between QC and SiPs may be at functional groups from A ring or C ring, affecting the transfer electron of resorcinol moiety. Iron chelating activity and lipid peroxidation assays showed that after conjugation to SiPs, QC decreased its metal chelating activity, but anti-radical properties is maintained. Our results demonstrated that our proposed method is simple and effective to obtain bio-functional HMs. Our findings prove to be useful in the design of protective approaches against lipid oxidation in food, pharmaceutical, and cosmetics fields. PMID:26704475

  4. Adsorption characteristics of haloacetonitriles on functionalized silica-based porous materials in aqueous solution.

    PubMed

    Prarat, Panida; Ngamcharussrivichai, Chawalit; Khaodhiar, Sutha; Punyapalakul, Patiparn

    2011-09-15

    The effect of the surface functional group on the removal and mechanism of dichloroacetonitrile (DCAN) adsorption over silica-based porous materials was evaluated in comparison with powdered activated carbon (PAC). Hexagonal mesoporous silicate (HMS) was synthesized and functionalized by three different types of organosilanes (3-aminopropyltriethoxysilane, 3-mercaptopropyltrimethoxysilane and n-octyldimethysilane). Adsorption kinetics and isotherm models were used to determine the adsorption mechanism. The selective adsorption of five haloacetonitriles (HANs) in the single and mixed solute systems was also studied. The experiments revealed that the surface functional groups of the adsorbents largely affected the DCAN adsorption capacities. 3-Mercaptopropyl-grafted HMS had a high DCAN adsorption capacity compared to PAC. The adsorption mechanism is believed to occur via an ion-dipole electrostatic interaction in which water interference is inevitable at low concentrations of DCAN. In addition, the adsorption of DCAN strongly depended on the pH of the solution as this related to the charge density of the adsorbents. The selective adsorption of the five HANs over PAC was not observed, while the molecular structure of different HANs obviously influenced the adsorption capacity and selectivity over 3-mercaptopropyl-grafted HMS. PMID:21752539

  5. Nonionic fluorinated-hydrogenated surfactants for the design of mesoporous silica materials.

    PubMed

    Michaux, F; Blin, J L; Stébé, M J

    2008-09-25

    We have investigated the influence of the ratio between the volume of the hydrophilic head (VA) and the volume of the hydrophobic part (VB) of the surfactant on the mesopore ordering. To understand the difference of behavior we have performed a complete study dealing with fluorinated [Rm(F)(EO)n] and hydrogenated [Rm(H)(EO)n] surfactants. Their mixtures have also been taken into account. Here only the phase diagrams and the structural parameters of the liquid crystal phases of the mixed systems are reported. We have shown that the mutual or partial miscibility of the fluorinated and the hydrogenated surfactants depends on the number of oxyethylene units of each surfactant. To follow, various systems were used for the preparation of silica mesoporous materials via a cooperative templating mechanism (CTM). Results clearly reveal that VA/VB ratios in the range between 0.95 and 1.78 lead to the formation of well-ordered mesostructures. Wormhole-like structures are obtained for higher or lower values. Moreover, results show that from the VA/VB point of view, polyoxyethylene fluoroalkyl ether surfactants behave like their hydrogenated analogues. PMID:18759404

  6. Crosslinking Amine-Modified Silica Aerogels with Epoxies: Mechanically Strong Lightweight Porous Materials

    NASA Technical Reports Server (NTRS)

    Meador, Mary Ann B.; Fabrizio, Eve F.; Ilhan, Faysal; Dass, Amala; Zhang, Guo-Hui; Vassilaras, Plousia; Johnston, J. Chris; Leventis, Nicholas

    2005-01-01

    The mesoporous surfaces of TMOS-derived silica aerogels have been modified with amines by co-polymerization of TMOS with APTES. The amine sites have become anchors for crosslinking the nanoparticles of the skeletal backbone of the aerogel by attachment of di-, tri and tetra-functional epoxies. The resulting conformal coatings increase the density of the native aerogels by a factor of 2-3 but the strength of the resulting materials may increase by more than two orders of magnitude. Processing variables such as amount of APTES used to make the gels, the epoxy type and concentration used for crosslinking, as well as the crosslinking temperature and time were varied according to a multivariable design-of-experiments (DOE) model. It was found that while elastic modulus follows a similar trend with density, maximum strength is attained neither at the maximum density nor at the highest concentration of -NH2 groups, suggesting surface saturation effects. Aerogels crosslinked with the tri-functional epoxide always show improved strength compared with aerogels crosslinked with the other two epoxides under identical conditions. Solid C-13 NMR studies show residual unreacted epoxides, which condense with ne another by heating crosslinked aerogels at 150 C.

  7. The toxicological mode of action and the safety of synthetic amorphous silica-a nanostructured material.

    PubMed

    Fruijtier-Pölloth, Claudia

    2012-04-11

    Synthetic amorphous silica (SAS), in the form of pyrogenic (fumed), precipitated, gel or colloidal SAS, has been used in a wide variety of industrial and consumer applications including food, cosmetics and pharmaceutical products for many decades. Based on extensive physico-chemical, ecotoxicology, toxicology, safety and epidemiology data, no environmental or health risks have been associated with these materials if produced and used under current hygiene standards and use recommendations. With internal structures in the nanoscale size range, pyrogenic, precipitated and gel SAS are typical examples of nanostructured materials as recently defined by the International Organisation for Standardisation (ISO). The manufacturing process of these SAS materials leads to aggregates of strongly (covalently) bonded or fused primary particles. Weak interaction forces (van der Waals interactions, hydrogen bonding, physical adhesion) between aggregates lead to the formation of micrometre (μm)-sized agglomerates. Typically, isolated nanoparticles do not occur. In contrast, colloidal SAS dispersions may contain isolated primary particles in the nano-size range which can be considered nano-objects. The size of the primary particle resulted in the materials often being considered as "nanosilica" and in the inclusion of SAS in research programmes on nanomaterials. The biological activity of SAS can be related to the particle shape and surface characteristics interfacing with the biological milieu rather than to particle size. SAS adsorbs to cellular surfaces and can affect membrane structures and integrity. Toxicity is linked to mechanisms of interactions with outer and inner cell membranes, signalling responses, and vesicle trafficking pathways. Interaction with membranes may induce the release of endosomal substances, reactive oxygen species, cytokines and chemokines and thus induce inflammatory responses. None of the SAS forms, including colloidal nano-sized particles, were shown

  8. A New Phase Change Material Based on Potassium Nitrate with Silica and Alumina Nanoparticles for Thermal Energy Storage

    NASA Astrophysics Data System (ADS)

    Chieruzzi, Manila; Miliozzi, Adio; Crescenzi, Tommaso; Torre, Luigi; Kenny, José M.

    2015-06-01

    In this study different nanofluids with phase change behavior were developed by mixing a molten salt base fluid (KNO3 selected as phase change material) with nanoparticles using the direct synthesis method. The thermal properties of the nanofluids obtained were investigated. Following the improvement in the specific heat achieved, these nanofluids can be used in concentrating solar plants with a reduction of storage material. The nanoparticles used (1.0 wt.%) were silica (SiO2), alumina (Al2O3), and a mix of silica-alumina (SiO2-Al2O3) with an average diameter of 7, 13, and 2-200 nm respectively. Each nanofluid was prepared in water solution, sonicated, and evaporated. Measurements of the thermophysical properties were performed by DSC analysis, and the dispersion of the nanoparticles was analyzed by SEM microscopy. The results obtained show that the addition of 1.0 wt.% of nanoparticles to the base salt increases the specific heat of about 5-10 % in solid phase and of 6 % in liquid phase. In particular, this research shows that the addition of silica nanoparticles has significant potential for enhancing the thermal storage characteristics of KNO3. The phase-change temperature of potassium nitrate was lowered up to 3 °C, and the latent heat was increased to 12 % with the addition of silica nanoparticles. These results deviated from the predictions of theoretical simple mixing model used. The stored heat as a function of temperature was evaluated for the base salt, and the nanofluids and the maximum values obtained were 229, 234, 242, and 266 J/g respectively. The maximum total gain (16 %) due to the introduction of the nanoparticles (calculated as the ratio between the total stored heat of the nanofluids and the base salt in the range of temperatures 260-390 °C) was also recorded with the introduction of silica. SEM and EDX analysis showed the presence of aggregates in all nanofluids: with silica nanoparticles they were homogenously present while with alumina and

  9. A New Phase Change Material Based on Potassium Nitrate with Silica and Alumina Nanoparticles for Thermal Energy Storage.

    PubMed

    Chieruzzi, Manila; Miliozzi, Adio; Crescenzi, Tommaso; Torre, Luigi; Kenny, José M

    2015-12-01

    In this study different nanofluids with phase change behavior were developed by mixing a molten salt base fluid (KNO3 selected as phase change material) with nanoparticles using the direct synthesis method. The thermal properties of the nanofluids obtained were investigated. Following the improvement in the specific heat achieved, these nanofluids can be used in concentrating solar plants with a reduction of storage material. The nanoparticles used (1.0 wt.%) were silica (SiO2), alumina (Al2O3), and a mix of silica-alumina (SiO2-Al2O3) with an average diameter of 7, 13, and 2-200 nm respectively. Each nanofluid was prepared in water solution, sonicated, and evaporated. Measurements of the thermophysical properties were performed by DSC analysis, and the dispersion of the nanoparticles was analyzed by SEM microscopy. The results obtained show that the addition of 1.0 wt.% of nanoparticles to the base salt increases the specific heat of about 5-10 % in solid phase and of 6 % in liquid phase. In particular, this research shows that the addition of silica nanoparticles has significant potential for enhancing the thermal storage characteristics of KNO3. The phase-change temperature of potassium nitrate was lowered up to 3 °C, and the latent heat was increased to 12 % with the addition of silica nanoparticles. These results deviated from the predictions of theoretical simple mixing model used. The stored heat as a function of temperature was evaluated for the base salt, and the nanofluids and the maximum values obtained were 229, 234, 242, and 266 J/g respectively. The maximum total gain (16 %) due to the introduction of the nanoparticles (calculated as the ratio between the total stored heat of the nanofluids and the base salt in the range of temperatures 260-390 °C) was also recorded with the introduction of silica. SEM and EDX analysis showed the presence of aggregates in all nanofluids: with silica nanoparticles they were homogenously present while with

  10. Silica-based materials as drug adsorbents: first principle investigation on the role of water microsolvation on Ibuprofen adsorption.

    PubMed

    Delle Piane, Massimo; Vaccari, Stefano; Corno, Marta; Ugliengo, Piero

    2014-08-01

    Silica-based materials find applications as excipients and, particularly for those of mesoporous nature, as drug delivery agents for pharmaceutical formulations. Their performance can be crucially affected by water moisture, as it can modify the behavior of these formulations, by limiting their shelf life. Here we describe the role of water microsolvation on the features of ibuprofen adsorbed on a model of amorphous silica surface by means of density functional theory (DFT) simulations. Starting from the results of the simulation of ibuprofen in interaction with a dry hydrophobic amorphous silica surface, a limited number of water molecules has been added to study the configurational landscape of the microsolvated system. Structural and energetics properties, as well as the role of dispersive forces, have been investigated. Our simulations have revealed that the silica surface exhibits a higher affinity for water than for ibuprofen, even if several structures coexist at room temperature, with an active competition of ibuprofen and water for the exposed surface silanols. Dispersive interactions play a key role in this system, as pure DFT fails to correctly describe its potential energy surface. Indeed, van der Waals forces are the leading contribution to adsorption, independently of whether the drug is hydrogen-bonded directly to the surface or via water molecules. PMID:24467179

  11. Probing local pH-based precipitation processes in self-assembled silica-carbonate hybrid materials.

    PubMed

    Opel, Julian; Hecht, Mandy; Rurack, Knut; Eiblmeier, Josef; Kunz, Werner; Cölfen, Helmut; Kellermeier, Matthias

    2015-11-01

    Crystallisation of barium carbonate in the presence of silica can lead to the spontaneous assembly of highly complex superstructures, consisting of uniform and largely co-oriented BaCO3 nanocrystals that are interspersed by a matrix of amorphous silica. The formation of these biomimetic architectures (so-called silica biomorphs) is thought to be driven by a dynamic interplay between the components, in which subtle changes of conditions trigger ordered mineralisation at the nanoscale. In particular, it has been proposed that local pH gradients at growing fronts play a crucial role in the process of morphogenesis. In the present work, we have used a special pH-sensitive fluorescent dye to directly trace these presumed local fluctuations by means of confocal laser scanning microscopy. Our data demonstrate the existence of an active region near the growth front, where the pH is locally decreased with respect to the alkaline bulk solution on a length scale of few microns. This observation provides fundamental and, for the first time, direct experimental support for the current picture of the mechanism underlying the formation of these peculiar materials. On the other hand, the absence of any temporal oscillations in the local pH - another key feature of the envisaged mechanism - challenges the notion of autocatalytic phenomena in such systems and raises new questions about the actual role of silica as an additive in the crystallisation process. PMID:26439927

  12. The effects of surface chemistry of mesoporous silica materials and solution pH on kinetics of molsidomine adsorption

    SciTech Connect

    Dolinina, E.S.; Parfenyuk, E.V.

    2014-01-15

    Adsorption kinetics of molsidomine on mesoporous silica material (UMS), the phenyl- (PhMS) and mercaptopropyl-functionalized (MMS) derivatives from solution with different pH and 298 K was studied. The adsorption kinetics was found to follow the pseudo-second-order kinetic model for all studied silica materials and pH. Effects of surface functional groups and pH on adsorption efficiency and kinetic adsorption parameters were investigated. At all studied pH, the highest molsidomine amount is adsorbed on PhMS due to π–π interactions and hydrogen bonding between surface groups of PhMS and molsidomine molecules. An increase of pH results in a decrease of the amounts of adsorbed molsidomine onto the silica materials. Furthermore, the highest adsorption rate kinetically evaluated using a pseudo-second-order model, is observed onto UMS and it strongly depends on pH. The mechanism of the adsorption process was determined from the intraparticle diffusion and Boyd kinetic film–diffusion models. The results showed that the molsidomine adsorption on the silica materials is controlled by film diffusion. Effect of pH on the diffusion parameters is discussed. - Graphical abstract: The kinetic study showed that the k{sub 2} value, the rate constant of pseudo-second order kinetic model, is the highest for molsidomine adsorption on UMS and strongly depends on pH because it is determined by availability and accessibility of the reaction sites of the adsorbents molsidomine binding. Display Omitted - Highlights: • The adsorption capacities of UMS, PhMS and MMS were dependent on the pH. • At all studied pH, the highest molsidomine amount is adsorbed on PhMS. • The highest adsorption rate, k{sub 2}, is observed onto UMS and strongly depends on pH. • Film diffusion was the likely rate-limiting step in the adsorption process.

  13. Combination of porous silica monolith and gold thin films for electrode material of supercapacitor

    NASA Astrophysics Data System (ADS)

    Pastre, A.; Cristini-Robbe, O.; Boé, A.; Raulin, K.; Branzea, D.; El Hamzaoui, H.; Kinowski, C.; Rolland, N.; Bernard, R.

    2015-12-01

    An all-solid electrical double layer supercapacitor was prepared, starting from a porous silica matrix coated with a gold thin-film. The metallization of the silica xerogel was performed by an original wet chemical process, based on the controlled growth of gold nanoparticles on two opposite faces of the silica monolith as a seed layer, followed by an electroless deposition of a continuous gold thin film. The thickness of the metallic thin film was assessed to be 700 nm. The silica plays two major roles: (1) it is used as a porous matrix for the gold electrode, creating a large specific surface area, and (2) it acts as a separator (non-metallized part of the silica). The silica monolith was soaked in a polyvinyl alcohol and phosphoric acid mixture which is used as polymer electrolyte. Capacitance effect was demonstrated by cyclic voltammetry experiments. The specific capacitance was found to be equal to 0.95 mF cm- 2 (9.5 F g-1). No major degradation occurs within more than 3000 cycles.

  14. Multimillion-to-billion atom molecular dynamics simulations of deformation, damage, nanoindentation, and fracture in silica glass and energetic materials

    NASA Astrophysics Data System (ADS)

    Chen, Yi-Chun

    Multimillion-to-billion molecular dynamics (MD) simulations are carried out to study atomistic mechanisms of deformation, damage and failure in silica glass and energetic materials. The simulations are based on experimentally validated interatomic potentials and employ highly efficiently algorithms for parallel architectures. The onset of void-void interaction is investigated by performing MD simulations of amorphous silica under hydrostatic tension. The simulations reveal that nanocavities in amorphous silica (a-SiO2), which are linked to Si-O rings, play an important role in void-void coalescence and inter-void ligament failure. Nanocracks nucleated by the migration of three-fold coordinated Si and nonbridging O on ---Si-O-Si-O--- rings are observed in the multimillion MD simulations of a single void in amorphous silica subjected to a high shear rate. With the increase in shear strain, nanocracks appear on void surfaces and the voids deform into a threadlike structure. At a strain of 40%, the voids break into fragments. The results are similar to experimental and theoretical studies of bubble deformation and breakup under shear. Defects such as voids are known to be important in the detonation of energetic materials. To investigate deformation of a void in an RDX crystal under high shear rate, we have performed million-atom reactive force field (ReaxFF) MD simulations. Simulations reveal that without breaking a bond, the excess strain energy leads to translational and rotational motion of RDX molecules. At a strain of 13%, molecules with high kinetic energy collapse inward without affecting the rest of the system. MD simulations of nanoindentation in amorphous silica reveal migration of defects and their recombination in the densified plastic region under and the material pileup region around the indenter. The plastic flow of silica glass is related to the defect transport mechanism where a defect migrates a considerable distance via a chain of bond

  15. Models of metal binding structures in fulvic acid from the Suwannee River, Georgia

    SciTech Connect

    Leenheer, J.A.; Brown, G.K.; Cabaniss, S.E.; MacCarthy, P.

    1998-08-15

    Fulvic acid, isolated from the Suwannee River, Georgia, was assessed for its ability to bind Ca{sup 2+}, Cd{sup 2+}, Cu{sup 2+}, Ni{sup 2+}, and Zn{sup 2+} ions at pH 6 before and after extensive fractionation that was designed to reveal the nature of metal binding functional groups. The binding constant for Ca{sup 2+} ion had the greatest increase of all the ions in a metal binding fraction that was selected for intensive characterization for the purpose of building quantitative average model structures. The metal binding fraction was characterized by quantitative {sup 13}C NMR, {sup 1}H NMR, and FT-IR spectrometry and elemental, titrimetric, and molecular weight determinations. The characterization data revealed that carboxyl groups were clustered in short-chain aliphatic dibasic acid structures. The Ca{sup 2+} binding data suggested that ether-substituted oxysuccinic acid structures are good models for the metal binding sites at pH 6. Structural models were derived based upon oxidation and photolytic rearrangements of cutin, lignin, and tannin precursors. These structural models rich in substituted dibasic acid structures revealed polydentate binding sites with the potential for both inner-sphere and outer-sphere type binding. The majority of the fulvic acid molecule was involved with metal binding rather than a small substructural unit.

  16. Validating metal binding sites in macromolecule structures using the CheckMyMetal web server

    PubMed Central

    Zheng, Heping; Chordia, Mahendra D.; Cooper, David R.; Chruszcz, Maksymilian; Müller, Peter; Sheldrick, George M.

    2015-01-01

    Metals play vital roles in both the mechanism and architecture of biological macromolecules. Yet structures of metal-containing macromolecules where metals are misidentified and/or suboptimally modeled are abundant in the Protein Data Bank (PDB). This shows the need for a diagnostic tool to identify and correct such modeling problems with metal binding environments. The "CheckMyMetal" (CMM) web server (http://csgid.org/csgid/metal_sites/) is a sophisticated, user-friendly web-based method to evaluate metal binding sites in macromolecular structures in respect to 7350 metal binding sites observed in a benchmark dataset of 2304 high resolution crystal structures. The protocol outlines how the CMM server can be used to detect geometric and other irregularities in the structures of metal binding sites and alert researchers to potential errors in metal assignment. The protocol also gives practical guidelines for correcting problematic sites by modifying the metal binding environment and/or redefining metal identity in the PDB file. Several examples where this has led to meaningful results are described in the anticipated results section. CMM was designed for a broad audience—biomedical researchers studying metal-containing proteins and nucleic acids—but is equally well suited for structural biologists to validate new structures during modeling or refinement. The CMM server takes the coordinates of a metal-containing macromolecule structure in the PDB format as input and responds within a few seconds for a typical protein structure modeled with a few hundred amino acids. PMID:24356774

  17. Interplay of carbon-silica sources on the formation of hierarchical porous composite materials for biological applications such as lipase immobilization.

    PubMed

    Higuita, Mario; Bernal, Claudia; Mesa, Monica

    2014-10-01

    The porous inorganic materials, with hierarchical structures, find application in many processes where the chemical stability and pore connectivity are key points, such as separation, adsorption and catalysis. Here, we synthesized carbon-silica composite materials, which combine hydrolytic stability of the carbon with the surface chemical reactivity of silica in aqueous media. The polycondensation of carbonaceous and siliceous species from sucrose, Triton X-100 surfactant and tetraethylortosilicate during the hydrothermal synthesis led to the formation of hydrochar composite materials. The subsequent carbonization process of these composite hydrochars gave carbon-silica hierarchical porous materials. The study of the micellar reaction system and the characterization of the derivate materials (carbon-silica composite, carbon and silica) were carried out. The results indicate that synthesis conditions allowed the formation of a silica network interpenetrated with a carbon one, which is produced from the incorporated organic matter. The control of the acidity of the reaction medium and hydrothermal conditions modulated the reaction yield and porous characteristics of the materials. The composite nature in conjunction with the hierarchical porosity increases the interest of these materials for future biological applications, such as lipase immobilization. PMID:25175205

  18. Development of UHPC mixtures utilizing natural and industrial waste materials as partial replacements of silica fume and sand.

    PubMed

    Ahmad, Shamsad; Hakeem, Ibrahim; Maslehuddin, Mohammed

    2014-01-01

    In the exploratory study presented in this paper, an attempt was made to develop different mixtures of ultrahigh performance concrete (UHPC) using various locally available natural and industrial waste materials as partial replacements of silica fume and sand. Materials such as natural pozzolana (NP), fly ash (FA), limestone powder (LSP), cement kiln dust (CKD), and pulverized steel slag (PSS), all of which are abundantly available in Saudi Arabia at little or no cost, were employed in the development of the UHPC mixtures. A base mixture of UHPC without replacement of silica fume or sand was selected and a total of 24 trial mixtures of UHPC were prepared using different percentages of NP, FA, LSP, CKD, and PSS, partially replacing the silica fume and sand. Flow and 28-d compressive strength of each UHPC mixture were determined to finally select those mixtures, which satisfied the minimum flow and strength criteria of UHPC. The test results showed that the utilization of NP, FA, LSP, CKD, and PSS in production of UHPC is possible with acceptable flow and strength. A total of 10 UHPC mixtures were identified with flow and strength equal to or more than the minimum required. PMID:25197709

  19. Development of UHPC Mixtures Utilizing Natural and Industrial Waste Materials as Partial Replacements of Silica Fume and Sand

    PubMed Central

    2014-01-01

    In the exploratory study presented in this paper, an attempt was made to develop different mixtures of ultrahigh performance concrete (UHPC) using various locally available natural and industrial waste materials as partial replacements of silica fume and sand. Materials such as natural pozzolana (NP), fly ash (FA), limestone powder (LSP), cement kiln dust (CKD), and pulverized steel slag (PSS), all of which are abundantly available in Saudi Arabia at little or no cost, were employed in the development of the UHPC mixtures. A base mixture of UHPC without replacement of silica fume or sand was selected and a total of 24 trial mixtures of UHPC were prepared using different percentages of NP, FA, LSP, CKD, and PSS, partially replacing the silica fume and sand. Flow and 28-d compressive strength of each UHPC mixture were determined to finally select those mixtures, which satisfied the minimum flow and strength criteria of UHPC. The test results showed that the utilization of NP, FA, LSP, CKD, and PSS in production of UHPC is possible with acceptable flow and strength. A total of 10 UHPC mixtures were identified with flow and strength equal to or more than the minimum required. PMID:25197709

  20. Silylated melamine and cyanuric acid as precursors for imprinted and hybrid silica materials with molecular recognition properties.

    PubMed

    Arrachart, Guilhem; Carcel, Carole; Trens, Philippe; Moreau, Jöel J E; Wong Chi Man, Michel

    2009-06-15

    Two monotrialkoxysilylated compounds that consist of complementary fragments of melamine (M) and cyanuric acid (CA) have been synthesised. The molecular recognition properties of the M and CA fragments through complementary hydrogen bonds (DAD and ADA; D=donor, A=acceptor) are the key factor used to direct the formation of hybrid silica materials by using a sol-gel process. These materials were synthesised following two methods: First, an organo-bridged silsesquioxane was obtained by the hydrolysis of the two complementary monotrialkoxysilylated melamine and cyanuric acid derivatives, with fluoride ions as a catalyst. The hydrogen-bonding interactions between the two organic fragments are responsible for the formation of the bridging unit. The transcription of the assembly into the hybrid material was characterised and evidenced by solid-state NMR (29Si, 13C) and FTIR spectroscopic experiments. Second, the molecular recognition was exploited to synthesise an imprinted hybrid silica. This material was prepared by co-condensation of tetraethyl orthosilicate (TEOS) with the monosilylated cyanuric acid derivative (CA) templated by nonsilylated melamine. The melamine template was completely removed by treating the solid material with hydrochloric acid. The reintroduction of the template was performed by treating the resulting material with an aqueous suspension of melamine. These steps were monitored and analysed by several techniques, such as solid-state NMR (29Si, 13C) and FTIR spectroscopic analysis and nitrogen adsorption-desorption isotherms. PMID:19440996

  1. Application of an ampholine-functionalized hybrid organic-inorganic silica material for the SPE of aromatic amines.

    PubMed

    Chen, Yihui; Wang, Tingting; Ma, Junfeng; Liang, Zhen; Chen, Mingliang; Fang, Jianghua; Gao, Haoqi; Zhang, Lihua; Zhang, Yukui

    2014-01-01

    An SPE cartridge based on an ampholine-functionalized hybrid organic-inorganic silica sorbent has been adopted for the analysis of aromatic amines including 4-aminobiphenyl, benzidine, 2-naphthylamine, p-chloroaniline, 2,4,5-trimethylaniline, and 3,3'-dichlorobenzidine. Crucial variables governing the extraction efficiency of the material such as the pH of sample, sample loading volume, solvent used for elution, and elution volume have been thoroughly optimized. The adsorption capacities for the six aromatic amines ranged from 0.17 to 1.82 μg/mg. The recoveries of aromatic amines spiked in textile samples ranged from 78.9 to 103.0%, with RSDs of 1.1-11.9% (n = 3). Moreover, the extraction efficiency of the ampholine-functionalized hybrid organic-inorganic silica sorbent was at least comparable with that of Oasis WCX. PMID:24178632

  2. Effects of quenching, irradiation, and annealing processes on the radiation hardness of silica fiber cladding materials (I)

    NASA Astrophysics Data System (ADS)

    Wen, Jianxiang; Gong, Renxiang; Xiao, Zhongyin; Luo, Wenyun; Wu, Wenkai; Luo, Yanhua; Peng, Gang-ding; Pang, Fufei; Chen, Zhenyi; Wang, Tingyun

    2016-07-01

    Silica optical fiber cladding materials were experimentally treated by a series of processes. The treatments involved quenching, irradiation, followed by annealing and subsequent re-irradiation, and they were conducted in order to improve the radiation hardness. The microstructural properties of the treated materials were subsequently investigated. Following the treatment of the optical fiber cladding materials, the results from the electron spin resonance (ESR) analysis demonstrated that there was a significant decrease in the radiation-induced defect structures. The ESR signals became significantly weaker when the samples were annealed at 1000 °C in combination with re-irradiation. In addition, the microstructure changes within the silica optical fiber cladding material were also analyzed using Raman spectroscopy. The experimental results demonstrate that the Sisbnd Osbnd Si bending vibrations at ω3 = 800-820 cm-1 and ω4 = 1000-1200 cm-1 (with longitudinal optical (LO) and transverse optical (TO) splitting bands) were relatively unaffected by the quenching, irradiation, and annealing treatments. In particular, the annealing process resulted in the disappearance of the defect centers; however, the LO and TO modes at the ω3 and ω4 bands were relatively unchanged. With the additional support of the ESR test results, we can conclude that the combined treatment processes can significantly enhance the radiation hardness properties of the optical fiber cladding materials.

  3. Effect of silica coating and silane surface treatment on the bond strength of soft denture liner to denture base material

    PubMed Central

    ATSÜ, Saadet; KESKİN, Yasemin

    2013-01-01

    Objective This study investigated the effects of different surface treatments on the tensile bond strength of an autopolymerizing silicone denture liner to a denture base material after thermocycling. Material and Methods Fifty rectangular heat-polymerized acrylic resin (QC-20) specimens consisting of a set of 2 acrylic blocks were used in the tensile test. Specimens were divided into 5 test groups (n=10) according to the bonding surface treatment as follows: Group A, adhesive treatment (Ufi Gel P adhesive) (control); Group S, sandblasting using 50-µm Al2O3; Group SCSIL, silica coating using 30-µm Al2O3 modified by silica and silanized with silane agent (CoJet System); Group SCA, silica coating and adhesive application; Group SCSILA, silica coating, silane and adhesive treatment. The 2 PMMA blocks were placed into molds and the soft lining materials (Ufi Gel P) were packed into the space and polymerized. All specimens were thermocycled (5,000 cycles) before the tensile test. Bond strength data were analyzed using 1-way ANOVA and Duncan tests. Fracture surfaces were observed by scanning electron microscopy. X-ray photoelectron spectrometer (XPS) and Fourier Transform Infrared spectrometer (FTIR) analysis were used for the chemical analysis and a profilometer was used for the roughness of the sample surfaces. Results The highest bond strength test value was observed for Group A (1.35±0.13); the lowest value was for Group S (0.28±0.07) and Group SCSIL (0.34±0.03). Mixed and cohesive type failures were seen in Group A, SCA and SCSILA. Group S and SCSIL showed the least silicone integrations and the roughest surfaces. Conclusion Sandblasting, silica coating and silane surface treatments of the denture base resin did not increase the bond strength of the silicone based soft liner. However, in this study, the chemical analysis and surface profilometer provided interesting insights about the bonding mechanism between the denture base resin and silicone soft liner

  4. Evaluation of the acid properties of porous zirconium-doped and undoped silica materials

    NASA Astrophysics Data System (ADS)

    Fuentes-Perujo, D.; Santamaría-González, J.; Mérida-Robles, J.; Rodríguez-Castellón, E.; Jiménez-López, A.; Maireles-Torres, P.; Moreno-Tost, R.; Mariscal, R.

    2006-07-01

    A series of porous silica and Zr-doped silica molecular sieves, belonging to the MCM-41 and MSU families, were prepared and characterized by X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS) and N 2 adsorption at 77 K. Their acid properties have been evaluated by NH 3-TPD, adsorption of pyridine and deuterated acetonitrile coupled to FT-IR spectroscopy and the catalytic tests of isopropanol decomposition and isomerization of 1-butene. The acidity of purely siliceous solids were, in all cases, very low, while the incorporation of Zr(IV) into the siliceous framework produced an enhancement of the acidity. The adsorption of basic probe molecules and the catalytic behaviour revealed that Zr-doped MSU-type silica was more acidic than the analogous Zr-MCM-41 solid, with a similar Zr content. This high acidity observed in the case of Zr-doped silica samples is due to the presence of surface zirconium atoms with a low coordination, mainly creating Lewis acid sites.

  5. Preparation of antibacterial composite material of natural rubber particles coated with silica and titania

    NASA Astrophysics Data System (ADS)

    Wisutiratanamanee, Apisit; Poompradub, Sirilux; Poochinda, Kunakorn

    2014-06-01

    Silica coating, followed by titania coating, was performed over spray-dried natural rubber (NR) compound for physical and anti-bacterial characterizations. Titania has a strong photo-oxidative catalytic property, which can disinfect bacteria, but may degrade NR. Therefore, silica coating was intended to form a barrier between NR and titania. First, NR particles were prepared by spray-drying of NR compound latex, formulated for household glove products, mixed with sodium dodecyl sulfate (SDS) to reduce particle agglomeration. The factorial experimental design was employed to investigate the effects of nozzle flow rate (500-700 Lh-1), inlet air temperature (110-150 °C), SDS content (35-55 phr) and mass flow rate (1.2-1.7 g rubber/min) on NR yield and moisture content. Then, the NR compound particles prepared at the optimum condition were coated with silica, using tetraethoxysilane (TEOS) as the precursor, by chemical vapor deposition (CVD) at 60 °C for 2-48 hours. Next, the particles were coated with titania using titanium tetrafluoride (TiF4) by liquid phase deposition (LPD) at 60 ºC for 4-8 hours. The NR composites were characterized for surface morphology by SEM, silica and titania content by TGA and EDX. The NR composites were found to cause more than 99% reduction of Escherichia coli and Staphylococcus aureus under 1-hour exposure to natural light.

  6. Probing local pH-based precipitation processes in self-assembled silica-carbonate hybrid materials

    NASA Astrophysics Data System (ADS)

    Opel, Julian; Hecht, Mandy; Rurack, Knut; Eiblmeier, Josef; Kunz, Werner; Cölfen, Helmut; Kellermeier, Matthias

    2015-10-01

    Crystallisation of barium carbonate in the presence of silica can lead to the spontaneous assembly of highly complex superstructures, consisting of uniform and largely co-oriented BaCO3 nanocrystals that are interspersed by a matrix of amorphous silica. The formation of these biomimetic architectures (so-called silica biomorphs) is thought to be driven by a dynamic interplay between the components, in which subtle changes of conditions trigger ordered mineralisation at the nanoscale. In particular, it has been proposed that local pH gradients at growing fronts play a crucial role in the process of morphogenesis. In the present work, we have used a special pH-sensitive fluorescent dye to directly trace these presumed local fluctuations by means of confocal laser scanning microscopy. Our data demonstrate the existence of an active region near the growth front, where the pH is locally decreased with respect to the alkaline bulk solution on a length scale of few microns. This observation provides fundamental and, for the first time, direct experimental support for the current picture of the mechanism underlying the formation of these peculiar materials. On the other hand, the absence of any temporal oscillations in the local pH - another key feature of the envisaged mechanism - challenges the notion of autocatalytic phenomena in such systems and raises new questions about the actual role of silica as an additive in the crystallisation process.Crystallisation of barium carbonate in the presence of silica can lead to the spontaneous assembly of highly complex superstructures, consisting of uniform and largely co-oriented BaCO3 nanocrystals that are interspersed by a matrix of amorphous silica. The formation of these biomimetic architectures (so-called silica biomorphs) is thought to be driven by a dynamic interplay between the components, in which subtle changes of conditions trigger ordered mineralisation at the nanoscale. In particular, it has been proposed that local

  7. Silver-coated silica beads applicable as core materials of dual-tagging sensors operating via SERS and MEF.

    PubMed

    Kim, Kwan; Lee, Yoon Mi; Lee, Hyang Bong; Shin, Kuan Soo

    2009-10-01

    We have developed dual-tagging sensors, operating via both surface-enhanced Raman scattering (SERS) and metal-enhanced fluorescence (MEF), composed of silver-coated silica beads onto which were deposited SERS markers and dye-grafted polyelectrolytes, for multiplex immunoassays. Initially, a very simple electroless-plating method was applied to prepare Ag-coated silica beads. The Raman markers were then assembled onto the Ag-coated silica beads, after which they were brought to stabilization by the layer-by-layer deposition of anionic and cationic polyelectrolytes including a dye-grafted polyelectrolyte. In the final stage, the dual-tagging sensors were assembled onto them with specific antibodies (antihuman-IgG or antirabbit-IgG) to detect target antigens (human-IgG or rabbit-IgG). The MEF signal was used as an immediate indicator of molecular recognition, while the SERS signals were subsequently used as the signature of specific molecular interactions. For this reason, these materials should find wide application, especially in the areas of biological sensing and recognition that rely heavily on optical and spectroscopic properties. PMID:20355851

  8. Naphthopyran-Based Silica Nanoparticles as New High-Performance Photoresponsive Materials.

    PubMed

    Pinto, Tânia V; Costa, Paula; Sousa, Céu M; Sousa, Carlos A D; Monteiro, Andreia; Pereira, Clara; Soares, Olívia Salomé G P; Silva, Carla S M; Pereira, Manuel Fernando R; Coelho, Paulo J; Freire, Cristina

    2016-03-23

    Hybrid nanomaterials based on the covalent grafting of silylated naphthopyrans (NPTs) onto silica nanoparticles (SiO2 NPs) were successfully prepared and studied as new photochromic materials. They were prepared by a two-step protocol consisting of (i) NPTs (derivatives from 2H-naphtho[1,2-b]pyran (2H-NPT) and 3H-naphtho[2,1-b]pyran (3H-NPT)) silylation by a microwave-assisted reaction between hydroxyl-substituted NPTs and 3-(triethoxysilyl)propyl isocyanate, followed by (ii) covalent post-grafting onto SiO2 NPs. In order to study the role of the silylation step, the analogous non-silylated nanomaterials were also prepared by direct adsorption of NPTs. The characterization techniques confirmed the successful NPTs silylation and subsequent grafting to SiO2 NPs. All SiO2-based nanomaterials revealed photoswitching behavior, following a biexponential decay. The SiO2 NPs functionalized with silylated 3H-NPTs (SiO2@S3 and SiO2@S4) presented the most promising photochromic properties, showing fast coloration/decoloration kinetics (coloring in 1 min under UV irradiation and fading in only 2 min) and high values of total color difference (ΔE*ab = 30-50). Also, the 2H-NPTs-based SiO2 NPs (SiO2@S1 and SiO2@S2) presented fast coloration and good color contrasts (ΔE*ab = 54), but slower fading kinetic rates, taking more than 2 h to return to their initial color. In contrast, the SiO2 NPs functionalized with non-silylated NPTs (SiO2@1 and SiO2@3) showed weaker color contrasts (ΔE*ab = 6-10) and slower fading kinetics, proving that the NPT silylation step was crucial to enhance the photochromic behavior of SiO2 NPs based on NPTs. Furthermore, the silylated-based nanomaterials showed good photostability upon prolonged UV light exposure, keeping their photochromic performance unchanged for at least 12 successive UV/dark cycles, anticipating interesting technological applications in several areas. PMID:26926033

  9. Prediction of the functional class of metal-binding proteins from sequence derived physicochemical properties by support vector machine approach

    PubMed Central

    Lin, HH; Han, LY; Zhang, HL; Zheng, CJ; Xie, B; Cao, ZW; Chen, YZ

    2006-01-01

    Metal-binding proteins play important roles in structural stability, signaling, regulation, transport, immune response, metabolism control, and metal homeostasis. Because of their functional and sequence diversity, it is desirable to explore additional methods for predicting metal-binding proteins irrespective of sequence similarity. This work explores support vector machines (SVM) as such a method. SVM prediction systems were developed by using 53,333 metal-binding and 147,347 non-metal-binding proteins, and evaluated by an independent set of 31,448 metal-binding and 79,051 non-metal-binding proteins. The computed prediction accuracy is 86.3%, 81.6%, 83.5%, 94.0%, 81.2%, 85.4%, 77.6%, 90.4%, 90.9%, 74.9% and 78.1% for calcium-binding, cobalt-binding, copper-binding, iron-binding, magnesium-binding, manganese-binding, nickel-binding, potassium-binding, sodium-binding, zinc-binding, and all metal-binding proteins respectively. The accuracy for the non-member proteins of each class is 88.2%, 99.9%, 98.1%, 91.4%, 87.9%, 94.5%, 99.2%, 99.9%, 99.9%, 98.0%, and 88.0% respectively. Comparable accuracies were obtained by using a different SVM kernel function. Our method predicts 67% of the 87 metal-binding proteins non-homologous to any protein in the Swissprot database and 85.3% of the 333 proteins of known metal-binding domains as metal-binding. These suggest the usefulness of SVM for facilitating the prediction of metal-binding proteins. Our software can be accessed at the SVMProt server . PMID:17254297

  10. Development and characterization of silica and titania based nano structured materials for the removal of indoor and outdoor air pollutants

    NASA Astrophysics Data System (ADS)

    Peiris, Thelge Manindu Nirasha

    Solar energy driven catalytic systems have gained popularity in environmental remediation recently. Various photocatalytic systems have been reported in this regard and most of the photocatalysts are based on well-known semiconducting material, Titanium Dioxide, while some are based on other materials such as Silicon Dioxide and various Zeolites. However, in titania based photocatalysts, titania is actively involved in the catalytic mechanism by absorbing light and generating exitons. Because of this vast popularity of titania in the field of photocatalysis it is believed that photocatalysis mainly occurs via non-localized mechanisms and semiconductors are extremely important. Even though it is still rare, photocatalysis could be localized and possible without use of a semiconductor as well. Thus, to support localized photocatalytic systems, and to compare the activity to titania based systems, degradation of organic air pollutants by nanostructured silica, titania and mixed silica titania systems were studied. New materials were prepared using two different approaches, precipitation technique (xerogel) and aerogel preparation technique. The prepared xerogel samples were doped with both metal (silver) and non-metals (carbon and sulfur) and aerogel samples were loaded with Chromium, Cobalt and Vanadium separately, in order to achieve visible light photocatalytic activity. Characterization studies of the materials were carried out using Nova BET analysis, DR UV-vis spectrometry, powder X-ray diffraction, X-ray photoelectron Spectroscopy, FT-IR spectroscopy, Transmission Electron Microscopy, etc. Kinetics of the catalytic activities was studied using a Shimadzu GCMS-QP 5000 instrument using a closed glass reactor. All the experiments were carried out in gaseous phase using acetaldehyde as the model pollutant. Kinetic results suggest that chromium doped silica systems are good UV and visible light active photocatalysts. This is a good example for a localized

  11. Real Understanding of the Nitrogen-Doping Effect on the Electrochemical Performance of Carbon Materials by Using Carbon-Coated Mesoporous Silica as a Model Material.

    PubMed

    Castro-Muñiz, Alberto; Hoshikawa, Yasuto; Kasukabe, Takatoshi; Komiyama, Hiroshi; Kyotani, Takashi

    2016-03-01

    The main aim of the present work is to precisely understand the sole effect of nitrogen doping on the electrochemical performance of porous carbon materials. To achieve this objective, the whole surface of mesoporous silica (SBA-15) was coated with a thin layer of carbon (about 0.4 nm) with and without N-doping by using acetonitrile and acetylene chemical vapor deposition, respectively. The resulting N-doped and nondoped carbon-coated silica samples have mesopore structures identical to those in the original SBA-15, and they are practically the same in terms of not only the pore size and pore structure but also the particle size distribution and particle morphology, with the exception of N-doping, which makes them unique model materials to extract the sole effect of nitrogen on the performances of electrochemical capacitors and electrocatalytic oxygen reduction. Moreover, the outstanding features of the carbon-coated silica samples allow even a quantitative understanding of the pseudocapacitance induced by nitrogen functionalities on the carbon surface in an acidic aqueous electrolyte. PMID:26859703

  12. Study of the ligands involved in metal binding to alfalfa biomass

    SciTech Connect

    Tiemann, K.J.; Gardea-Torresdey, J.L.; Sias, S.; Gamez, G.; Rodriguez, O.; Renner, M.W.; Furenlid, L.R.

    1997-12-31

    Previously performed studies have shown that the alfalfa shoot biomass can bind an appreciable amount of copper(II), nickel(II), cadmium(II), chromium(III), lead(II), and zinc(II) ions from aqueous solution. Of the seven different alfalfa populations studied, Malone and African demonstrated the highest capacity for metal binding. Laboratory experiments were performed to determine the pH profiles, time dependency, capacity for metal binding, as well as the recovery of the metals bound. For most of the metal ions studied, the biomass showed a high affinity for metal binding around pH 5.0 within a short time period. Binding capacity experiments revealed the following amounts of metal ions bound per gram of biomass: 19.7 mg Cu(II), 4.11 mg Ni(II), 7.1 mg Cd(II), 7.7 mg Cr(III), 43 mg Pb(II), and 4.9 mg Zn(II). Most of these metals were recovered from the biomass by treatment with 0.1 M HCl with the exception of Cr(III). Because no Cr(VI) binding occurred, none was recovered. Direct and indirect approaches were applied to study the possible mechanisms involved in metal binding by the alfalfa biomass. The direct approach involves investigations of the alfalfa shoot biomass by X-ray absorption spectroscopy analysis (XANES and EXAFS), which were performed at Brookhaven National Laboratory.

  13. Metal Binding Studies and EPR Spectroscopy of the Manganese Transport Regulator MntR†

    PubMed Central

    Golynskiy, Misha V.; Gunderson, William A.; Hendrich, Michael P.; Cohen, Seth M.

    2007-01-01

    Manganese transport regulator (MntR) is a member of the diphtheria toxin repressor (DtxR) family of transcription factors that is responsible for manganese homeostasis in Bacillus subtilis. Prior biophysical studies have focused on the metal-mediated DNA binding of MntR [Lieser, S. A., Davis, T. C., Helmann, J. D., and Cohen, S. M. (2003) Biochemistry 42, 12634-12642], as well as metal stabilization of the MntR structure [Golynskiy, M. V., Davis, T. C., Helmann, J. D., and Cohen, S. M. (2005) Biochemistry 44, 3380-3389], but only limited data on the metal-binding affinities for MntR are available. Herein, the metal-binding affinities of MntR were determined by using electron paramagnetic resonance (EPR) spectroscopy, as well as competition experiments with the fluorimetric dyes Fura-2 and Mag-fura-2. MntR was not capable of competing with Fura-2 for the binding of transition metal ions. Therefore, the metal-binding affinities and stoichiometries of Mag-fura-2 for Mn2+, Co2+, Ni2+, Zn2+, and Cd2+ were determined and utilized in MntR/Mag-fura-2 competition experiments. The measured Kd values for MntR metal binding are comparable to those reported for DtxR metal binding [Kd from 10-7 to 10-4 M; D’Aquino, J. A., et al. (2005) Proc. Natl. Acad. Sci. U.S.A. 102, 18408-18413], AntR [a homologue from Bacillus anthracis; Sen, K. I. et al. (2006) Biochemistry 45, 4295-4303], and generally follow the Irving-Williams series. Direct detection of the dinuclear Mn2+ site in MntR with EPR spectroscopy is presented, and the exchange interaction was determined, J = -0.2 cm-1. This value is lower in magnitude than most known dinuclear Mn2+ sites in proteins and synthetic complexes and is consistent with a dinuclear Mn2+ site with a longer Mn···Mn distance (4.4 Å) observed in some of the available crystal structures. MntR is found to have a surprisingly low binding affinity (∼160 μM) for its cognate metal ion Mn2+. Moreover, the results of DNA binding studies in the presence

  14. A systematic typology for negative Poisson's ratio materials and the prediction of complete auxeticity in pure silica zeolite JST.

    PubMed

    Siddorn, M; Coudert, F-X; Evans, K E; Marmier, A

    2015-07-21

    Single crystals can commonly have negative Poisson's ratio in a few directions; however more generalised auxeticity is rarer. We propose a typology to distinguish auxetic materials. We characterise numerous single crystals and demonstrate that partial auxeticity occurs for around 37%. We find average auxeticity to be limited to α-cristobalite and no example of complete auxeticity. We simulate two hundreds pure silica zeolites with empirical potentials and quantum chemistry methods, and for the first time identify complete auxeticity in a zeolite network, JST. PMID:26094853

  15. Quasi-continuum photoluminescence: Unusual broad spectral and temporal characteristics found in defective surfaces of silica and other materials

    SciTech Connect

    Laurence, Ted A. Bude, Jeff D.; Shen, Nan; Steele, William A.; Ly, Sonny

    2014-02-28

    We previously reported a novel photoluminescence (PL) with a distribution of fast decay times in fused silica surface flaws that is correlated with damage propensity by high fluence lasers. The source of the PL was not attributable to any known silica point defect. Due to its broad spectral and temporal features, we here give this PL the name quasi-continuum PL (QC-PL) and describe the features of QC-PL in more detail. The primary features of QC-PL include broad excitation and emission spectra, a broad distribution of PL lifetimes from 20 ps to 5 ns, continuous shifts in PL lifetime distributions with respect to emission wavelength, and a propensity to photo-bleach and photo-brighten. We found similar PL characteristics in surface flaws of other optical materials, including CaF{sub 2}, DKDP, and quartz. Based on the commonality of the features in different optical materials and the proximity of QC-PL to surfaces, we suggest that these properties arise from interactions associated with high densities of defects, rather than a distribution over a large number of types of defects and is likely found in a wide variety of structures from nano-scale composites to bulk structures as well as in both broad and narrow band materials from dielectrics to semiconductors.

  16. Silica nanoparticle addition to control the calcium-leaching in cement-based materials

    NASA Astrophysics Data System (ADS)

    Gaitero, J. J.; Sáez de Ibarra, Y.; Erkizia, E.; Campillo, I.

    2006-05-01

    The calcium leaching of the cement hydrated matrix is of vital importance for constructions like water containers, dams, bridges, etc which have to be in contact with water during their lifetime. The aim of this work is the study of the reduction of such a negative phenomenon by the addition of silica nanoparticles. Several characterisation techniques such as 29Si MAS NMR, X-ray diffraction, mercury intrusion porosimetry and EDX-microanalysis have been used to evaluate the effect of the nanoparticles in the cement matrix nanostructure and in their impact on the evolution of the Ca leaching throughout time. Subsequent analysis of the results indicates that silica nanoparticles can reduce the Ca-leaching both decreasing the amount of portlandite in the matrix and controlling the degradation rate of the C-S-H gel.

  17. Raspberry-like PS/CdTe/Silica Microspheres for Fluorescent Superhydrophobic Materials.

    PubMed

    Chang, Jinghui; Zang, Linlin; Wang, Cheng; Sun, Liguo; Chang, Qing

    2016-12-01

    Superhydrophobic particulate films were fabricated via deposition of raspberry-like fluorescent PS/CdTe/silica microspheres on clean glass substrates and surface modification. Particularly, the fluorescent microspheres were prepared by a kind of modified strategy, namely introducing poly (acrylic acid)-functionalized polystyrene microspheres and thiol-stabilized CdTe quantum dots into a hydrolysis reaction of tetraethoxysilane simultaneously. And through adjusting the reaction parameters, the polystyrene spheres with two particle sizes and three colors of CdTe quantum dots aqueous solution were obtained. Consequently, raspberry-like microspheres consist of polystyrene cores and the composite shells of CdTe quantum dots and silica. These microspheres possess a fluorescent characteristic and form a hierarchical dual roughness which was conductive to superhydrophobicity, and the hydrophobic tests also showed the contact angles of water droplets on the surface of the raspberry-like microspheres which were over 160° at room temperature. PMID:26925862

  18. Shock-wave compression of silica gel as a model material for comets

    NASA Astrophysics Data System (ADS)

    Arasuna, Akane; Okuno, Masayuki; Chen, Liliang; Mashimo, Tsutomu; Okudera, Hiroki; Mizukami, Tomoyuki; Arai, Shoji

    2016-07-01

    A shock-wave compression experiment using synthesized silica gel was investigated as a model for a comet impact event on the Earth's surface. The sample shocked at 20.7 GPa showed considerable structural changes, a release of water molecules, and the dehydration of silanol (Si-OH) that led to the formation of a new Si-O-Si network structure containing larger rings (e.g., six-membered ring of SiO4 tetrahedra). The high aftershock temperature at 20.7 GPa, which could be close to 800 °C, influenced the sample structure. However, some silanols, which were presumed to be the mutually hydrogen-bonded silanol group, remained at pressures >20.7 GPa. This type of silanol along with a small number of water molecules may remain even after shock compression at 30.9 GPa, although the intermediate structure of the sample recovered was similar to that of silica glass.

  19. Raspberry-like PS/CdTe/Silica Microspheres for Fluorescent Superhydrophobic Materials

    NASA Astrophysics Data System (ADS)

    Chang, Jinghui; Zang, Linlin; Wang, Cheng; Sun, Liguo; Chang, Qing

    2016-02-01

    Superhydrophobic particulate films were fabricated via deposition of raspberry-like fluorescent PS/CdTe/silica microspheres on clean glass substrates and surface modification. Particularly, the fluorescent microspheres were prepared by a kind of modified strategy, namely introducing poly (acrylic acid)-functionalized polystyrene microspheres and thiol-stabilized CdTe quantum dots into a hydrolysis reaction of tetraethoxysilane simultaneously. And through adjusting the reaction parameters, the polystyrene spheres with two particle sizes and three colors of CdTe quantum dots aqueous solution were obtained. Consequently, raspberry-like microspheres consist of polystyrene cores and the composite shells of CdTe quantum dots and silica. These microspheres possess a fluorescent characteristic and form a hierarchical dual roughness which was conductive to superhydrophobicity, and the hydrophobic tests also showed the contact angles of water droplets on the surface of the raspberry-like microspheres which were over 160° at room temperature.

  20. Shock-wave compression of silica gel as a model material for comets

    NASA Astrophysics Data System (ADS)

    Arasuna, Akane; Okuno, Masayuki; Chen, Liliang; Mashimo, Tsutomu; Okudera, Hiroki; Mizukami, Tomoyuki; Arai, Shoji

    2016-03-01

    A shock-wave compression experiment using synthesized silica gel was investigated as a model for a comet impact event on the Earth's surface. The sample shocked at 20.7 GPa showed considerable structural changes, a release of water molecules, and the dehydration of silanol (Si-OH) that led to the formation of a new Si-O-Si network structure containing larger rings (e.g., six-membered ring of SiO4 tetrahedra). The high aftershock temperature at 20.7 GPa, which could be close to 800 °C, influenced the sample structure. However, some silanols, which were presumed to be the mutually hydrogen-bonded silanol group, remained at pressures >20.7 GPa. This type of silanol along with a small number of water molecules may remain even after shock compression at 30.9 GPa, although the intermediate structure of the sample recovered was similar to that of silica glass.

  1. Electrospun Ultrafine Fiber Composites Containing Fumed Silica: From Solution Rheology to Materials with Tunable Wetting.

    PubMed

    Dufficy, Martin K; Geiger, Mackenzie T; Bonino, Christopher A; Khan, Saad A

    2015-11-17

    Fumed silica (FS) particles with hydrophobic (R805) or hydrophilic (A150) surface functionalities are incorporated in polyacrylonitrile (PAN) fibers by electrospinning to produce mats with controlled wettability. Rheological measurements are conducted to elucidate the particle-polymer interactions and characterize the system while microscopic and analytic tools are used to examine FS location within both fibers and films to aid in the fundamental understanding of wetting behavior. Unlike traditional polymers, we find these systems to be gel-like, yet electrospinnable; the fumed silica networks break down into smaller aggregates during the electrospinning process and disperse both within and on the surface of the fibers. Composite nanofiber mats containing R805 FS exhibit an apparent contact angle over 130° and remain hydrophobic over 30 min, while similar mats with A150 display rapid surface-wetting with a static contact angle of ∼30°. Wicking experiments reveal that the water absorption properties can be further manipulated, with R805 FS-impregnated mats taking up only 8% water relative to mat weight in 15 min. In contrast, PAN fibers containing A150 FS absorb 425% of water in the same period, even more than the pure PAN fiber (371%). The vastly different responses to water demonstrate the versatility of FS in surface modification, especially for submicron fibrous mats. The role of fumed silica in controlling wettability is discussed in terms of their surface functionality, placement on nanofibers and induced surface roughness. PMID:26477547

  2. A sulfonic-azobenzene-grafted silica amphiphilic material: a versatile stationary phase for mixed-mode chromatography.

    PubMed

    Qiu, Hongdeng; Zhang, Mingliang; Gu, Tongnian; Takafuji, Makoto; Ihara, Hirotaka

    2013-12-23

    A novel sulfonic-azobenzene-functionalized amphiphilic silica material was synthesized through the preparation of a new sulfonic azobenzene monomer and its grafting on mercaptopropyl-modified silica by a surface-initiated radical chain-transfer reaction. The synthesis was confirmed by infrared spectra, elemental analysis, and thermogravimetric analysis. This new material was successfully applied as a new kind of mixed-mode stationary phase in liquid chromatography. This allows an exceptionally flexible adjustment of retention and selectivity by tuning the experimental conditions. The distinct separation mechanisms were outlined by selected examples of chromatographic separations in the different modes. In reversed-phase liquid chromatography, this new stationary phase presented specific chromatographic performance when evaluated using a Tanaka test mixture. Seven dinitro aromatic isomers, four steroids, and seven flavonoids were separated successfully in simple reversed-phase mode. This stationary phase can also be used in hydrophilic interaction chromatography because of the existing polar functional groups; for this, nucleosides and their bases were used as a test mixture. Interestingly, the same nucleosides and bases can also be separated in per aqueous liquid chromatography using the same stationary phase. Three ginsenosides including Rg1, Re, and Rb1 were successfully separated in hydrophilic mode. There is the potential for more applications to benefit from this useful column. PMID:24353082

  3. Patterning of silica MCM-41 high-order material on a glass surface by XeCl laser irradiation

    NASA Astrophysics Data System (ADS)

    Panahibakhsh, Somayeh; Hadi Maleki, Mohammad; Jelvani, Saeid

    2015-08-01

    Silica glass samples (with the compositions of SiO2 96.66, Na2O 0.62, MgO 0.80, Al2O3 1.66 and CaO 0.26 in wt%) were irradiated with 5 pulses of a nanosecond XeCl excimer laser at a fluence of 300mJ/cm2 and 1Hz repetition rate. Scanning electron microscopy images of the irradiated area showed that micro and nanostructures were developed on the glass surface by the XeCl laser irradiation. It is found from energy dispersive X-ray analysis, X-ray diffraction analysis and micro-Raman spectroscopy that the structures are fine crystalline patterns of silica MCM-41 materials. It is supposed that crystallization of the glass is induced through the absorption of 308nm wavelength XeCl laser irradiation by silicon ions. Therefore, it is proposed that this method of spatially selective crystallization of glass could be applicable to other glass materials for potential optics and photonics applications.

  4. Application of Hectorite-Coated Silica Gel Particles as a Packing Material for Chromatographic Resolution.

    PubMed

    Okada, Tomohiko; Kumasaki, Aisaku; Shimizu, Kei; Yamagishi, Akihiko; Sato, Hisako

    2016-08-01

    A new type of clay column particles was prepared, in which a hectorite layer (∼0.1 µm thickness) covered uniformly the surface of amorphous silica particles with an average radius of 5 µm (ref. Okada et al., The Journal of Physical Chemistry C, 116, 21864-21869 (2012)). The hectorite layer was fully ion-exchanged with Δ-[Ru(phen)3](2+) (phen = 1,10-phenanthroline) ions by being immersed in a methanol solution of Δ-[Ru(phen)3](ClO4)2 (1 mM). The modified silica gel particles thus prepared were packed into a stainless steel tube (4 mm (i.d.) × 25 cm) as a high-performance liquid chromatography column. Optical resolution was achieved when the racemic mixtures of several metal complexes or organic molecules were eluted with methanol. In the case of tris(acetylacetonato)ruthenium(III) ([Ru(acac)3]), for example, the Λ- and Δ-enantiomers gave an elution volume of 2.6 and 3.0 mL, respectively, with the separation factor of 1.2. The total elution volume (5 mL) was nearly one-tenth for the previously reported column of the same size (RU-1 (Shiseido Co., Ltd.)) packed with the spray-dried particles of synthetic hectorite (average radius 5 µm) ion-exchanged by the same Ru(II) complexes. PMID:27130880

  5. Fluorescent core-shell silica nanoparticles: an alternative radiative materials platform

    NASA Astrophysics Data System (ADS)

    Herz, Erik; Burns, Andrew; Lee, Stephanie; Sengupta, Prabuddha; Bonner, Daniel; Ow, Hooisweng; Liddell, Chekesha; Baird, Barbara; Wiesner, Ulrich

    2006-02-01

    We report on monodisperse fluorescent core-shell silica nanoparticles (C dots) with enhanced brightness and photostability as compared to parent free dye in aqueous solution. Dots containing either tetramethylrhodamine or 7-nitrobenz-2-oxa-1,3-diazole dyes with diameters ranging from tens of nanometers to microns are discussed. The benefits of the core-shell architecture are described in terms of enhanced fluorescent yield of the fluorophores in the quasi-solid-state environment within the particle as compared with parent free dye in water. Several applications of these particles in the fields of photonics and the life sciences are discussed. Specifically, fluorescent core-shell silica nanoparticles are investigated as an active medium for photonic building blocks assembled on zinc sulfide-based seed particles. Initial assembly results for these composite raspberry structures are shown. Finally, applications in the life sciences are explored, including targeting of specific antibody receptors using these single-emission nanoparticles. We expand on single-emission core-shell architecture to incorporate environmentally-sensitive fluorophores to create quantitative ratiometric nanoscale sensors capable of interrogating chemical concentrations on the sub-cellular to molecular levels and demonstrate initial results of intracellular pH imaging. The concept of a single particle laboratory (SPL) is introduced as an active investigator of its environment.

  6. Silica colloidal crystals as emerging materials for high-throughput protein electrophoresis.

    PubMed

    Njoya, Nadine K; Birdsall, Robert E; Wirth, Mary J

    2013-10-01

    Silica colloidal crystals are a new type of media for protein electrophoresis, and they are assessed for their promise in rapidly measuring aggregation of monoclonal antibodies. The nature of silica colloidal crystals is described in the context of the need for a high-throughput separation tool for optimizing the formulations of protein drugs for minimal aggregation. The fundamental relations between molecular weight and mobility in electrophoresis are used to make a theoretical comparison of selectivity between gels and colloidal crystals. The results show that the selectivity is similar for these media, but slightly higher, 10%, for gels, and the velocity is inherently lower than that for gels due to the smaller free volume fraction. These factors are more than compensated for by lower broadening in colloidal crystals. These new media give plate heights of only 0.15 μm for the antibody monomer and 0.42 μm for the antibody dimer. The monoclonal antibody is separated from its dimer in 72 s over a distance of only 6.5 mm. This is five times faster than size-exclusion chromatography, with more than tenfold miniaturization, and amenable to parallel separations, all of which are promising for the design of high-throughput devices for optimizing protein drug formulations. PMID:23800834

  7. Time-Resolved Imaging of Material Response Following Laser-Induced Breakdown in the Bulk and Surface of Fused Silica

    SciTech Connect

    Raman, R N; Negres, R A; DeMange, P; Demos, S G

    2010-02-04

    Optical components within high energy laser systems are susceptible to laser-induced material modification when the breakdown threshold is exceeded or damage is initiated by pre-existing impurities or defects. These modifications are the result of exposure to extreme conditions involving the generation of high temperatures and pressures and occur on a volumetric scale of the order of a few cubic microns. The response of the material following localized energy deposition, including the timeline of events and the individual processes involved during this timeline, is still largely unknown. In this work, we investigate the events taking place during the entire timeline in both bulk and surface damage in fused silica using a set of time-resolved microscopy systems. These microscope systems offer up to 1 micron spatial resolution when imaging static or dynamic effects, allowing for imaging of the entire process with adequate temporal and spatial resolution. These systems incorporate various pump-probe geometries designed to optimize the sensitivity for detecting individual aspects of the process such as the propagation of shock waves, near-surface material motion, the speed of ejecta, and material transformations. The experimental results indicate that the material response can be separated into distinct phases, some terminating within a few tens of nanoseconds but some extending up to about 100 microseconds. Overall the results demonstrate that the final characteristics of the modified region depend on the material response to the energy deposition and not on the laser parameters.

  8. New nanostructured silica incorporated with isolated Ti material for the photocatalytic conversion of CO2 to fuels

    NASA Astrophysics Data System (ADS)

    Akhter, Parveen; Hussain, Murid; Saracco, Guido; Russo, Nunzio

    2014-04-01

    In this work, new nanoporous silica (Korea Advanced Institute of Science and Technology-6 (KIT-6)-dried or KIT-6-calcined) incorporated with isolated Ti materials with different Si/Ti ratios (Si/Ti = 200, 100, and 50) has been synthesized and investigated to establish photocatalytic reduction of CO2 in the presence of H2O vapors. The properties of the materials have been characterized through N2 adsorption/desorption, UV-vis, TEM, FT-IR, and XPS analysis techniques. The intermediate amount of the isolated Ti (Si/Ti = 100) has resulted to be more uniformly distributed on the surface and within the three-dimensional pore structure of the KIT-6 material, without its structure collapsing, than the other two ratios (Si/Ti = 200 and 50). However, titania agglomerates have been observed to have formed due to the increased Ti content (Si/Ti = 50). The Ti-KIT-6 (calcined) materials in the reaction showed higher activity than the Ti-KIT-6 (dried) materials, which produced CH4, H2, CO, and CH3OH (vapors) as fuel products. The Ti-KIT-6 (Si/Ti = 100) material also showed more OH groups, which are useful to obtain a higher production rate of the products, particularly methane, which was even higher than the rate of the best commercial TiO2 (Aeroxide P25, Evonik Industries AG, Essen, Germany) photocatalyst.

  9. Oxidized dextran facilitated synthesis of a silica-based concanavalin a material for lectin affinity enrichment of glycoproteins/glycopeptides.

    PubMed

    Liu, Yujie; Fu, Dongmei; Yu, Long; Xiao, Yuansheng; Peng, Xiaojun; Liang, Xinmiao

    2016-07-15

    Lectin affinity chromatography (LAC) is an important enrichment technique in glycoproteomics analysis. In order to improve the effectiveness of enrichment, it is necessary to develop LAC materials with high specificity and efficiency. Herein, using oxidized dextran as the spacer, a silica-based concanavalin A material (SiO2-ODex Con A) was synthesized to enrich glycoproteins/glycopeptides. For comparison, the SiO2-Ald Con A material was synthesized using conventional (3-glycidoxypropyl) triethoxysilane (GPMS) as the initial spacer arm. The analytical merits of both Con A materials, such as non-specific adsorption, binding capacity and trapping efficiency, have been evaluated using ovalbumin. Under high performance liquid affinity chromatography (HPLAC) mode, the SiO2-ODex Con A material was highly effective in the enrichment of glycoproteins/glycopeptides attached to high-mannose-type and bi-antennary complex-type glycans. The promising potential of the SiO2-ODex Con A material was demonstrated by selective fractionation of glycoproteins from complex biological samples for glycosylation analysis. PMID:27289501

  10. New nanostructured silica incorporated with isolated Ti material for the photocatalytic conversion of CO2 to fuels

    PubMed Central

    2014-01-01

    In this work, new nanoporous silica (Korea Advanced Institute of Science and Technology-6 (KIT-6)-dried or KIT-6-calcined) incorporated with isolated Ti materials with different Si/Ti ratios (Si/Ti = 200, 100, and 50) has been synthesized and investigated to establish photocatalytic reduction of CO2 in the presence of H2O vapors. The properties of the materials have been characterized through N2 adsorption/desorption, UV-vis, TEM, FT-IR, and XPS analysis techniques. The intermediate amount of the isolated Ti (Si/Ti = 100) has resulted to be more uniformly distributed on the surface and within the three-dimensional pore structure of the KIT-6 material, without its structure collapsing, than the other two ratios (Si/Ti = 200 and 50). However, titania agglomerates have been observed to have formed due to the increased Ti content (Si/Ti = 50). The Ti-KIT-6 (calcined) materials in the reaction showed higher activity than the Ti-KIT-6 (dried) materials, which produced CH4, H2, CO, and CH3OH (vapors) as fuel products. The Ti-KIT-6 (Si/Ti = 100) material also showed more OH groups, which are useful to obtain a higher production rate of the products, particularly methane, which was even higher than the rate of the best commercial TiO2 (Aeroxide P25, Evonik Industries AG, Essen, Germany) photocatalyst. PMID:24690396

  11. Relationships of silica, barite, organic material, and sulfide minerals at the Red Dog Zn-Pb-Ag deposit, western Brooks Range, Alaska

    SciTech Connect

    Sims, D.B. . Dept. of Geosciences)

    1992-01-01

    Relationships of silica, barite, organic material, and sulfide minerals at Cominco Alaska's Red Dog mine indicate that organic material was driven from carbonaceous shale during one or more silicification and mineralization events, and deposited with barite on the seafloor. Red Dog is a strata-bound accumulation of barite, silica, and sulfide minerals. Massive sulfide mineralization consisting of sphalerite, pyrite, marcasite, and galena is concentrated within the upper portion of the Mississippian-Pennsylvanian Ikalukrok shale, and the lower portion of the conformably overlying Ikalukrok barite. Mineralization below the massive sulfide horizon comprises veins and disseminated grains of sulfide minerals in silicified shale. The concentration of sulfide minerals and silica decreases, and the total organic carbon content of shale increases with depth. Mineralization above the massive sulfide horizon comprises silicified barite with disseminated and vein-controlled sulfide minerals. The total organic carbon content of ore is generally low. Silicified Ikalukrok shale has been depleted of organic carbon with respect to unaltered shale. Within the mineralized shale and massive sulfide horizons, trace amounts of organic material occur with barite in small vugs and veins that cross-cut mineralized and silicified rock. Similar organic material also occurs in the barite section. Where the barite is silicified, the organic material pre-dates silica. Sulfide minerals pre-date, and are cogenetic with silica in altered and mineralized barite. These relationships indicate that organic material was displaced from shale and transported with a fluid that deposited it with barite on the seafloor. The zone of silica and sulfide replacement migrated or expanded upward from the shale into the barite as the thickness of the barite section increased.

  12. Biosynthesis of metal-binding polypeptides and their precursors in response to cadmium in Datura innoxia

    SciTech Connect

    Jackson, P.J.; Delhaize, E.; Kuske, C.R.

    1991-01-01

    Metal-tolerant Datura innoxia cells synthesize large amounts of a class of metal-binding polypeptides, poly({gamma}-glutamylcysteinyl) glycines (({gamma}-EC){sub n}G, n=2-5), when exposed to Cd. These polypeptides have a high affinity for Cd (2) and certain other metal ions and are thought to play a role in metal tolerance in higher plants. ({gamma}-EC){sub n}G is biosynthetically derived from glutathione. Therefore, the response of Datura cells to Cd must include an increase in production of glutathione and its precursors, since cells rapidly accumulate very high concentrations of these metal-binding polypeptides. The biosynthesis of ({gamma}-EC){sub n}Gs, glutathione, and cysteine in response to Cd exposure is described. The physiological significance of the synthesis of these polypeptides and their precursors and its relevance to Cd tolerance and metal homeostasis are discussed. 34 refs., 6 figs., 1 tab.

  13. Influence of methanol on the phase behavior of nonionic fluorinated surfactant: relation to the structure of mesoporous silica materials.

    PubMed

    Zimny, K; Blin, J L; Stébé, M J

    2009-02-15

    We have investigated the effect of methanol addition on the R(F)(8)(EO)(9) and R(F)(7)(EO)(8) surfactant-based systems. While upon the addition of methanol the L(1) micellar phase grows, the direct hexagonal (H(1)) and the lamellar (L(alpha)) liquid crystals progressively melt with the increase of alcohol content. Phase behavior and SAXS measurements proved that methanol molecules interact with the oxyethylene units of the surfactant. This involves a folding up of the hydrophobic chains in the liquid crystal phases. Moreover, for the R(F)(7)(EO)(8) surfactant, the cloud point curve is shifted to high temperatures upon addition of alcohol. Starting from these systems, we have prepared mesoporous materials. Results show that due to the hydrogen bonds between the alcohol and the EO groups, the hexagonal structure of the mesostructured silica obtained from R(F)(8)(EO)(9) is lost when the content of CH(3)OH is increased. In contrast, for the compounds prepared from the R(F)(7)(EO)(8)-based system, the pore ordering occurs in the presence of alcohol. This phenomenon has been related to the moving of the cloud point curve toward high temperatures with the addition of methanol. Our study reveals also that under our conditions the methanol released during the hydrolysis of the silica precursor does not affect the self-assembly mechanism in a positive or negative way. PMID:19058809

  14. Method 1664, Revision A: n-hexane extractable material (HEM; oil and grease) and silica gel treated n-hexane extractable material (SGT-HEM; non-polar material) by extraction and gravimetry

    SciTech Connect

    Not Available

    1999-02-01

    This method is for determination of n-hexane extractable material (HEM; oil and grease) and n-hexane extractable material that is not adsorbed by silica gel (SGT-HEM; non-polar material) in surface and saline waters and industrial and domestic aqueous wastes. Extractable materials that may be determined are relatively non-volatile hydrocarbons, vegetable oils, animal fats, waxes, soaps, greases, and related materials. This method is capable of measuring HEM and SGT-HEM in the range of 5 to 1000 mg/L, and may be extended to higher levels by analysis of a smaller sample volume collected separately.

  15. Imaging System to Measure Kinetics of Material Cluster Ejection During Exit-Surface Damage Initiation and Growth in Fused Silica

    SciTech Connect

    Raman, R N; Negres, R A; Demos, S G

    2009-10-29

    Laser-induced damage on the surface of optical components typically is manifested by the formation of microscopic craters that can ultimately degrade the optics performance characteristics. It is believed that the damage process is the result of the material exposure to high temperatures and pressures within a volume on the order of several cubic microns located just below the surface. The response of the material following initial localized energy deposition by the laser pulse, including the timeline of events and the individual processes involved during this timeline, is still largely unknown. In this work we introduce a time-resolved microscope system designed to enable a detailed investigation of the sequence of dynamic events involved during surface damage. To best capture individual aspects of the damage timeline, this system is employed in multiple imaging configurations (such as multi-view image acquisition at a single time point and multi-image acquisition at different time points of the same event) and offers sensitivity to phenomena at very early delay times. The capabilities of this system are demonstrated with preliminary results from the study of exit-surface damage in fused silica. The time-resolved images provide information on the material response immediately following laser energy deposition, the processes later involved during crater formation or growth, the material ejecta kinetics, and overall material motion and transformation. Such results offer insight into the mechanisms governing damage initiation and growth in the optical components of ICF class laser systems.

  16. Generation of laser-induced periodic surface structures on transparent material-fused silica

    NASA Astrophysics Data System (ADS)

    Schwarz, Simon; Rung, Stefan; Hellmann, Ralf

    2016-05-01

    We report on a comparison between simulated and experimental results for the generation of laser-induced periodic surface structures with low spatial frequency on dielectrics. Using the established efficacy factor theory extended by a Drude model, we determine the required carrier density for the generation of low spatial frequency LIPSS (LSFL) and forecast their periodicity and orientation. In a subsequent calculative step, we determine the fluence of ultrashort laser pulses necessary to excite this required carrier density in due consideration of the pulse number dependent ablation threshold. The later calculation is based on a rate equation including photo- and avalanche ionization and derives appropriate process parameters for a selective generation of LSFL. Exemplarily, we apply this approach to the generation of LSFL on fused silica using a 1030 nm femtosecond laser. The experimental results for the orientation and spatial periodicity of LSFL reveal excellent agreement with the simulation.

  17. Parameters affecting the efficient delivery of mesoporous silica nanoparticle materials and gold nanorods into plant tissues by the biolistic method.

    PubMed

    Martin-Ortigosa, Susana; Valenstein, Justin S; Sun, Wei; Moeller, Lorena; Fang, Ning; Trewyn, Brian G; Lin, Victor S-Y; Wang, Kan

    2012-02-01

    Applying nanotechnology to plant science requires efficient systems for the delivery of nanoparticles (NPs) to plant cells and tissues. The presence of a cell wall in plant cells makes it challenging to extend the NP delivery methods available for animal research. In this work, research is presented which establishes an efficient NP delivery system for plant tissues using the biolistic method. It is shown that the biolistic delivery of mesoporous silica nanoparticle (MSN) materials can be improved by increasing the density of MSNs through gold plating. Additionally, a DNA-coating protocol is used based on calcium chloride and spermidine for MSN and gold nanorods to enhance the NP-mediated DNA delivery. Furthermore, the drastic improvement of NP delivery is demonstrated when the particles are combined with 0.6 μm gold particles during bombardment. The methodology described provides a system for the efficient delivery of NPs into plant cells using the biolistic method. PMID:22174078

  18. Thermolytic Conversion of a bis(alkoxy)tris(siloxy)tantalum(V)Single-Source Molecular Precursor to Catalytic Tantala-SilicaMaterials

    SciTech Connect

    Brutchey, Robert L.; Lugmair, Claus G.; Schebaum, Lugmair O.; Tilley, T. Don

    2004-10-13

    The new complex ({sup i}PrO){sub 2}Ta[OSi(O{sup t}Bu){sub 3}]{sub 3} (1) was prepared via silanolysis of Ta(O{sup i}Pr){sub 5} with ({sup t}BuO){sub 3}SiOH and is a useful structural and spectroscopic (NMR, FTIR) model of Ta(V) on silica. The complex was also used to prepare tantalum-containing silica materials, via the thermolytic molecular precursor method (yielding Ta{sub 2}O{sub 5}{center_dot}6SiO{sub 2} and Ta{sub 2}O{sub 5}{center_dot}18SiO{sub 2}) or by grafting 1 onto mesoporous SBA-15 silica (yielding a surface-supported tantala species, TaSBA-15). The solution phase thermolysis of 1 in nonpolar media afforded homogeneous, high-surface-area (ca. 450 m{sup 2} g{sup -1}) xerogels (Ta{sub 2}O{sub 5}{center_dot}6SiO{sub 2}) that are amorphous up to approximately 1100 C. A more silica-rich tantala-silica material (Ta{sub 2}O{sub 5}{center_dot}18SiO{sub 2}) was prepared via a solution-phase co-thermolytic route with 1 and HOSi(O{sup t}Bu){sub 3}, to yield a material with a Si/Ta ratio of 9/1. It was demonstrated that tantala-silica materials are active as catalysts for cyclohexene oxidation.

  19. Performance and mechanism on a high durable silica alumina based cementitious material composed of coal refuse and coal combustion byproducts

    NASA Astrophysics Data System (ADS)

    Yao, Yuan

    Coal refuse and combustion byproducts as industrial solid waste stockpiles have become great threats to the environment. Recycling is one practical solution to utilize this huge amount of solid waste through activation as substitute for ordinary Portland cement. The central goal of this dissertation is to investigate and develop a new silica-alumina based cementitious material largely using coal refuse as a constituent that will be ideal for durable construction, mine backfill, mine sealing and waste disposal stabilization applications. This new material is an environment-friendly alternative to ordinary Portland cement. The main constituents of the new material are coal refuse and other coal wastes including coal sludge and coal combustion products (CCPs). Compared with conventional cement production, successful development of this new technology could potentially save energy and reduce greenhouse gas emissions, recycle vast amount of coal wastes, and significantly reduce production cost. A systematic research has been conducted to seek for an optimal solution for enhancing pozzolanic reactivity of the relatively inert solid waste-coal refuse in order to improve the utilization efficiency and economy benefit for construction and building materials. The results show that thermal activation temperature ranging from 20°C to 950°C significantly increases the workability and pozzolanic property of the coal refuse. The optimal activation condition is between 700°C to 800°C within a period of 30 to 60 minutes. Microanalysis illustrates that the improved pozzolanic reactivity contributes to the generated amorphous materials from parts of inert aluminosilicate minerals by destroying the crystallize structure during the thermal activation. In the coal refuse, kaolinite begins to transfer into metakaol in at 550°C, the chlorite minerals disappear at 750°C, and muscovite 2M1 gradually dehydroxylates to muscovite HT. Furthermore, this research examines the environmental

  20. Kinetics of the formation of 2D-hexagonal silica nanostructured materials by nonionic block copolymer templating in solution.

    PubMed

    Manet, Sabine; Schmitt, Julien; Impéror-Clerc, Marianne; Zholobenko, Vladimir; Durand, Dominique; Oliveira, Cristiano L P; Pedersen, Jan Skov; Gervais, Christel; Baccile, Niki; Babonneau, Florence; Grillo, Isabelle; Meneau, Florian; Rochas, Cyrille

    2011-10-01

    The different steps of the self-assembly in solution of several 2D-hexagonal silica nanostructured SBA-15 materials have been investigated by SAXS and SANS in situ experiments. Unique quantitative information about the shape and size evolution upon time of the micellar aggregates throughout the self-assembly process is obtained using a complete model that describes well the scattering data for the various synthesis conditions. In all cases, before the precipitation of the material, the micelles shape changes from spherical to rod-like, where the structure of the rod-like micelles is linked to the structure of the 2D-hexagonal precipitated material. In addition, the kinetics of hydrolysis of the inorganic precursor (TEOS) has been determined by in situ Raman spectroscopy. More specifically, by comparing synthesis made with different acids (HNO(3), HBr, HCl, H(2)SO(4), and H(3)PO(4)), it is found that materials prepared using the "salting-out" anions (SO(4)(2-) and H(2)PO(4)(-)) are much better ordered than with the "salting-in" anions (NO(3)(-) and Br(-)). PMID:21863844

  1. Selective enrichment of metal-binding proteins based on magnetic core/shell microspheres functionalized with metal cations.

    PubMed

    Fang, Caiyun; Zhang, Lei; Zhang, Xiaoqin; Lu, Haojie

    2015-06-21

    Metal binding proteins play many important roles in a broad range of biological processes. Characterization of metal binding proteins is important for understanding their structure and biological functions, thus leading to a clear understanding of metal associated diseases. The present study is the first to investigate the effectiveness of magnetic microspheres functionalized with metal cations (Ca(2+), Cu(2+), Zn(2+) and Fe(3+)) as the absorbent matrix in IMAC technology to enrich metal containing/binding proteins. The putative metal binding proteins in rat liver were then globally characterized by using this strategy which is very easy to handle and can capture a number of metal binding proteins effectively. In total, 185 putative metal binding proteins were identified from rat liver including some known less abundant and membrane-bound metal binding proteins such as Plcg1, Acsl5, etc. The identified proteins are involved in many important processes including binding, catalytic activity, translation elongation factor activity, electron carrier activity, and so on. PMID:25913209

  2. Study of the high-coercivity material based on ɛ-Fe2O3 nanoparticles in the silica gel matrix

    NASA Astrophysics Data System (ADS)

    Balaev, D. A.; Yakushkin, S. S.; Dubrovskii, A. A.; Bukhtiyarova, G. A.; Shaikhutdinov, K. A.; Martyanov, O. N.

    2016-04-01

    We report the results of investigations of ɛ-Fe2O3 magnetic nanoparticles obtained by incipient wetness impregnation of silica gel. It was established that the obtained samples with an iron content of 12‒16% mass % containing ɛ-Fe2O3 nanoparticles with an average size of 10 nm on the silica gel surface exhibit a room-temperature coercivity of about 10 kOe. Along with fabrication simplicity, this fact makes the prepared samples promising for application as a magnetically hard material.

  3. Synthesis and characterization of novel macroporous silica-polymer-calixcrown hybrid supramolecular recognition materials for effective separation of cesium.

    PubMed

    Xiao, Chengliang; Zhang, Anyun; Chai, Zhifang

    2014-02-28

    Two novel macroporous silica-polymer-calixcrown hybrid supramolecular recognition materials, 25,27-bis(n-octyloxy)calix[4]arene-crown-6 (BnOCalix[4]C6)/SiO2-P and 25,27-bis(i-octyloxy)calix[4]arene-crown-6 (BiOCalix[4]C6)/SiO2-P were synthesized by in situ polymerization and impregnation techniques. The obtained materials were characterized by scanning electron microscope (SEM), particle size distribution, nitrogen adsorption-desorption isotherms, thermogravimetric analysis (TGA), Fourier transform infrared (FT-IR) spectroscopy, (29)Si solid-state NMR, and powder X-ray diffraction (XRD). The adsorption of some typical fission and non-fission products Na(I), K(I), Rb(I), Cs(I), Sr(II), Ba(II), La(III), Y(III), Pd(II), Ru(III), Zr(IV), and Mo(VI) onto BnOCalix[4]C6/SiO2-P and BiOCalix[4]C6/SiO2-P in HNO3 solution was investigated. The bleeding of the materials in HNO3 solution was evaluated by analysis of total organic carbon (TOC). BnOCalix[4]C6/SiO2-P and BiOCalix[4]C6/SiO2-P exhibited excellent adsorption ability and high selectivity for Cs(I) over all the other tested metals. PMID:24440652

  4. Fungus-Mediated Preferential Bioleaching of Waste Material Such as Fly - Ash as a Means of Producing Extracellular, Protein Capped, Fluorescent and Water Soluble Silica Nanoparticles

    PubMed Central

    Khan, Shadab Ali; Uddin, Imran; Moeez, Sana; Ahmad, Absar

    2014-01-01

    In this paper, we for the first time show the ability of the mesophilic fungus Fusarium oxysporum in the bioleaching of waste material such as Fly-ash for the extracellular production of highly crystalline and highly stable, protein capped, fluorescent and water soluble silica nanoparticles at ambient conditions. When the fungus Fusarium oxysporum is exposed to Fly-ash, it is capable of selectively leaching out silica nanoparticles of quasi-spherical morphology within 24 h of reaction. These silica nanoparticles have been completely characterized by UV-vis spectroscopy, Photoluminescence (PL), Transmission electron microscopy (TEM), X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FTIR) and Energy dispersive analysis of X-rays (EDAX). PMID:25244567

  5. Fungus-mediated preferential bioleaching of waste material such as fly - ash as a means of producing extracellular, protein capped, fluorescent and water soluble silica nanoparticles.

    PubMed

    Khan, Shadab Ali; Uddin, Imran; Moeez, Sana; Ahmad, Absar

    2014-01-01

    In this paper, we for the first time show the ability of the mesophilic fungus Fusarium oxysporum in the bioleaching of waste material such as Fly-ash for the extracellular production of highly crystalline and highly stable, protein capped, fluorescent and water soluble silica nanoparticles at ambient conditions. When the fungus Fusarium oxysporum is exposed to Fly-ash, it is capable of selectively leaching out silica nanoparticles of quasi-spherical morphology within 24 h of reaction. These silica nanoparticles have been completely characterized by UV-vis spectroscopy, Photoluminescence (PL), Transmission electron microscopy (TEM), X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FTIR) and Energy dispersive analysis of X-rays (EDAX). PMID:25244567

  6. Microstructure investigation on micropore formation in microporous silica materials prepared via a catalytic sol-gel process by small angle X-ray scattering.

    PubMed

    Shimizu, Wataru; Hokka, Junsuke; Sato, Takaaki; Usami, Hisanao; Murakami, Yasushi

    2011-08-01

    The so-called sol-gel technique has been shown to be a template-free, efficient way to create functional porous silica materials having uniform micropores. This appears to be closely linked with a postulation that the formation of weakly branched polymer-like aggregates in a precursor solution is a key to the uniform micropore generation. However, how such a polymer-like structure can precisely be controlled, and further, how the generated low-fractal dimension solution structure is imprinted on the solid silica materials still remain elusive. Here we present fabrication of microporous silica from tetramethyl orthosilicate (TMOS) using a recently developed catalytic sol-gel process based on a nonionic hydroxyacetone (HA) catalyst. Small angle X-ray scattering (SAXS), nitrogen adsorption porosimetry, and transmission electron microscope (TEM) allowed us to observe the whole structural evolution, ranging from polymer-like aggregates in the precursor solution to agglomeration with heat treatment and microporous morphology of silica powders after drying and hydrolysis. Using the HA catalyst with short chain monohydric alcohols (methanol or ethanol) in the precursor solution, polymer-like aggregates having microscopic correlation length (or mesh-size) < 2 nm and low fractal dimensions ∼2, which is identical to that of an ideal coil polymer, can selectively be synthesized, yielding the uniform micropores with diameters <2 nm in the solid materials. In contrast, the absence of HA or substitution of 1-propanol led to considerably different scattering behavior reflecting the particle-like aggregate formation in the precursor solution, which resulted in the formation of mesopores (diameter >2 nm) in the solid product due to apertures between the particle-like aggregates. The data demonstrate that the extremely fine porous silica architecture comes essentially from a gaussian polymer-like nature of the silica aggregates in the precursor having the microscopic mesh-size and

  7. Sol-gel synthesis of nanocomposite materials based on lithium niobate nanocrystals dispersed in a silica glass matrix

    NASA Astrophysics Data System (ADS)

    Marenna, Elisa; Aruta, Carmela; Fanelli, Esther; Barra, Mario; Pernice, Pasquale; Aronne, Antonio

    2009-05-01

    With the final goal to obtain thin films containing stoichiometric lithium niobate nanocrystals embedded in an amorphous silica matrix, the synthesis strategy used to set a new inexpensive sol-gel route to prepare nanocomposite materials in the Li 2O-Nb 2O 5-SiO 2 system is reported. In this route, LiNO 3, NbCl 5 and Si(OC 2H 5) 4 were used as starting materials. The gels were annealed at different temperatures and nanocrystals of several phases were formed. Futhermore, by controlling the gel compositions and the synthesis parameters, it was possible to obtain LiNbO 3 as only crystallizing phase. LiNbO 3-SiO 2 nanocomposite thin films on Si-SiO 2 and Al 2O 3 substrates were grown. The LiNbO 3 average size, increasing with the annealing temperature, was 27 nm for a film of composition 10Li 2O-10Nb 2O 5-80SiO 2 heated 2 h at 800 °C. Electrical investigation revealed that the nanocrystals size strongly affects the film conductivity and the occurrence of hysteretic current-voltage curves.

  8. MamO Is a Repurposed Serine Protease that Promotes Magnetite Biomineralization through Direct Transition Metal Binding in Magnetotactic Bacteria

    PubMed Central

    Hershey, David M.; Ren, Xuefeng; Melnyk, Ryan A.; Browne, Patrick J.; Ozyamak, Ertan; Jones, Stephanie R.; Chang, Michelle C. Y.; Hurley, James H.; Komeili, Arash

    2016-01-01

    Many living organisms transform inorganic atoms into highly ordered crystalline materials. An elegant example of such biomineralization processes is the production of nano-scale magnetic crystals in magnetotactic bacteria. Previous studies implicated the involvement of two putative serine proteases, MamE and MamO, during the early stages of magnetite formation in Magnetospirillum magneticum AMB-1. Here, using genetic analysis and X-ray crystallography, we show that MamO has a degenerate active site, rendering it incapable of protease activity. Instead, MamO promotes magnetosome formation through two genetically distinct, noncatalytic activities: activation of MamE-dependent proteolysis of biomineralization factors and direct binding to transition metal ions. By solving the structure of the protease domain bound to a metal ion, we identify a surface-exposed di-histidine motif in MamO that contributes to metal binding and show that it is required to initiate biomineralization in vivo. Finally, we find that pseudoproteases are widespread in magnetotactic bacteria and that they have evolved independently in three separate taxa. Our results highlight the versatility of protein scaffolds in accommodating new biochemical activities and provide unprecedented insight into the earliest stages of biomineralization. PMID:26981620

  9. MamO Is a Repurposed Serine Protease that Promotes Magnetite Biomineralization through Direct Transition Metal Binding in Magnetotactic Bacteria

    DOE PAGESBeta

    Hershey, David M.; Ren, Xuefeng; Melnyk, Ryan A.; Browne, Patrick J.; Ozyamak, Ertan; Jones, Stephanie R.; Chang, Michelle C. Y.; Hurley, James H.; Komeili, Arash

    2016-03-16

    Many living organisms transform inorganic atoms into highly ordered crystalline materials. An elegant example of such biomineralization processes is the production of nano-scale magnetic crystals in magnetotactic bacteria. Previous studies have implicated the involvement of two putative serine proteases, MamE and MamO, during the early stages of magnetite formation in Magnetospirillum magneticum AMB-1. Here, using genetic analysis and X-ray crystallography, we show that MamO has a degenerate active site, rendering it incapable of protease activity. Instead, MamO promotes magnetosome formation through two genetically distinct, noncatalytic activities: activation of MamE-dependent proteolysis of biomineralization factors and direct binding to transition metal ions.more » By solving the structure of the protease domain bound to a metal ion, we identify a surface-exposed di-histidine motif in MamO that contributes to metal binding and show that it is required to initiate biomineralization in vivo. Finally, we find that pseudoproteases are widespread in magnetotactic bacteria and that they have evolved independently in three separate taxa. In conclusion, our results highlight the versatility of protein scaffolds in accommodating new biochemical activities and provide unprecedented insight into the earliest stages of biomineralization.« less

  10. Kinetic Analysis of the Metal Binding Mechanism of Escherichia coli Manganese Superoxide Dismutase

    PubMed Central

    Whittaker, Mei M.; Mizuno, Kazunori; Bächinger, Hans Peter; Whittaker, James W.

    2006-01-01

    The acquisition of a catalytic metal cofactor is an essential step in the maturation of every metalloenzyme, including manganese superoxide dismutase (MnSOD). In this study, we have taken advantage of the quenching of intrinsic protein fluorescence by bound metal ions to continuously monitor the metallation reaction of Escherichia coli MnSOD in vitro, permitting a detailed kinetic characterization of the uptake mechanism. Apo-MnSOD metallation kinetics are “gated”, zero order in metal ion for both the native Mn2+ and a nonnative metal ion (Co2+) used as a spectroscopic probe to provide greater sensitivity to metal binding. Cobalt-binding time courses measured over a range of temperatures (35–50°C) reveal two exponential kinetic processes (fast and slow phases) associated with metal binding. The amplitude of the fast phase increases rapidly as the temperature is raised, reflecting the fraction of Apo-MnSOD in an “open” conformation, and its temperature dependence allows thermodynamic parameters to be estimated for the “closed” to “open” conformational transition. The sensitivity of the metallated protein to exogenously added chelator decreases progressively with time, consistent with annealing of an initially formed metalloprotein complex (kanneal = 0.4 min−1). A domain-separation mechanism is proposed for metal uptake by apo-MnSOD. PMID:16258041

  11. A new metal binding domain involved in cadmium, cobalt and zinc transport.

    PubMed

    Smith, Aaron T; Barupala, Dulmini; Stemmler, Timothy L; Rosenzweig, Amy C

    2015-09-01

    The P1B-ATPases, which couple cation transport across membranes to ATP hydrolysis, are central to metal homeostasis in all organisms. An important feature of P1B-ATPases is the presence of soluble metal binding domains (MBDs) that regulate transport activity. Only one type of MBD has been characterized extensively, but bioinformatics analyses indicate that a diversity of MBDs may exist in nature. Here we report the biochemical, structural and functional characterization of a new MBD from the Cupriavidus metallidurans P1B-4-ATPase CzcP (CzcP MBD). The CzcP MBD binds two Cd(2+), Co(2+) or Zn(2+) ions in distinct and unique sites and adopts an unexpected fold consisting of two fused ferredoxin-like domains. Both in vitro and in vivo activity assays using full-length CzcP, truncated CzcP and several variants indicate a regulatory role for the MBD and distinct functions for the two metal binding sites. Taken together, these findings elucidate a previously unknown MBD and suggest new regulatory mechanisms for metal transport by P1B-ATPases. PMID:26192600

  12. A new metal binding domain involved in cadmium, cobalt and zinc transport

    PubMed Central

    Smith, Aaron T.; Barupala, Dulmini; Stemmler, Timothy L.; Rosenzweig, Amy C.

    2015-01-01

    The P1B-ATPases, which couple cation transport across membranes to ATP hydrolysis, are central to metal homeostasis in all organisms. An important feature of P1B-ATPases is the presence of soluble metal binding domains that regulate transport activity. Only one type of MBD has been characterized extensively, but bioinformatics analyses indicate that a diversity of MBDs may exist in nature. Here we report the biochemical, structural, and functional characterization of a new MBD from the Cupriavidus metallidurans P1B-4-ATPase CzcP (CzcP MBD). The CzcP MBD binds two Cd2+, Co2+, or Zn2+ ions in distinct and unique sites, and adopts an unexpected fold consisting of two fused ferredoxin-like domains. Both in vitro and in vivo activity assays using full length CzcP, truncated CzcP, and several variants indicate a regulatory role for the MBD and distinct functions for the two metal binding sites. Taken together, these findings elucidate a previously unknown MBD and suggest new regulatory mechanisms for metal transport by P1B-ATPases. PMID:26192600

  13. A New Metal Binding Domain Involved in Cadmium, Cobalt and Zinc Transport

    SciTech Connect

    Smith, Aaron T.; Barupala, Dulmini; Stemmler, Timothy L.; Rosenzweig, Amy C.

    2015-07-20

    In the P1B-ATPases, which couple cation transport across membranes to ATP hydrolysis, are central to metal homeostasis in all organisms. An important feature of P1B-ATPases is the presence of soluble metal binding domains (MBDs) that regulate transport activity. Only one type of MBD has been characterized extensively, but bioinformatics analyses indicate that a diversity of MBDs may exist in nature. Here we report the biochemical, structural and functional characterization of a new MBD from the Cupriavidus metallidurans P1B-4-ATPase CzcP (CzcP MBD). The CzcP MBD binds two Cd2+, Co2+ or Zn2+ ions in distinct and unique sites and adopts an unexpected fold consisting of two fused ferredoxin-like domains. Both in vitro and in vivo activity assays using full-length CzcP, truncated CzcP and several variants indicate a regulatory role for the MBD and distinct functions for the two metal binding sites. Moreover, these findings elucidate a previously unknown MBD and suggest new regulatory mechanisms for metal transport by P1B-ATPases.

  14. Characterization of a multi-metal binding biosorbent: Chemical modification and desorption studies.

    PubMed

    Abdolali, Atefeh; Ngo, Huu Hao; Guo, Wenshan; Zhou, John L; Du, Bin; Wei, Qin; Wang, Xiaochang C; Nguyen, Phuoc Dan

    2015-10-01

    This work attends to preparation and characterization of a novel multi-metal binding biosorbent after chemical modification and desorption studies. Biomass is a combination of tea waste, maple leaves and mandarin peels with a certain proportion to adsorb cadmium, copper, lead and zinc ions from aqueous solutions. The mechanism involved in metal removal was investigated by SEM, SEM/EDS and FTIR. SEM/EDS showed the presence of different chemicals and adsorbed heavy metal ions on the surface of biosorbent. FTIR of both unmodified and modified biosorbents revealed the important role of carboxylate groups in heavy metal biosorption. Desorption using different eluents and 0.1 M HCl showed the best desorption performance. The effectiveness of regeneration step by 1 M CaCl2 on five successive cycles of sorption and desorption displays this multi-metal binding biosorbent (MMBB) can effectively be utilized as an adsorbent to remove heavy metal ions from aqueous solutions in five cycles of sorption/desorption/regeneration. PMID:26162526

  15. Characterization of metal-binding bioflocculants produced by the cyanobacterial component of mixed microbial mats.

    PubMed Central

    Bender, J; Rodriguez-Eaton, S; Ekanemesang, U M; Phillips, P

    1994-01-01

    Mixed-species microbial mats that were dominated by the cyanobacterium Oscillatoria sp. and contained heterotrophic and purple autotrophic bacteria were constructed for specific bioremediation applications. When the mats were challenged with metals, production and secretion of metal-binding extracellular polysaccharide bioflocculants were observed. The concentration of these negatively charged polysaccharides was correlated with the removal of manganese from the water column beneath a surface microbial mat. Bioflocculants from an Oscillatoria sp. that was isolated from the mat were collected and concentrated for characterization. A chromatographic analysis revealed a heterogeneous population of polysaccharides with respect to charge density and molecular size. The subpopulation of polysaccharides which exhibited the highest level of flocculating activity was polyanionic and had a molecular weight of more than 200,000. A glycosyl analysis of the bioflocculants revealed the presence of galacturonic acid (2.2%) and glucuronic acid (1.86%). The presence of these components, which were negatively charged at the pH levels generated by the mats during photosynthesis (pH > 7.5), may account for the metal-binding properties of the mats. PMID:8074512

  16. Exploring the influence of the protein environment on metal-binding pharmacophores.

    PubMed

    Martin, David P; Blachly, Patrick G; McCammon, J Andrew; Cohen, Seth M

    2014-08-28

    The binding of a series of metal-binding pharmacophores (MBPs) related to the ligand 1-hydroxypyridine-2-(1H)-thione (1,2-HOPTO) in the active site of human carbonic anhydrase II (hCAII) has been investigated. The presence and/or position of a single methyl substituent drastically alters inhibitor potency and can result in coordination modes not observed in small-molecule model complexes. It is shown that this unexpected binding mode is the result of a steric clash between the methyl group and a highly ordered water network in the active site that is further stabilized by the formation of a hydrogen bond and favorable hydrophobic contacts. The affinity of MBPs is dependent on a large number of factors including donor atom identity, orientation, electrostatics, and van der Waals interactions. These results suggest that metal coordination by metalloenzyme inhibitors is a malleable interaction and that it is thus more appropriate to consider the metal-binding motif of these inhibitors as a pharmacophore rather than a "chelator". The rational design of inhibitors targeting metalloenzymes will benefit greatly from a deeper understanding of the interplay between the variety of forces governing the binding of MBPs to active site metal ions. PMID:25116076

  17. Development and evaluation of a new multi-metal binding biosorbent.

    PubMed

    Abdolali, A; Ngo, H H; Guo, W S; Lee, D J; Tung, K L; Wang, X C

    2014-05-01

    A novel multi-metal binding biosorbent (MMBB) was developed by combining a group of three from the selective natural lignocellulosic agro-industrial wastes for effectively eliminating lead, cadmium, copper and zinc from aqueous solutions. Four MMBBs with different combinations (MMBB1: tea waste, corncob, sugarcane bagasse; MMBB2: tea waste, corncob and sawdust; MMBB3: tea waste, corncob and apple peel; MMBB4: tea waste, corncob and grape stalk) were evaluated. FTIR analysis for characterizing the MMBB2 explored that the MMBB2 contains more functional groups available for multi-metals binding. Comparing among the MMBBs as well as the single group biosorbents, MMBB2 was the best biosorbent with the maximum biosorption capacities of 41.48, 39.48, 94.00 and 27.23 mg/g for Cd(II), Cu(II), Pb(II) and Zn(II), respectively. After 5 times of desorption with CaCl2, CH3COOH and NaCl as eluent, the MMBB2 still remained excellent biosorptive capacity, so as it could be well regenerated for reuse and possible recovery of metals. PMID:24405652

  18. Method to prevent recession loss of silica and silicon-containing materials in combustion gas environments

    DOEpatents

    Brun, Milivoj Konstantin; Luthra, Krishan Lal

    2003-01-01

    While silicon-containing ceramics or ceramic composites are prone to material loss in combustion gas environments, this invention introduces a method to prevent or greatly reduce the thickness loss by injecting directly an effective amount, generally in the part per million level, of silicon or silicon-containing compounds into the combustion gases.

  19. Changes in alveolar lavage materials and lung microsomal xenobiotic metabolism following exposures to HCl-washed or unwashed crystalline silica.

    PubMed

    Miles, P R; Bowman, L; Jones, W G; Berry, D S; Vallyathan, V

    1994-12-01

    Intratracheal exposures of rats to crystalline silica washed with HCl to remove iron contaminants have previously been shown to increase lung surfactant phospholipids (PL) and proteins and to alter the pulmonary microsomal cytochrome P450 system. We compared these effects of HCl-washed silica with those produced by exposures to unwashed silica and alumina. Both silica preparations produce increases in lung weights and alveolar lavage PL and proteins, but to different degrees. The increases produced by HCl-washed vs unwashed silica are lung weights, 2.2- vs 1.3-fold; lavage PL, 25.9- vs 3.7-fold; and lavage proteins, 11.1- vs 3.2-fold, respectively. Although the two silica particles increase lung microsomal protein concentrations (expressed per gram lung) by 50-60%, their effects on cytochrome P-450-mediated xenobiotic metabolism are quite different. Exposure to HCl-washed silica leads to a 2.3-fold increase in 7-ethoxyresorufin O-deethylation, a reaction catalyzed by cytochrome P4501A1, and a 0.5- to 0.6-fold reduction in 7-ethoxycoumarin O-deethylation, a reaction which may be catalyzed by cytochrome P-4502B1. Unwashed silica does not alter the metabolism of either xenobiotic when results are expressed per milligram microsomal protein. Administration of alumina produces only minor increases in lung weight and lavage PL and no effect on microsomal xenobiotic metabolism. These results show that the increases in alveolar lavage PL and proteins induced by administration of unwashed silica are exaggerated by 3- to 7-fold if the silica is treated with HCl. Furthermore, exposure to HCl-washed silica results in significant alterations of the lung microsomal cytochrome P450 system, but the unwashed silica has little effect. Although the reason(s) for these different effects is not known, measurements of iron levels and formation of hydroxyl radicals using ESR demonstrate that there is more iron associated with the unwashed than with the HCl-washed silica. PMID:7992313

  20. Formation of Mach angle profiles during wet etching of silica and silicon nitride materials

    NASA Astrophysics Data System (ADS)

    Ghulinyan, M.; Bernard, M.; Bartali, R.; Pucker, G.

    2015-12-01

    In integrated circuit technology peeling of masking photoresist films is a major drawback during the long-timed wet etching of materials. It causes an undesired film underetching, which is often accompanied by a formation of complex etch profiles. Here we report on a detailed study of wedge-shaped profile formation in a series of silicon oxide, silicon oxynitride and silicon nitride materials during wet etching in a buffered hydrofluoric acid (BHF) solution. The shape of etched profiles reflects the time-dependent adhesion properties of the photoresist to a particular material and can be perfectly circular, purely linear or a combination of both, separated by a knee feature. Starting from a formal analogy between the sonic boom propagation and the wet underetching process, we model the wedge formation mechanism analytically. This model predicts the final form of the profile as a function of time and fits the experimental data perfectly. We discuss how this knowledge can be extended to the design and the realization of optical components such as highly efficient etch-less vertical tapers for passive silicon photonics.

  1. Designing novel hybrid materials by one-pot co-condensation: from hydrophobic mesoporous silica nanoparticles to superamphiphobic cotton textiles.

    PubMed

    Pereira, C; Alves, C; Monteiro, A; Magén, C; Pereira, A M; Ibarra, A; Ibarra, M R; Tavares, P B; Araújo, J P; Blanco, G; Pintado, J M; Carvalho, A P; Pires, J; Pereira, M F R; Freire, C

    2011-07-01

    This work reports the synthesis and characterization of mesoporous silica nanoparticles (MSNs) functionalized with tridecafluorooctyltriethoxysilane (F13) and their in situ incorporation onto cotton textiles. The hybrid MSNs and the functional textiles were prepared by a one-pot co-condensation methodology between tetraethylorthosilicate (TEOS) and F13, with hexadecyltrimethylammonium chloride (CTAC) as the template and triethanolamine as the base. The influence of the F13 to TEOS molar ratio (1:10, 1:5 and 1:3) on the nanoparticle morphology, porosity, degree of functionalization, and hydro/oleophobic properties is discussed. The hybrid nanosilicas presented high colloidal stability and were spherical and monodispersed with average particle size of ∼45 nm. They also showed high surface areas, large pore volumes, and a wormhole-type mesoporous structure. The increase in the organosilane proportion during the co-condensation process led to a more radially branched wormhole-like mesoporosity, a decrease in the surface area, pore volume, and amount of surface silanol groups, and an enrichment of the surface with fluorocarbon moieties. These changes imparted hydrophobic and oleophobic properties to the materials, especially to that containing the highest F13 loading. Cotton textiles were coated with the F13-MSNs through an efficient and less time-consuming route. The combination between surface roughness and mesoporosity imparted by the MSNs, and the low surface energy provided by the organosilane resulted in superhydrophobic functional textiles. Moreover, the textile with the highest loading of fluorocarbon groups was superamphiphobic. PMID:21615151

  2. Sol-gel derived copper-doped silica glass as a sensitive material for X-ray beam dosimetry

    NASA Astrophysics Data System (ADS)

    Capoen, Bruno; Hamzaoui, Hicham El; Bouazaoui, Mohamed; Ouerdane, Youcef; Boukenter, Aziz; Girard, Sylvain; Marcandella, Claude; Duhamel, Olivier

    2016-01-01

    The light emission from a sol-gel-derived Cu-doped silica glass was studied under 10 keV X-ray irradiation using a fibered setup. Both radioluminescence (RL) and optically stimulated luminescence (OSL) were analyzed at different high dose rates up to 50 Gy/s and for different exposure times, yielding accumulated doses up to 50 kGy (in SiO2). Even if a darkening effect appears at this dose level, the material remains X-sensitive after exposure to several kGy. At low dose rate, the scintillation mechanisms are similar to photoluminescence, involving the Cu+ ions electronic levels, contrary to the nonlinear domain (for dose rates higher than 30 Gy/s). This RL, as well as the OSL, could be exploited in their linear domain to measure doses as high as 3 kGy. A thorough study of the OSL signal has shown that it must be employed with caution in order to take the fading phenomenon and the response dependency on stimulation source intensity into consideration.

  3. Graphene-coated materials using silica particles as a framework for highly efficient removal of aromatic pollutants in water

    PubMed Central

    Yang, Kaijie; Chen, Baoliang; Zhu, Lizhong

    2015-01-01

    The substantial aggregation of pristine graphene nanosheets decreases its powerful adsorption capacity and diminishes its practical applications. To overcome this shortcoming, graphene-coated materials (GCMs) were prepared by loading graphene onto silica nanoparticles (SiO2). With the support of SiO2, the stacked interlamination of graphene was held open to expose the powerful adsorption sites in the interlayers. The adsorption of phenanthrene, a model aromatic pollutant, onto the loaded graphene nanosheets increased up to 100 fold compared with pristine graphene at the same level. The adsorption of GCMs increased with the loading amount of the graphene nanosheets and dramatically decreased with the introduction of oxygen-containing groups in the graphene nanosheets. The highly hydrophobic effect and the strong π-π stacking interactions of the exposed graphene nanosheets contributed to their superior adsorption of GCMs. An unusual GCM peak adsorption coefficient (Kd) was observed with the increase in sorbate concentration. The sorbate concentration at peak Kd shifted to lower values for the reduced graphene oxide and graphene relative to the graphene oxide. Therefore, the replacement of water nanodroplets attached to the graphene nanosheets through weak non-hydrogen bonding with phenanthrene molecules via strong π-π stacking interactions is hypothesized to be an additional adsorption mechanism for GCMs. PMID:26119007

  4. Preparation and adsorption behavior of berberine hydrochloride imprinted polymers by using silica gel as sacrificed support material

    NASA Astrophysics Data System (ADS)

    Li, Hui; Li, Yuzhuo; Li, Zhiping; Peng, Xiyang; Li, Yanan; Li, Gui; Tan, Xianzhou; Chen, Gongxi

    2012-03-01

    Preparation of berberine hydrochloride (B-Cl) imprinted polymers (MIPs) based on surface imprinting technique with silica gel as sacrificial support material was performed successfully by using B-Cl as template, methacrylic acid (MAA) and ethylene glycol dimethacrylate (EGDMA) as functional monomer and cross-linker, respectively. The prepared polymers were characterized by Fourier transmission infrared spectrometry (FTIR) and scanning electron microscopy (SEM). Adsorption behavior of the MIPs for the template and its structural analogues was investigated. Sites distribution on the surface of MIPs was explored by using different isotherm adsorption models and thermodynamic parameters for the adsorption of B-Cl on the MIPs determined. Sample application and reusability for the MIPs was also evaluated. Results indicated the strong adsorption and high selectivity of the MIPs for B-Cl. Saturated adsorption capacity reached 27.2 μmol g-1 and the selectivity coefficient of the MIPs for B-Cl relative to jatrorrhizine hydrochloride (J-Cl) and palmatine palmatus hydrochloride (P-Cl) are 3.70 and 6.03, respectively. In addition, the MIPs were shown with good reusability and selectively retention ability in sample application.

  5. Immobilization of Lactobacillus rhamnosus in mesoporous silica-based material: An efficiency continuous cell-recycle fermentation system for lactic acid production.

    PubMed

    Zhao, Zijian; Xie, Xiaona; Wang, Zhi; Tao, Yanchun; Niu, Xuedun; Huang, Xuri; Liu, Li; Li, Zhengqiang

    2016-06-01

    Lactic acid bacteria immobilization methods have been widely used for lactic acid production. Until now, the most common immobilization matrix used is calcium alginate. However, Ca-alginate gel disintegrated during lactic acid fermentation. To overcome this deficiency, we developed an immobilization method in which Lactobacillus rhamnosus cells were successfully encapsulated into an ordered mesoporous silica-based material under mild conditions with a high immobilization efficiency of 78.77% by using elemental analysis. We also optimized the cultivation conditions of the immobilized L. rhamnosus and obtained a high glucose conversion yield of 92.4%. Furthermore, L. rhamnosus encapsulated in mesoporous silica-based material exhibited operational stability during repeated fermentation processes and no decrease in lactic acid production up to 8 repeated batches. PMID:26803707

  6. Ampholine-functionalized hybrid organic-inorganic silica material as sorbent for solid-phase extraction of acidic and basic compounds.

    PubMed

    Wang, Tingting; Chen, Yihui; Ma, Junfeng; Chen, Mingliang; Nie, Chenggang; Hu, Minjie; Li, Ying; Jia, Zhijian; Fang, Jianghua; Gao, Haoqi

    2013-09-20

    A novel sorbent for solid-phase extraction (SPE) was synthesized by chemical immobilization of ampholine on hybrid organic-inorganic silica material. The ampholine-functionalized hybrid organic-inorganic silica sorbent is consisted of aliphatic amine groups, carboxyl groups and long carbon chains, allowing for extraction of both acidic and basic compounds. The retention properties of the developed sorbent were evaluated for 1-hydroxy-2-naphthoic acid (HNA), 1-naphthoic acid (NA), 3-hydroxybenzoic acid (HBA), benzoic acid (BA), sorbic acid (SA), vanillic aldehyde (VA), butyl 4-hydroxybenzoate (BHB), propyl 4-hydroxybenzoate (PHB), ethyl 4-hydroxybenzoate (EHB), and methyl 4-hydroxybenzoate (MHB). The results show that such a sorbent has three types of interaction, i.e., electrostatic interaction, hydrophobic interaction, and hydrogen bonding, exhibiting high extraction efficiency towards the compounds tested. The adsorption capacities of the analytes ranged from 0.61 to 6.54μgmg(-1). The reproducibility of the sorbent preparation was evaluated at three spiking concentration levels, with relative standard deviations (RSDs) of 1.0-10.5%. The recoveries of ten acidic and basic compounds spiked in beverage Coca-Cola(®) sample ranged from 82.5% to 98.2% with RSDs less than 5.8%. Under optimum conditions, the ampholine-functionalized hybrid organic-inorganic silica sorbent rendered higher extraction efficiency for acidic compounds than that of the commercially available ampholine-functionalized silica particles, and was comparable to that of the commercial Oasis WAX and Oasis WCX. PMID:23953713

  7. Selective adsorption mechanisms of antilipidemic and non-steroidal anti-inflammatory drug residues on functionalized silica-based porous materials in a mixed solute.

    PubMed

    Suriyanon, Nakorn; Permrungruang, Jutima; Kaosaiphun, Jidanan; Wongrueng, Aunnop; Ngamcharussrivichai, Chawalit; Punyapalakul, Patiparn

    2015-10-01

    The selective adsorption mechanisms of naproxen (NAP), acetaminophen (ACT), and clofibric acid (CFA) on silica-based porous materials were examined by single and mixed-batch adsorption. Effects of the types and densities of surface functional groups on adsorption capacities were determined, including the role of hydrophobic and hydrophilic dissolved organic matters (DOMs). Hexagonal mesoporous silica (HMS), superparamagnetic HMS (HMS-SP) and SBA-15 were functionalized and applied as adsorbents. Compared with powdered activated carbon (PAC), amine-functionalized HMS had a better adsorption capacity for CFA, but PAC possessed a higher adsorption capacity for the other pharmaceuticals than HMS and its two derivatives. In contrast to PAC, the adsorption capacity of the mesoporous silicas varied with the solution pH, being highest at pH 5. Electrostatic interactions and hydrogen bonding were found to be the main mechanisms. Increase in grafted amine group density on silica surfaces can enhance the CFA adsorption capacity. Further, hydrophilic DOM can decrease CFA adsorption capacities on amino-grafted adsorbents by adsorption site competition, while hydrophobic DOM can interfere with CFA adsorption by the interaction between hydrophobic DOM and CFA. Finally, in a competitive adsorption study, the adsorption capacity of hydrophilic adsorbents for acidic pharmaceuticals varied with their pKa values. PMID:26025186

  8. Studies on chelating adsorption properties of novel composite material polyethyleneimine/silica gel for heavy-metal ions

    NASA Astrophysics Data System (ADS)

    Gao, Baojiao; An, Fuqiang; Liu, Kangkai

    2006-12-01

    Firstly, the coordination processes of line-type polyethyleneimine with Cu 2+, Cd 2+ and Zn 2+ were studied by using visible light absorption spectroscopy and chelation conductivity titration method, and the structures of the chelates were determined. Afterwards, polyethyleneimine (PEI) was grafted onto the surface of silica gel particles via the coupling effect of γ-chloropropyl trimethoxysilane (CP), and the novel composite adsorption material PEI/SiO 2 with strong adsorption ability towards heavy-metal ions was prepared. The chelating adsorption properties of PEI/SiO 2 for Cu 2+, Cd 2+ and Zn 2+ were researched by both static (batch) and dynamic (flow) methods. The experiment results show that water-soluble polyamine PEI with line-type structure reacts with Cu 2+, Cd 2+ and Zn 2+ easily and quantitatively, and water-soluble chelates with four ligands are formed. The composite material PEI/SiO 2 possesses very strong chelating adsorption ability for heavy-metal ions, and the saturated adsorption amount can reach 25.94 mg g -1 and 50.01 mg g -1 for Cu 2+ under static and dynamic conditions, respectively. The isothermal adsorption data fit to Langmuir equation, and the adsorption is typical chemical adsorption with monomolecular layer. The adsorbing ability of PEI/SiO 2 towards the three kinds of the ions follows the order of Cu 2+ > Cd 2+ > Zn 2+. The pH value has great influence on the sorption, and at pH 6-7, the adsorption capacity is the greatest. The fact that adsorption capacity increases with temperature rising indicates the adsorbing process of PEI/SiO 2 for metal ions is endothermic. As diluted hydrochloric acid is used as eluent, the adsorbed heavy-metal ions are eluted easily from PEI/SiO 2, and the regeneration and reuse without decreasing sorption for PEI/SiO 2 are demonstrated.

  9. Design of a low power optical limiter based on a new nanocomposite material incorporating silica-encapsulated phthalocyanine in Nafion

    NASA Astrophysics Data System (ADS)

    Sathiyamoorthy, K.; Vijayan, C.; Kothiyal, M. P.

    2007-10-01

    We report on the design of a stable optical limiter in the low laser power regime based on the thermal variation of refractive index in a novel nanocomposite material. The optical material, chloroaluminium-phthalocyanine (ClAlPc), is embedded in SiO2-Nafion nanocomposite membrane (ClSNf) and its thermally induced nonlinear refractive index is characterized by the Z-scan technique with a low power cw He-Ne laser as the source. The value of nonlinear refractive index coefficient, n2, is found to be about 1.11 × 10-11 m2 W-1. The experiment is repeated with the dye doped in pure Nafion membrane (ClNf) and the results are compared with those of ClAlPc doped SiO2-Nafion nanocomposite membrane. The value of n2 is found to be 1.36 × 10-11 m2 W-1 and is larger than that of the ClAlPc embedded SiO2-Nafion nanocomposite membrane. The photostability of the dye-embedded membrane is studied by exposing the sample to cw He-Ne laser and monitoring its fluorescence emission intensity continuously. The samples are found to show large thermal lens effect and demonstrated to be good optical limiters in the low power regime. Whereas the optical properties of dye-doped Nafion appear to be slightly better than those of the dye embedded in silica and incorporated in Nafion, the latter is found to offer excellent photostability.

  10. Copper-doped silica materials silanized with bis-(triethoxy silyl propyl)-tetra sulfide for mercury vapor capture

    SciTech Connect

    D.E. Meyer; N. Meeks; S. Sikdar; N.D. Hutson; D. Hua; D. Bhattacharyya

    2008-07-15

    The use of Cu-S sites for Hg capture from the gas phase has been successfully applied to a silica-based platform using an S4 organic polysulfane and copper sulfate. The maximum fixed-bed equilibrium capacity achieved using these materials was 19 789 {mu}g Hg.g{sup -1} sorbent for a material with 2.5 wt % Cu and 6 wt % S. An optimal S level was determined to be around 3 wt % because enhancement of capacity was only 18% when increasing from this 3 to 6 wt %. The rate of adsorption in pure beds ranged from 0.6 to 1.6 {mu}g Hg.min{sup -1} depending on the inlet concentration. Differences in breakthrough times suggest that material deposition is not uniform. When compared to two other platforms, commercially available Darco HG-LH and previously tested Fe-Cu-S4 nanoaggregates, the Si-1 material performed the best in fixed-bed testing. During entrained-flow testing, a steady-state Hg removal of 82% was achieved using Si-1 at injection rates of both 6 x 10{sup -5} and 1.2 x 10{sup -4} g.L{sup -1}.h{sup -1}. The lack of increase in Hg removal when the injection rate is doubled suggests that pore accessibility is the rate-controlling step during dynamic Hg capture. A calculation of the approximate pore usage based on injection testing helped confirm this observation. During injection testing, the performance of Si-1 was only diminished 10% when exposed to 20 ppm SO{sub 3}. This is an encouraging result for flue-gas applications where SO{sub 3} levels range from 1 to 40 ppm. Testing demonstrated that Si-1 is stable when exposed to leaching conditions after concrete blending and cement impregnation. This is an important aspect to consider for injection because the sale of fly ash for concrete is a key cost-recovery tool for power plants. 27 refs., 8 figs., 5 tabs.

  11. The effect of various naturally occurring metal-binding compounds on the electrochemical behavior of aluminum

    SciTech Connect

    Hansen, D.C.; McCafferty, E.

    1996-01-01

    Naturally occurring biological molecules are of considerable interest as possible corrosion inhibitors because of increased attention on the development of environmentally compatible, nonpolluting corrosion inhibitors. A hydroxamate yeast siderophore (rhodotorulic acid), a catecholate bacterial siderophore (parabactin), an adhesive protein from the blue mussel Mytilus edulis, and two metal-binding compounds isolated from the tomato and sunflower roots, namely, chlorogenic and caffeic acid, respectively, were adsorbed from solution onto pure aluminum (99.9995%) and their effect on the critical pitting potential and polarization resistance in deaerated 0.1 M NaCl was measured. These measurements were made using anodic polarization and ac impedance spectroscopy. The catechol-containing siderophore has an inhibitive effect on the critical pitting potential of aluminum in 0.1 M NaCl and increases the polarization resistance of the metal over time. The adhesive protein from the blue mussel is also effective in inhibiting the pitting of aluminum.

  12. Growth-inhibitory and metal-binding proteins in Chlorella vulgaris exposed to cadmium or zinc.

    PubMed

    Huang, Zhiyong; Li, Lianping; Huang, Gaoling; Yan, Qingpi; Shi, Bing; Xu, Xiaoqin

    2009-01-18

    Phytochelatins, with the general structure of (gamma-Glu-Cys)n-Gly (n=2-11), are usually recognized as being strongly induced by metals in microalgae and play an important role in the detoxification of heavy metals in environment. However, there have been few studies on metallothionein (MT) synthesis in Chlorella vulgaris (C. vulgaris) exposed to heavy metals. The present study describes the growth inhibition of C. vulgaris exposed to different concentrations of cadmium and zinc, and the induction of metal-binding MT-like proteins in the cells. The amounts of metal-binding proteins, induced in the alga exposed to different concentrations of Cd and Zn, were analyzed with a size-exclusion HPLC coupled to ICP-MS. After being purified with a gel filtration column (Sephadex G-75, 3.5cmx80cm) and a desalting column (G-25, 1.5cmx30cm), the isoforms and sub-isoforms of Zn-binding protein were characterized by a reverse phase-HPLC coupled to electrospray ionization and a triple quadrupole mass spectrometer (HPLC-ESI-MS/MS). In addition, the ultraviolet spectra of purified Zn-binding proteins were analyzed in media with different pH values. The results showed that the significant inhibitory effects (at p<0.05) on the cell growth were observed when excessive metals such as 80micromoll(-1) of Cd, and 60 and 80micromoll(-1) of Zn were added. The Cd/Zn-binding proteins induced in C. vulgaris exposed to Cd and Zn were referred to as Cd/Zn-MT-like proteins in which the mean molecular mass of the apo-MT-like was 6152Da. The induced Cd/Zn-MT-like proteins might be involved in the detoxification of heavy metals, such as cadmium and zinc, by the alga. PMID:19019465

  13. New antifouling silica hydrogel.

    PubMed

    Beltrán-Osuna, Ángela A; Cao, Bin; Cheng, Gang; Jana, Sadhan C; Espe, Matthew P; Lama, Bimala

    2012-06-26

    In this work, a new antifouling silica hydrogel was developed for potential biomedical applications. A zwitterionic polymer, poly(carboxybetaine methacrylate) (pCBMA), was produced via atom-transfer radical polymerization and was appended to the hydrogel network in a two-step acid-base-catalyzed sol-gel process. The pCBMA silica aerogels were obtained by drying the hydrogels under supercritical conditions using CO(2). To understand the effect of pCBMA on the gel structure, pCBMA silica aerogels with different pCBMA contents were characterized using scanning electron microscopy (SEM), nuclear magnetic resonance (NMR) spectroscopy, and the surface area from Brauner-Emmet-Teller (BET) measurements. The antifouling property of pCBMA silica hydrogel to resist protein (fibrinogen) adsorption was measured using enzyme-linked immunosorbent assay (ELISA). SEM images revealed that the particle size and porosity of the silica network decreased at low pCBMA content and increased at above 33 wt % of the polymer. The presence of pCBMA increased the surface area of the material by 91% at a polymer content of 25 wt %. NMR results confirmed that pCBMA was incorporated completely into the silica structure at a polymer content below 20 wt %. A protein adsorption test revealed a reduction in fibrinogen adsorption by 83% at 25 wt % pCBMA content in the hydrogel compared to the fibrinogen adsorption in the unmodified silica hydrogel. PMID:22607091

  14. Pore Size Effect on Methane Adsorption in Mesoporous Silica Materials Studied by Small-Angle Neutron Scattering.

    PubMed

    Chiang, Wei-Shan; Fratini, Emiliano; Baglioni, Piero; Chen, Jin-Hong; Liu, Yun

    2016-09-01

    Methane adsorption in model mesoporous silica materials with the size range characteristic of shale is studied by small-angle neutron scattering (SANS). Size effect on the temperature-dependent gas adsorption at methane pressure about 100 kPa is investigated by SANS using MCM-41 and SBA-15 as adsorbents. Above the gas-liquid condensation temperature, the thickness of the adsorption layer is found to be roughly constant as a function of the temperature. Moreover, the gas adsorption properties, such as the adsorbed layer thickness and the specific amount of adsorbed gas, have little dependence on the pore size being studied, i.e., pore radius of 16.5 and 34.1 Å, but are mainly affected by the roughness of the pore surfaces. Hence, the surface properties of the pore wall are more dominant than the pore size in determining the methane gas adsorption of pores at the nanometer size range. Not surprisingly, the gas-liquid condensation temperature is observed to be sensitive to pore size and shifts to higher temperature when the pore size is smaller. Below the gas-liquid condensation temperature, even though the majority of gas adsorption experiments/simulations have assumed the density of confined liquid to be the same as the bulk density, the measured methane mass density in our samples is found to be appreciably smaller than the bulk methane density regardless of the pore sizes studied here. The mass density of liquid/solid methane in pores with different sizes shows different temperature dependence below the condensation temperature. With decreasing temperature, the methane density in larger pores (SBA-15) abruptly increases at approximately 65 K and then plateaus. In contrast, the density in smaller pores (MCM-41) monotonically increases with decreasing temperature before reaching a plateau at approximately 30 K. PMID:27512895

  15. Synthesis Mechanism and Thermal Optimization of an Economical Mesoporous Material Using Silica: Implications for the Effective Removal or Delivery of Ibuprofen.

    PubMed

    Kittappa, Shanmuga; Cui, Mingcan; Ramalingam, Malarvili; Ibrahim, Shaliza; Khim, Jeehyeong; Yoon, Yeomin; Snyder, Shane A; Jang, Min

    2015-01-01

    Mesoporous silica materials (MSMs) were synthesized economically using silica (SiO2) as a precursor via a modified alkaline fusion method. The MSM prepared at 500°C (MSM-500) had the highest surface area, pore size, and volume, and the results of isotherms and the kinetics of ibuprofen (IBP) removal indicated that MSM-500 had the highest sorption capacity and fastest removal speed vs. SBA-15 and zeolite. Compared with commercial granular activated carbon (GAC), MSM-500 had a ~100 times higher sorption rate at neutral pH. IBP uptake by MSM-500 was thermodynamically favorable at room temperature, which was interpreted as indicating relatively weak bonding because the entropy (∆adsS, -0.07 J mol(-1) K(-1)) was much smaller. Five times recycling tests revealed that MSM-500 had 83-87% recovery efficiencies and slower uptake speeds due to slight deformation of the outer pore structure. In the IBP delivery test, MSM-500 drug loading was 41%, higher than the reported value of SBA-15 (31%). The in vitro release of IBP was faster, almost 100%, reaching equilibrium within a few hours, indicating its effective loading and unloading characteristics. A cost analysis study revealed that the MSM was ~10-70 times cheaper than any other mesoporous silica material for the removal or delivery of IBP. PMID:26161510

  16. Synthesis Mechanism and Thermal Optimization of an Economical Mesoporous Material Using Silica: Implications for the Effective Removal or Delivery of Ibuprofen

    PubMed Central

    Kittappa, Shanmuga; Cui, Mingcan; Ramalingam, Malarvili; Ibrahim, Shaliza; Khim, Jeehyeong; Yoon, Yeomin; Snyder, Shane A.; Jang, Min

    2015-01-01

    Mesoporous silica materials (MSMs) were synthesized economically using silica (SiO2) as a precursor via a modified alkaline fusion method. The MSM prepared at 500°C (MSM–500) had the highest surface area, pore size, and volume, and the results of isotherms and the kinetics of ibuprofen (IBP) removal indicated that MSM–500 had the highest sorption capacity and fastest removal speed vs. SBA–15 and zeolite. Compared with commercial granular activated carbon (GAC), MSM–500 had a ~100 times higher sorption rate at neutral pH. IBP uptake by MSM–500 was thermodynamically favorable at room temperature, which was interpreted as indicating relatively weak bonding because the entropy (∆adsS, –0.07 J mol–1 K–1) was much smaller. Five times recycling tests revealed that MSM–500 had 83–87% recovery efficiencies and slower uptake speeds due to slight deformation of the outer pore structure. In the IBP delivery test, MSM–500 drug loading was 41%, higher than the reported value of SBA–15 (31%). The in vitro release of IBP was faster, almost 100%, reaching equilibrium within a few hours, indicating its effective loading and unloading characteristics. A cost analysis study revealed that the MSM was ~10–70 times cheaper than any other mesoporous silica material for the removal or delivery of IBP. PMID:26161510

  17. Characterization and acidic properties of Al-SBA-15 materials prepared by post-synthesis alumination of a low-cost ordered mesoporous silica

    SciTech Connect

    Gomez-Cazalilla, M.; Merida-Robles, J.M.; Gurbani, A.; Rodriguez-Castellon, E.; Jimenez-Lopez, A.

    2007-03-15

    A series of Al-containing SBA-15 type materials with different Si/Al ratio, were prepared by post-synthesis modification of a pure highly ordered mesoporous silica SBA-15 obtained by using sodium silicate as silica source, and amphiphilic block copolymer as structure-directing agent. A high level of aluminum incorporation was achieved, reaching an Si/Al ratio of up to 5.5, without any significant loss in the textural properties of SBA-15. These materials were fully characterized by powder X-ray diffraction (XRD), X-ray photoelectron spectroscopy (XPS), {sup 27}Al NMR spectroscopy, and N{sub 2} adsorption at 77 K. The acid properties of these materials have been evaluated by NH{sub 3}-TPD, adsorption of pyridine and deuterated acetonitrile coupled to FTIR spectroscopy. The effective acidity of these materials was evaluated using two catalytic reactions: 2-propanol dehydrogenation and 1-butene isomerization. The adsorption of basic probe molecules and the catalytic behavior revealed an evolution of the acid properties with the Al content. These studies have shown that the Al-SBA-15 materials contain Bronsted and Lewis acid sites with medium acidity which makes them appropriate to be used as acid catalysts in heterogeneous catalysis, catalytic supports, and adsorbents. - Graphical abstract: Al KLL spectra of Al-SBA-15 materials with different Si/Al ratios.

  18. MODELING OF METAL BINDING ON HUMIC SUBSTANCES USING THE NIST DATABASE: AN A PRIORI FUNCTIONAL GROUP APPROACH

    EPA Science Inventory

    Various modeling approaches have been developed for metal binding on humic substances. However, most of these models are still curve-fitting exercises-- the resulting set of parameters such as affinity constants (or the distribution of them) is found to depend on pH, ionic stren...

  19. Preparation and physical characterization of calcium sulfate cement/silica-based mesoporous material composites for controlled release of BMP-2

    PubMed Central

    Tan, Honglue; Yang, Shengbing; Dai, Pengyi; Li, Wuyin; Yue, Bing

    2015-01-01

    As a commonly used implant material, calcium sulfate cement (CSC), has some shortcomings, including low compressive strength, weak osteoinduction capability, and rapid degradation. In this study, silica-based mesoporous materials such as SBA-15 were synthesized and combined with CSC to prepare CSC/SBA-15 composites. The properties of SBA-15 were characterized by X-ray diffraction, transmission electron microscopy, and nitrogen adsorption–desorption isotherms. SBA-15 was blended into CSC at 0, 5, 10, and 20 wt%, referred to as CSC, CSC-5S (5% mass ratio), CSC-10S (10% mass ratio), and CSC-20S (20% mass ratio), respectively. Fourier-transform infrared spectroscopy and compression tests were used to determine the structure and mechanical properties of the composites, respectively. The formation of hydroxyapatite on composite surfaces was analyzed using scanning electron microscopy and X-ray diffraction after soaking in simulated body fluid. BMP-2 was loaded into the composites by vacuum freeze-drying, and its release characteristics were detected by Bradford protein assay. The in vitro degradation of the CSC/SBA-15 composite was investigated by measuring weight loss. The results showed that the orderly, nanostructured, mesoporous SBA-15 possessed regular pore size and structure. The compressive strength of CSC/SBA-15 increased with the increase in SBA-15 mass ratio, and CSC-20S demonstrated the maximum strength. Compared to CSC, hydroxyapatite that formed on the surfaces of CSC/SBA-15 was uniform and compact. The degradation rate of CSC/SBA-15 decreased with increasing mass ratio of SBA-15. The adsorption of BMP-2 increased and released at a relatively slow rate; the release rate of BMP-2 in CSC-20S was the slowest, and presented characteristics of low doses of release. In vitro experiments demonstrated that the physical properties of pure CSC incorporated with SBA-15 could be improved significantly, which made the CSC/SBA-15 composite more suitable for bone repair

  20. Preparation and physical characterization of calcium sulfate cement/silica-based mesoporous material composites for controlled release of BMP-2.

    PubMed

    Tan, Honglue; Yang, Shengbing; Dai, Pengyi; Li, Wuyin; Yue, Bing

    2015-01-01

    As a commonly used implant material, calcium sulfate cement (CSC), has some shortcomings, including low compressive strength, weak osteoinduction capability, and rapid degradation. In this study, silica-based mesoporous materials such as SBA-15 were synthesized and combined with CSC to prepare CSC/SBA-15 composites. The properties of SBA-15 were characterized by X-ray diffraction, transmission electron microscopy, and nitrogen adsorption-desorption isotherms. SBA-15 was blended into CSC at 0, 5, 10, and 20 wt%, referred to as CSC, CSC-5S (5% mass ratio), CSC-10S (10% mass ratio), and CSC-20S (20% mass ratio), respectively. Fourier-transform infrared spectroscopy and compression tests were used to determine the structure and mechanical properties of the composites, respectively. The formation of hydroxyapatite on composite surfaces was analyzed using scanning electron microscopy and X-ray diffraction after soaking in simulated body fluid. BMP-2 was loaded into the composites by vacuum freeze-drying, and its release characteristics were detected by Bradford protein assay. The in vitro degradation of the CSC/SBA-15 composite was investigated by measuring weight loss. The results showed that the orderly, nanostructured, mesoporous SBA-15 possessed regular pore size and structure. The compressive strength of CSC/SBA-15 increased with the increase in SBA-15 mass ratio, and CSC-20S demonstrated the maximum strength. Compared to CSC, hydroxyapatite that formed on the surfaces of CSC/SBA-15 was uniform and compact. The degradation rate of CSC/SBA-15 decreased with increasing mass ratio of SBA-15. The adsorption of BMP-2 increased and released at a relatively slow rate; the release rate of BMP-2 in CSC-20S was the slowest, and presented characteristics of low doses of release. In vitro experiments demonstrated that the physical properties of pure CSC incorporated with SBA-15 could be improved significantly, which made the CSC/SBA-15 composite more suitable for bone repair

  1. The properties of silica-gelatin composites

    NASA Astrophysics Data System (ADS)

    Stavinskaya, O. N.; Laguta, I. V.

    2010-06-01

    Silica-gelatin composites with various silica-to-gelatin ratios were obtained. The influence of high-dispersity silica on the swelling of composites in water and desorption of pyridoxine and thiamine vitamins incorporated into the material was studied. The addition of silica to gelatin was shown to increase the time of the dissolution of the materials in aqueous medium and decelerate the desorption of vitamins.

  2. Double layer approach to create durable superhydrophobicity on cotton fabric using nano silica and auxiliary non fluorinated materials

    NASA Astrophysics Data System (ADS)

    Manatunga, Danushika Charyangi; de Silva, Rohini M.; de Silva, K. M. Nalin

    2016-01-01

    Creation of differential superhydrophobicity by applying different non-fluorinated hydrophobization agents on a cotton fabric roughened with silica nanoparticles was studied. Cotton fabric surface has been functionalized with silica nanoparticles and further hydrophobized with different hydrophobic agents such as hexadecyltrimethoxy silane (HDTMS), stearic acid (SA), triethoxyoctyl silane (OTES) and hybrid mixtures of HDTMS/SA and HDTMS/OTES. The cotton fabrics before and after the treatment were characterized using scanning electron microscopy (SEM), atomic force microscopy (AFM) and thermogravimetric analysis (TGA). The wetting behavior of cotton samples was investigated by water contact angle (WCA) measurement, water uptake, water repellency and soil repellency testing. The treated fabrics exhibited excellent water repellency and high water contact angles (WCA). When the mixture of two hydrophobization agents such as HDTMS/OTES and HDTMS/SA is used, the water contact angle has increased (145°-160°) compared to systems containing HDTMS, OTES, SA alone (130°-140°). It was also noted that this fabricated double layer (silica + hydrophobization agent) was robust even after applying harsh washing conditions and there is an excellent anti-soiling effect observed over different stains. Therefore superhydrophobic cotton surfaces with high WCA and soil repellency could be obtained with silica and mixture of hydrophobization agents which are cost effective and environmentally friendly when compared with the fluorosilane treatment.

  3. Fine Ambient Particles Induce Oxidative Stress and Metal Binding Genes in Human Alveolar Macrophages

    PubMed Central

    Huang, Yuh-Chin T.; Li, Zhuowei; Carter, Jacqueline D.; Soukup, Joleen M.; Schwartz, David A.; Yang, Ivana V.

    2009-01-01

    Exposure to pollutant particles increased respiratory morbidity and mortality. The alveolar macrophages (AMs) are one cell type in the lung directly exposed to particles. Upon contact with particles, AMs are activated and produce reactive oxygen species, but the scope of this oxidative stress response remains poorly defined. In this study, we determined the gene expression profile in human AMs exposed to particles, and sought to characterize the global response of pro- and antioxidant genes. We exposed AMs obtained by bronchoscopy from normal individuals to Chapel Hill particulate matter of 2.5-μm diameter or smaller (PM2.5; 1 μg/ml) or vehicle for 4 hours (n = 6 independent samples). mRNAs were extracted, amplified, and hybridized to Agilent human 1A microarray. Significant genes were identified by significance analysis of microarrays (false discovery rate, 10%; P ≤ 0.05) and mapped with Gene Ontology in the Database for Annotation, Visualization, and Integrated Discovery. We found 34 and 41 up- and down-regulated genes, respectively; 22 genes (∼30%) were involved in metal binding, and 11 were linked to oxidative stress, including up-regulation of five metallothionein (MT)-1 isoforms. Exogenous MT1 attenuated PM2.5-induced H2O2 release. PM2.5 premixed with MT1 stimulated less H2O2 release. Knockdown of MT1F gene increased PM2.5-induced H2O2 release. PM2.5 at 1 μg/ml did not increase H2O2 release. Mount St. Helens PM2.5 and acid-extracted Chapel Hill PM2.5, both poor in metals, did not induce MT1F or H2O2 release. Our results show that PM2.5 induced a gene expression profile prevalent with genes related to metal binding and oxidative stress in human AMs, independent of oxidative stress. Metals associated with PM may play an important role in particle-induced gene changes. PMID:19251948

  4. The Fungus Tremella mesenterica Encodes the Longest Metallothionein Currently Known: Gene, Protein and Metal Binding Characterization

    PubMed Central

    Lin, Weiyu; Calatayud, Sara; Palacios, Òscar; Capdevila, Mercè; Atrian, Sílvia

    2016-01-01

    Fungal Cu-thioneins, and among them, the paradigmatic Neurospora crassa metallothionein (MT) (26 residues), were once considered as the shortest MTs -the ubiquitous, versatile metal-binding proteins- among all organisms, and thus representatives of their primeval forms. Nowadays, fungal MTs of diverse lengths and sequence features are known, following the huge heterogeneity of the Kingdom of Fungi. At the opposite end of N. crassa MT, the recently reported Cryptococcus neoformans CnMT1 and CnMT2 (122 and 186 aa) constitute the longest reported fungal MTs, having been identified as virulence factors of this pathogen. CnMTs are high-capacity Cu-thioneins that appear to be built by tandem amplification of a basic unit, a 7-Cys segment homologous to N. crassa MT. Here, we report the in silico, in vivo and in vitro study of a still longer fungal MT, belonging to Tremella mesenterica (TmMT), a saprophytic ascomycete. The TmMT gene has 10 exons, and it yields a 779-bp mature transcript that encodes a 257 residue-long protein. This MT is also built by repeated fragments, but of variable number of Cys: six units of the 7-Cys building blocks-CXCX3CSCPPGXCXCAXCP-, two fragments of six Cys, plus three Cys at the N-terminus. TmMT metal binding abilities have been analyzed through the spectrophotometric and spectrometric characterization of its recombinant Zn-, Cd- and Cu-complexes. Results allow it to be unambiguous classified as a Cu-thionein, also of extraordinary coordinating capacity. According to this feature, when the TmMT cDNA is expressed in MT-devoid yeast cells, it is capable of restoring a high Cu tolerance level. Since it is not obvious that T. mesenterica shares the same physiological needs for a high capacity Cu-binding protein with C. neoformans, the existence of this peculiar MT might be better explained on the basis of a possible role in Cu-handling for the Cu-enzymes responsible in lignin degradation pathways. PMID:26882011

  5. Fine ambient particles induce oxidative stress and metal binding genes in human alveolar macrophages.

    PubMed

    Huang, Yuh-Chin T; Li, Zhuowei; Carter, Jacqueline D; Soukup, Joleen M; Schwartz, David A; Yang, Ivana V

    2009-11-01

    Exposure to pollutant particles increased respiratory morbidity and mortality. The alveolar macrophages (AMs) are one cell type in the lung directly exposed to particles. Upon contact with particles, AMs are activated and produce reactive oxygen species, but the scope of this oxidative stress response remains poorly defined. In this study, we determined the gene expression profile in human AMs exposed to particles, and sought to characterize the global response of pro- and antioxidant genes. We exposed AMs obtained by bronchoscopy from normal individuals to Chapel Hill particulate matter of 2.5-microm diameter or smaller (PM(2.5); 1 microg/ml) or vehicle for 4 hours (n = 6 independent samples). mRNAs were extracted, amplified, and hybridized to Agilent human 1A microarray. Significant genes were identified by significance analysis of microarrays (false discovery rate, 10%; P < or = 0.05) and mapped with Gene Ontology in the Database for Annotation, Visualization, and Integrated Discovery. We found 34 and 41 up- and down-regulated genes, respectively; 22 genes (approximately 30%) were involved in metal binding, and 11 were linked to oxidative stress, including up-regulation of five metallothionein (MT)-1 isoforms. Exogenous MT1 attenuated PM(2.5)-induced H2O2 release. PM(2.5) premixed with MT1 stimulated less H2O2 release. Knockdown of MT1F gene increased PM(2.5)-induced H2O2 release. PM(2.5) at 1 microg/ml did not increase H2O2 release. Mount St. Helens PM(2.5) and acid-extracted Chapel Hill PM(2.5), both poor in metals, did not induce MT1F or H2O2 release. Our results show that PM(2.5) induced a gene expression profile prevalent with genes related to metal binding and oxidative stress in human AMs, independent of oxidative stress. Metals associated with PM may play an important role in particle-induced gene changes. PMID:19251948

  6. Silica, hybrid silica, hydride silica and non-silica stationary phases for liquid chromatography.

    PubMed

    Borges, Endler M

    2015-04-01

    Free silanols on the surface of silica are the "villains", which are responsible for detrimental interactions of those compounds and the stationary phase (i.e., bad peak shape, low efficiency) as well as low thermal and chemical stability. For these reasons, we began this review describing new silica and hybrid silica stationary phases, which have reduced and/or shielded silanols. At present, in liquid chromatography for the majority of analyses, reversed-phase liquid chromatography is the separation mode of choice. However, the needs for increased selectivity and increased retention of hydrophilic bases have substantially increased the interest in hydrophilic interaction chromatography (HILIC). Therefore, stationary phases and this mode of separation are discussed. Then, non-silica stationary phases (i.e., zirconium oxide, titanium oxide, alumina and porous graphitized carbon), which afford increased thermal and chemical stability and also selectivity different from those obtained with silica and hybrid silica, are discussed. In addition, the use of these materials in HILIC is also reviewed. PMID:25234386

  7. Earthworm Lumbricus rubellus MT-2: Metal Binding and Protein Folding of a True Cadmium-MT

    PubMed Central

    Kowald, Gregory R.; Stürzenbaum, Stephen R.; Blindauer, Claudia A.

    2016-01-01

    Earthworms express, as most animals, metallothioneins (MTs)—small, cysteine-rich proteins that bind d10 metal ions (Zn(II), Cd(II), or Cu(I)) in clusters. Three MT homologues are known for Lumbricus rubellus, the common red earthworm, one of which, wMT-2, is strongly induced by exposure of worms to cadmium. This study concerns composition, metal binding affinity and metal-dependent protein folding of wMT-2 expressed recombinantly and purified in the presence of Cd(II) and Zn(II). Crucially, whilst a single Cd7wMT-2 species was isolated from wMT-2-expressing E. coli cultures supplemented with Cd(II), expressions in the presence of Zn(II) yielded mixtures. The average affinities of wMT-2 determined for either Cd(II) or Zn(II) are both within normal ranges for MTs; hence, differential behaviour cannot be explained on the basis of overall affinity. Therefore, the protein folding properties of Cd- and Zn-wMT-2 were compared by 1H NMR spectroscopy. This comparison revealed that the protein fold is better defined in the presence of cadmium than in the presence of zinc. These differences in folding and dynamics may be at the root of the differential behaviour of the cadmium- and zinc-bound protein in vitro, and may ultimately also help in distinguishing zinc and cadmium in the earthworm in vivo. PMID:26742040

  8. Metal binding affinity and structural properties of calmodulin-like protein 14 from Arabidopsis thaliana.

    PubMed

    Vallone, Rosario; La Verde, Valentina; D'Onofrio, Mariapina; Giorgetti, Alejandro; Dominici, Paola; Astegno, Alessandra

    2016-08-01

    In addition to the well-known Ca(2+) sensor calmodulin, plants possess many calmodulin-like proteins (CMLs) that are predicted to have specific roles in the cell. Herein, we described the biochemical and biophysical characterization of recombinant Arabidopsis thaliana CML14. We applied isothermal titration calorimetry to analyze the energetics of Ca(2+) and Mg(2+) binding to CML14, and nuclear magnetic resonance spectroscopy, together with intrinsic and ANS-based fluorescence, to evaluate the structural effects of metal binding and metal-induced conformational changes. Furthermore, differential scanning calorimetry and limited proteolysis were used to characterize protein thermal and local stability. Our data demonstrate that CML14 binds one Ca(2+) ion with micromolar affinity (Kd ∼ 12 µM) and the presence of 10 mM Mg(2+) decreases the Ca(2+) affinity by ∼5-fold. Although binding of Ca(2+) to CML14 increases protein stability, it does not result in a more hydrophobic protein surface and does not induce the large conformational rearrangement typical of Ca(2+) sensors, but causes only localized structural changes in the unique functional EF-hand. Our data, together with a molecular modelling prediction, provide interesting insights into the biochemical properties of Arabidopsis CML14 and may be useful to direct additional studies aimed at understanding its physiological role. PMID:27124620

  9. Metal Binding in Photosystem II Super- and Subcomplexes from Barley Thylakoids1

    PubMed Central

    Schmidt, Sidsel Birkelund; Persson, Daniel Pergament; Powikrowska, Marta; Frydenvang, Jens; Schjoerring, Jan K.; Jensen, Poul Erik; Husted, Søren

    2015-01-01

    Metals exert important functions in the chloroplast of plants, where they act as cofactors and catalysts in the photosynthetic electron transport chain. In particular, manganese (Mn) has a key function because of its indispensable role in the water-splitting reaction of photosystem II (PSII). More and better knowledge is required on how the various complexes of PSII are affected in response to, for example, nutritional disorders and other environmental stress conditions. We here present, to our knowledge, a new method that allows the analysis of metal binding in intact photosynthetic complexes of barley (Hordeum vulgare) thylakoids. The method is based on size exclusion chromatography coupled to inductively coupled plasma triple-quadrupole mass spectrometry. Proper fractionation of PSII super- and subcomplexes was achieved by critical selection of elution buffers, detergents for protein solubilization, and stabilizers to maintain complex integrity. The applicability of the method was shown by quantification of Mn binding in PSII from thylakoids of two barley genotypes with contrasting Mn efficiency exposed to increasing levels of Mn deficiency. The amount of PSII supercomplexes was drastically reduced in response to Mn deficiency. The Mn efficient genotype bound significantly more Mn per unit of PSII under control and mild Mn deficiency conditions than the inefficient genotype, despite having lower or similar total leaf Mn concentrations. It is concluded that the new method facilitates studies of the internal use of Mn and other biometals in various PSII complexes as well as their relative dynamics according to changes in environmental conditions. PMID:26084923

  10. Detection of metal binding sites on functional S-layer nanoarrays using single molecule force spectroscopy.

    PubMed

    Tang, Jilin; Ebner, Andreas; Kraxberger, Bernhard; Leitner, Michael; Hykollari, Alba; Kepplinger, Christian; Grunwald, Christian; Gruber, Hermann J; Tampé, Robert; Sleytr, Uwe B; Ilk, Nicola; Hinterdorfer, Peter

    2009-10-01

    Crystalline bacterial cell surface layers (S-layers) show the ability to recrystallize into highly regular pattern on solid supports. In this study, the genetically modified S-layer protein SbpA of Lysinibacillus sphaericus CCM 2177, carrying a hexa-histidine tag (His(6)-tag) at the C-terminus, was used to generate functionalized two-dimensional nanoarrays on a silicon surface. Atomic force microscopy (AFM) was applied to explore the topography and the functionality of the fused His(6)-tags. The accessibility of the His(6)-tags was demonstrated by in-situ anti-His-tag antibody binding to the functional S-layer array. The metal binding properties of the His(6)-tag was investigated by single molecule force microscopy. For this purpose, newly developed tris-NTA was tethered to the AFM tips via a flexible polyethylene glycol (PEG) linker. The functionalized tips showed specific interactions with S-layer containing His(6)-tags in the presence of nickel ions. Thus the His(6)-tag is located at the outer surface of the S-layer and can be used for stable but reversible attachment of functional tris-NTA derivatives. PMID:19232541

  11. Metal-binding peptides: Their role in responses to metal stress

    SciTech Connect

    Rauser, W.E. )

    1989-04-01

    Excess metals are one stress that plants may encounter. The metals Cd, Cu, Ni, and Zn are considered because of concern for their entry into the foodchain of animals and man. Studies of metal tolerant plants and cell cultures suggest three types of responses: exclusion of metal from protoplasts by binding to cell walls, differential membrane transport reducing metal exposure of enzymes, and intracellular chelation of metal in innocuous forms. One group of compounds involved in the latter response are metal-binding peptides designated phytochelatins. They are a family of small peptides composed of five kinds of amino acids, including 2 to 11 cysteines which provide thiols for selective binding of metal. Metals induce the synthesis of phytochelatins through unknown enzymes involving glutathione. In plant cell cultures the peptides bind about 90% of the intracellular Cd. In roots of young plants up to half of the metal is bound by phytochelatins. Intact plants probably use a combination of responses to deal with excess metals, phytochelatins may dominate in certain cases.

  12. Evolutionary history of redox metal-binding domains across the tree of life.

    PubMed

    Harel, Arye; Bromberg, Yana; Falkowski, Paul G; Bhattacharya, Debashish

    2014-05-13

    Oxidoreductases mediate electron transfer (i.e., redox) reactions across the tree of life and ultimately facilitate the biologically driven fluxes of hydrogen, carbon, nitrogen, oxygen, and sulfur on Earth. The core enzymes responsible for these reactions are ancient, often small in size, and highly diverse in amino acid sequence, and many require specific transition metals in their active sites. Here we reconstruct the evolution of metal-binding domains in extant oxidoreductases using a flexible network approach and permissive profile alignments based on available microbial genome data. Our results suggest there were at least 10 independent origins of redox domain families. However, we also identified multiple ancient connections between Fe2S2- (adrenodoxin-like) and heme- (cytochrome c) binding domains. Our results suggest that these two iron-containing redox families had a single common ancestor that underwent duplication and divergence. The iron-containing protein family constitutes ∼50% of all metal-containing oxidoreductases and potentially catalyzed redox reactions in the Archean oceans. Heme-binding domains seem to be derived via modular evolutionary processes that ultimately form the backbone of redox reactions in both anaerobic and aerobic respiration and photosynthesis. The empirically discovered network allows us to peer into the ancient history of microbial metabolism on our planet. PMID:24778258

  13. Similarities in the HIV-1 and ASV Integrease Active Site Upon Metal Binding

    SciTech Connect

    Lins, Roberto D.; Straatsma, TP; Briggs, J. M.

    2000-04-05

    The HIV-1 integrase, which is essential for viral replication, catalyzes the insertion of viral DNA into the host chromosome thereby recruiting host cell machinery into making viral proteins. It represents the third main HIV enzyme target for inhibitor design, the first two being the reverse transcriptase and the protease. We report here a fully hydrated 2 ns molecular dynamics simulation performed using parallel NWChem3.2.1 with the AMBER95 force field. The HIV-1 integrase catalytic domain previously determined by crystallography (1B9D) and modeling including two Mg2+ ions placed into the active site based on an alignment against an ASV integrase structure containing two divalent metals (1VSH), was used as the starting structure. The simulation reveals a high degree of flexibility in the region of residues 140-149 even in the presence of a second divalent metal ion and a dramatic conformational change of the side chain of E152 when the second metal ion is present. This study shows similarities in the behavior of the catalytic residues in the HIV-1 and ASV integrases upon metal binding. The present simulation also provides support to the hypothesis that the second metal ion is likely to be carried into the HIV-1 integrase active site by the substrate, a strand of DNA.

  14. Evolutionary history of redox metal-binding domains across the tree of life

    PubMed Central

    Harel, Arye; Bromberg, Yana; Falkowski, Paul G.; Bhattacharya, Debashish

    2014-01-01

    Oxidoreductases mediate electron transfer (i.e., redox) reactions across the tree of life and ultimately facilitate the biologically driven fluxes of hydrogen, carbon, nitrogen, oxygen, and sulfur on Earth. The core enzymes responsible for these reactions are ancient, often small in size, and highly diverse in amino acid sequence, and many require specific transition metals in their active sites. Here we reconstruct the evolution of metal-binding domains in extant oxidoreductases using a flexible network approach and permissive profile alignments based on available microbial genome data. Our results suggest there were at least 10 independent origins of redox domain families. However, we also identified multiple ancient connections between Fe2S2- (adrenodoxin-like) and heme- (cytochrome c) binding domains. Our results suggest that these two iron-containing redox families had a single common ancestor that underwent duplication and divergence. The iron-containing protein family constitutes ∼50% of all metal-containing oxidoreductases and potentially catalyzed redox reactions in the Archean oceans. Heme-binding domains seem to be derived via modular evolutionary processes that ultimately form the backbone of redox reactions in both anaerobic and aerobic respiration and photosynthesis. The empirically discovered network allows us to peer into the ancient history of microbial metabolism on our planet. PMID:24778258

  15. Metal Binding in Photosystem II Super- and Subcomplexes from Barley Thylakoids.

    PubMed

    Schmidt, Sidsel Birkelund; Persson, Daniel Pergament; Powikrowska, Marta; Frydenvang, Jens; Schjoerring, Jan K; Jensen, Poul Erik; Husted, Søren

    2015-08-01

    Metals exert important functions in the chloroplast of plants, where they act as cofactors and catalysts in the photosynthetic electron transport chain. In particular, manganese (Mn) has a key function because of its indispensable role in the water-splitting reaction of photosystem II (PSII). More and better knowledge is required on how the various complexes of PSII are affected in response to, for example, nutritional disorders and other environmental stress conditions. We here present, to our knowledge, a new method that allows the analysis of metal binding in intact photosynthetic complexes of barley (Hordeum vulgare) thylakoids. The method is based on size exclusion chromatography coupled to inductively coupled plasma triple-quadrupole mass spectrometry. Proper fractionation of PSII super- and subcomplexes was achieved by critical selection of elution buffers, detergents for protein solubilization, and stabilizers to maintain complex integrity. The applicability of the method was shown by quantification of Mn binding in PSII from thylakoids of two barley genotypes with contrasting Mn efficiency exposed to increasing levels of Mn deficiency. The amount of PSII supercomplexes was drastically reduced in response to Mn deficiency. The Mn efficient genotype bound significantly more Mn per unit of PSII under control and mild Mn deficiency conditions than the inefficient genotype, despite having lower or similar total leaf Mn concentrations. It is concluded that the new method facilitates studies of the internal use of Mn and other biometals in various PSII complexes as well as their relative dynamics according to changes in environmental conditions. PMID:26084923

  16. Investigation of metal binding and activation of Escherichia coli glyoxalase I: kinetic, thermodynamic and mutagenesis studies.

    PubMed Central

    Clugston, Susan L; Yajima, Rieko; Honek, John F

    2004-01-01

    GlxI (glyoxalase I) isomerizes the hemithioacetal formed between glutathione and methylglyoxal. Unlike other GlxI enzymes, Escherichia coli GlxI exhibits no activity with Zn(2+) but maximal activation with Ni(2+). To elucidate further the metal site in E. coli GlxI, several approaches were undertaken. Kinetic studies indicate that the catalytic metal ion affects the k (cat) without significantly affecting the K (m) for the substrate. Inductively coupled plasma analysis and isothermal titration calorimetry confirmed one metal ion bound to the enzyme, including Zn(2+), which produces an inactive enzyme. Isothermal titration calorimetry was utilized to determine the relative binding affinity of GlxI for various bivalent metals. Each metal ion examined bound very tightly to GlxI with an association constant ( K (a))>10(7) M(-1), with the exception of Mn(2+) ( K (a) of the order of 10(6) M(-1)). One of the ligands to the catalytic metal, His(5), was altered to glutamine, a side chain found in the Zn(2+)-active Homo sapiens GlxI. The affinity of the mutant protein for all bivalent metals was drastically decreased. However, low levels of activity were now observed for Zn(2+)-bound GlxI. Although this residue has a marked effect on metal binding and activation, it is not the sole factor determining the differential metal activation between the human and E. coli GlxI enzymes. PMID:14556652

  17. Sol-gel encapsulation of binary Zn(II) compounds in silica nanoparticles. Structure-activity correlations in hybrid materials targeting Zn(II) antibacterial use.

    PubMed

    Halevas, E; Nday, C M; Kaprara, E; Psycharis, V; Raptopoulou, C P; Jackson, G E; Litsardakis, G; Salifoglou, A

    2015-10-01

    In the emerging issue of enhanced multi-resistant properties in infectious pathogens, new nanomaterials with optimally efficient antibacterial activity and lower toxicity than other species attract considerable research interest. In an effort to develop such efficient antibacterials, we a) synthesized acid-catalyzed silica-gel matrices, b) evaluated the suitability of these matrices as potential carrier materials for controlled release of ZnSO4 and a new Zn(II) binary complex with a suitably designed well-defined Schiff base, and c) investigated structural and textural properties of the nanomaterials. Physicochemical characterization of the (empty-loaded) silica-nanoparticles led to an optimized material configuration linked to the delivery of the encapsulated antibacterial zinc load. Entrapment and drug release studies showed the competence of hybrid nanoparticles with respect to the a) zinc loading capacity, b) congruence with zinc physicochemical attributes, and c) release profile of their zinc load. The material antimicrobial properties were demonstrated against Gram-positive (Staphylococcus aureus, Bacillus subtilis, Bacillus cereus) and negative (Escherichia coli, Pseudomonas aeruginosa, Xanthomonas campestris) bacteria using modified agar diffusion methods. ZnSO4 showed less extensive antimicrobial behavior compared to Zn(II)-Schiff, implying that the Zn(II)-bound ligand enhances zinc antimicrobial properties. All zinc-loaded nanoparticles were less antimicrobially active than zinc compounds alone, as encapsulation controls their release, thereby attenuating their antimicrobial activity. To this end, as the amount of loaded zinc increases, the antimicrobial behavior of the nano-agent improves. Collectively, for the first time, sol-gel zinc-loaded silica-nanoparticles were shown to exhibit well-defined antimicrobial activity, justifying due attention to further development of antibacterial nanotechnology. PMID:26198972

  18. Investigations of the uptake of transuranic radionuclides by humic and fulvic acids chemically immobilized on silica gel and their competitive release by complexing agents

    SciTech Connect

    Bulman, R.A.; Szabo, G.; Clayton, R.F.; Clayton, C.R.

    1998-07-01

    The chemistry of the interactions of transuranic elements (TUs) with humic substances needs to be understood so that humate-mediated movement of transuranic radionuclides through the environment can be predicted. This paper reports the chemical immobilization on silica gel of humic and fulvic acids and evaluates the potential of these new materials for the retention of Pu and Am. In addition to the preparation of the foregoing immobilized humic substances, other low molecular weight metal-binding ligands have also been immobilized on silica gel to investigate the binding sites for transuranic elements (TUs) in humic substances. The X-ray photoelectron spectra (XPS) of Th(IV) complexed by humic acid and the immobilized humic acid are similar thus it appears that immobilization of humic acid does not generate any configurational changes in the Th(IV)-binding sites of the macromolecule. A variety of chelating agents partly mobilize these TUs sorbed on the solid phases. A batch method was used to determine the distribution coefficients (R{sub d}) of Pu and Am between the silica gels and aqueous solutions of phosphate and citrate. The effects of the immobilized ligands, the anions and pH in the solution on sorption were assessed. Distributed coefficients (R{sub d}) for the uptake of Pu and Am by these prepared solid phases are, in some cases, of a similar order of magnitude as those determined for soil and particles suspended in terrestrial surface waters.

  19. Silica nephropathy.

    PubMed

    Ghahramani, N

    2010-07-01

    Occupational exposure to heavy metals, organic solvents and silica is associated with a variety of renal manifestations. Improved understanding of occupational renal disease provides insight into environmental renal disease, improving knowledge of disease pathogenesis. Silica (SiO2) is an abundant mineral found in sand, rock, and soil. Workers exposed to silica include sandblasters, miners, quarry workers, masons, ceramic workers and glass manufacturers. New cases of silicosis per year have been estimated in the US to be 3600-7300. Exposure to silica has been associated with tubulointerstitial disease, immune-mediated multisystem disease, chronic kidney disease and end-stage renal disease. A rare syndrome of painful, nodular skin lesions has been described in dialysis patients with excessive levels of silicon. Balkan endemic nephropathy is postulated to be due to chronic intoxication with drinking water polluted by silicates released during soil erosion. The mechanism of silica nephrotoxicity is thought to be through direct nephrotoxicity, as well as silica-induced autoimmune diseases such as scleroderma and systemic lupus erythematosus. The renal histopathology varies from focal to crescentic and necrotizing glomerulonephritis with aneurysm formation suggestive of polyarteritis nodosa. The treatment for silica nephrotoxicity is non-specific and depends on the mechanism and stage of the disease. It is quite clear that further research is needed, particularly to elucidate the pathogenesis of silica nephropathy. Considering the importance of diagnosing exposure-related renal disease at early stages, it is imperative to obtain a thorough occupational history in all patients with renal disease, with particular emphasis on exposure to silica, heavy metals, and solvents. PMID:23022796

  20. A Rapid and Sensitive Strip-Based Quick Test for Nerve Agents Tabun, Sarin, and Soman Using BODIPY-Modified Silica Materials.

    PubMed

    Climent, Estela; Biyikal, Mustafa; Gawlitza, Kornelia; Dropa, Tomáš; Urban, Martin; Costero, Ana M; Martínez-Máñez, Ramón; Rurack, Knut

    2016-08-01

    Test strips that in combination with a portable fluorescence reader or digital camera can rapidly and selectively detect chemical warfare agents (CWAs) such as Tabun (GA), Sarin (GB), and Soman (GD) and their simulants in the gas phase have been developed. The strips contain spots of a hybrid indicator material consisting of a fluorescent BODIPY indicator covalently anchored into the channels of mesoporous SBA silica microparticles. The fluorescence quenching response allows the sensitive detection of CWAs in the μg m(-3) range in a few seconds. PMID:27124609

  1. Novel silica surface charge density mediated control of the optical properties of embedded optically active materials and its application for fiber optic pH sensing at elevated temperatures

    NASA Astrophysics Data System (ADS)

    Wang, Congjun; Ohodnicki, Paul R.; Su, Xin; Keller, Murphy; Brown, Thomas D.; Baltrus, John P.

    2015-01-01

    Silica and silica incorporated nanocomposite materials have been extensively studied for a wide range of applications. Here we demonstrate an intriguing optical effect of silica that, depending on the solution pH, amplifies or attenuates the optical absorption of a variety of embedded optically active materials with very distinct properties, such as plasmonic Au nanoparticles, non-plasmonic Pt nanoparticles, and the organic dye rhodamine B (not a pH indicator), coated on an optical fiber. Interestingly, the observed optical response to varying pH appears to follow the surface charge density of the silica matrix for all the three different optically active materials. To the best of our knowledge, this optical effect has not been previously reported and it appears universal in that it is likely that any optically active material can be incorporated into the silica matrix to respond to solution pH or surface charge density variations. A direct application of this effect is for optical pH sensing which has very attractive features that can enable minimally invasive, remote, real time and continuous distributed pH monitoring. Particularly, as demonstrated here, using highly stable metal nanoparticles embedded in an inorganic silica matrix can significantly improve the capability of pH sensing in extremely harsh environments which is of increasing importance for applications in unconventional oil and gas resource recovery, carbon sequestration, water quality monitoring, etc. Our approach opens a pathway towards possible future development of robust optical pH sensors for the most demanding environmental conditions. The newly discovered optical effect of silica also offers the potential for control of the optical properties of optically active materials for a range of other potential applications such as electrochromic devices.Silica and silica incorporated nanocomposite materials have been extensively studied for a wide range of applications. Here we demonstrate an

  2. Designed synthesis of carbon-functional magnetic graphene mesoporous silica materials using polydopamine as carbon precursor for the selective enrichment of N-linked glycan.

    PubMed

    Sun, Nianrong; Yao, Jizong; Deng, Chunhui

    2016-02-01

    Glycosylation, which has been confirmed to be associated with many diseases, is an important protein post-translation modification. Taking into account the low abundant of glycan, the purification of complex biological samples is considered to be very significant before mass spectrometry detection. In this work, carbon-functionalized magnetic graphene /mesoporous silica materials (C-Mag G@mSiO2 materials) with high content of carbon were designed and synthesized by using polydopamine as carbon precursor. Taking advantage of the special interaction between carbon and glycan, C-Mag G@mSiO2 materials were successfully applied to enrich N-linked glycans in different complex samples, such as standard glycoprotein digestion, the mixture of standard glycoprotein digestion, glycoprotein and non-glycoprotein, and human serum. PMID:26653470

  3. Direct Measurement of the Nanomechanical Stability of a Redox Protein Active Site and Its Dependence upon Metal Binding.

    PubMed

    Giannotti, Marina I; Cabeza de Vaca, Israel; Artés, Juan M; Sanz, Fausto; Guallar, Victor; Gorostiza, Pau

    2015-09-10

    The structural basis of the low reorganization energy of cupredoxins has long been debated. These proteins reconcile a conformationally heterogeneous and exposed metal-chelating site with the highly rigid copper center required for efficient electron transfer. Here we combine single-molecule mechanical unfolding experiments with statistical analysis and computer simulations to show that the metal-binding region of apo-azurin is mechanically flexible and that high mechanical stability is imparted by copper binding. The unfolding pathway of the metal site depends on the pulling residue and suggests that partial unfolding of the metal-binding site could be facilitated by the physical interaction with certain regions of the redox protein. PMID:26305718

  4. Molecular interactions and metal binding in the theophylline-binding core of an RNA aptamer.

    PubMed Central

    Zimmermann, G R; Wick, C L; Shields, T P; Jenison, R D; Pardi, A

    2000-01-01

    An RNA aptamer containing a 15-nt binding site shows high affinity and specificity for the bronchodilator theophylline. A variety of base modifications or 2' deoxyribose substitutions in binding-site residues were tested for theophyllinebinding affinity and the results were compared with the previously determined three-dimensional structure of the RNA-theophylline complex. The RNA-theophylline complex contains a U6-A28-U23 base triple, and disruption of this A28-U23 Hoogsteen-pair by a 7-deaza, 2'-deoxy A28 mutant reduces theophylline binding >45-fold at 25 degrees C. U24 is part of a U-turn in the core of the RNA, and disruption of this U-turn motif by a 2'-deoxy substitution of U24 also reduces theophylline binding by >90-fold. Several mutations outside the "conserved core" of the RNA aptamer showed reduced binding affinity, and these effects could be rationalized by comparison with the three-dimensional structure of the complex. Divalent ions are absolutely required for high-affinity theophylline binding. High-affinity binding was observed with 5 mM Mg2+, Mn2+, or Co2+ ions, whereas little or no significant binding was observed for other divalent or lanthanide ions. A metal-binding site in the core of the complex was revealed by paramagnetic Mn2+-induced broadening of specific RNA resonances in the NMR spectra. When caffeine is added to the aptamer in tenfold excess, the NMR spectra show no evidence for binding in the conserved core and instead the drug stacks on the terminal helix. The lack of interaction between caffeine and the theophylline-binding site emphasizes the extreme molecular discrimination of this RNA aptamer. PMID:10836787

  5. Kinetics and thermodynamics of metal-binding to histone deacetylase 8

    PubMed Central

    Kim, Byungchul; Pithadia, Amit S; Fierke, Carol A

    2015-01-01

    Histone deacetylase 8 (HDAC8) was originally classified as a Zn(II)-dependent deacetylase on the basis of Zn(II)-dependent HDAC8 activity in vitro and illumination of a Zn(II) bound to the active site. However, in vitro measurements demonstrated that HDAC8 has higher activity with a bound Fe(II) than Zn(II), although Fe(II)-HDAC8 rapidly loses activity under aerobic conditions. These data suggest that in the cell HDAC8 could be activated by either Zn(II) or Fe(II). Here we detail the kinetics, thermodynamics, and selectivity of Zn(II) and Fe(II) binding to HDAC8. To this end, we have developed a fluorescence anisotropy assay using fluorescein-labeled suberoylanilide hydroxamic acid (fl-SAHA). fl-SAHA binds specifically to metal-bound HDAC8 with affinities comparable to SAHA. To measure the metal affinity of HDAC, metal binding was coupled to fl-SAHA and assayed from the observed change in anisotropy. The metal KD values for HDAC8 are significantly different, ranging from picomolar to micromolar for Zn(II) and Fe(II), respectively. Unexpectedly, the Fe(II) and Zn(II) dissociation rate constants from HDAC8 are comparable, koff ∼0.0006 s−1, suggesting that the apparent association rate constant for Fe(II) is slow (∼3 × 103 M−1 s−1). Furthermore, monovalent cations (K+ or Na+) that bind to HDAC8 decrease the dissociation rate constant of Zn(II) by ≥100-fold for K+ and ≥10-fold for Na+, suggesting a possible mechanism for regulating metal exchange in vivo. The HDAC8 metal affinities are comparable to the readily exchangeable Zn(II) and Fe(II) concentrations in cells, consistent with either or both metal cofactors activating HDAC8. PMID:25516458

  6. The different catalytic roles of the metal-binding ligands in human 4-hydroxyphenylpyruvate dioxygenase.

    PubMed

    Huang, Chih-Wei; Liu, Hsiu-Chen; Shen, Chia-Pei; Chen, Yi-Tong; Lee, Sung-Jai; Lloyd, Matthew D; Lee, Hwei-Jen

    2016-05-01

    4-Hydroxyphenylpyruvate dioxygenase (HPPD) is a non-haem iron(II)-dependent oxygenase that catalyses the conversion of 4-hydroxyphenylpyruvate (HPP) to homogentisate (HG). In the active site, a strictly conserved 2-His-1-Glu facial triad co-ordinates the iron ready for catalysis. Substitution of these residues resulted in about a 10-fold decrease in the metal binding affinity, as measured by isothermal titration calorimetry, and a large reduction in enzyme catalytic efficiencies. The present study revealed the vital role of the ligand Glu(349) in enzyme function. Replacing this residue with alanine resulted in loss of activity. The E349G variant retained 5% activity for the coupled reaction, suggesting that co-ordinating water may be able to support activation of the trans-bound dioxygen upon substrate binding. The reaction catalysed by the H183A variant was fully uncoupled. H183A variant catalytic activity resulted in protein cleavage between Ile(267) and Ala(268) and the production of an N-terminal fragment. The H266A variant was able to produce 4-hydroxyphenylacetate (HPA), demonstrating that decarboxylation had occurred but that there was no subsequent product formation. Structural modelling of the variant enzyme with bound dioxygen revealed the rearrangement of the co-ordination environment and the dynamic behaviour of bound dioxygen in the H266A and H183A variants respectively. These models suggest that the residues regulate the geometry of the reactive oxygen intermediate during the oxidation reaction. The mutagenesis and structural simulation studies demonstrate the critical and unique role of each ligand in the function of HPPD, and which correlates with their respective co-ordination position. PMID:26936969

  7. Hepatic cadmium, metal-binding proteins and bioaccumulation in bluegills exposed to aqueous cadmium

    USGS Publications Warehouse

    Cope, W.G.; Atchison, G.J.; Wiener, J.G.

    1994-01-01

    We examined sublethal responses of juvenile bluegills Lepomis macrochirus to aqueous cadmium in two 28-d tests (test I, 0.0-8.4 μg Cd per liter; test II, 0.0-32.3 μg Cd per liter) in an intermittent-flow diluter. The experimental design was completely randomized, with two replicates in each of eight treatments (seven Cd exposures and one water control with 25 fish per replicate). Cadmium did not affect the growth of test fish. The mean whole-body concentrations of Cd in exposed fish were 1.8- to 44-fold those in controls in the two tests. Mean concentrations of hepatic nonthionein cytosolic Cd (not bound by metal-binding proteins, MBP) in all Cd treatments greatly exceeded those in controls, and mean concentrations of hepatic MBP in all treatments except one (0.8 μg Cd per liter in test I) exceeded those in controls. Nonthionein cytosolic Cd, hepatic MBP, and whole-body Cd in bluegills were linearly related to exposure concentrations within the range 0 to 20 μg Cd per liter. Much of the total Cd-binding capacity of hepatic MBP per fish was occupied by Cd after the 28-d exposures, although additional Cd-binding capacity remained unoccupied by Cd in fish in all treatments. The mean total Cd-binding capacity of hepatic MBP per fish, which ranged from 1.7 to 14 nmol Cd in test I and from 0.8 to 24 nmol Cd in test II, increased in a concentration-response manner at exposure concentrations below 13 μg/L. Nonthionein cytosolic Cd was the most sensitive indicator of Cd exposure, based on an LOEC of 0.8 μg Cd per liter.

  8. Evolutionary Implications of Metal Binding Features in Different Species’ Prion Protein: An Inorganic Point of View

    PubMed Central

    La Mendola, Diego; Rizzarelli, Enrico

    2014-01-01

    Prion disorders are a group of fatal neurodegenerative conditions of mammals. The key molecular event in the pathogenesis of such diseases is the conformational conversion of prion protein, PrPC, into a misfolded form rich in β-sheet structure, PrPSc, but the detailed mechanistic aspects of prion protein conversion remain enigmatic. There is uncertainty on the precise physiological function of PrPC in healthy individuals. Several evidences support the notion of its role in copper homeostasis. PrPC binds Cu2+ mainly through a domain composed by four to five repeats of eight amino acids. In addition to mammals, PrP homologues have also been identified in birds, reptiles, amphibians and fish. The globular domain of protein is retained in the different species, suggesting that the protein carries out an essential common function. However, the comparison of amino acid sequences indicates that prion protein has evolved differently in each vertebrate class. The primary sequences are strongly conserved in each group, but these exhibit a low similarity with those of mammals. The N-terminal domain of different prions shows tandem amino acid repeats with an increasing amount of histidine residues going from amphibians to mammals. The difference in the sequence affects the number of copper binding sites, the affinity and the coordination environment of metal ions, suggesting that the involvement of prion in metal homeostasis may be a specific characteristic of mammalian prion protein. In this review, we describe the similarities and the differences in the metal binding of different species’ prion protein, as revealed by studies carried out on the entire protein and related peptide fragments. PMID:24970230

  9. Novel silica surface charge density mediated control of the optical properties of embedded optically active materials and its application for fiber optic pH sensing at elevated temperatures.

    PubMed

    Wang, Congjun; Ohodnicki, Paul R; Su, Xin; Keller, Murphy; Brown, Thomas D; Baltrus, John P

    2015-02-14

    Silica and silica incorporated nanocomposite materials have been extensively studied for a wide range of applications. Here we demonstrate an intriguing optical effect of silica that, depending on the solution pH, amplifies or attenuates the optical absorption of a variety of embedded optically active materials with very distinct properties, such as plasmonic Au nanoparticles, non-plasmonic Pt nanoparticles, and the organic dye rhodamine B (not a pH indicator), coated on an optical fiber. Interestingly, the observed optical response to varying pH appears to follow the surface charge density of the silica matrix for all the three different optically active materials. To the best of our knowledge, this optical effect has not been previously reported and it appears universal in that it is likely that any optically active material can be incorporated into the silica matrix to respond to solution pH or surface charge density variations. A direct application of this effect is for optical pH sensing which has very attractive features that can enable minimally invasive, remote, real time and continuous distributed pH monitoring. Particularly, as demonstrated here, using highly stable metal nanoparticles embedded in an inorganic silica matrix can significantly improve the capability of pH sensing in extremely harsh environments which is of increasing importance for applications in unconventional oil and gas resource recovery, carbon sequestration, water quality monitoring, etc. Our approach opens a pathway towards possible future development of robust optical pH sensors for the most demanding environmental conditions. The newly discovered optical effect of silica also offers the potential for control of the optical properties of optically active materials for a range of other potential applications such as electrochromic devices. PMID:25572664

  10. Enhanced bioaccumulation of heavy metal ions by bacterial cells due to surface display of short metal binding peptides

    SciTech Connect

    Kotrba, P.; Ruml, T.; Doleckova, L.; Lorenzo, V. de

    1999-03-01

    Metal binding peptides of sequences Gly-His-His-Pro-His-Gly (named HP) and Gly-Cys-Gly-Cys-Pro-Cys-Gly-Cys-Gly (named CP) were genetically engineered into LamB protein and expressed in Escherichia coli. The Cd{sup 2+}-to-HP and Cd{sup 2+}-to-CP stoichiometries of peptides were 1:1 and 3:1, respectively. Hybrid LamB proteins were found to be properly folded in the outer membrane of E. coli. Isolated cell envelopes of E. coli bearing newly added metal binding peptides showed an up to 1.8-fold increase in Cd{sup 2+} binding capacity. The bioaccumulation of Cd{sup 2+}, Cu{sup 2+}, and Zn{sup 2+} by E. coli was evaluated. Surface display of CP multiplied the ability of E. coli to bind Cd{sup 2+} from growth medium fourfold. Display of HP peptide did not contribute to an increase in the accumulation of Cu{sup 2+} and Zn{sup 2+}. However, Cu{sup 2+} ceased contribution of HP for Cd{sup 2+} accumulation, probably due to the strong binding of Cu{sup 2+} to HP. Thus, considering the cooperation of cell structures with inserted peptides, the relative affinities of metal binding peptide and, for example, the cell wall to metal ion should be taken into account in the rational design of peptide sequences possessing specificity for a particular metal.

  11. Enhanced Bioaccumulation of Heavy Metal Ions by Bacterial Cells Due to Surface Display of Short Metal Binding Peptides

    PubMed Central

    Kotrba, Pavel; Dolečková, Lucie; de Lorenzo, Víctor; Ruml, Tomas

    1999-01-01

    Metal binding peptides of sequences Gly-His-His-Pro-His-Gly (named HP) and Gly-Cys-Gly-Cys-Pro-Cys-Gly-Cys-Gly (named CP) were genetically engineered into LamB protein and expressed in Escherichia coli. The Cd2+-to-HP and Cd2+-to-CP stoichiometries of peptides were 1:1 and 3:1, respectively. Hybrid LamB proteins were found to be properly folded in the outer membrane of E. coli. Isolated cell envelopes of E. coli bearing newly added metal binding peptides showed an up to 1.8-fold increase in Cd2+ binding capacity. The bioaccumulation of Cd2+, Cu2+, and Zn2+ by E. coli was evaluated. Surface display of CP multiplied the ability of E. coli to bind Cd2+ from growth medium fourfold. Display of HP peptide did not contribute to an increase in the accumulation of Cu2+ and Zn2+. However, Cu2+ ceased contribution of HP for Cd2+ accumulation, probably due to the strong binding of Cu2+ to HP. Thus, considering the cooperation of cell structures with inserted peptides, the relative affinities of metal binding peptide and, for example, the cell wall to metal ion should be taken into account in the rational design of peptide sequences possessing specificity for a particular metal. PMID:10049868

  12. Metal binding sites of the estradiol receptor from calf uterus and their possible role in the regulation of receptor function

    SciTech Connect

    Medici, N.; Minucci, S.; Nigro, V.; Abbondanza, C.; Armetta, I.; Molinari, A.M.; Puca, G.A. )

    1989-01-10

    The existence of putative metal binding sites on the estradiol receptor (ER) molecule from calf uterus was evaluated by immobilizing various divalent metals to iminodiacetate-Sepharose. ER from both crude and highly purified preparations binds to metal-containing adsorbents complexed with Zn(II), Ni(II), Co(II), and Cu(II), but not to those complexed with Fe(II) and Cd(II). Analysis of affinity-labeled ER by ({sup 3}H)tamoxifen aziridine after elution from a column of Zn(II)-charged iminodiacetate-Sepharose showed that ER fragments obtained by extensive trypsinization were also bound. Zn(II) and the same other metals able to bind ER, when immobilized on resins, inhibit the binding of estradiol to the receptor at micromolar concentration. This inhibition is noncompetitive and can be reversed by EDTA. The inhibition of the hormone binding was still present after trypsin treatment of the cytosol, and it was abolished by preincubation with the hormone. Micromolar concentrations of these metals were able to block those chemical-physical changes occurring during the process of ER transformation in vitro. The presence of metal binding sites that modulate the ER activity in the hormone binding domain of ER is speculated. Since progesterone receptor showed the same pattern of binding and elution from metal-containing adsorbents, the presence of metal binding regulatory sites could be a property of all steroid receptors.

  13. Template-directed covalent conjugation of DNA to native antibodies, transferrin and other metal-binding proteins

    NASA Astrophysics Data System (ADS)

    Rosen, Christian B.; Kodal, Anne L. B.; Nielsen, Jesper S.; Schaffert, David H.; Scavenius, Carsten; Okholm, Anders H.; Voigt, Niels V.; Enghild, Jan J.; Kjems, Jørgen; Tørring, Thomas; Gothelf, Kurt V.

    2014-09-01

    DNA-protein conjugates are important in bioanalytical chemistry, molecular diagnostics and bionanotechnology, as the DNA provides a unique handle to identify, functionalize or otherwise manipulate proteins. To maintain protein activity, conjugation of a single DNA handle to a specific location on the protein is often needed. However, preparing such high-quality site-specific conjugates often requires genetically engineered proteins, which is a laborious and technically challenging approach. Here we demonstrate a simpler method to create site-selective DNA-protein conjugates. Using a guiding DNA strand modified with a metal-binding functionality, we directed a second DNA strand to the vicinity of a metal-binding site of His6-tagged or wild-type metal-binding proteins, such as serotransferrin, where it subsequently reacted with lysine residues at that site. This method, DNA-templated protein conjugation, facilitates the production of site-selective protein conjugates, and also conjugation to IgG1 antibodies via a histidine cluster in the constant domain.

  14. Insulation formed of precipitated silica and fly ash

    SciTech Connect

    Barito, R.W.; Downs, K.L.

    1987-07-21

    This patent describes a slab of board-like material for use as a thermal insulation comprising: a. a precipitated silica and a fly ash material, between 30% and 70% based upon the total weight of the precipitated silica and fly ash material; and b. a gas and water light envelope containing the mixture of precipitated silica and fly ash material.

  15. Novel Sol–Gel Precursors for Thin Mesoporous Eu3+-Doped Silica Coatings as Efficient Luminescent Materials.

    PubMed Central

    2012-01-01

    Europium(III) ions containing mesoporous silica coatings have been prepared via a solvent evaporation-induced self-assembly (EISA) approach of different single-source precursors (SSPs) in the presence of Pluronic P123 as a structure-directing agent, using the spin-coating process. A deliberate tailoring of the chemical composition of the porous coatings with various Si:Eu ratios was achieved by processing mixtures of tetraethylorthosilicate (TEOS) and Eu3+-coordinated SSPs. Small-angle X-ray scattering (SAXS) and transmission electron microscopy (TEM) analyses demonstrate that the thin metal oxide-doped silica coatings consist of a porous network with a short-range order of the pore structure, even at high europium(III) loadings. Furthermore, luminescence properties were investigated at different temperatures and different degrees of Eu3+ contents. The photoluminescence spectra clearly show characteristic emission peaks corresponding to the 5D0 → 7FJ (J = 0–5) transitions resulting in a red luminescence visible by the eyes, although the films have a very low thickness (150–200 nm). PMID:23503160

  16. Heavy metal binding to heparin disaccharides. I. Iduronic acid is the main binding site.

    PubMed

    Whitfield, D M; Choay, J; Sarkar, B

    1992-06-01

    As model compounds for Ni(II)-binding heparin-like compounds isolated from human kidneys (Templeton, D.M. & Sarkar, B. (1985) Biochem. J. 230 35-42.), we investigated two disaccharides--4-O-(2-O-sulfo-alpha-L-idopyranosyluronic acid)-2,5-anhydro- D-mannitol, disodium salt (1a), and 4-O-(2-O-sulfo-alpha-L-idopyranosyluronic acid)-6-O- sulfo-2,5-anhydro-D-mannitol, trisodium salt (1b)--that were isolated from heparin after nitrous acid hydrolysis and reduction. The monosulfate (1a) was active whereas the disulfate (1b) was inactive in a high-performance liquid chromatography (HPLC) binding assay with the tracer ions 63Ni(II) 54Mn(II), 65Zn(II), and 109Cd(II). This result is in accord with the isolation of two 67Cu(II) and 63Ni(II) binding fractions from a complete pool of nitrous-acid-derived heparin disaccharides using sulfate gradients and a MonoQ anion exchange column on an FPLC system. One was identified as compound (1a) and the other as a tetrasulfated trisaccharide by high resolution FAB-MS, NMR and HPLC-PAD. Similarly, two synthetic disaccharides-methyl, 2-O-sulfo-4-O-(alpha-L-idopyranosyluronic acid)-2-deoxy-2-sulfamide-alpha-D-glucosamine, trisodium salt [IdopA2S(alpha 1,4)GlcNS alpha Me, 2a], and 2-O-sulfo-4-O-(alpha-L-idopyranosyluronic acid)-2-deoxy-2-sulfamide-6-O-sulfo- alpha-D-glucosamine, tetrasodium salt [IdopA2S (alpha 1,4)GlcNS6S alpha Me, 2b]--were shown to bind tracer amounts of 63Ni and 67Cu using chromatographic assays. Subsequently, 1H NMR titrations of 1a, 1b, 2a, and 2b with Zn (OAc)2 were analyzed to yield 1:1 Zn(II)-binding constants of 472 +/- 59, 698 +/- 120, 8,758 +/- 2,237 and 20,100 +/- 5,598 M-1, respectively. The values for 2a and 2b suggest chelation. It is suggested that the idopyranosiduronic acid residue is the major metal binding site. NMR evidence for this hypothesis comes from marked 1H and 13C chemical shift changes to the iduronic acid resonances after addition of diamagnetic Zn(II) ions. PMID:1643264

  17. Bivalent-metal binding to CheY protein. Effect on protein conformation.

    PubMed Central

    Kar, L; Matsumura, P; Johnson, M E

    1992-01-01

    CheY is a 14 kDa cytoplasmic protein that is activated by the transfer of a phosphoryl moiety to Asp-57 from phosphoCheA during signal transduction in bacterial chemotaxis. It has been established that metal ions are necessary for the autophosphorylation of CheA, the transfer of phosphate from phosphoCheA to CheY and the autodephosphorylation of phosphoCheY. In this work, paramagnetic relaxation enhancement has been used in conjunction with one- and two-dimensional n.m.r. to study the interaction of CheY with bivalent metal ions. These studies have led to the discovery of two conformations of the protein in water, corresponding to the metal-free and the metal-bound states. Binding of bivalent cations like Mg2+, Ca2+, Sr2+, Zn2+ and Mn2+ results in a conformational change from the metal-free to the metal-bound state. Preliminary assignments of the aromatic proton resonances are reported. Comparison of phase-sensitive double-quantum-filtered COSY, homonuclear Hartmann-Hahn coherence transfer and nuclear Overhauser enhancement spectra from the metal-bound and metal-free protein indicates that Trp-58, Thr-87 and Tyr-106 are particularly affected by the conformational change involved, and that this change is limited to a small number of residues. In addition, homonuclear Hartmann-Hahn coherence transfer experiments with paramagnetic Mn2+ show significant suppression of cross-peaks associated with Trp-58 and several neighbouring residues. Comparison of the distances estimated using n.m.r. with the CheY crystal structure indicates that the n.m.r. results are consistent with bivalent metal binding at the cluster of aspartic acid residues that includes Asp-13 and Asp-57. These studies also demonstrate the utility of paramagnetic metal-induced relaxation in conjunction with two-dimensional n.m.r. measurements for exploring ligand-binding sites. PMID:1445211

  18. Preliminary study of the metal binding site of an anti-DTPA-indium antibody by equilibrium binding immunoassays and immobilized metal ion affinity chromatography.

    PubMed

    Boden, V; Colin, C; Barbet, J; Le Doussal, J M; Vijayalakshmi, M

    1995-01-01

    Creating metal coordination sites by modifying an existing enzyme or by eliciting antibodies against metal chelate haptens is of great interest in biotechnology to create enzyme catalysts with novel specificities. Here, we investigate the metal binding potential of a monoclonal antibody raised against a DTPA-In(III) hapten (mAb 734). We study its relative binding efficiency to metals of biological relevance by equilibrium binding immunoassays and immobilized metal ion affinity chromatography, two approaches which can give complementary information regarding composition and/or structure of the metal binding site(s). Fe(III), Fe(II), Cu(II), Mg(II), Ca(II), and Zn(II) binding was compared to In(III). All of them were shown to displace indium, but their affinity for mAb 734 decreased by 100-fold compared to indium. Competitive metal binding immunoassays between Zn(II) and In(III) revealed an unusual behavior by Zn(II) which remains to be explained. Moreover, IMAC allowed us to predict the metal binding amino acids involved in the antibody paratope. The antibody metal binding site was shown to contain at least two histidine residues in a cluster, and the presence of aspartic and glutamic acid as well as cysteine residues could not be excluded. Thus, simple competition studies allows us to obtain some partial information on the metal binding structural features of this anti-metal chelate antibody and to guide our screening of its catalytic potential. PMID:7578356

  19. Silaffins in Silica Biomineralization and Biomimetic Silica Precipitation

    PubMed Central

    Lechner, Carolin C.; Becker, Christian F. W.

    2015-01-01

    Biomineralization processes leading to complex solid structures of inorganic material in biological systems are constantly gaining attention in biotechnology and biomedical research. An outstanding example for biomineral morphogenesis is the formation of highly elaborate, nano-patterned silica shells by diatoms. Among the organic macromolecules that have been closely linked to the tightly controlled precipitation of silica in diatoms, silaffins play an extraordinary role. These peptides typically occur as complex posttranslationally modified variants and are directly involved in the silica deposition process in diatoms. However, even in vitro silaffin-based peptides alone, with and without posttranslational modifications, can efficiently mediate biomimetic silica precipitation leading to silica material with different properties as well as with encapsulated cargo molecules of a large size range. In this review, the biomineralization process of silica in diatoms is summarized with a specific focus on silaffins and their in vitro silica precipitation properties. Applications in the area of bio- and nanotechnology as well as in diagnostics and therapy are discussed. PMID:26295401

  20. Silaffins in Silica Biomineralization and Biomimetic Silica Precipitation.

    PubMed

    Lechner, Carolin C; Becker, Christian F W

    2015-08-01

    Biomineralization processes leading to complex solid structures of inorganic material in biological systems are constantly gaining attention in biotechnology and biomedical research. An outstanding example for biomineral morphogenesis is the formation of highly elaborate, nano-patterned silica shells by diatoms. Among the organic macromolecules that have been closely linked to the tightly controlled precipitation of silica in diatoms, silaffins play an extraordinary role. These peptides typically occur as complex posttranslationally modified variants and are directly involved in the silica deposition process in diatoms. However, even in vitro silaffin-based peptides alone, with and without posttranslational modifications, can efficiently mediate biomimetic silica precipitation leading to silica material with different properties as well as with encapsulated cargo molecules of a large size range. In this review, the biomineralization process of silica in diatoms is summarized with a specific focus on silaffins and their in vitro silica precipitation properties. Applications in the area of bio- and nanotechnology as well as in diagnostics and therapy are discussed. PMID:26295401

  1. RAFT Polymerization of N-[3-(Trimethoxysilyl)-propyl]acrylamide and Its Versatile Use in Silica Hybrid Materials.

    PubMed

    Maçon, Anthony L B; Greasley, Sarah L; Becer, C Remzi; Jones, Julian R

    2015-12-01

    Reversible addition-fragmentation chain transfer (RAFT) polymerization and characterization of an alkoxysilane acrylamide monomer using a trithiocarbonate chain transfer agent are described. Poly(N-[3-(trimethoxysilyl)propyl]acrylamide) (PTMSPAA) homopolymers are obtained with good control over the polymerization. A linear increase in the molecular weight is observed whereas the polydispersity values do not exceed 1.2 regardless of the monomer conversion. Moreover, PTMSPAA is used as a macro-RAFT agent to polymerize N-isopropylacrylamide (NIPAM). By varying the degree of polymerization of NIPAM within the block copolymer, different sizes of thermoresponsive particles are obtained. These particles are stabilized by the condensation of the alkoxysilane moieties of the polymers. Furthermore, a co-network of silica and PTMSPAA is prepared using the sol-gel process. After drying, transparent mesoporous hybrids are obtained with a surface area of up to 400 m(2) g(-1). PMID:26288010

  2. Exposure to crystalline silica in abrasive blasting operations where silica and non-silica abrasives are used.

    PubMed

    Radnoff, Diane L; Kutz, Michelle K

    2014-01-01

    Exposure to respirable crystalline silica is a hazard common to many industries in Alberta but particularly so in abrasive blasting. Alberta occupational health and safety legislation requires the consideration of silica substitutes when conducting abrasive blasting, where reasonably practicable. In this study, exposure to crystalline silica during abrasive blasting was evaluated when both silica and non-silica products were used. The crystalline silica content of non-silica abrasives was also measured. The facilities evaluated were preparing metal products for the application of coatings, so the substrate should not have had a significant contribution to worker exposure to crystalline silica. The occupational sampling results indicate that two-thirds of the workers assessed were potentially over-exposed to respirable crystalline silica. About one-third of the measurements over the exposure limit were at the work sites using silica substitutes at the time of the assessment. The use of the silica substitute, by itself, did not appear to have a large effect on the mean airborne exposure levels. There are a number of factors that may contribute to over-exposures, including the isolation of the blasting area, housekeeping, and inappropriate use of respiratory protective equipment. However, the non-silica abrasives themselves also contain silica. Bulk analysis results for non-silica abrasives commercially available in Alberta indicate that many contain crystalline silica above the legislated disclosure limit of 0.1% weight of silica per weight of product (w/w) and this information may not be accurately disclosed on the material safety data sheet for the product. The employer may still have to evaluate the potential for exposure to crystalline silica at their work site, even when silica substitutes are used. Limited tests on recycled non-silica abrasive indicated that the silica content had increased. Further study is required to evaluate the impact of product recycling

  3. Mesoporous Silica: A Suitable Adsorbent for Amines

    PubMed Central

    2009-01-01

    Mesoporous silica with KIT-6 structure was investigated as a preconcentrating material in chromatographic systems for ammonia and trimethylamine. Its adsorption capacity was compared to that of existing commercial materials, showing its increased adsorption power. In addition, KIT-6 mesoporous silica efficiently adsorbs both gases, while none of the employed commercial adsorbents did. This means that KIT-6 Mesoporous silica may be a good choice for integrated chromatography/gas sensing micro-devices. PMID:20628459

  4. Oxidation Protection in Metal-Binding Peptide Motif and Its Application to Antibody for Site-Selective Conjugation

    PubMed Central

    Chung, Hye-Shin; Lee, Sunbae; Park, Soon Jae

    2016-01-01

    Here, we demonstrate that a metal ion binding motif could serve as an efficient and robust tool for site-specific conjugation strategy. Cysteine-containing metal binding motifs were constructed as single repeat or tandem repeat peptides and their metal binding characteristics were investigated. The tandem repeats of the Cysteine-Glycine-Histidine (CGH) metal ion binding motif exhibited concerted binding to Co(II) ions, suggesting that conformational transition of peptide was triggered by the sequential metal ion binding. Evaluation of the free thiol content after reduction by reducing reagent showed that metal-ion binding elicited strong retardation of cysteine oxidation in the order of Zn(II)>Ni(II)>Co(II). The CGH metal ion binding motif was then introduced to the C-terminus of antibody heavy chain and the metal ion-dependent characteristics of oxidation kinetics were investigated. As in the case of peptides, CGH-motif-introduced antibody exhibited strong dependence on metal ion binding to protect against oxidation. Zn(II)-saturated antibody with tandem repeat of CGH motif retains the cysteine reactivity as long as 22 hour even with saturating O2 condition. Metal-ion dependent fluorophore labeling clearly indicated that metal binding motifs could be employed as an efficient tool for site-specific conjugation. Whereas Trastuzumab without a metal ion binding site exhibited site-nonspecific dye conjugation, Zn(II) ion binding to antibody with a tandem repeat of CGH motif showed that fluorophores were site-specifically conjugated to the heavy chain of antibody. We believe that this strong metal ion dependence on oxidation protection and the resulting site-selective conjugation could be exploited further to develop a highly site-specific conjugation strategy for proteins that contain multiple intrinsic cysteine residues, including monoclonal antibodies. PMID:27420328

  5. Spectroscopic and metal-binding properties of DF3: an artificial protein able to accommodate different metal ions

    PubMed Central

    Torres Martin de Rosales, Rafael; Faiella, Marina; Farquhar, Erik; Que, Lawrence; Andreozzi, Concetta; Pavone, Vincenzo; Maglio, Ornella; Nastri, Flavia

    2010-01-01

    The design, synthesis, and metal-binding properties of DF3, a new de novo designed di-iron protein model are described (“DF” represents due ferri, Italian for “two iron,” “di-iron”). DF3 is the latest member of the DF family of synthetic proteins. They consist of helix–loop–helix hairpins, designed to dimerize and form an antiparallel four-helix bundle that encompasses a metal-binding site similar to those of non-heme carboxylate-bridged di-iron proteins. Unlike previous DF proteins, DF3 is highly soluble in water (up to 3 mM) and forms stable complexes with several metal ions (Zn, Co, and Mn), with the desired secondary structure and the expected stoichiometry of two ions per protein. UV–vis studies of Co(II) and Fe(III) complexes confirm a metal-binding environment similar to previous di-Co(II)- and di-Fe(III)-DF proteins, including the presence of a µ-oxo-di-Fe(III) unit. Interestingly, UV–vis, EPR, and resonance Raman studies suggest the interaction of a tyro-sine adjacent to the di-Fe(III) center. The design of DF3 was aimed at increasing the accessibility of small molecules to the active site of the four-helix bundle. Indeed, binding of azide to the di-Fe(III) site demonstrates a more accessible metal site compared with previous DFs. In fact, fitting of the binding curve to the Hill equation allows us to quantify a 150% accessibility enhancement, with respect to DF2. All these results represent a significant step towards the development of a functional synthetic DF metalloprotein. PMID:20225070

  6. Metal binding sites of the estradiol receptor from calf uterus and their possible role in the regulation of receptor function.

    PubMed

    Medici, N; Minucci, S; Nigro, V; Abbondanza, C; Armetta, I; Molinari, A M; Puca, G A

    1989-01-10

    The existence of putative metal binding sites on the estradiol receptor (ER) molecule from calf uterus was evaluated by immobilizing various divalent metals to iminodiacetate-Sepharose. ER from both crude and highly purified preparations binds to metal-containing adsorbents complexed with Zn(II), Ni(II), Co(II), and Cu(II), but not to those complexed with Fe(II) and Cd(II). Elution of ER was obtained by chelating agents or by imidazole, thus indicating that histidine residues on the ER molecule are involved in the interaction with the metal. Analysis of affinity-labeled ER by [3H]tamoxifen aziridine after elution from a column of Zn(II)-charged iminodiacetate-Sepharose showed that ER fragments obtained by extensive trypsinization were also bound. Zn(II) and the same other metals able to bind ER, when immobilized on resins, inhibit the binding of estradiol to the receptor at micromolar concentrations. This inhibition is noncompetitive and can be reversed by EDTA. The inhibition of the hormone binding was still present after trypsin treatment of the cytosol, and it was abolished by preincubation with the hormone. Micromolar concentrations of these metals were able to block those chemical-physical changes occurring during the process of ER transformation in vitro. Furthermore, if added to pretransformed ER-hormone complex, they strongly inhibited the binding of the complex to isolated nuclei. The presence of metal binding sites that modulate the ER activity in the hormone binding domain of ER is therefore speculated. Since progesterone receptor showed the same pattern of binding and elution from metal-containing adsorbents, the presence of metal binding regulatory sites could be a property of all steroid receptors. PMID:2706244

  7. Myoglobin-biomimetic electroactive materials made by surface molecular imprinting on silica beads and their use as ionophores in polymeric membranes for potentiometric transduction.

    PubMed

    Moreira, Felismina T C; Dutra, Rosa A F; Noronha, Joao P C; Sales, M Goreti F

    2011-08-15

    Myoglobin (Mb) is among the cardiac biomarkers playing a major role in urgent diagnosis of cardiovascular diseases. Its monitoring in point-of-care is therefore fundamental. Pursuing this goal, a novel biomimetic ionophore for the potentiometric transduction of Mb is presented. It was synthesized by surface molecular imprinting (SMI) with the purpose of developing highly efficient sensor layers for near-stereochemical recognition of Mb. The template (Mb) was imprinted on a silane surface that was covalently attached to silica beads by means of self-assembled monolayers. First the silica was modified with an external layer of aldehyde groups. Then, Mb was attached by reaction with its amine groups (on the external surface) and subsequent formation of imine bonds. The vacant places surrounding Mb were filled by polymerization of the silane monomers 3-aminopropyltrimethoxysilane (APTMS) and propyltrimethoxysilane (PTMS). Finally, the template was removed by imine cleavage after treatment with oxalic acid. The results materials were finely dispersed in plasticized PVC selective membranes and used as ionophores in potentiometric transduction. The best analytical features were found in HEPES buffer of pH 4. Under this condition, the limits of detection were of 1.3 × 10(-6)mol/L for a linear response after 8.0 × 10(-7) mol/L with an anionic slope of -65.9 mV/decade. The imprinting effect was tested by preparing non-imprinted (NI) particles and employing these materials as ionophores. The resulting membranes showed no ability to detect Mb. Good selectivity was observed towards creatinine, sacarose, fructose, galactose, sodium glutamate, and alanine. The analytical application was conducted successfully and showed accurate and precise results. PMID:21683568

  8. Research and Development of a New Silica-Alumina Based Cementitious Material Largely Using Coal Refuse for Mine Backfill, Mine Sealing and Waste Disposal Stabilization

    SciTech Connect

    Henghu Sun; Yuan Yao

    2012-06-29

    Coal refuse and coal combustion byproducts as industrial solid waste stockpiles have become great threats to the environment. To activate coal refuse is one practical solution to recycle this huge amount of solid waste as substitute for Ordinary Portland Cement (OPC). The central goal of this project is to investigate and develop a new silica-alumina based cementitious material largely using coal refuse as a constituent that will be ideal for durable construction, mine backfill, mine sealing and waste disposal stabilization applications. This new material is an environment-friendly alternative to Ordinary Portland Cement. The main constituents of the new material are coal refuse and other coal wastes including coal sludge and coal combustion products (CCPs). Compared with conventional cement production, successful development of this new technology could potentially save energy and reduce greenhouse gas emissions, recycle vast amount of coal wastes, and significantly reduce production cost. A systematic research has been conducted to seek for an optimal solution for enhancing pozzolanic reactivity of the relatively inert solid waste-coal refuse in order to improve the utilization efficiency and economic benefit as a construction and building material.

  9. Hints for Metal-Preference Protein Sequence Determinants: Different Metal Binding Features of the Five Tetrahymena thermophila Metallothioneins

    PubMed Central

    Espart, Anna; Marín, Maribel; Gil-Moreno, Selene; Palacios, Òscar; Amaro, Francisco; Martín-González, Ana; Gutiérrez, Juan C.; Capdevila, Mercè; Atrian, Sílvia

    2015-01-01

    The metal binding preference of metallothioneins (MTs) groups them in two extreme subsets, the Zn/Cd- and the Cu-thioneins. Ciliates harbor the largest MT gene/protein family reported so far, including 5 paralogs that exhibit relatively low sequence similarity, excepting MTT2 and MTT4. In Tetrahymena thermophila, three MTs (MTT1, MTT3 and MTT5) were considered Cd-thioneins and two (MTT2 and MTT4) Cu-thioneins, according to gene expression inducibility and phylogenetic analysis. In this study, the metal-binding abilities of the five MTT proteins were characterized, to obtain information about the folding and stability of their cognate- and non-cognate metal complexes, and to characterize the T. thermophila MT system at protein level. Hence, the five MTTs were recombinantly synthesized as Zn2+-, Cd2+- or Cu+-complexes, which were analyzed by electrospray mass spectrometry (ESI-MS), circular dichroism (CD), and UV-vis spectrophotometry. Among the Cd-thioneins, MTT1 and MTT5 were optimal for Cd2+ coordination, yielding unique Cd17- and Cd8- complexes, respectively. When binding Zn2+, they rendered a mixture of Zn-species. Only MTT5 was capable to coordinate Cu+, although yielding heteronuclear Zn-, Cu-species or highly unstable Cu-homometallic species. MTT3 exhibited poor binding abilities both for Cd2+ and for Cu+, and although not optimally, it yielded the best result when coordinating Zn2+. The two Cu-thioneins, MTT2 and MTT4 isoforms formed homometallic Cu-complexes (major Cu20-MTT) upon synthesis in Cu-supplemented hosts. Contrarily, they were unable to fold into stable Cd-complexes, while Zn-MTT species were only recovered for MTT4 (major Zn10-MTT4). Thus, the metal binding preferences of the five T. thermophila MTs correlate well with their previous classification as Cd- and Cu-thioneins, and globally, they can be classified from Zn/Cd- to Cu-thioneins according to the gradation: MTT1>MTT5>MTT3>MTT4>MTT2. The main mechanisms underlying the evolution and

  10. Structural Comparisons of Apo- and Metalated Three-Stranded Coiled Coils Clarify Metal Binding Determinants in Thiolate Containing Designed Peptides

    SciTech Connect

    Chakraborty, Saumen; Touw, Debra S.; Peacock, Anna F.A.; Stuckey, Jeanne; Pecoraro, Vincent L.

    2010-11-05

    Over the past two decades, designed metallopeptides have held the promise for understanding a variety of fundamental questions in metallobiochemistry; however, these dreams have not yet been realized because of a lack of structural data to elaborate the protein scaffolds before metal complexation and the resultant metalated structures which ultimately exist. This is because there are few reports of structural characterization of such systems either in their metalated or nonmetalated forms and no examples where an apo structure and the corresponding metalated peptide assembly have both been defined by X-ray crystallography. Herein we present X-ray structures of two de novo designed parallel three-stranded coiled coils (designed using the heptad repeat (a {yields} g)) CSL9C (CS = Coil Ser) and CSL19C in their nonmetalated forms, determined to 1.36 and 2.15 {angstrom} resolutions, respectively. Leucines from either position 9 (a site) or 19 (d site) are replaced by cysteine to generate the constructs CSL9C and CSL19C, respectively, yielding thiol-rich pockets at the hydrophobic interior of these peptides, suitable to bind heavy metals such as As(III), Hg(II), Cd(II), and Pb(II). We use these structures to understand the inherent structural differences between a and d sites to clarify the basis of the observed differential spectroscopic behavior of metal binding in these types of peptides. Cys side chains of (CSL9C){sub 3} show alternate conformations and are partially preorganized for metal binding, whereas cysteines in (CSL19C){sub 3} are present as a single conformer. Zn(II) ions, which do not coordinate or influence Cys residues at the designed metal sites but are essential for forming X-ray quality crystals, are bound to His and Glu residues at the crystal packing interfaces of both structures. These 'apo' structures are used to clarify the changes in metal site organization between metalated As(CSL9C){sub 3} and to speculate on the differential basis of Hg

  11. The Role of Silica in Precious Metal Supported Titania Hybrid Mesoporous Materials for Remediation and Energy Production

    NASA Astrophysics Data System (ADS)

    Kibombo, Harrison S.

    Semiconductor photocatalysis is an advanced oxidation process (AOP) that continues to show promise for the concomitant mineralization of non--biodegradable noxious and persistent organic pollutants (POPs) to environmentally benign products, and the splitting of water. This work examined the use of sol--gel chemistry as a viable approach for the incorporation of transparent silica (SiO2) matrix and/or platinum onto titania (TiO2) so as to optimize physico-chemical properties such as charge separation, crystallinity, surface area, and particle size. It was determined that crystallinity of anatase in the mixed oxide photocatalyst can be improved by the addition of simple non-polar aromatic co-solvents in the sol-gel route, and subsequently enhance the photocatalytic degradation of phenol under UV--light irradiation. The Pt of smaller particle sizes in Pt--TiO2--SiO 2 resulted in higher phenol degradation efficiencies under solar simulated conditions, irrespective of the synthesis method employed. The presence of Pt in the lowest oxidation state, Pt0, is crucial for enhanced phenol degradation whereas PtO2 (Pt4+) serves as a mild recombination center for photogenerated charge carriers rather than demonstrating total inactivity. The production of ·OH radicals was shown to be imperative for sustaining the degradation process. In the water splitting reaction for hydrogen production, the role of the crystallinity of anatase is reaffirmed when TiO2--SiO2 is used, as the surface defects present in the silica phase seem to serve as recombination centers. However, in Pt--TiO2 photocatalysts, the presence of Pt 0 or PtO2 in close contact with TiO2 (heterojunction) allows for more efficient electron propagation and facilitates minimization of electron--hole recombination, hence improved solar simulated photocatalytic hydrogen evolution. Extensive characterization of the photocatalysts were carried out by powder X--ray Diffraction (XRD), Nitrogen Physisorption Studies, Diffuse

  12. Porous carbon-coated silica macroparticles as anode materials for lithium ion batteries: Effect of boric acid

    NASA Astrophysics Data System (ADS)

    Kim, Young-Kuk; Moon, Jong-Woo; Lee, Jung-Goo; Baek, Youn-Kyung; Hong, Seong-Hyun

    2014-12-01

    We report carbon-coated porous silica macroparticles (SiO2@C) prepared using polymeric templates and subsequent carbonization with sucrose for improved electrochemical energy storage in lithium-ion batteries (LIBs). In addition, boron is introduced to improve the stability of electrochemical cells by pyrolyzing mixtures of sucrose and boric acid (SiO2@C + B) under inert atmosphere. The initially large surface area of porous SiO2 (SBET ∼ 658 m2 g-1) is reduced to 102 m2 g-1 after carbonization and introduction of boric acid. Surface of both SiO2@C and SiO2@C + B are covered with amorphous carbon. In particular, SiO2@C + B particles containing borosilicate (Si-O-B) phase and B-O bondings and Si-C-O bondings are also detected from the X-ray photoelectron spectra. The SiO2@C + B macroparticles shows high reversible charge capacity up to 503 mAh g-1 after 103 cycles of Li intercalation/de-intercalation although initial capacity was 200 mAh g-1. The improved charge capacity of SiO2@C + B is attributed to formation of advantageous microstructures induced from boric acid.

  13. Porous carbon-coated silica macroparticles as anode materials for lithium ion batteries: Effect of boric acid

    NASA Astrophysics Data System (ADS)

    Kim, Young-Kuk; Moon, Jong-Woo; Lee, Jung-Goo; Baek, Youn-Kyung; Hong, Seong-Hyun

    2014-12-01

    We report carbon-coated porous silica macroparticles (SiO2@C) prepared using polymeric templates and subsequent carbonization with sucrose for improved electrochemical energy storage in lithium-ion batteries (LIBs). In addition, boron is introduced to improve the stability of electrochemical cells by pyrolyzing mixtures of sucrose and boric acid (SiO2@C + B) under inert atmosphere. The initially large surface area of porous SiO2 (SBET ˜ 658 m2 g-1) is reduced to 102 m2 g-1 after carbonization and introduction of boric acid. Surface of both SiO2@C and SiO2@C + B are covered with amorphous carbon. In particular, SiO2@C + B particles containing borosilicate (Si-O-B) phase and B-O bondings and Si-C-O bondings are also detected from the X-ray photoelectron spectra. The SiO2@C + B macroparticles shows high reversible charge capacity up to 503 mAh g-1 after 103 cycles of Li intercalation/de-intercalation although initial capacity was 200 mAh g-1. The improved charge capacity of SiO2@C + B is attributed to formation of advantageous microstructures induced from boric acid.

  14. Modified mesoporous silica materials for on-line separation and preconcentration of hexavalent chromium using a microcolumn coupled with flame atomic absorption spectrometry.

    PubMed

    Wang, Zheng; Fang, Dong-Mei; Li, Qing; Zhang, Ling-Xia; Qian, Rong; Zhu, Yan; Qu, Hai-Yun; Du, Yi-Ping

    2012-05-01

    A modified SBA-15 mesoporous silica material NH(2)-SBA-15 was synthesized successfully by grafting γ-aminopropyl-triethoxysilane. The material was characterized using transmission electron microscopy (TEM) and Fourier transform infrared/Raman (FT-IR/Raman) spectroscopy, and used for the first time in a flow injection on-line solid phase extraction (SPE) coupled with flame atomic absorption spectrometry (FAAS) to detect trace Cr (VI). Effective sorption of Cr (VI) was achieved at pH 2.0 with no interference from Cr (III) and other ions and 0.5 mol L(-1) NH(3)·H(2)O solution was found optimal for the complete elution of Cr (VI). An enrichment factor of 44 and was achieved under optimized experimental conditions at a sample loading of 2.0 mL min(-1) sample loading (300 s) and an elution flow rate of 2.0 mL min(-1) (24s). The precision of the 11 replicate Cr (VI) measurements was 2.1% at the 100 μg L(-1) level with a detection limit of 0.2 μg L(-1) (3s, n=10) using the FAAS. The developed method was successfully applied to trace chromium determination in waste water. The accuracy was validated using a certified reference material of riverine water (GBW08607). PMID:22502615

  15. Metal-binding proteins and peptides in the aquatic fungi Fontanospora fusiramosa and Flagellospora curta exposed to severe metal stress.

    PubMed

    Guimarães-Soares, Luís; Felícia, Helena; João Bebianno, Maria; Cássio, Fernanda

    2006-12-15

    The production of thiol-containing proteins/peptides and its role in metal-binding was examined in the aquatic hyphomycetes Fontanospora fusiramosa and Flagellospora curta exposed to Cu, Cd, or Zn at concentrations inhibiting the biomass production in 80%. Heat-treated cell-free extracts were separated by size-exclusion chromatography and the thiol and metal content in the fractions was determined. F. curta, the species tolerant to metals, showed higher absolute levels of thiol compounds, which bound higher amounts of Cu and Cd than F. fusiramosa. Peptides with very low molecular weight (<9 kDa), most likely glutathione and phytochelatins, were the major Cu- and Zn-binding components in both species of aquatic hyphomycetes. In most cases, proteins with high molecular weight (>26 kDa) were induced by metal ions and they were the major Cd-binding component in both species. Proteins with characteristics of metallothioneins were also induced by exposure to metals in both species, but they showed a minor role in metal-binding, suggesting they might have other functions in fungal cells. PMID:17083969

  16. Direct vibrational structure of protein metal-binding sites from near-infrared Yb3+ vibronic side band spectroscopy.

    PubMed Central

    Roselli, C; Boussac, A; Mattioli, T A

    1994-01-01

    Near-infrared Yb3+ vibronic side band (VSB) spectroscopy is used to obtain structural information of metal binding sites in metalloproteins. This technique provides a selective "IR-like" vibrational spectrum of those ligands chelated to the Yb3+ ion. VSB spectra of various model complexes of Yb3+ representing different ligand types were studied to provide references for the VSB spectra of Yb(3+)-reconstituted metalloproteins. Ca2+ in the calcium-binding protein parvalbumin and Fe3+ in the iron-transporting protein transferrin were replaced with Yb3+. The fluorescence of Yb3+ reconstituted into these two proteins exhibits weak VSBs whose energy shifts, with respect to the main 2F5/2-->2F7/2 Yb3+ electronic transition, represent the vibrational frequencies of the Yb3+ ligands. The chemical nature of the ligands of the Yb3+ in these proteins, as deduced by the observed VSB frequencies, is entirely in agreement with their known crystal structures. For transferrin, replacement of the 12CO3(2-) metal counterion with 13CO3(2-) yielded the expected isotopic shift for the VSBs corresponding to the carbonate vibrational modes. This technique demonstrates enormous potential in elucidating the localized structure of metal binding sites in proteins. PMID:7809143

  17. Does Variation of the Inter-Domain Linker Sequence Modulate the Metal Binding Behaviour of Helix pomatia Cd-Metallothionein?

    PubMed Central

    Gil-Moreno, Selene; Jiménez-Martí, Elena; Palacios, Òscar; Zerbe, Oliver; Dallinger, Reinhard; Capdevila, Mercè; Atrian, Sílvia

    2015-01-01

    Snail metallothioneins (MTs) constitute an ideal model to study structure/function relationships in these metal-binding polypeptides. Helix pomatia harbours three MT isoforms: the highly specific CdMT and CuMT, and an unspecific Cd/CuMT, which represent paralogous proteins with extremely different metal binding preferences while sharing high sequence similarity. Preceding work allowed assessing that, although, the Cys residues are responsible for metal ion coordination, metal specificity or preference is achieved by diversification of the amino acids interspersed between them. The metal-specific MT polypeptides fold into unique, energetically-optimized complexes of defined metal content, when binding their cognate metal ions, while they produce a mixture of complexes, none of them representing a clear energy minimum, with non-cognate metal ions. Another critical, and so far mostly unexplored, region is the stretch linking the individual MT domains, each of which represents an independent metal cluster. In this work, we have designed and analyzed two HpCdMT constructs with substituted linker segments, and determined their coordination behavior when exposed to both cognate and non-cognate metal ions. Results unequivocally show that neither length nor composition of the inter-domain linker alter the features of the Zn(II)- and Cd(II)-complexes, but surprisingly that they influence their ability to bind Cu(I), the non-cognate metal ion. PMID:26703589

  18. claMP Tag: A Versatile Inline Metal-Binding Platform Based on the Metal Abstraction Peptide

    PubMed Central

    2015-01-01

    Molecularly targeted research and diagnostic tools are essential to advancing understanding and detection of many diseases. Metals often impart the desired functionality to these tools, and conjugation of high-affinity chelators to proteins is carried out to enable targeted delivery of the metal. This approach has been much more effective with large lanthanide series metals than smaller transition metals. Because chemical conjugation requires additional processing and purification steps and yields a heterogeneous mixture of products, inline incorporation of a peptide tag capable of metal binding is a highly preferable alternative. Development of a transition metal binding tag would provide opportunity to greatly expand metal-based analyses. The metal abstraction peptide (MAP) sequence was genetically engineered into recombinant protein to generate the claMP Tag. The effects of this tag on recombinant epidermal growth factor (EGF) protein expression, disulfide bond formation, tertiary structural integrity, and transition metal incorporation using nickel were examined to confirm the viability of utilizing the MAP sequence to generate linker-less metal conjugates. PMID:24807049

  19. Cathepsin Protease Controls Copper and Cisplatin Accumulation via Cleavage of the Ctr1 Metal-binding Ectodomain.

    PubMed

    Öhrvik, Helena; Logeman, Brandon; Turk, Boris; Reinheckel, Thomas; Thiele, Dennis J

    2016-07-01

    Copper is an essential metal ion for embryonic development, iron acquisition, cardiac function, neuropeptide biogenesis, and other critical physiological processes. Ctr1 is a high affinity Cu(+) transporter on the plasma membrane and endosomes that exists as a full-length protein and a truncated form of Ctr1 lacking the methionine- and histidine-rich metal-binding ectodomain, and it exhibits reduced Cu(+) transport activity. Here, we identify the cathepsin L/B endolysosomal proteases functioning in a direct and rate-limiting step in the Ctr1 ectodomain cleavage. Cells and mice lacking cathepsin L accumulate full-length Ctr1 and hyper-accumulate copper. As Ctr1 also transports the chemotherapeutic drug cisplatin via direct binding to the ectodomain, we demonstrate that the combination of cisplatin with a cathepsin L/B inhibitor enhances cisplatin uptake and cell killing. These studies identify a new processing event and the key protease that cleaves the Ctr1 metal-binding ectodomain, which functions to regulate cellular Cu(+) and cisplatin acquisition. PMID:27143361

  20. Structural changes and metal binding by proalbumins and other amino-terminal genetic variants of human serum albumin.

    PubMed Central

    Takahashi, N; Takahashi, Y; Putnam, F W

    1987-01-01

    Proalbumins are rare genetic variants of human serum albumin containing a basic propeptide that is not removed during post-transcriptional processing because of a mutation in the site of excision, an Arg-Arg sequence. We have identified the amino acid substitutions in three different types of proalbumins designated Gainesville, Taipei, and Takefu. The first two proalbumins are identical to previously described proalbumins of the Christchurch and Lille types, respectively, and exhibit the characteristic properties of susceptibility to tryptic cleavage and of lower metal-binding affinity. Takefu is a third type of proalbumin and resists tryptic cleavage because of the substitution Arg-1----Pro. Each of the first two types of proalbumins has been identified in geographically separate, ethnically diverse populations and therefore must have arisen by independent mutations. There is some tendency for mutations in albumin to cluster in the propeptide sequence. Although the substitution His3----Gln in the genetic variant albumin Nagasaki-3 decreases metal-binding affinity, mutations further down the polypeptide chain have no such effect, nor is there any reduction of copper-binding affinity in albumin from patients with Wilson disease. Images PMID:3478700

  1. Cellular membrane trafficking of mesoporous silica nanoparticles

    SciTech Connect

    Fang, I-Ju

    2012-01-01

    This dissertation mainly focuses on the investigation of the cellular membrane trafficking of mesoporous silica nanoparticles. We are interested in the study of endocytosis and exocytosis behaviors of mesoporous silica nanoparticles with desired surface functionality. The relationship between mesoporous silica nanoparticles and membrane trafficking of cells, either cancerous cells or normal cells was examined. Since mesoporous silica nanoparticles were applied in many drug delivery cases, the endocytotic efficiency of mesoporous silica nanoparticles needs to be investigated in more details in order to design the cellular drug delivery system in the controlled way. It is well known that cells can engulf some molecules outside of the cells through a receptor-ligand associated endocytosis. We are interested to determine if those biomolecules binding to cell surface receptors can be utilized on mesoporous silica nanoparticle materials to improve the uptake efficiency or govern the mechanism of endocytosis of mesoporous silica nanoparticles. Arginine-glycine-aspartate (RGD) is a small peptide recognized by cell integrin receptors and it was reported that avidin internalization was highly promoted by tumor lectin. Both RGD and avidin were linked to the surface of mesoporous silica nanoparticle materials to investigate the effect of receptor-associated biomolecule on cellular endocytosis efficiency. The effect of ligand types, ligand conformation and ligand density were discussed in Chapter 2 and 3. Furthermore, the exocytosis of mesoporous silica nanoparticles is very attractive for biological applications. The cellular protein sequestration study of mesoporous silica nanoparticles was examined for further information of the intracellular pathway of endocytosed mesoporous silica nanoparticle materials. The surface functionality of mesoporous silica nanoparticle materials demonstrated selectivity among the materials and cancer and normal cell lines. We aimed to determine

  2. Ionic Liquid and Silica Sol-Gel Composite Materials Doped with N,N,N ',N '-tetra(n-octyl)diglycolamide for Extraction of La3+ and Ba2+

    SciTech Connect

    Bell, Jason R; Dai, Sheng; Yu, Bo; Luo, Huimin

    2012-01-01

    Sol-gel processed silica materials which incorporated ionic liquids and tetraoctyldiglycolamide (TODGA) were prepared and used for extraction of La3+ and Ba2+ from aqueous solution. Imidazolium-based ionic liquids, 1-alkyl-3-methylimidazolium bis(trifluoromethane)sulfonimide ([Cnmim][NTf2]) were entrapped in the monolithic composite sorbents. Extraction efficiency was found to be dependent upon both the volume of IL used in the silica matrix, and the alkyl chain length of the IL cation. The silica composite sorbent containing [C8mim][NTf2] exhibited the best extraction efficiency for La3+ and the best separation factor for La3+ / Ba 2+. The results were analyzed by both Langmuir and Freundlich adsorption isotherm models, and the Freundlich model was found to give better fit.

  3. Removal of uranium(VI) ions from aqueous solutions using Schiff base functionalized SBA-15 mesoporous silica materials.

    PubMed

    Dolatyari, Leila; Yaftian, Mohammad Reza; Rostamnia, Sadegh

    2016-03-15

    Functionalized SBA-15 mesoporous silica particles, bearing N-propylsalicylaldimine and ethylenediaminepropylesalicylaldimine Schiff base ligands, abbreviated as SBA/SA and SBA/EnSA respectively, were prepared and characterized by FT-IR, elemental analysis, TGA, XRD, TEM and SEM techniques. The potentials of these adsorbents were examined by using them in solid phase extraction of U(VI) ions from water samples. It is shown that 20 mg of SBA/SA or SBA/EnSA can remove rapidly (∼15 min) and quantitatively uranium(VI) ions from 10 to 200 mL of water solutions (pH 4) containing 0.2 mg of the ions, at 25 °C. The adsorbed ions were stripped by 1 mL of dilute nitric acid solution (0.1 mol L(-1)). It means that the studied adsorbents are able to be used for removal and concentration of uranyl ions. This allowed achieving to a concentration factor of 200 for uranyl ions. The variation in the ionic strength in the range 0-1 mol L(-1) did not affect the extraction efficiencies of the adsorbents. The adsorbents showed selective separation of uranyl ions from Cd(2+), Co(2+), Ni(2+), Mn(2+), Cr(3+), Ba(2+), Fe(3+) and Eu(3+) ions. Thermodynamic investigations revealed that the adsorption of uranyl ions by the adsorbents was spontaneous and endothermic. The Langmuir model described suitably the adsorption isotherms. This model determined the maximum adsorption capacity of the adsorbents SBA/SA and SBA/EnSA as 54 and 105.3 mg uranyl/g adsorbent, respectively. The kinetics of the processes was interpreted by using Pseudo-second-order model. PMID:26720327

  4. Silica/Polymer and Silica/Polymer/Fiber Composite Aerogels

    NASA Technical Reports Server (NTRS)

    Ou, Danny; Stepanian, Christopher J.; Hu, Xiangjun

    2010-01-01

    Aerogels that consist, variously, of neat silica/polymer alloys and silica/polymer alloy matrices reinforced with fibers have been developed as materials for flexible thermal-insulation blankets. In comparison with prior aerogel blankets, these aerogel blankets are more durable and less dusty. These blankets are also better able to resist and recover from compression . an important advantage in that maintenance of thickness is essential to maintenance of high thermal-insulation performance. These blankets are especially suitable as core materials for vacuum- insulated panels and vacuum-insulated boxes of advanced, nearly seamless design. (Inasmuch as heat leakage at seams is much greater than heat leakage elsewhere through such structures, advanced designs for high insulation performance should provide for minimization of the sizes and numbers of seams.) A silica/polymer aerogel of the present type could be characterized, somewhat more precisely, as consisting of multiply bonded, linear polymer reinforcements within a silica aerogel matrix. Thus far, several different polymethacrylates (PMAs) have been incorporated into aerogel networks to increase resistance to crushing and to improve other mechanical properties while minimally affecting thermal conductivity and density. The polymethacrylate phases are strongly linked into the silica aerogel networks in these materials. Unlike in other organic/inorganic blended aerogels, the inorganic and organic phases are chemically bonded to each other, by both covalent and hydrogen bonds. In the process for making a silica/polymer alloy aerogel, the covalent bonds are introduced by prepolymerization of the methacrylate monomer with trimethoxysilylpropylmethacrylate, which serves as a phase cross-linker in that it contains both organic and inorganic monomer functional groups and hence acts as a connector between the organic and inorganic phases. Hydrogen bonds are formed between the silanol groups of the inorganic phase and the

  5. The second metal-binding site of 70 kDa heat-shock protein is essential for ADP binding, ATP hydrolysis and ATP synthesis.

    PubMed Central

    Wu, Xueji; Yano, Mihiro; Washida, Hiroyo; Kido, Hiroshi

    2004-01-01

    The chaperone activity of Hsp70 (70 kDa heat-shock protein) in protein folding and its conformational switch, including oligomeric and monomeric interconversion, are regulated by the hydrolysis of ATP and the ATP-ADP exchange cycle. The crystal structure of human ATPase domain shows two metal-binding sites, the first for ATP binding and a second, in close proximity to the first, whose function remains unknown [Sriram, Osipiuk, Freeman, Morimoto and Joachimiak (1997) Structure 5, 403-414]. In this study, we have characterized the second metal-binding motif by site-directed mutagenesis and the kinetics of ATP and ADP binding, and found that the second metal-binding site, comprising a loop co-ordinated by His-227, Glu-231 and Asp-232, participates both in ATP hydrolysis and ATP-synthetic activities, in co-operation with the first metal-binding site. The first metal-binding site, a catalytic centre, is essential for ATP binding and the second site for ADP binding in the reactions of ATP hydrolysis and ATP synthesis. PMID:14664695

  6. Skin penetration of silica microparticles.

    PubMed

    Boonen, J; Baert, B; Lambert, J; De Spiegeleer, B

    2011-06-01

    Knowledge about skin penetration of nano- and microparticles is essential for the development of particle-core drug delivery systems and toxicology. A large number of studies have been devoted to metallic particle penetration. However, little work has been published about the importance of chemical material properties of the particles and the skin penetration effect of the applied formulation. Here, we investigated the penetration of 3 microm silica particles in water and in a 65% ethanolic plant extract on ex vivo human skin using scanning electron microscopy. Contrary to most other microsphere skin studies, we observed for the first time that 3 microm silica particles can penetrate the living epidermis. Moreover, when formulated in the ethanolic medium, particles even reach the dermis. The deviating chemical properties of silica compared to previously investigated microparticles (titanium dioxide, zinc oxide) and confounding effect of the formulation in which the silica microparticles are presented, is thus demonstrated. PMID:21699089

  7. Assessing the potential of ToF-SIMS as a complementary approach to investigate cement-based materials — Applications related to alkali–silica reaction

    SciTech Connect

    Bernard, Laetitia; Leemann, Andreas

    2015-02-15

    In this study, the potential of time-of-flight secondary ion mass spectrometry (ToF-SIMS) for the application in cement-based materials is assessed in combination and comparison with scanning electron microscopy (SEM) and energy dispersive X-ray (EDX). Mortar, concrete and samples from model systems providing products formed by the alkali–silica reaction (ASR) were studied. ToF-SIMS provides qualitative data on alkalis in cases where EDX reaches its limits in regard to detectable concentration, lateral resolution and atomic number of the elements. Due to its high in-depth resolution of a few atomic monolayers, thin layers of reaction products can be detected on the surfaces and chemically analyzed with ToF-SIMS. Additionally, it delivers information on the molecular conformation within the ASR product, its hydrogen content and its isotope ratios, information not provided by EDX. Provided the samples are carefully prepared, ToF-SIMS opens up new possibilities in the analysis of cement-based materials.

  8. Change in transmittance of fused silica as a means of detecting material sputtered from components on a 5-cm ion thruster

    NASA Technical Reports Server (NTRS)

    Weigand, A. J.; Mirtich, M. J.

    1972-01-01

    Two endurance tests of a 5-cm mercury bombardment thruster are reported. Both tests used a translational screen-grid system with the beam vectored 10 degrees. The first test lasted 141 hours and the second test operated for 2026 hours. In each test two fused silica samples (solar cell covers), 2.0 cm by 2.1 cm, were placed in shielded holders to detect materials sputtered from the thruster. Spectral optical properties between 0.398 and 2.16 microns were measured on each sample, both before and after the endurance tests. The deposition on each sample was spectrographically analyzed to determine the type of materials sputtered from the thruster. It was found that sputtering from the neutralizer is highly dependent on its position with respect to the beam edge. The sputtering from the accelerator grid of the translational screen-grid system of the 2026 hour test was sufficient to form an opaque film on the sample located in the direction opposite to the vectored beam.

  9. Synthesis, characterization, and light-controlled antibiotic application of a composite material derived from polyurethane and silica xerogel with embedded photoactive manganese nitrosyl.

    PubMed

    Heilman, Brandon J; Halpenny, Genevieve M; Mascharak, Pradip K

    2011-11-01

    The synthesis of a light-sensitive polyurethane-based composite material (PUX-NO) is described. In its polyurethane medium, PUX-NO contains entrapped silica xerogel particles in which a photoactive manganese nitrosyl has been incorporated. Green flexible films of PUX-NO readily release nitric oxide (NO) only when exposed to low power (mW) visible light. Incorporation of the nitrosyl in the xerogel not only retains the nitrosyl (NO donor) within the composite material but also provides the right extent of hydration. Pre-swelled films of PUX-NO have water content close to 30 Wt % and such films can be stored for months under slightly moist condition without loss in NO-delivering capacity. The NO-releasing parameters of the film have been determined. The NO-releasing capacity of PUX-NO films can be conveniently altered by changing the amount of the nitrosyl as well as the thickness of the films. Patches of PUX-NO film have been successfully employed to reduce drastically bacterial loads of both gram-positive and gram-negative bacteria including methicillin-resistant Staphylococcus aureus and Acinetobacter baumannii under the total control of light. Effective control of infections by these bacterial pathogens via delivery of proper doses of NO only to the sites of infection appears feasible with PUX-NO films. PMID:21948317

  10. Fast characterization of functionalized silica materials by silicon-29 surface-enhanced NMR spectroscopy using dynamic nuclear polarization.

    PubMed

    Lelli, Moreno; Gajan, David; Lesage, Anne; Caporini, Marc A; Vitzthum, Veronika; Miéville, Pascal; Héroguel, Florent; Rascón, Fernando; Roussey, Arthur; Thieuleux, Chloé; Boualleg, Malika; Veyre, Laurent; Bodenhausen, Geoffrey; Copéret, Christophe; Emsley, Lyndon

    2011-02-23

    We demonstrate fast characterization of the distribution of surface bonding modes and interactions in a series of functionalized materials via surface-enhanced nuclear magnetic resonance spectroscopy using dynamic nuclear polarization (DNP). Surface-enhanced silicon-29 DNP NMR spectra were obtained by using incipient wetness impregnation of the sample with a solution containing a polarizing radical (TOTAPOL). We identify and compare the bonding topology of functional groups in materials obtained via a sol-gel process and in materials prepared by post-grafting reactions. Furthermore, the remarkable gain in time provided by surface-enhanced silicon-29 DNP NMR spectroscopy (typically on the order of a factor 400) allows the facile acquisition of two-dimensional correlation spectra. PMID:21280606

  11. Interplay between metal binding and cis/trans isomerization in legume lectins: structural and thermodynamic study of P. angolensis lectin.

    PubMed

    Garcia-Pino, Abel; Buts, Lieven; Wyns, Lode; Loris, Remy

    2006-08-01

    The interplay between metal binding, carbohydrate binding activity, stability and structure of the lectin from Pterocarpus angolensis was investigated. Removal of the metals leads to a more flexible form of the protein with significantly less conformational stability. Crystal structures of this metal-free form show significant structural rearrangements, although some structural features that allow the binding of sugars are retained. We propose that substitution of an asparagine residue at the start of the C-terminal beta-strand of the legume lectin monomer hinders the trans-isomerization of the cis-peptide bond upon demetallization and constitutes an intramolecular switch governing the isomer state of the non-proline bond and ultimately the lectin phenotype. PMID:16824540

  12. Design of a novel metal binding peptide by molecular dynamics simulation to sequester Cu and Zn ions

    PubMed Central

    Mahnam, K.; Saffar, B.; Mobini-Dehkordi, M.; Fassihi, A.; Mohammadi, A.

    2014-01-01

    Heavy metal toxicity has serious adverse effects on the environment. The metal sequestering characteristics of a novel metal binding peptide (Glu-Cys)11 Gly+linker+hexahistidine (EC11:His6) was investigated to determine if it can absorb Cu2+ or Zn2+ cations. Molecular dynamics simulations were carried out using a model of 6 Cu2+ or Zn2+ and other ions enclosed in a fully hydrated simulation box with the designed peptide. Totally, 240 nano second (ns) simulations were done in three phases. Results showed that the selected linker is able to separate two domains of this peptide and that the carboxyl oxygens of Glu residues of EC11 in the designed peptide can absorb these ions. Sequestration of Cu2+ or Zn2+ ions by the designed peptide does not change overall tertiary and secondary structures of peptide. PMID:25598801

  13. Effects of extraction procedures on metal binding properties of extracellular polymeric substances (EPS) from anaerobic granular sludges.

    PubMed

    d'Abzac, Paul; Bordas, François; van Hullebusch, Eric; Lens, Piet N L; Guibaud, Gilles

    2010-10-15

    The effects of the extraction procedure of extracellular polymeric substances (EPS) on their proton/metal binding properties were studied. Nine extraction procedures (one control, four physical and four chemical procedures) were applied to four types of anaerobic granular sludges. The binding capacities between the EPS and lead or cadmium were investigated at pH 7 by a polarographic method. The composition of the EPS extracts varied according to the extraction technique and the origin of the sludge. This induced differences in the pK(a)s and the binding sites density of the EPS extracts. The carry-over of the extractant in the samples strongly affects the properties of the EPS from chemical extraction protocols. Lead and cadmium seem to be bound differently with the EPS, a higher binding capacity was observed for Pb(2+) than for Cd(2+). PMID:20580210

  14. Dissociation and metal-binding characteristics of yellow lichen substances suggest a relationship with site preferences of lichens

    PubMed Central

    Hauck, Markus; Jürgens, Sascha-René; Willenbruch, Karen; Huneck, Siegfried; Leuschner, Christoph

    2009-01-01

    Background and Aims Many species of lichen-forming fungi contain yellow or orange extracellular pigments belonging to the dibenzofurans (usnic acid), anthraquinones (e.g. parietin) or pulvinic acid group. These pigments are all equally efficient light screens, leading us to question the potential ecological and evolutionary significance of diversity in yellow and orange lichen substances. Here the hypothesis is tested that the different pigments differ in metal-binding characteristics, which suggest that they may contribute to adaptation to sites differing in pH and metal availability. Methods UV spectroscopy was used to study the dissociation and the pH dependence of the metal-binding behaviour of seven isolated lichen substances in methanol. Metals applied were selected macro- and micro-nutrients (Cu2+, Fe2+, Fe3+, Mg2+, Mn2+ and Zn2+). Key Results All the pigments studied are strong to moderate acids with pKa1 values between 2·8 and 4·5. Metal complexation is common in the lichen substances studied. Complexation takes place under acidic conditions with usnic acid, but under alkaline conditions with parietin and most compounds of the pulvinic acid group. The pulvinic acid derivative rhizocarpic acid forms metal complexes both in the acidic and the alkaline range. Conclusions Metal complexation by lichen substances could be a prerequisite for lichen substance-mediated control of metal uptake. Assuming such an effect at pH values where the affinity of the metal for the lichen substance is intermediate would explain the strong preference of lichens with usnic or rhizocarpic acids to acidic substrata. Moreover, it would explain the preference of lichens with parietin and some lichens with compounds of the pulvinic acid group either for nutrient-rich substrata at low pH or for calcareous substrata. PMID:18977765

  15. The sea urchin metallothionein system: Comparative evaluation of the SpMTA and SpMTB metal-binding preferences☆

    PubMed Central

    Tomas, Mireia; Domènech, Jordi; Capdevila, Mercè; Bofill, Roger; Atrian, Sílvia

    2013-01-01

    Metallothioneins (MTs) constitute a superfamily of ubiquitous metal-binding proteins of low molecular weight and high Cys content. They are involved in metal homeostasis and detoxification, amongst other proposed biological functions. Two MT isoforms (SpMTA and SpMTB) have been reported in the echinoderm Strongylocentrotus purpuratus (sea urchin), both containing 20 Cys residues and presenting extremely similar sequences, although showing distinct tissular and ontogenic expression patterns. Although exhaustive information is available for the Cd(II)-SpMTA complex, this including the full resolution of its 3D structure, no data has been reported concerning either SpMTA Zn(II) and Cu(I) binding properties, or the characterization of SpMTB at protein level. In this work, both the SpMTA and SpMTB isoforms, as well as their separate α and β domains, have been recombinantly synthesized in the presence of Zn(II), Cd(II) or Cu(II), and the corresponding metal complexes have been analyzed using electrospray mass spectrometry, and CD, ICP-AES and UV–vis spectroscopies. The results clearly show a better performance of isoform A when binding Zn(II) and Cd(II), and of isoform B when coordinating Cu(I). Thus, our results confirm the differential metal binding preference of SpMTA and SpMTB, which, together with the reported induction pattern of the respective genes, highlights how also in Echinodermata the MT polymorphism may be linked to the evolution of different physiological roles. PMID:23847757

  16. High purity silica reflecting heat shield development

    NASA Technical Reports Server (NTRS)

    Congdon, W.

    1974-01-01

    A reflecting heat shield composed of fused silica in which the scattering results from the refractive index mismatch between silica particles and the voids introduced during the fabrication process is developed. Major considerations and conclusions of the development are: the best material to use is Type A, which is capable of ultra-high-purity and which does not show the 0.243 micrometer absorption band; the reflection efficiency of fused silica is decreased at higher temperatures due to the bathochromic shift of the ultraviolet cut-off; for a given silica material, over the wavelength region and particle sizes tested, the monodisperse particle size configurations produce higher reflectances than continuous particle size configurations; and the smaller monodisperse particle size configurations give higher reflectance than the larger ones. A reflecting silica configuration that is an efficient reflector of shock layer radiation at high ablation temperatures is achieved by tailoring the matrix for optimum scattering and using an ultra-high-purity material.

  17. Phase transition of silica in the TMB-P123-H2O-TEOS quadru-component system: a feasible route to different mesostructured materials.

    PubMed

    Xin, Chunling; Zhao, Ning; Zhan, Haijuan; Xiao, Fukui; Wei, Wei; Sun, Yuhan

    2014-11-01

    Various siliceous structures were obtained using a nonionic block copolymer (Pluronic P123) surfactant and trimethylbenzene (TMB) as a hydrophobic additive by hydrolysis and condensation of tetraethoxysilane (TEOS) in a sol-gel process. The resultant materials were characterized by small-angle X-ray diffraction (SAXRD), nitrogen adsorption analysis, scanning electron microscopy (SEM) and transmission electron microscopy (TEM). The results revealed the structure transformation from hexagonal structure (HEX) to multilamellar vesicles (MLVs) and then to mesocellular foams (MCFs) in the TMB-P123-H2O-TEOS quadru-component system. The morphology of the mesoporous silica was mainly controlled by the mass ratio of TMB/P123 resulted from the increasing volume of the hydrophobic chain of micelle of P123 that caused by more amount of TMB dissolved in the PPO segment of polymer. The fact that the occurrence of rod-like particles with curved ends and the coexistence of the MLVs and the HEX structure indicates that the MLVs are developed from the ends of HEX structures, rather than formed by a direct cooperative self-assembly mechanism. Further increasing of packing parameter of surfactant resulted from TMB addition transforms lamellar micelles to reversed micelles, leading to the formation of MCFs. PMID:25128865

  18. Immobilizing gold nanoparticles in mesoporous silica covered reduced graphene oxide: a hybrid material for cancer cell detection through hydrogen peroxide sensing.

    PubMed

    Maji, Swarup Kumar; Sreejith, Sivaramapanicker; Mandal, Amal Kumar; Ma, Xing; Zhao, Yanli

    2014-08-27

    A new kind of two-dimensional (2-D) hybrid material (RGO-PMS@AuNPs), fabricated by the immobilization of ultrasmall gold nanoparticles (AuNPs, ∼3 nm) onto sandwich-like periodic mesopourous silica (PMS) coated reduced graphene oxide (RGO), was employed for both electrocatalytic application and cancer cell detection. The hybrid-based electrode sensor showed attractive electrochemical performance for sensitive and selective nonenzymatic detection of hydrogen peroxide (H2O2) in 0.1 M phosphate buffered saline, with wide linear detection range (0.5 μM to 50 mM), low detection limit (60 nM), and good sensitivity (39.2 μA mM(-1) cm(-2)), and without any interference by common interfering agents. In addition, the sensor exhibited a high capability for glucose sensing and H2O2 detection in human urine. More interestingly, the hybrid was found to be nontoxic, and the electrode sensor could sensitively detect a trace amount of H2O2 in a nanomolar level released from living tumor cells (HeLa and HepG2). Because the hybrid presents significant properties for the detection of bioactive species and certain cancerous cells by the synergistic effect from RGO, PMS, and AuNPs, it could be able to serve as a versatile platform for biosensing, bioanalysis, and biomedical applications. PMID:25046127

  19. Enhanced thermal properties of novel shape-stabilized PEG composite phase change materials with radial mesoporous silica sphere for thermal energy storage

    NASA Astrophysics Data System (ADS)

    Min, Xin; Fang, Minghao; Huang, Zhaohui; Liu, Yan'Gai; Huang, Yaoting; Wen, Ruilong; Qian, Tingting; Wu, Xiaowen

    2015-08-01

    Radial mesoporous silica (RMS) sphere was tailor-made for further applications in producing shape-stabilized composite phase change materials (ss-CPCMs) through a facile self-assembly process using CTAB as the main template and TEOS as SiO2 precursor. Novel ss-CPCMs composed of polyethylene glycol (PEG) and RMS were prepared through vacuum impregnating method. Various techniques were employed to characterize the structural and thermal properties of the ss-CPCMs. The DSC results indicated that the PEG/RMS ss-CPCM was a promising candidate for building thermal energy storage applications due to its large latent heat, suitable phase change temperature, good thermal reliability, as well as the excellent chemical compatibility and thermal stability. Importantly, the possible formation mechanisms of both RMS sphere and PEG/RMS composite have also been proposed. The results also indicated that the properties of the PEG/RMS ss-CPCMs are influenced by the adsorption limitation of the PEG molecule from RMS sphere with mesoporous structure and the effect of RMS, as the impurities, on the perfect crystallization of PEG.

  20. Enhanced thermal properties of novel shape-stabilized PEG composite phase change materials with radial mesoporous silica sphere for thermal energy storage.

    PubMed

    Min, Xin; Fang, Minghao; Huang, Zhaohui; Liu, Yan'gai; Huang, Yaoting; Wen, Ruilong; Qian, Tingting; Wu, Xiaowen

    2015-01-01

    Radial mesoporous silica (RMS) sphere was tailor-made for further applications in producing shape-stabilized composite phase change materials (ss-CPCMs) through a facile self-assembly process using CTAB as the main template and TEOS as SiO2 precursor. Novel ss-CPCMs composed of polyethylene glycol (PEG) and RMS were prepared through vacuum impregnating method. Various techniques were employed to characterize the structural and thermal properties of the ss-CPCMs. The DSC results indicated that the PEG/RMS ss-CPCM was a promising candidate for building thermal energy storage applications due to its large latent heat, suitable phase change temperature, good thermal reliability, as well as the excellent chemical compatibility and thermal stability. Importantly, the possible formation mechanisms of both RMS sphere and PEG/RMS composite have also been proposed. The results also indicated that the properties of the PEG/RMS ss-CPCMs are influenced by the adsorption limitation of the PEG molecule from RMS sphere with mesoporous structure and the effect of RMS, as the impurities, on the perfect crystallization of PEG. PMID:26261089

  1. Enhanced thermal properties of novel shape-stabilized PEG composite phase change materials with radial mesoporous silica sphere for thermal energy storage

    PubMed Central

    Min, Xin; Fang, Minghao; Huang, Zhaohui; Liu, Yan’gai; Huang, Yaoting; Wen, Ruilong; Qian, Tingting; Wu, Xiaowen

    2015-01-01

    Radial mesoporous silica (RMS) sphere was tailor-made for further applications in producing shape-stabilized composite phase change materials (ss-CPCMs) through a facile self-assembly process using CTAB as the main template and TEOS as SiO2 precursor. Novel ss-CPCMs composed of polyethylene glycol (PEG) and RMS were prepared through vacuum impregnating method. Various techniques were employed to characterize the structural and thermal properties of the ss-CPCMs. The DSC results indicated that the PEG/RMS ss-CPCM was a promising candidate for building thermal energy storage applications due to its large latent heat, suitable phase change temperature, good thermal reliability, as well as the excellent chemical compatibility and thermal stability. Importantly, the possible formation mechanisms of both RMS sphere and PEG/RMS composite have also been proposed. The results also indicated that the properties of the PEG/RMS ss-CPCMs are influenced by the adsorption limitation of the PEG molecule from RMS sphere with mesoporous structure and the effect of RMS, as the impurities, on the perfect crystallization of PEG. PMID:26261089

  2. The Hydrothermal System at Home Plate in Gusev Crater, Mars: Formation of High Silica Material by Acid-Sulfate Alteration of Basalt

    NASA Technical Reports Server (NTRS)

    Morris, R. V.; Ming, D. W.; Gellert, R.; Yen, A.; Clark, B. C.; Gnaff, T. G.; Arvidson, R. E.; Squyres, S. W.

    2008-01-01

    The Alpha Particle X-ray Spectrometer (APXS) instrument on the Mars Exploration Rover (MER) Spirit measured three targets on or adjacent to Home Plate in Gusev Crater that have unusually high SiO2 concentrations (68% to 91%), unusually low FeO concentrations (1% to 7%, with total Fe as FeO), and unusually high TiO2/FeO ratios (0.2 to 1.2 by weight) [1]. Two targets (Kenosha Comets and Lefty Ganote) are located on high albedo soil (Gertrude Weise) that was exposed by the rover wheels, and one target is a float rock called Fuzzy Smith. Kenosha Comets has the highest SiO2 concentration, lowest FeO concentration, and highest TiO2/FeO ratio. Mineralogical evidence from the MER Miniature Thermal Emission Spectrometer (Mini-TES) suggests that the SiO2 is present as amorphous (noncrystalline) SiO2 at Gertrude Weise and nearby targets [2,3]. Mini-TES data were not acquired for Fuzzy Smith. Home Plate is considered to have an explosive volcanic origin, resulting when basaltic magma came into contact with ground water or ice [4]. Within 50 m to 1 km of Home Plate are sulfate rich soil deposits (Paso Robles class soils with 22-35% SO3) which are considered to be probable fumarolic and/or hydrothermal deposits associated with the volcanism [5]. We develop the model here, suggested by [5], that the high-silica materials are another manifestation of acid-sulfate processes associated with fumarolic and hydrothermal activity at Home Plate. This is done by analogy with basaltic materials altered by acid sulfate processes on the Island of Hawaii.

  3. Nanoscale control of silica particle formation via silk-silica fusion proteins for bone regeneration.

    PubMed

    Mieszawska, Aneta J; Nadkarni, Lauren D; Perry, Carole C; Kaplan, David L

    2010-10-26

    The biomimetic design of silk/silica fusion proteins was carried out, combining the self assembling domains of spider dragline silk (Nephila clavipes) and silaffin derived R5 peptide of Cylindrotheca fusiformis that is responsible for silica mineralization. Genetic engineering was used to generate the protein-based biomaterials incorporating the physical properties of both components. With genetic control over the nanodomain sizes and chemistry, as well as modification of synthetic conditions for silica formation, controlled mineralized silk films with different silica morphologies and distributions were successfully generated; generating 3D porous networks, clustered silica nanoparticles (SNPs), or single SNPs. Silk serves as the organic scaffolding to control the material stability and multiprocessing makes silk/silica biomaterials suitable for different tissue regenerative applications. The influence of these new silk-silica composite systems on osteogenesis was evaluated with human mesenchymal stem cells (hMSCs) subjected to osteogenic differentiation. hMSCs adhered, proliferated, and differentiated towards osteogenic lineages on the silk/silica films. The presence of the silica in the silk films influenced osteogenic gene expression, with the upregulation of alkaline phosphatase (ALP), bone sialoprotein (BSP), and collagen type 1 (Col 1) markers. Evidence for early bone formation as calcium deposits was observed on silk films with silica. These results indicate the potential utility of these new silk/silica systems towards bone regeneration. PMID:20976116

  4. Coumarin-based fluorescence hybrid silica material used for selective detection and absorption of Hg2+ in aqueous media

    NASA Astrophysics Data System (ADS)

    Meng, Qingtao; Jia, Hongmin; Wang, Cuiping; Zhao, Hongbin; Lu, Gonghao; Hu, Zhizhi; Zhang, Zhiqiang; Duan, Chunying

    2014-11-01

    An inorganic-organic hybrid fluorescence material (C-SBA-15) was prepared by covalent immobilization of a coumarin derivative within the channels of SBA-15. The characterization results of XRD, TEM micrographs, FT-IR and UV-vis demonstrate that coumarin is successfully grafted onto the inner surface of SBA-15 and its organized structure is preserved. C-SBA-15 can detect Hg2+ with high selectivity to Pb2+, Zn2+, Cu2+, Mn2+, Cd2+, Co2+, Ag+, Fe3+, Ni2+, K+, Na+, Ca2+, Mg2+ and Li+ in water. Furthermore, the fluorogenical response is reversible by treating with EDTA and do not vary over a broad pH range (5.0-10.5). C-SBA-15 features more outstanding absorbing capacity for Hg2+ among other HTM ions in water.

  5. Arabidopsis AtNaKR1 is a phloem mobile metal-binding protein necessary for phloem function and root meristem maintenance

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The SODIUM POTASSIUM ROOT DEFECTIVE 1 (NaKR1) encodes a soluble metal binding protein that is specifically expressed in companion cells of the phloem. The nakr1-1 mutant phenotype includes high Na+, K+, and Rb+ accumulation in leaves, short roots, and late flowering. Starch accumulation in the leave...

  6. Preconcentration of low levels of americium and plutonium from waste waters by synthetic water-soluble metal-binding polymers with ultrafiltration

    SciTech Connect

    Smith, B.F.; Gibson, R.R.; Jarvinen, G.D.; Robison, T.W.; Schroeder, N.C.; Stalnaker, N.D.

    1997-12-31

    A preconcentration approach to assist in the measurement of low levels of americium and plutonium in waste waters has been developed based on the concept of using water-soluble metal-binding polymers in combination with ultrafiltration. The method has been optimized to give over 90% recovery and accountability from actual waste water.

  7. Structural Biology of The sequestration & Transport of Heavy Metal Toxins: NMR Structure Determination of Proteins Containing the CYS-X-Y-Metal Binding Motif

    SciTech Connect

    Stanley J. Opella

    2004-03-10

    The support from the Department of Energy enabled us to initiate research on several proteins from the bacterial mercury detoxification system; in particular, we were able to determine the structures of MerP and related metal binding sequences. We have also worked on the membrane transport proteins MerF and MerT.

  8. Efficient Cadmium Bioaccumulation by Displayed Hybrid CS3 Pili: Effect of Heavy Metal Binding Motif Insertion Site on Adsorption Capacity and Selectivity.

    PubMed

    Eskandari, Vajiheh; Yakhchali, Bagher; Sadeghi, Mehdi; Karkhane, Ali Asghar; Ahmadi-Danesh, Houra

    2015-12-01

    The objective of this study was to evaluate the influence of insertion site of the metal binding motif on the bioaccumulation capacity of the hybrid CS3 pili displayed on the surface of Escherichia coli using both computational and experimental methods. Two metal binding motifs (cadmium binding motif (cbm) and cadmium binding beta motif (cbβm)), identified by searching against the PROSITE database, were inserted into five putative permissive sites of CstH protein (CS3 pili subunit) by using SOEing PCR technique. The expression and surface display of the hybrid pili were evaluated using dot and Western blotting methods and also immunofluorescence microscopy. The cadmium binding affinity and selectivity of the recombinant bacteria displaying various hybrid pili were evaluated using atomic absorption procedure. The results showed that the cadmium binding motifs enabled the cells to sequester cadmium 8- to 16-fold higher than the E.coli expressing native pili. The location of the metal binding motifs in the pili subunit had also a significant effect on the metal-binding properties of the hybrid pili. The insertion at positions 107-108 and 92-93 of the mature CstH showed the highest adsorption in comparison to other positions. PMID:26438314

  9. Metal binding to the N-terminal cytoplasmic domain of the PIB ATPase HMA4 is required for metal transport in Arabidopsis.

    PubMed

    Laurent, Clémentine; Lekeux, Gilles; Ukuwela, Ashwinie A; Xiao, Zhiguang; Charlier, Jean-Benoit; Bosman, Bernard; Carnol, Monique; Motte, Patrick; Damblon, Christian; Galleni, Moreno; Hanikenne, Marc

    2016-03-01

    PIB ATPases are metal cation pumps that transport metals across membranes. These proteins possess N- and C-terminal cytoplasmic extensions that contain Cys- and His-rich high affinity metal binding domains, which may be involved in metal sensing, metal ion selectivity and/or in regulation of the pump activity. The PIB ATPase HMA4 (Heavy Metal ATPase 4) plays a central role in metal homeostasis in Arabidopsis thaliana and has a key function in zinc and cadmium hypertolerance and hyperaccumulation in the extremophile plant species Arabidopsis halleri. Here, we examined the function and structure of the N-terminal cytoplasmic metal-binding domain of HMA4. We mutagenized a conserved CCTSE metal-binding motif in the domain and assessed the impact of the mutations on protein function and localization in planta, on metal-binding properties in vitro and on protein structure by Nuclear Magnetic Resonance spectroscopy. The two Cys residues of the motif are essential for the function, but not for localization, of HMA4 in planta, whereas the Glu residue is important but not essential. These residues also determine zinc coordination and affinity. Zinc binding to the N-terminal domain is thus crucial for HMA4 protein function, whereas it is not required to maintain the protein structure. Altogether, combining in vivo and in vitro approaches in our study provides insights towards the molecular understanding of metal transport and specificity of metal P-type ATPases. PMID:26797794

  10. Hydrophilic modification of silica-titania mesoporous materials as restricted-access matrix adsorbents for enrichment of phosphopeptides.

    PubMed

    Wang, Fei; Guan, Yafeng; Zhang, Sen; Xia, Yan

    2012-07-13

    A new nano-scale restricted-access matrix (RAM) SiO₂ (MCM-41) with relatively high Ti-content (Ti/Si=0.1), but superior surface area (1129 m²/g), was successfully synthesised for the enrichment of phosphopeptides. The TiO₂ was incorporated into the Si-MCM-41 via a hydrothermal process and the external surface was modified with alkyl diol by the successive hydrolysis of γ-(glycidyloxypropyl) trimethoxysilane (GPTMS). Scanning electron microscopy, transmission electron microscopy, N₂ adsorption and Fourier transform infrared spectroscopy were used to characterise the alkyl diol-Ti-MCM-41. The appropriate pore diameter (2 nm) coupled to the marshy weeds-like hydrophilic external surface result in an efficient size-exclusion effect for the adsorption of standard cytochrome c with a molecular weight (MW) of ca. 12.4 kDa. At the same time, the strong affinity interaction between the incorporated titanium in the framework and the phosphoryl groups of phosphopeptides demonstrated a selective extract of phosphopeptides from the tryptic digestion. The detection sensitivity for phosphopeptides, determined by matrix-assisted laser desorption/ionisation time-of-flight mass spectrometry (MALDI-TOF MS) was as low as 5 fmol for standard tryptic digest of β-casein. Therefore, this alkyl diol-Ti-MCM-41 mesoporous material can be used as a potential adsorbent for applications in MS-based phosphoproteomics. PMID:22410151

  11. Engineered Bacterial Metal-binding Proteins for Nanoscale Self-assembly and heavy Metal Tolerance

    NASA Astrophysics Data System (ADS)

    Hall Sedlak, Ruth Amanda

    Implementing biological principles in material synthesis and assembly is one way to expand our abilities to efficiently assemble nanoscale materials and devices. Specifically, recent advances in identifying peptides that bind inorganic materials with high affinity and specificity has spurred investigation of protein models for nanoscale inorganic assembly. This dissertation presents the results of my studies of several E. coli proteins engineered to bind inorganic materials through simple peptide motifs. I demonstrate that these proteins modulate the self-assembly of DNA-based nanostructures and can introduce heavy metal tolerance into metal-sensitive bacteria. Chapter 2 explores use of the engineered F plasmid DNA relaxase/helicase TraI for the self-assembly of complex DNA-protein-gold nanostructures. The full-length protein is engineered with a gold binding motif at an internal permissive site (TraI369GBP1-7x), while a truncated version of TraI is engineered with the same gold binding motif at the C-terminus (TraI361GBP1-7x). Both constructs bind gold nanoparticles while maintaining their DNA binding activity, and transmission electron microscopy reveals TraI369GBP1-7x utilizes its non-specific DNA binding activity to decorate single-stranded and double-stranded DNA with gold nanoparticles. The self assembly principles demonstrated in this work will be fundamental to constructing higher ordered hybrid nanostructures through DNA-protein-nanoparticle interactions. Chapter 3 studies the effects of expressing inorganic binding peptides within cells. I identified a silver binding peptide that, when fused to the periplasmic maltose binding protein, protects E. coli from silver toxicity in batch culture and reduces silver ions to silver nanoparticles within the bacterial periplasm. Engineered metal-ion tolerant microorganisms such as this E. coli could potentially be used in applications ranging from remediation to interrogation of biomolecule-metal interactions in vivo

  12. Optothermal nonlinearity of silica aerogel

    NASA Astrophysics Data System (ADS)

    Braidotti, Maria Chiara; Gentilini, Silvia; Fleming, Adam; Samuels, Michiel C.; Di Falco, Andrea; Conti, Claudio

    2016-07-01

    We report on the characterization of silica aerogel thermal optical nonlinearity, obtained by z-scan technique. The results show that typical silica aerogels have nonlinear optical coefficient similar to that of glass (≃10-12 m2/W), with negligible optical nonlinear absorption. The nonlinear coefficient can be increased to values in the range of 10-10 m2/W by embedding an absorbing dye in the aerogel. This value is one order of magnitude higher than that observed in the pure dye and in typical highly nonlinear materials like liquid crystals.

  13. Biomimetic silica encapsultation of living cells

    NASA Astrophysics Data System (ADS)

    Jaroch, David Benjamin

    Living cells perform complex chemical processes on size and time scales that artificial systems cannot match. Cells respond dynamically to their environment, acting as biological sensors, factories, and drug delivery devices. To facilitate the use of living systems in engineered constructs, we have developed several new approaches to create stable protective microenvironments by forming bioinspired cell-membrane-specific silica-based encapsulants. These include vapor phase deposition of silica gels, use of endogenous membrane proteins and polysaccharides as a site for silica nucleation and polycondensation in a saturated environment, and protein templated ordered silica shell formation. We demonstrate silica layer formation at the surface of pluripotent stem-like cells, bacterial biofilms, and primary murine and human pancreatic islets. Materials are characterized by AFM, SEM and EDS. Viability assays confirm cell survival, and metabolite flux measurements demonstrate normal function and no major diffusion limitations. Real time PCR mRNA analysis indicates encapsulated islets express normal levels of genetic markers for β-cells and insulin production. The silica glass encapsulant produces a secondary bone like calcium phosphate mineral layer upon exposure to media. Such bioactive materials can improve device integration with surrounding tissue upon implantation. Given the favorable insulin response, bioactivity, and long-term viability observed in silica-coated islets, we are currently testing the encapsulant's ability to prevent immune system recognition of foreign transplants for the treatment of diabetes. Such hybrid silica-cellular constructs have a wide range of industrial, environmental, and medical applications.

  14. Precipitated silica as flow regulator.

    PubMed

    Müller, Anne-Kathrin; Ruppel, Joanna; Drexel, Claus-Peter; Zimmermann, Ingfried

    2008-08-01

    Flow regulators are added to solid pharmaceutical formulations to improve the flow properties of the powder mixtures. The primary particles of the flow regulators exist in the form of huge agglomerates which are broken down into smaller aggregates during the blending process. These smaller aggregates adsorb at the surface of the solid's grains and thus diminish attractive Van-der-Waals-forces by increasing the roughness of the host's surface. In most cases amorphous silica is used as flow additive but material properties like particle size or bond strength influence the desagglomeration tendency of the agglomerates and thus the flow regulating potency of each silica. For some silica types we will show that the differences in their flow regulating potency are due to the rate and extent by which they are able to cover the surface of the host particles. Binary powder mixtures consisting of a pharmaceutical excipient and an added flow regulator were blended in a Turbula mixer for a defined period of time. As pharmaceutical excipient corn starch was used. The flow regulators were represented by a selection of amorphous silicon dioxide types like a commercial fumed silica and various types of SIPERNAT precipitated silica provided by Evonik-Degussa GmbH, Hanau, Germany. Flowability parameters of the mixtures were characterized by means of a tensile strength tester. The reduction of tensile strength with the blending time can be correlated with an increase in fragmentation of the flow regulator. PMID:18595668

  15. Ab initio Study of Transition metal binding to the Prion Protein

    NASA Astrophysics Data System (ADS)

    Cox, Daniel L.; Singh, Rajiv R. P.; Pan, Jianping

    2004-03-01

    Fundamental understanding of the prion protein (PrP) is of critical public health importance in view of mad cow and chronic wasting diseases. In recent years, it has been shown that the normal form (PrP^c) binds copper^1), and the structure of the copper binding domain has been elaborated. Hypotheses about toxicity associated with binding of other metals (notably manganese) have been put forward, Accordingly, using the ab initio SIESTA density functional theory code^2), we calculated the binding energy E_B(M) of M-(PrP) complexes relative to initially uncomplexed M ions, with M=Cu,Ni,Zn,Mn and (PrP)^* the minimal binding domain. The binding energy trend is E_B(Ni)>E_B(Cu)>E_B(Zn)>E_B(Mn), consistent with recent experiments apart from the surprising stability of Ni. We will also present preliminary results for binding of initially complexed M ions. *-Supported by U.S. DOE, Office of Basic Energy Sciences, Division of Materials Research 1) G.S. Jackson et al., Proc. Nat. Acad. Sci. (USA) 98, 8531 (2001). 2) P. Ordejón, et al., Phys. Rev. B53, R10441 (1996); J.M. Soler et al., J. Phys. Cond. Matt. 14, 2745 (2002).

  16. Chemical and enzymatic extraction of heavy metal binding polymers from isolated cell walls of Saccharomyces cerevisiae

    SciTech Connect

    Brady, D.; Stoll, A.D.; Starke, L.; Duncan, J.R. . Dept. of Biochemistry and Microbiology)

    1994-07-01

    Isolated cell walls of the yeast Saccharomyces cerevisiae were treated by either chemical (alkali and acid) or enzymatic (protease, mannanase or [beta]-glucuronidase) processes to yield partially purified products. These products were partially characterized by infrared analysis. They were subsequently reacted with heavy metal cation solutions and the quantity of metal accumulated by the cell wall material determined. The Cu[sup 2+] ion (0.24, 0.36, 1.12, and 0.60 [mu]mol/mg) was accumulated to a greater extent than either Co[sup 2+] (0.13, 0.32, 0.43, and 0.32 [mu]mol/mg) or Cd[sup 2+] (0.17, 0.34, 0.39, and 0.46 [mu]mol/mg) by yeast cell walls, glucan, mannan, and chitin, respectively. The isolated components each accumulated greater quantities of the cations than the intact cell wall. Removal of the protein component of the yeast cell wall by Pronase caused a 29.5% decrease in metal accumulation by yeast cell walls per mass, indicating that protein is a heavy metal accumulating component. The data indicate that the outer mannan-protein layer of the yeast cell wall is more important than the inner glucan-chitin layer in heavy metal cation accumulation.

  17. Stimuli-responsive polyaniline coated silica microspheres and their electrorheology

    NASA Astrophysics Data System (ADS)

    Park, Dae Eun; Choi, Hyoung Jin; Vu, Cuong Manh

    2016-05-01

    Silica/polyaniline (PANI) core–shell structured microspheres were synthesized by coating the surface of silica micro-beads with PANI and applied as a candidate inorganic/polymer composite electrorheological (ER) material. The silica micro-beads were initially modified using N-[(3-trimethoxysilyl)-propyl] aniline to activate an aniline functional group on the silica surface for a better PANI coating. The morphology of the PANI coating on the silica surface was examined by scanning electron microscopy and the silica/PANI core–shell structure was confirmed by transmission electron microscopy. The chemical structure of the particles was confirmed by Fourier transform infrared spectroscopy. Rotational rheometry was performed to confirm the difference in the ER properties between pure silica and silica/PANI microsphere-based ER fluids when dispersed in silicone oil.

  18. Application of a constrained regularization method to extraction of affinity distributions: proton and metal binding to humic substances.

    PubMed

    Orsetti, Silvia; Andrade, Estela María; Molina, Fernando V

    2009-08-15

    The binding of proton and metal cations to humic substances has been analyzed with a regularized fitting procedure (using the CONTIN software package) to extract conditional affinity distributions, valid at a given ionic strength, from binding (titration) curves. The procedure was previously tested with simulated titration curves using a simple bi-Gaussian model, the NICA-Donnan model, and the Stockholm humic model. Application to literature data for proton binding shows that in several cases the affinity distribution found is bimodal (carboxylic and phenolic sites) as usually assumed; however in other cases, specially for fulvic acids, a trimodal distribution is clearly discerned, with a smaller peak between the two noted above attributed to the presence of vicinal carboxylic groups. The analysis of metal binding curves has been performed in a few cases where the available data could be reliably processed, separating the proton affinity distribution and obtaining the conditional affinity spectra. For Cd(II) and Pb(II) a bimodal distribution is found, attributed in principle to mono- and bidentate binding, based on spectroscopic data. In the case of Cu(II), a more complex affinity distribution is found showing 3-4 peaks; this is consistent with spectroscopic studies, where different binding modes, up to tetradentate, have been observed. PMID:19477457

  19. Evaluation of synthetic water-soluble metal-binding polymers with ultrafiltration for selective concentration of americium and plutonium

    SciTech Connect

    Smith, B.F.; Gibson, R.R.; Jarvinen, G.D.; Jones, M.M.; Lu, M.T.; Robison, T.W.; Schroeder, N.C.; Stalnaker, N.

    1997-12-31

    Routine counting methods and ICP-MS are unable to directly measure the new US Department of Energy (DOE) regulatory level for discharge waters containing alpha-emitting radionuclides of 30 pCi/L total alpha or the 0.05 pCi/L regulatory level for Pu or Am activity required for surface waters at the Rocky Flats site by the State of Colorado. This inability indicates the need to develop rapid, reliable, and robust analytical techniques for measuring actinide metal ions, particularly americium and plutonium. Selective separation or preconcentration techniques would aid in this effort. Water-soluble metal-binding polymers in combination with ultrafiltration are shown to be an effective method for selectively removing dilute actinide ions from acidic solutions of high ionic strength. The actinide-binding properties of commercially available water-soluble polymers and several polymers which have been reported in the literature were evaluated. The functional groups incorporated in the polymers were pyrrolidone, amine, oxime, and carboxylic, phosphonic, or sulfonic acid. The polymer containing phosphonic acid groups gave the best results with high distribution coefficients and concentration factors for {sup 241}Am(III) and {sup 238}Pu(III)/(IV) at pH 4 to 6 and ionic strengths of 0.1 to 4.

  20. Metal-binding protein in the pacific oyster, Crassostrea gigas: assessment of the protein as a biochemical environmental indicator

    SciTech Connect

    Imber, B.E.; Thompson, J.A.J.; Ward, S.

    1987-04-01

    In this paper the determination of metal-binding proteins (MBP) in the Pacific Oyster (Crassostrea gigas) is reported. The objectives of this study were to employ a simple, cost-effective method for quantifying MBP and to assess this parameter for possible use as an indicator of identifiable sources of metal input to biological systems. Abnormally high quantities of zinc had been found previously in C. gigas growing in waters adjacent to the Kraft pump mill at Crofton, British Columbia. From 1971 to 1973 oysters near the effluent outfalls were found to have body-burden zinc six to ten times the zinc concentrations found in reference specimens. Zinc dithionite was used in the pulping process at the mill until 1973. Subsequent to a change to sodium dithionite, concentrations of zinc in oysters decreased steadily. A second potential source of contamination is sited directly south of the pulp mill. In this case, leaching of copper and zinc from smelter slag into Osborn Bay has been identified.

  1. Transcriptional Regulation, Metal Binding Properties and Structure of Pden1597, an Unusual Zinc Transport Protein from Paracoccus denitrificans*

    PubMed Central

    Handali, Melody; Neupane, Durga P.; Roychowdhury, Hridindu; Yukl, Erik T.

    2015-01-01

    ATP-binding cassette (ABC) transporters of the cluster 9 family are ubiquitous among bacteria and essential for acquiring Zn2+ and Mn2+ from the environment or, in the case of pathogens, from the host. These rely on a substrate-binding protein (SBP) to coordinate the relevant metal with high affinity and specificity and subsequently release it to a membrane permease for translocation into the cytoplasm. Although a number of cluster 9 SBP structures have been determined, the structural attributes conferring Zn2+ or Mn2+ specificity remain ambiguous. Here we describe the gene expression profile, in vitro metal binding properties, and crystal structure of a new cluster 9 SBP from Paracoccus denitrificans we have called AztC. Although all of our results strongly indicate Zn2+ over Mn2+ specificity, the Zn2+ ion is coordinated by a conserved Asp residue only observed to date as a metal ligand in Mn2+-specific SBPs. The unusual sequence properties of this protein are shared among close homologues, including members from the human pathogens Klebsiella pneumonia and Enterobacter aerogenes, and would seem to suggest a subclass of Zn2+-specific transporters among the cluster 9 family. In any case, the unusual coordination environment of AztC expands the already considerable range of those available to Zn2+-specific SBPs and highlights the presence of a His-rich loop as the most reliable indicator of Zn2+ specificity. PMID:25787075

  2. Unbound position II in MXCXXC metallochaperone model peptides impacts metal binding mode and reactivity: Distinct similarities to whole proteins.

    PubMed

    Shoshan, Michal S; Dekel, Noa; Goch, Wojciech; Shalev, Deborah E; Danieli, Tsafi; Lebendiker, Mario; Bal, Wojciech; Tshuva, Edit Y

    2016-06-01

    The effect of position II in the binding sequence of copper metallochaperones, which varies between Thr and His, was investigated through structural analysis and affinity and oxidation kinetic studies of model peptides. A first Cys-Cu(I)-Cys model obtained for the His peptide at acidic and neutral pH, correlated with higher affinity and more rapid oxidation of its complex; in contrast, the Thr peptide with the Cys-Cu(I)-Met coordination under neutral conditions demonstrated weaker and pH dependent binding. Studies with human antioxidant protein 1 (Atox1) and three of its mutants where S residues were replaced with Ala suggested that (a) the binding affinity is influenced more by the binding sequence than by the protein fold (b) pH may play a role in binding reactivity, and (c) mutating the Met impacted the affinity and oxidation rate more drastically than did mutating one of the Cys, supporting its important role in protein function. Position II thus plays a dominant role in metal binding and transport. PMID:26901629

  3. Preparing mesoporous carbon and silica with rosin-silica composite gel.

    PubMed

    Liu, Haidi; Du, Shangfeng; Chen, Yunfa

    2009-02-01

    Mesoporous carbon and mesoporous silica were prepared respectively with a same rosin-silica nanocomposite gel which was synthesized by cogelating tetra-ethyl-oxy-silane (silica source) and rosin (carbon source). Carbonizing the gel in nitrogen and then etching away silica with alkaline solution, mesoporous carbon with specific surface area larger than 800 m2/g was obtained. If calcining the gel at high temperature in air for given time, porous silica with surface area higher than 700 m2/g was done. BET measurement was employed to investigate the pore distribution and surface area of the samples. Most of the pores in both the porous carbon and porous silica were mesoscale, which makes the materials potential in enzyme supports for bio-catalyzed reaction or adsorbents for contaminants with large molecular size. PMID:19441395

  4. Fungus-mediated biotransformation of amorphous silica in rice husk to nanocrystalline silica.

    PubMed

    Bansal, Vipul; Ahmad, Absar; Sastry, Murali

    2006-11-01

    Rice husk is a cheap agro-based waste material, which harbors a substantial amount of silica in the form of amorphous hydrated silica grains. However, there have been no attempts at harnessing the enormous amount of amorphous silica present in rice husk and its room-temperature biotransformation into crystalline silica nanoparticles. In this study, we address this issue and describe how naturally deposited amorphous biosilica in rice husk can be bioleached and simultaneously biotransformed into high value crystalline silica nanoparticles. We show here that the fungus Fusarium oxysporum rapidly biotransforms the naturally occurring amorphous plant biosilica into crystalline silica and leach out silica extracellularly at room temperature in the form of 2-6 nm quasi-spherical, highly crystalline silica nanoparticles capped by stabilizing proteins; that the nanoparticles are released into solution is an advantage of this process with significant application and commercial potential. Calcination of the silica nanoparticles leads to loss of occluded protein and to an apparently porous structure often of cubic morphology. The room-temperature synthesis of oxide nanomaterials using microorganisms starting from potential cheap agro-industrial waste materials is an exciting possibility and could lead to an energy-conserving and economically viable green approach toward the large-scale synthesis of oxide nanomaterials. PMID:17061888

  5. Antimicrobial Properties of a Novel Silver-Silica Nanocomposite Material▿

    PubMed Central

    Egger, Salome; Lehmann, Rainer P.; Height, Murray J.; Loessner, Martin J.; Schuppler, Markus

    2009-01-01

    Nanotechnology enables development and production of novel silver-based composite materials. We used in vitro tests to demonstrate the antimicrobial activity of a silver-silica nanocomposite compared to the activities of conventional materials, such as silver nitrate and silver zeolite. A silver-silica-containing polystyrene material was manufactured and shown to possess strong antimicrobial properties. PMID:19270121

  6. Chemically-bound xenon in fibrous silica.

    PubMed

    Kalinowski, Jaroslaw; Räsänen, Markku; Gerber, R Benny

    2014-06-21

    High-level quantum chemical calculations reported here predict the existence and remarkable stability, of chemically-bound xenon atoms in fibrous silica. The results may support the suggestion of Sanloup and coworkers that chemically-bound xenon and silica account for the problem of "missing xenon" (by a factor of 20!) from the atmospheres of Earth and Mars. So far, the host silica was assumed to be quartz, which is in contradiction with theory. The xenon-fibrous silica molecule is computed to be stable well beyond room temperature. The calculated Raman spectra of the species agree well with the main features of the experiments by Sanloup et al. The results predict computationally the existence of a new family of noble-gas containing materials. The fibrous silica species are finite molecules, their laboratory preparation should be feasible, and potential applications are possible. PMID:24807740

  7. Incorporation of anti-inflammatory agent into mesoporous silica.

    PubMed

    Braz, Wilson Rodrigues; Rocha, Natállia Lamec; de Faria, Emerson H; Silva, Márcio L A E; Ciuffi, Katia J; Tavares, Denise C; Furtado, Ricardo Andrade; Rocha, Lucas A; Nassar, Eduardo J

    2016-09-23

    The unique properties of macroporous, mesoporous, and microporous systems, including their ability to accommodate molecules of different sizes inside their pores and to act as drug delivery systems, have been the object of extensive studies. In this work, mesoporous silica with hexagonal structure was obtained by template synthesis via the sol-gel process. The resulting material was used as support to accommodate the anti-inflammatory agent indomethacin. The alkaline route was used to prepare the mesoporous silica; cetyltrimethylammonium bromide was employed as porogenic agent. The silica particles were functionalized with 3-aminopropyltriethoxysilane alkoxide (APTES) by the sol-gel post-synthesis method. Indomethacin was incorporated into the silica functionalized with APTES and into non-functionalized silica. The resulting systems were characterized by x-ray diffraction (XRD), specific area, infrared spectroscopy, and thermal analyses (TGA). XRD attested to formation of mesoporous silica with hexagonal structure. This structure remained after silica functionalization with APTES and incorporation of indomethacin. Typical infrared spectroscopy vibrations and organic material decomposition during TGA confirmed silica functionalization and drug incorporation. The specific surface area and pore volume of the functionalized material incorporated with indomethacin decreased as compared with the specific surface area and pore volume of the non-functionalized silica containing no drug, suggesting both the functionalizing agent and the drug were present in the silica. Cytotoxicity tests conducted on normal fibroblasts (GM0479A) cells attested that the silica matrix containing indomethacin was less toxic than the free drug. PMID:27533108

  8. Silica extraction from geothermal water

    SciTech Connect

    Bourcier, William L; Bruton, Carol J

    2014-09-23

    A method of producing silica from geothermal fluid containing low concentration of the silica of less than 275 ppm includes the steps of treating the geothermal fluid containing the silica by reverse osmosis treatment thereby producing a concentrated fluid containing the silica, seasoning the concentrated fluid thereby producing a slurry having precipitated colloids containing the silica, and separating the silica from the slurry.

  9. Enhanced mercury tolerance in Mytilus edulis: influence of Cu, Zn, and Cd pre-exposure and relationship to metal-binding proteins

    SciTech Connect

    Roesijadi, G.

    1983-06-01

    Experiments were conducted to determine whether exposure to Cu, Cd or Zn would induce enhanced mercury tolerance in mussels. The results indicated that enhanced tolerance can be elicited if exposure to Cu, Cd or Zn is sufficiently high that bioaccumulation of the metal and induction of metal-binding proteins will occur, and if the concentrations are below levels in which the exposure itself becomes toxic. 7 references. (ACR)

  10. FINDSITE-metal: Integrating evolutionary information and machine learning for structure-based metal binding site prediction at the proteome level

    PubMed Central

    Brylinski, Michal; Skolnick, Jeffrey

    2010-01-01

    The rapid accumulation of gene sequences, many of which are hypothetical proteins with unknown function, has stimulated the development of accurate computational tools for protein function prediction with evolution/structure-based approaches showing considerable promise. In this paper, we present FINDSITE-metal, a new threading-based method designed specifically to detect metal binding sites in modeled protein structures. Comprehensive benchmarks using different quality protein structures show that weakly homologous protein models provide sufficient structural information for quite accurate annotation by FINDSITE-metal. Combining structure/evolutionary information with machine learning results in highly accurate metal binding annotations; for protein models constructed by TASSER, whose average Cα RMSD from the native structure is 8.9 Å, 59.5% (71.9%) of the best of top five predicted metal locations are within 4 Å (8 Å) from a bound metal in the crystal structure. For most of the targets, multiple metal binding sites are detected with the best predicted binding site at rank 1 and within the top 2 ranks in 65.6% and 83.1% of the cases, respectively. Furthermore, for iron, copper, zinc, calcium and magnesium ions, the binding metal can be predicted with high, typically 70-90%, accuracy. FINDSITE-metal also provides a set of confidence indexes that help assess the reliability of predictions. Finally, we describe the proteome-wide application of FINDSITE-metal that quantifies the metal binding complement of the human proteome. FINDSITE-metal is freely available to the academic community at http://cssb.biology.gatech.edu/findsite-metal/. PMID:21287609

  11. Synthesis and Characterization of Bionanoparticle-Silica Composites and Mesoporous Silica with Large Pores

    SciTech Connect

    Niu, Z.; Yang, L.; Kabisatpathy, S.; He, J.; Lee, A.; Ron, J.; Sikha, G.; Popov, B.N.; Emrick, T.; Russell, T. P.; Wang. Q.

    2009-03-24

    A sol-gel process has been developed to incorporate bionanoparticles, such as turnip yellow mosaic virus, cowpea mosaic virus, tobacco mosaic virus, and ferritin into silica, while maintaining the integrity and morphology of the particles. The structures of the resulting materials were characterized by transmission electron microscopy, small angle X-ray scattering, and N{sub 2} adsorption-desorption analysis. The results show that the shape and surface morphology of the bionanoparticles are largely preserved after being embedded into silica. After removal of the bionanoparticles by calcination, mesoporous silica with monodisperse pores, having the shape and surface morphology of the bionanoparticles replicated inside the silica, was produced,. This study is expected to lead to both functional composite materials and mesoporous silica with structurally well-defined large pores.

  12. Structure and interactions of the C-terminal metal binding domain of Archaeoglobus fulgidus CopA

    SciTech Connect

    Agarwal, S.; Hong, D.; Desai, N.K.; H.Sazinsky, M.; Argüello, J.M.; Rosenzweig, A.C.

    2010-08-13

    The Cu(+)-ATPase CopA from Archaeoglobus fulgidus belongs to the P(1B) family of the P-type ATPases. These integral membrane proteins couple the energy of ATP hydrolysis to heavy metal ion translocation across membranes. A defining feature of P(1B-1)-type ATPases is the presence of soluble metal binding domains at the N-terminus (N-MBDs). The N-MBDs exhibit a conserved ferredoxin-like fold, similar to that of soluble copper chaperones, and bind metal ions via a conserved CXXC motif. The N-MBDs enable Cu(+) regulation of turnover rates apparently through Cu-sensitive interactions with catalytic domains. A. fulgidus CopA is unusual in that it contains both an N-terminal MBD and a C-terminal MBD (C-MBD). The functional role of the unique C-MBD has not been established. Here, we report the crystal structure of the apo, oxidized C-MBD to 2.0 A resolution. In the structure, two C-MBD monomers form a domain-swapped dimer, which has not been observed previously for similar domains. In addition, the interaction of the C-MBD with the other cytoplasmic domains of CopA, the ATP binding domain (ATPBD) and actuator domain (A-domain), has been investigated. Interestingly, the C-MBD interacts specifically with both of these domains, independent of the presence of Cu(+) or nucleotides. These data reinforce the uniqueness of the C-MBD and suggest a distinct structural role for the C-MBD in CopA transport.

  13. Spectral and metal-binding properties of three single-point tryptophan mutants of the human transferrin N-lobe.

    PubMed Central

    He, Q Y; Mason, A B; Lyons, B A; Tam, B M; Nguyen, V; MacGillivray, R T; Woodworth, R C

    2001-01-01

    Human serum transferrin N-lobe (hTF/2N) contains three conserved tryptophan residues, Trp(8), Trp(128) and Trp(264), located in three different environments. The present report addresses the different contributions of the three tryptophan residues to the UV-visible, fluorescence and NMR spectra of hTF/2N and the effect of the mutations at each tryptophan residue on the iron-binding properties of the protein. Trp(8) resides in a hydrophobic box containing a cluster of three phenylalanine side chains and is H bonded through the indole N to an adjacent water cluster lying between two beta-sheets containing Trp(8) and Lys(296) respectively. The fluorescence of Trp(8) may be quenched by the benzene rings. The apparent increase in the rate of iron release from the Trp(8)-->Tyr mutant could be due to the interference of the mutation with the H-bond linkage resulting in an effect on the second shell network. The partial quenching in the fluorescence of Trp(128) results from the nearby His(119) residue. Difference-fluorescence spectra reveal that any protein containing Trp(128) shows a blue shift upon binding metal ion, and the NMR signal of Trp(128) broadens out and disappears upon the binding of paramagnetic metals to the protein. These data imply that Trp(128) is a major fluorescent and NMR reporter group for metal binding, and possibly for cleft closure in hTF/2N. Trp(264) is located on the surface of the protein and does not connect to any functional residues. This explains the facts that Trp(264) is the major contributor to both the absorbance and fluorescence spectra, has a strong NMR signal and the mutation at Trp(264) has little effect on the iron-binding and release behaviours of the protein. PMID:11171122

  14. The role of substrate specificity and metal binding in defining the activity and structure of an intracellular subtilisin.

    PubMed

    Gamble, Michael; Künze, Georg; Brancale, Andrea; Wilson, Keith S; Jones, D Dafydd

    2012-01-01

    The dimeric intracellular subtilisin proteases (ISPs) found throughout Gram-positive bacteria are a structurally distinct class of the subtilase family. Unlike the vast majority of subtilisin-like proteases, the ISPs function exclusively within the cell, contributing the majority of observed cellular proteolytic activity. Given that they are active within the cell, little is known about substrate specificity and the role of stress signals such as divalent metal ions in modulating ISP function. We demonstrate that both play roles in defining the proteolytic activity of Bacillus clausii ISP and propose the molecular basis of their effects. Enzyme kinetics reveal that one particular synthetic tetrapeptide substrate, Phe-Ala-Ala-Phe-pNA, is hydrolysed with a catalytic efficiency ∼100-fold higher than any other tested. Heat-denatured whole proteins were found to be better substrates for ISP than the native forms. Substrate binding simulations suggest that the S1, S2 and S4 sites form defined binding pockets. The deep S1 cavity and wide S4 site are fully occupied by the hydrophobic aromatic side-chains of Phe. Divalent metal ions, probably Ca(2+), are proposed to be important for ISP activity through structural changes. The presence of >0.01 mM EDTA inactivates ISP, with CD and SEC suggesting that the protein becomes less structured and potentially monomeric. Removal of Ca(2+) at sites close to the dimer interface and the S1 pocket are thought to be responsible for the effect. These studies provide a new insight into the potential physiological function of ISPs, by reconciling substrate specificity and divalent metal binding to associate ISP with the unfolded protein response under stress conditions. PMID:23650602

  15. Metal Binding Properties of Escherichia coli YjiA, a Member of the Metal Homeostasis-Associated COG0523 Family of GTPases

    PubMed Central

    2013-01-01

    GTPases are critical molecular switches involved in a wide range of biological functions. Recent phylogenetic and genomic analyses of the large, mostly uncharacterized COG0523 subfamily of GTPases revealed a link between some COG0523 proteins and metal homeostasis pathways. In this report, we detail the bioinorganic characterization of YjiA, a representative member of COG0523 subgroup 9 and the only COG0523 protein to date with high-resolution structural information. We find that YjiA is capable of binding several types of transition metals with dissociation constants in the low micromolar range and that metal binding affects both the oligomeric structure and GTPase activity of the enzyme. Using a combination of X-ray crystallography and site-directed mutagenesis, we identify, among others, a metal-binding site adjacent to the nucleotide-binding site in the GTPase domain that involves a conserved cysteine and several glutamate residues. Mutations of the coordinating residues decrease the impact of metal, suggesting that metal binding to this site is responsible for modulating the GTPase activity of the protein. These findings point toward a regulatory function for these COG0523 GTPases that is responsive to their metal-bound state. PMID:24449932

  16. Mutants of metal binding site M1 in APP E2 show metal specific differences in binding of heparin but not of sorLA.

    PubMed

    Dienemann, Christian; Coburger, Ina; Mehmedbasic, Arnela; Andersen, Olav M; Than, Manuel E

    2015-04-21

    The amyloid precursor protein (APP) and its neurotoxic cleavage product Aβ are key players in the development of Alzheimer's disease (AD) and appear to be essential for neuronal development and cell homeostasis. Proteolytic processing of APP and its physiological function depend on its interaction with heparin and are influenced by the binding of metal ions and sorLA. We created various mutations of metal binding site M1 residing within the extracellular E2 domain of APP. Using isothermal titration calorimetry and circular dichroism spectroscopy, we analyzed the binding of Cu(2+) and Zn(2+) to APP E2 and identified two mutations that are most suited for functional studies to dissect ion specific effects of metal binding. The H313A mutation abrogates only copper-based effects, whereas the H382A mutation weakens any metal binding at M1 of APP E2. Subsequently, we tested the effect of Cu(2+) and Zn(2+) on the binding of heparin and sorLA to APP E2 using a chromatographic technique and surface plasmon resonance. We show that Zn(2+) and to a larger degree also Cu(2+) enhance the binding of heparin to APP E2, consistent with an extracellular regulation of the function of APP by both metal ions. In contrast, neither ion seemed to affect the interaction between APP E2 and sorLA. This supports an intracellular interaction between the latter two partners that would not sense extracellular variations of metal ions upon synaptic activity. PMID:25835329

  17. Health hazards due to the inhalation of amorphous silica.

    PubMed

    Merget, R; Bauer, T; Küpper, H U; Philippou, S; Bauer, H D; Breitstadt, R; Bruening, T

    2002-01-01

    Occupational exposure to crystalline silica dust is associated with an increased risk for pulmonary diseases such as silicosis, tuberculosis, chronic bronchitis, chronic obstructive pulmonary disease (COPD) and lung cancer. This review summarizes the current knowledge about the health effects of amorphous (non-crystalline) forms of silica. The major problem in the assessment of health effects of amorphous silica is its contamination with crystalline silica. This applies particularly to well-documented pneumoconiosis among diatomaceous earth workers. Intentionally manufactured synthetic amorphous silicas are without contamination of crystalline silica. These synthetic forms may be classified as (1) wet process silica, (2) pyrogenic ("thermal" or "fumed") silica, and (3) chemically or physically modified silica. According to the different physicochemical properties, the major classes of synthetic amorphous silica are used in a variety of products, e.g. as fillers in the rubber industry, in tyre compounds, as free-flow and anti-caking agents in powder materials, and as liquid carriers, particularly in the manufacture of animal feed and agrochemicals; other uses are found in toothpaste additives, paints, silicon rubber, insulation material, liquid systems in coatings, adhesives, printing inks, plastisol car undercoats, and cosmetics. Animal inhalation studies with intentionally manufactured synthetic amorphous silica showed at least partially reversible inflammation, granuloma formation and emphysema, but no progressive fibrosis of the lungs. Epidemiological studies do not support the hypothesis that amorphous silicas have any relevant potential to induce fibrosis in workers with high occupational exposure to these substances, although one study disclosed four cases with silicosis among subjects exposed to apparently non-contaminated amorphous silica. Since the data have been limited, a risk of chronic bronchitis, COPD or emphysema cannot be excluded. There is no study

  18. Nonporous Silica Nanoparticles for Nanomedicine Application

    PubMed Central

    Tang, Li; Cheng, Jianjun

    2013-01-01

    Summary Nanomedicine, the use of nanotechnology for biomedical applications, has potential to change the landscape of the diagnosis and therapy of many diseases. In the past several decades, the advancement in nanotechnology and material science has resulted in a large number of organic and inorganic nanomedicine platforms. Silica nanoparticles (NPs), which exhibit many unique properties, offer a promising drug delivery platform to realize the potential of nanomedicine. Mesoporous silica NPs have been extensively reviewed previously. Here we review the current state of the development and application of nonporous silica NPs for drug delivery and molecular imaging. PMID:23997809

  19. Conversion of geothermal waste to commercial products including silica

    DOEpatents

    Premuzic, Eugene T.; Lin, Mow S.

    2003-01-01

    A process for the treatment of geothermal residue includes contacting the pigmented amorphous silica-containing component with a depigmenting reagent one or more times to depigment the silica and produce a mixture containing depigmented amorphous silica and depigmenting reagent containing pigment material; separating the depigmented amorphous silica and from the depigmenting reagent to yield depigmented amorphous silica. Before or after the depigmenting contacting, the geothermal residue or depigmented silica can be treated with a metal solubilizing agent to produce another mixture containing pigmented or unpigmented amorphous silica-containing component and a solubilized metal-containing component; separating these components from each other to produce an amorphous silica product substantially devoid of metals and at least partially devoid of pigment. The amorphous silica product can be neutralized and thereafter dried at a temperature from about 25.degree. C. to 300.degree. C. The morphology of the silica product can be varied through the process conditions including sequence contacting steps, pH of depigmenting reagent, neutralization and drying conditions to tailor the amorphous silica for commercial use in products including filler for paint, paper, rubber and polymers, and chromatographic material.

  20. Prevention of the acute cytotoxicity associated with silica-containing minerals

    SciTech Connect

    Vallyathan, V.; Castranova, V.; Dalal, N.S.; Van Dyke, K.

    1989-10-30

    The inventors have developed a method that may prevent the acute cytotoxicity of freshly fractured silica and silica containing minerals including asbestos and coal-mine dust containing silica. The method entails coating silica-containing minerals, including coal, with a monomolecular film of an aqueously compatible silane coupling agent, either during milling, processing or after grinding or fracturing of silica or silica-containing materials. The invention also provides for a method of preventing certain pulmonary diseases, have been considered as occupational hazards in certain professions, such as coal mining and any other profession where persons are subjected to the inhalation of small particles of freshly fractured or ground silica containing minerals.

  1. Modified Mesoporous Silica for Efficient Siloxane Capture.

    PubMed

    Jafari, Tahereh; Jiang, Ting; Zhong, Wei; Khakpash, Nasser; Deljoo, Bahareh; Aindow, Mark; Singh, Prabhakar; Suib, Steven L

    2016-03-15

    In this study, octamethylcyclotetrasiloxane (D4) was removed by using a novel modified solid adsorbent of mesoporous silica. The adsorbent was synthesized using inverse micelles with some modifications in the synthesis process (temperature of gelation) and in the post treatment conditions (calcination temperature and heating rate) with a concomitant improvement of D4 uptake. This is the first report on regulating the textural properties of the mesoporous silica material UCT-14 to develop an active silica adsorbent. These adjustments resulted in an increase of the silica surface area from 391 to 798 m(2)·g(-1), which leads to a high capacity (686 mg·g(-1)) of D4-capture for the silica synthesized at 80 °C, calcined at 450 °C with the heating rate of 100 °C·min(-1) (Si-Syn80). This adsorbent showed comparable adsorption performance with the widely used commercial silica gel under dry and humid condition. Recyclability tests on the commercial silica gel and mesoporous silica synthesized at 120 °C and calcined at 450 °C with a heating rate of 100 °C·min(-1) (called Si-Syn120 or Si-450 or Si-100 °C·min(-1)) indicated that the Si-Syn120 (capacity drop 10%) is more efficient than silica gel (capacity drop 15%) after three cycles. Although, the presence of moisture (25%) in the nitrogen gas stream led to capacity reduction in both Si-Syn120 and commercial silica gel, the modified UCT-14 shows slightly better resistance to humid condition. PMID:26890152

  2. High purity silica reflective heat shield development

    NASA Technical Reports Server (NTRS)

    Nachtscheim, P. R.; Blome, J. C.

    1976-01-01

    A hyperpure vitreous silica material is being developed for use as a reflective and ablative heat shield for planetary entry. Various purity grades and forms of raw materials were evaluated along with various processing methods. Slip casting of high purity grain was selected as the best processing method, resulting in a highly reflective material in the wavelength bands of interest (the visible and ultraviolet regions). The selected material was characterized with respect to optical, mechanical and physical properties using a limited number of specimens. The process has been scaled up to produce a one-half scale heat shield (18 in. dia.) (45.72 cm) for a Jupiter entry vehicle. This work is now being extended to improve the structural safety factor of the heat shield by making hyperpure silica material tougher through the addition of silica fibers.

  3. Optical shock waves in silica aerogel.

    PubMed

    Gentilini, S; Ghajeri, F; Ghofraniha, N; Di Falco, A; Conti, C

    2014-01-27

    Silica aerogels are materials well suited for high power nonlinear optical applications. In such regime, the non-trivial thermal properties may give rise to the generation of optical shock waves, which are also affected by the structural disorder due to the porous solid-state gel. Here we report on an experimental investigation in terms of beam waist and input power, and identify various regimes of the generation of wave-breaking phenomena in silica aerogels. PMID:24515173

  4. Surface modification of HMS material with silica sol leading to a remarkable enhanced catalytic performance of Cu/SiO2

    NASA Astrophysics Data System (ADS)

    Yin, Anyuan; Wen, Chao; Dai, Wei-Lin; Fan, Kangnian

    2011-04-01

    Cu/SiO2 catalysts with different bimodal pore structures adjusted by the ratio of HMS and silica sol were prepared via modified impregnation method. Structure evolutions of the catalyst were systematically characterized by N2-physisorption, X-ray diffraction, H2 temperature-programmed reduction, N2O titration and X-ray photoelectron spectroscopy. The results show that the composite silica supported copper catalysts showed remarkably enhanced catalytic performance in the selective hydrogenation of dimethyl oxalate to ethylene glycol compared to the individual silica supported ones obtained by the same method. The dimethyl oxalate conversion and the ethylene glycol selectivity can reach 100% and 98% at 473 K with 2.5 MPa H2 pressure and 1.5 h-1 liquid hour space velocity of dimethyl oxalate over the optimized Cu/SiO2 catalyst. The remarkably enhanced catalytic performance of Cu/SiO2 catalysts might be attributed to the homogeneous dispersion and uniformity of the active copper species and to the larger copper surface areas attained on the HMS supports with large pore diameters and surface areas.

  5. Silver-coated dye-embedded silica beads: a core material of dual tagging sensors based on fluorescence and Raman scattering.

    PubMed

    Kim, Kwan; Lee, Hyang Bong; Choi, Jeong-Yong; Shin, Kuan Soo

    2011-02-01

    We have developed a new type of dual-tag sensor for immunoassays, operating via both fluorescence and surface-enhanced Raman scattering (SERS). A one-shot fluorescence image over the whole specimen allows us to save considerable time because any unnecessary time-consuming SERS measurements can be avoided from the signature of the fluorescence. Dye-embedded silica beads are prepared initially, and then SERS-active silver is coated onto them via a very simple electroless-plating method. The Raman markers are subsequently assembled onto the Ag-coated silica beads, after which they are stabilized by silanization via a biomimetic process in which a poly(allylamine hydrochloride) layer formed on the Raman markers by a layer-by-layer deposition method acting as a scaffold for guiding silicification. In the final stage, specific antibodies are attached to the silica surface in order to detect target antigens. The fluorescence signal of the embedded dye can be used as a fast readout system of molecular recognition, whereas the SERS signals are subsequently used as the signature of specific molecular interactions. In this way, the antibody-grafted particles were found to recognize antigens down to 1 × 10(-10) g mL(-1) solely by the SERS peaks of the Raman markers. PMID:21190360

  6. Silica and Pyroxene in IVA Irons; Possible Formation of the IVA Magma by Impact Melting and Reduction of L-LL-Chondrite Materials Followed by Crystallization and Cooling

    NASA Technical Reports Server (NTRS)

    Wasson, John T.; Matsunami, Yoshiyuki; Rubin, Alan E.

    2006-01-01

    Group IVA is a large magmatic group of iron meteorites. The mean DELTA O-17 (= delta O-17 - 0.52(raised dot) delta O-18) of the silicates is approx. plus or minus 1.2%o, similar to the highest values in L chondrites and the lowest values in LL chondrites; delta O-18 values are also in the L/LL range. This strongly suggests that IVA irons formed by melting L-LL parental material, but the mean Ni content of IVA irons (83 mg/g) is much lower than that of a presumed L-LL parent (approx. 170 mg/g) and the low-Ca pyroxene present in two IVA meteorites is Fs13, much lower than the Fs20-29 values in L and LL chondrites. Thus, formation from L-LL precursors requires extensive addition of metallic Fe, probably produced by reduction of FeS and FeO. Group IVA also has S/Ni, Ga/Ni, and Ge/Ni ratios that are much lower than those in L-LL chondrites or any chondrite group that preserves nebular compositions, implying loss of these volatile elements during asteroidal processing. We suggest that these reduction and loss processes occurred near the surface of the asteroid during impact heating, and resulted partly from reduction by C, and partly from the thermal dissociation of FeS and FeO with loss of O and S. The hot (approx. 1770 K) low-viscosity melt quickly moved through channels in the porous asteroid to form a core. Two members of the IVA group, Sao Joao Nepomuceno (hereafter, SJN) and Steinbach, contain moderate amounts of orthopyroxene and silica, and minor amounts of low-Ca clinopyroxene. Even though SJN formed after approx. 26% crystallization and Steinbach formed after approx. 77% Crystallization of the IVA core, both could have originated within several tens of meters of the core-mantle interface if 99% of the crystallization occurred from the center outwards. Two other members of the group (Gibeon and Bishop Canyon) contain tabular tridymite, which we infer to have initially formed as veins deposited from a cooling SiO-rich vapor. The silicates were clearly introduced

  7. Silica and pyroxene in IVA irons; possible formation of the IVA magma by impact melting and reduction of L-LL-chondrite materials followed by crystallization and cooling

    NASA Astrophysics Data System (ADS)

    Wasson, John T.; Matsunami, Yoshiyuki; Rubin, Alan E.

    2006-06-01

    Group IVA is a large magmatic group of iron meteorites. The mean Δ 17O (=δ 17O - 0.52·δ 18O) of the silicates is ˜+1.2‰, similar to the highest values in L chondrites and the lowest values in LL chondrites; δ 18O values are also in the L/LL range. This strongly suggests that IVA irons formed by melting L-LL parental material, but the mean Ni content of IVA irons (83 mg/g) is much lower than that of a presumed L-LL parent (˜170 mg/g) and the low-Ca pyroxene present in two IVA meteorites is Fs13, much lower than the Fs20-29 values in L and LL chondrites. Thus, formation from L-LL precursors requires extensive addition of metallic Fe, probably produced by reduction of FeS and FeO. Group IVA also has S/Ni, Ga/Ni, and Ge/Ni ratios that are much lower than those in L-LL chondrites or any chondrite group that preserves nebular compositions, implying loss of these volatile elements during asteroidal processing. We suggest that these reduction and loss processes occurred near the surface of the asteroid during impact heating, and resulted partly from reduction by C, and partly from the thermal dissociation of FeS and FeO with loss of O and S. The hot (˜1770 K) low-viscosity melt quickly moved through channels in the porous asteroid to form a core. Two members of the IVA group, São João Nepomuceno (hereafter, SJN) and Steinbach, contain moderate amounts of orthopyroxene and silica, and minor amounts of low-Ca clinopyroxene. Even though SJN formed after ˜26% crystallization and Steinbach formed after ˜77% crystallization of the IVA core, both could have originated within several tens of meters of the core-mantle interface if 99% of the crystallization occurred from the center outwards. Two other members of the group (Gibeon and Bishop Canyon) contain tabular tridymite, which we infer to have initially formed as veins deposited from a cooling SiO-rich vapor. The silicates were clearly introduced into IVA irons after the initial magma crystallized. Because the

  8. Silica substrate or portion formed from oxidation of monocrystalline silicon

    DOEpatents

    Matzke, Carolyn M.; Rieger, Dennis J.; Ellis, Robert V.

    2003-07-15

    A method is disclosed for forming an inclusion-free silica substrate using a monocrystalline silicon substrate as the starting material and oxidizing the silicon substrate to convert it entirely to silica. The oxidation process is performed from both major surfaces of the silicon substrate using a conventional high-pressure oxidation system. The resulting product is an amorphous silica substrate which is expected to have superior etching characteristics for microfabrication than conventional fused silica substrates. The present invention can also be used to convert only a portion of a monocrystalline silicon substrate to silica by masking the silicon substrate and locally thinning a portion the silicon substrate prior to converting the silicon portion entirely to silica. In this case, the silica formed by oxidizing the thinned portion of the silicon substrate can be used, for example, as a window to provide optical access through the silicon substrate.

  9. Cadmium detoxification strategies in two phytoplankton species: metal binding by newly synthesized thiolated peptides and metal sequestration in granules.

    PubMed

    Lavoie, Michel; Le Faucheur, Séverine; Fortin, Claude; Campbell, Peter G C

    2009-04-01

    The aim of this study was to evaluate whether intracellular detoxification mechanisms could explain, at least partially, the different sensitivity to Cd of two freshwater green algae, Chlamydomonas reinhardtii and Pseudokirchneriella subcapitata. Subcellular Cd distribution and the synthesis of metal-binding thiolated peptides were thus examined in both algae exposed to a range of free [Cd(2+)] from 0.7 to 253 nM. Cadmium partitioning among five subcellular fractions (cellular debris, granules, organelles, heat-denaturable proteins - HDP, and heat-stable proteins - HSP) was determined after differential centrifugation of algal homogenates. Thiolated-peptides, phytochelatins (PC(n)) and precursors, were analyzed by HPLC with pre-column monobromobimane derivatization. Cadmium accumulation per cell was 2-4 times greater for C. reinhardtii than for P. subcapitata, yet C. reinhardtii was more resistant to Cd with an EC(50) of 273 nM Cd(2+) [244-333 nM Cd(2+) CI(95%)]) compared to 127 nM Cd(2+) [111-143 nM Cd(2+) CI(95%)] for P. subcapitata. Although [Cd] generally increased in the organelle fractions when free [Cd(2+)] increased in the experimental media, their relative contributions to the total Cd cellular content decreased, suggesting that partial protection of some metal sensitive sites was achieved by the initiation of cellular detoxification mechanisms. An increase in the proportion of Cd in the granules fraction was observed for C. reinhardtii between 6 and 15 nM Cd(2+) (i.e., at [Cd(2+)]

  10. Apoprotein Structure and Metal Binding Characterization of a de Novo Designed Peptide, α3DIV, that Sequesters Toxic Heavy Metals

    PubMed Central

    Plegaria, Jefferson S.; Dzul, Stephen P.; Zuiderweg, Erik R. P.; Stemmler, Timothy L.; Pecoraro, Vincent L.

    2015-01-01

    De novo protein design is a biologically relevant approach that provides a novel process in elucidating protein folding and modeling the metal centers of metalloproteins in a completely unrelated or simplified fold. An integral step in de novo protein design is the establishment of a well-folded scaffold with one conformation, which is a fundamental characteristic of many native proteins. Here, we report the NMR solution structure of apo α3DIV at pH 7.0, a de novo designed three-helix bundle peptide containing a triscysteine motif (Cys18, Cys28, and Cys67) that binds toxic heavy metals. The structure comprises 1067 NOE restraints derived from multinuclear multidimensional NOESY, as well as 138 dihedral angles (ψ, φ, and χ1). The backbone and heavy atoms of the 20 lowest energy structures have a root mean square deviation from the mean structure of 0.79 (0.16) Å and 1.31 (0.15) Å, respectively. When compared to the parent structure α3D, the substitution of Leu residues to Cys enhanced the α-helical content of α3DIV while maintaining the same overall topology and fold. In addition, solution studies on the metalated species illustrated metal-induced stability. An increase in the melting temperatures was observed for Hg(II), Pb(II), or Cd(II) bound α3DIV by 18–24 °C compared to its apo counterpart. Further, the extended X-ray absorption fine structure analysis on Hg(II)-α3DIV produced an average Hg(II)–S bond length at 2.36 Å, indicating a trigonal T-shaped coordination environment. Overall, the structure of apo α3DIV reveals an asymmetric distorted triscysteine metal binding site, which offers a model for native metalloregulatory proteins with thiol-rich ligands that function in regulating toxic heavy metals, such as ArsR, CadC, MerR, and PbrR PMID:25790102

  11. Light-Induced Surface Patterning of Silica.

    PubMed

    Kang, Hong Suk; Lee, Seungwoo; Choi, Jaeho; Lee, Hongkyung; Park, Jung-Ki; Kim, Hee-Tak

    2015-10-27

    Manipulating the size and shape of silica precursor patterns using simple far-field light irradiation and transforming such reconfigured structures into inorganic silica patterns by pyrolytic conversion are demonstrated. The key concept of our work is the use of an azobenzene incorporated silica precursor (herein, we refer to this material as azo-silane composite) as ink in a micromolding process. The moving direction of azo-silane composite is parallel to light polarization direction; in addition, the amount of azo-silane composite movement can be precisely determined by controlling light irradiation time. By exploiting this peculiar phenomenon, azo-silane composite patterns produced using the micromolding technique are arbitrarily manipulated to obtain various structural features including high-resolution size or sophisticated shape. The photoreconfigured patterns formed with azo-silane composites are then converted into pure silica patterns through pyrolytic conversion. The pyrolytic converted silica patterns are uniformly formed over a large area, ensuring crack-free formation and providing high structural fidelity. Therefore, this optical manipulation technique, in conjunction with the pyrolytic conversion process, opens a promising route to the design of silica patterns with finely tuned structural features in terms of size and shape. This platform for designing silica structures has significant value in various nanotechnology fields including micro/nanofluidic channel for lab-on-a-chip devices, transparent superhydrophobic surfaces, and optoelectronic devices. PMID:26389813

  12. Uranium incorporation into amorphous silica.

    PubMed

    Massey, Michael S; Lezama-Pacheco, Juan S; Nelson, Joey M; Fendorf, Scott; Maher, Kate

    2014-01-01

    High concentrations of uranium are commonly observed in naturally occurring amorphous silica (including opal) deposits, suggesting that incorporation of U into amorphous silica may represent a natural attenuation mechanism and promising strategy for U remediation. However, the stability of uranium in opaline silicates, determined in part by the binding mechanism for U, is an important factor in its long-term fate. U may bind directly to the opaline silicate matrix, or to materials such as iron (hydr)oxides that are subsequently occluded within the opal. Here, we examine the coordination environment of U within opaline silica to elucidate incorporation mechanisms. Precipitates (with and without ferrihydrite inclusions) were synthesized from U-bearing sodium metasilicate solutions, buffered at pH ∼ 5.6. Natural and synthetic solids were analyzed with X-ray absorption spectroscopy and a suite of other techniques. In synthetic amorphous silica, U was coordinated by silicate in a double corner-sharing coordination geometry (Si at ∼ 3.8-3.9 Å) and a small amount of uranyl and silicate in a bidentate, mononuclear (edge-sharing) coordination (Si at ∼ 3.1-3.2 Å, U at ∼ 3.8-3.9 Å). In iron-bearing synthetic solids, U was adsorbed to iron (hydr)oxide, but the coordination environment also contained silicate in both edge-sharing and corner-sharing coordination. Uranium local coordination in synthetic solids is similar to that of natural U-bearing opals that retain U for millions of years. The stability and extent of U incorporation into opaline and amorphous silica represents a long-term repository for U that may provide an alternative strategy for remediation of U contamination. PMID:24984107

  13. Ga[OSi(O(t)Bu)3]3·THF, a thermolytic molecular precursor for high surface area gallium-containing silica materials of controlled dispersion and stoichiometry.

    PubMed

    Dombrowski, James P; Johnson, Gregory R; Bell, Alexis T; Tilley, T Don

    2016-07-01

    The molecular precursor tris[(tri-tert-butoxy)siloxy]gallium, as the tetrahydrofuran adduct Ga[OSi(O(t)Bu)3]3·THF (), was synthesized via the salt metathesis reaction of gallium trichloride with NaOSi(O(t)Bu)3. This complex serves as a model for isolated gallium in a silica framework. Complex decomposes thermally in hydrocarbon solvent, eliminating isobutylene, water, and tert-butanol to generate high surface area gallium-containing silica at low temperatures. When thermal decomposition was performed in the presence of P-123 Pluronic as a templating agent the generated material displayed uniform vermicular pores. Textural mesoporosity was evident in untemplated material. Co-thermolysis of with HOSi(O(t)Bu)3 in the presence of P-123 Pluronic led to materials with Ga : Si ratios ranging from 1 : 3 to 1 : 50, denoted UCB1-GaSi3, UCB1-GaSi10, UCB1-GaSi20 and UCB1-GaSi50. After calcination at 500 °C these materials exhibited decreasing surface areas and broadening pore distributions with increasing silicon content, indicating a loss of template effects. The position and dispersion of the gallium in UCB1-GaSi materials was investigated using (71)Ga MAS-NMR, powder XRD, and STEM/EDS elemental mapping. The results indicate a high degree of gallium dispersion in all samples, with gallium oxide clusters or oligomers present at higher gallium content. PMID:27312519

  14. Silazane to silica

    NASA Technical Reports Server (NTRS)

    Harvey, Gale A.

    1992-01-01

    Thin film silica and/or methyl silicone were detected on most external surfaces of the retrieved LDEF. Known sources of silicone in or on the LDEF appear inadequate to explain the ubiquitous presence of the silica and silicone films. Hexamethyldisilazane (HMDS) was used as the Challenger tile waterproofing compound for the Challenger/LDEF deployment mission. HMDS releases NH3 which depolymerizes silicone RTV's. Polyurethanes were also attacked. Much of the silica/silicone contamination of LDEF resulted from HMDS.

  15. Silazine to silica

    NASA Technical Reports Server (NTRS)

    Harvey, Gale A.

    1993-01-01

    Thin film silica and/or methyl silicone were detected on most external surfaces of the retrieved LDEF. Both solar ultraviolet radiation and atomic oxygen can convert silicones to silica. Known sources of silicone in or on the LDEF appear inadequate to explain the ubiquitous presence of the silica and silicone films. Hexamethyldisilazane (HMDS) was used as the Challenger tile waterproofing compound for the Challenger/LDEF deployment mission. HMDS is both volatile and chemically reactive at STP. In addition, HMDS releases NH3 which depolymerizes silicone RTV's. Polyurethanes are also depolymerized. Experiments are reported that indicate much of the silicone and silica contamination of LDEF resulted directly or indirectly from HMDS.

  16. Method of solidifying waste materials, such as radioactive or toxic materials, contained in aqueous solutions

    SciTech Connect

    Knieper, J.; May, K.; Printz, H.

    1984-07-24

    A method is disclosed of solidifying waste materials, such as radioactive or toxic materials, which are contained in aqueous solutions. To accomplish this solidification, an inorganic, non-metallic binding agent such as gypsum is intermixed with the aqueous solution and a substance such as pumice or ceramic tile which promotes the intermixing of the binding agent and the aqueous solution.

  17. Designed synthesis of Graphene @titania @mesoporous silica hybrid material as size-exclusive metal oxide affinity chromatography platform for selective enrichment of endogenous phosphopeptides.

    PubMed

    Yao, Jizong; Sun, Nianrong; Deng, Chunhui; Zhang, Xiangming

    2016-04-01

    In this work, a novel size-exclusive metal oxide affinity chromatography (SE-MOAC) platform was built for phosphoproteome research. The operation for preparing graphene @titania @mesoporous silica nanohybrids (denoted as G@TiO2@mSiO2) was facile and easy to conduct by grafting titania nanoparticles on polydopamine (PD)-covered graphene, following a layer of mesoporous silica was coated on the outermost layer. The G@TiO2@mSiO2 nanohybrids exhibited high sensitivity with a low detection limit of 5 amol/μL (a total amount of 1 fmol) and high selectivity for phosphopeptides at a mass ratio of phosphopeptides to non-phosphopeptides (1:1000). The size-exclusive capability of the nanohybrids were also demonstrated by enriching the phosphopeptides from the mixture of Bovine Serum Albumin (BSA), α-casein, and β-casein digests with a high mass ratio (β-casein digests: α-casein: BSA, 1:500:500), which was attributed to the large surface area and ordered mesoporous channels. In addition, the G@TiO2@mSiO2 nanohybrids were employed to capture the endogenous phosphopeptides from human serum successfully. PMID:26838411

  18. Interactive effects of waterborne metals in binary mixtures on short-term gill-metal binding and ion uptake in rainbow trout (Oncorhynchus mykiss).

    PubMed

    Niyogi, Som; Nadella, Sunita R; Wood, Chris M

    2015-08-01

    Metal binding to fish gills forms the basis of the biotic ligand model (BLM) approach, which has emerged as a useful tool for conducting site-specific water quality assessments for metals. The current BLMs are designed to assess the toxicity of individual metals, and cannot account for the interactive effects of metal mixtures to aquatic organisms including fish. The present study was designed mainly to examine the interactive effects of waterborne metals (Cd, Zn, Cu, Ag, and Ni) in specific binary combinations on short-term (3h) gill-metal binding and essential ion (Ca(2+) and Na(+)) uptake (a physiological index of toxicity) in fish, using juvenile freshwater rainbow trout (Oncorhynchus mykiss) as the model species. We hypothesized that binary mixtures of metals that share a common mode of uptake and toxicity (e.g., Cd and Zn - Ca(2+) antagonists, Cu and Ag - Na(+) antagonists) would reduce the gill binding of each other via competitive interactions and induce less than additive effects on ion transport. In addition, the mixture of metals that have different modes of uptake and toxicity (e.g., Cd and Cu, or Cd and Ni) would not exhibit any interactive effects either on gill-metal binding or ion transport. We found that both Zn and Cu reduced gill-Cd binding and vice versa, however, Ni did not influence gill-Cd binding in fish. Surprisingly, Ag was found to stimulate gill-Cu binding especially at high exposure concentrations, whereas, Cu had no effect on gill-Ag binding. The inhibitory effect of Cd and Zn in mixture on branchial Ca(2+) uptake was significantly greater than that of Cd or Zn alone. Similarly, the inhibitory effect of Cu and Ag in mixture on branchial Na(+) uptake was significantly greater than that of Cu or Ag alone. The inhibitory effects of Cd and Zn mixture on Ca(2+) uptake as well as Cu and Ag mixture on Na(+) uptake were found to follow the principles of simple additivity. In contrast, no significant additive effect on either Ca(2+) or Na

  19. Silica Transport and Cementation in Quartz Aggregates

    NASA Astrophysics Data System (ADS)

    Pebble, C.; Farver, J.; Onasch, C.; Winslow, D.

    2008-12-01

    Silica transport and cementation in quartz aggregates have been experimentally investigated. Starting materials include a natural quartz arenite (Pocono sandstone), sized clasts of synthetic quartz, and sized grains of disaggregated natural sandstones. Experimental charges consisted of amorphous silica powder (~25 mg), AlCl3 powder (~3 mg), 25 wt% NaCl brine solution (~20 mg), and the starting material (~150 mg). The charges were weld-sealed in gold capsules and run in cold-seal pressure vessels at 300°C to 600°C at 150 MPa confining pressure for up to 4 weeks. Detailed calibrations of the furnaces indicate the maximum temperature variation across the length of the sample charges (3-7mm) was <5°C, and typically <3°C. After the experiments, samples were vacuum impregnated with epoxy containing a blue dye and sawn in half along the long axis of the sample charge. The nature and amount of silica transport and cementation in the samples was determined by a combination of Cathodoluminescence (CL), Light Microscopy (LM), and Scanning Electron Microscopy (SEM). Photomosaics of the samples were collected and the amount of cement, porosity, and average grain sizes were determined by point-counting. The cement was easily recognized from the quartz grains by the difference in luminescence. The experiments indicate that the presence of amorphous silica results in rapid silica cementation in quartz aggregates (e.g., up to 12% cement by volume in 4 weeks at 450°C). The amount of cementation is a function of substrate type, time, temperature, and ionic strength of the brine. The rate of silica transport through the length of the experimental charge appears to be limited by the silica solubility and its rapid depletion by cementation. Although most of the cement was derived from the amorphous silica, evidence for local dissolution-precipitation was observed. The experiments demonstrate that the mobility of silica, and consequent precipitation of cement, does not require a

  20. Optimizing radiolabeling amine-functionalized silica nanoparticles using SarAr-NCS for applications in imaging and radiotherapy.

    PubMed

    Kong, Linggen; Mume, Eskender; Triani, Gerry; Smith, Suzanne V

    2013-05-01

    Silica nanoparticles functionalized with amine groups and in the size range of approximately 60-94 nm were produced by combining sol-gel processing and emulsion technology. Hexa-aza cage ligand SarAr-NCS was conjugated to the silica nanoparticles and subsequently radiolabeled with a solution of (57)Co(2+)-doped carrier Co(2+). The number of Co(2+) ions bound to the silica particles at pH 7 was used to determine the average number of available SarAr-NCS ligands conjugated to a silica particle. For organically modified silica particles of 94.0 and 59.5 nm diameter, the maximum number of metal binding sites was determined to be 11700 and 3270 sites per particle, respectively. For silica particles (63.5 nm peak diameter) produced using an water-in-oil emulsion, the calculated average was 4480 on the particle surface. The number of SarAr-NCS conjugated on the particles was easily controlled, potentially providing for a range of products for applications in the risk assessment of particles and theranostic imaging or radiotherapy when radiolabeled with a suitable radioisotope such as (64)Cu or (67)Cu. PMID:23581487

  1. Silica, Silicosis, and Autoimmunity

    PubMed Central

    Pollard, Kenneth Michael

    2016-01-01

    Inhalation of dust containing crystalline silica is associated with a number of acute and chronic diseases including systemic autoimmune diseases. Evidence for the link with autoimmune disease comes from epidemiological studies linking occupational exposure to crystalline silica dust with the systemic autoimmune diseases systemic lupus erythematosus, systemic sclerosis, and rheumatoid arthritis. Although little is known regarding the mechanism by which silica exposure leads to systemic autoimmune disease, there is a voluminous literature on silica exposure and silicosis that may help identify immune processes that precede development of autoimmunity. The pathophysiology of silicosis consists of deposition of silica particles in the alveoli of the lung. Ingestion of these particles by macrophages initiates an inflammatory response, which stimulates fibroblasts to proliferate and produce collagen. Silica particles are encased by collagen leading to fibrosis and the nodular lesions characteristic of the disease. The steps in the development of silicosis, including acute and chronic inflammation and fibrosis, have different molecular and cellular requirements, suggesting that silica-induced inflammation and fibrosis may be mechanistically separate. Significantly, it is unclear whether silica-induced inflammation and fibrosis contribute similarly to the development of autoimmunity. Nonetheless, the findings from human and animal model studies are consistent with an autoimmune pathogenesis that begins with activation of the innate immune system leading to proinflammatory cytokine production, pulmonary inflammation leading to activation of adaptive immunity, breaking of tolerance, and autoantibodies and tissue damage. The variable frequency of these immunological features following silica exposure suggests substantial genetic involvement and gene/environment interaction in silica-induced autoimmunity. However, numerous questions remain unanswered. PMID:27014276

  2. Silica, Silicosis, and Autoimmunity.

    PubMed

    Pollard, Kenneth Michael

    2016-01-01

    Inhalation of dust containing crystalline silica is associated with a number of acute and chronic diseases including systemic autoimmune diseases. Evidence for the link with autoimmune disease comes from epidemiological studies linking occupational exposure to crystalline silica dust with the systemic autoimmune diseases systemic lupus erythematosus, systemic sclerosis, and rheumatoid arthritis. Although little is known regarding the mechanism by which silica exposure leads to systemic autoimmune disease, there is a voluminous literature on silica exposure and silicosis that may help identify immune processes that precede development of autoimmunity. The pathophysiology of silicosis consists of deposition of silica particles in the alveoli of the lung. Ingestion of these particles by macrophages initiates an inflammatory response, which stimulates fibroblasts to proliferate and produce collagen. Silica particles are encased by collagen leading to fibrosis and the nodular lesions characteristic of the disease. The steps in the development of silicosis, including acute and chronic inflammation and fibrosis, have different molecular and cellular requirements, suggesting that silica-induced inflammation and fibrosis may be mechanistically separate. Significantly, it is unclear whether silica-induced inflammation and fibrosis contribute similarly to the development of autoimmunity. Nonetheless, the findings from human and animal model studies are consistent with an autoimmune pathogenesis that begins with activation of the innate immune system leading to proinflammatory cytokine production, pulmonary inflammation leading to activation of adaptive immunity, breaking of tolerance, and autoantibodies and tissue damage. The variable frequency of these immunological features following silica exposure suggests substantial genetic involvement and gene/environment interaction in silica-induced autoimmunity. However, numerous questions remain unanswered. PMID:27014276

  3. Reliable methods for silica coating of Au nanoparticles.

    PubMed

    Pastoriza-Santos, Isabel; Liz-Marzán, Luis M

    2013-01-01

    The inherent properties of silica, such as optical transparency, high biocompatibility, chemical and colloidal stability, controllable porosity, and easy surface modification, provide silica materials with a tremendous potential in biomedicine. Therefore, the coating of Au nanoparticles with silica largely contributes to enhance the important applications of metal nanoparticles in biomedicine. We describe in this chapter a number of reliable strategies that have been reported for silica coating of different types of Au nanoparticles. All descriptions are based on tested protocols and are expected to provide a reference for scientists with an interest in this field. PMID:23918330

  4. Water-Silica Force Field for Simulating Nanodevices

    PubMed Central

    Cruz-Chu, Eduardo R.; Aksimentiev, Aleksei; Schulten, Klaus

    2008-01-01

    Amorphous silica is an inorganic material that is central for many nanotechnology appplications, such as nanoelectronics, microfluidics, and nanopore technology. In order to use molecular dynamics (MD) simulations to study the behavior of biomolecules with silica, we developed a force field for amorphous silica surfaces based on their macroscopic wetting properties that is compatible with the CHARMM force field and TIP3P water model. The contact angle of a water droplet with silica served as a criterion to tune the intermolecular interactions. The resulting force field was used to study the permeation of water through silica nanopores, illustrating the influence of the surface topography and the intermolecular parameters on permeation kinetics. We find that minute modeling of the amorphous surface is critical for MD studies, since the particular arrangement of surface atoms controls sensitively electrostatic interactions between silica and water. PMID:17064100

  5. In silico design and construction of metal-binding hybrid proteins for specific removal of cadmium based on CS3 pili display on the surface of Escherichia coli.

    PubMed

    Eskandari, Vajiheh; Yakhchali, Bagher; Sadeghi, Mehdi; Karkhane, Ali Asghar

    2013-01-01

    In this study, through a combination of bioinformatics and genetic engineering procedures, high-affinity metal-binding peptides were designed and expressed on the surface of Escherichia coli for selective Cd(2+) adsorption. Putative cadmium-binding motifs were identified by searches against the Prosite database and permissive sites in the major subunit (CstH) of the enterotoxigenic E. coli pili were predicted based on the data derived from modeling of 3D structures, secondary structure prediction and assignment, inspection of protein hydropathy and exposed regions, and also protein interaction sites. The metal-binding motifs were inserted into one permissive site of the CstH (amino acid 38) with the aid of the SOEing PCR technique. The capacity and selectivity of the recombinant bacteria displaying hybrid pili to adsorb cadmium were evaluated with the atomic absorption procedure. The levels of Cd(2+) accumulation in the recombinant E. coli strains were 13.9- and 11.33-fold higher than those in the control strain. Cd(2+) was selectively absorbed from a solution containing equal concentrations of four metals, resulting in more than 90% of the total adsorbed metals being Cd(2+) , showing a relatively high affinity for Cd(2+) over other coexisting metal ions. PMID:23745737

  6. Metal binding by humic acids isolated from water hyacinth plants (Eichhornia crassipes [Mart.] Solm-Laubach: Pontedericeae) in the Nile Delta, Egypt.

    PubMed

    Ghabbour, Elham A; Davies, Geoffrey; Lam, Yam-Yuen; Vozzella, Marcy E

    2004-10-01

    Humic acids (HAs) are animal and plant decay products that confer water retention, metal and organic solute binding functions and texture/workability in soils. HAs assist plant nutrition with minimal run-off pollution. Recent isolation of HAs from several live plants prompted us to investigate the HA content of the water hyacinth (Eichhornia crassipes [Mart.] Solm-Laubach: Pontedericeae), a delicately flowered plant from Amazonian South America that has invaded temperate lakes, rivers and waterways with devastating economic effects. Hyacinth thrives in nutrient-rich and polluted waters. It has a high affinity for metals and is used for phytoremediation. In this work, HAs isolated from the leaves, stems and roots of live water hyacinth plants from the Nile Delta, Egypt were identified by chemical and spectral analysis and by comparison with authentic soil and plant derived HAs. Similar carbohydrate and amino acid distributions and tight metal binding capacities of the HAs and their respective plant components suggest that the presence of HAs in plants is related to their metal binding properties. PMID:15261408

  7. Bifunctional mesoporous silicas with clearly distinguished localization of grafted groups

    NASA Astrophysics Data System (ADS)

    Roik, N. V.; Belyakova, L. A.

    2013-12-01

    Bifunctional mesoporous silicas with clearly distinguished localization of grafted groups on the surface of particles and inside their pores were obtained by means of sol-gel synthesis with postsynthetic vapor-phase treatment in vacuum. It was found that the synthesized materials have the hexagonally ordered porous structure typical of MCM-41 type silica.

  8. Community Geothermal Technology Program: Silica bronze project. Final report

    SciTech Connect

    Bianchini, H.

    1989-10-01

    Objective was to incorporate waste silica from the HGP-A geothermal well in Pohoiki with other refractory materials for investment casting of bronze sculpture. The best composition for casting is about 50% silica, 25% red cinders, and 25% brick dust; remaining ingredient is a binder, such as plaster and water.

  9. Application of silica nanoparticles for increased silica availability in maize

    NASA Astrophysics Data System (ADS)

    Suriyaprabha, R.; Karunakaran, G.; Yuvakkumar, R.; Prabu, P.; Rajendran, V.; Kannan, N.

    2013-02-01

    Silica nanoparticles were extracted from rice husk and characterised comprehensively. The synthesised silica powders were amorphous in size with 99.7% purity (20-40 nm). Nanosilica was amended with red soil at 15 kg ha-1 along with micron silica. The influence of nanoscale on silica uptake, accumulation and nutritional variations in maize roots were evaluated through the studies such as root sectioning, elemental analysis and physiological parameters (root length and silica content) and compared with micron silica and control. Nanosilica treated soil reveals enhanced silica uptake and elongated roots which make the plant to resist in stress conditions like drought.

  10. Cellular complexity captured in durable silica biocomposites

    PubMed Central

    Kaehr, Bryan; Townson, Jason L.; Kalinich, Robin M.; Awad, Yasmine H.; Swartzentruber, B. S.; Dunphy, Darren R.; Brinker, C. Jeffrey

    2012-01-01

    Tissue-derived cultured cells exhibit a remarkable range of morphological features in vitro, depending on phenotypic expression and environmental interactions. Translation of these cellular architectures into inorganic materials would provide routes to generate hierarchical nanomaterials with stabilized structures and functions. Here, we describe the fabrication of cell/silica composites (CSCs) and their conversion to silica replicas using mammalian cells as scaffolds to direct complex structure formation. Under mildly acidic solution conditions, silica deposition is restricted to the molecularly crowded cellular template. Inter- and intracellular heterogeneity from the nano- to macroscale is captured and dimensionally preserved in CSCs following drying and subjection to extreme temperatures allowing, for instance, size and shape preserving pyrolysis of cellular architectures to form conductive carbon replicas. The structural and behavioral malleability of the starting material (cultured cells) provides opportunities to develop robust and economical biocomposites with programmed structures and functions. PMID:23045634

  11. Silica Embedded Metal Hydrides

    SciTech Connect

    Heung, L.K.; Wicks, G.G.

    1998-08-01

    A method to produce silica embedded metal hydride was developed. The product is a composite in which metal hydride particles are embedded in a matrix of silica. The silica matrix is highly porous. Hydrogen gas can easily reach the embedded metal hydride particles. The pores are small so that the metal hydride particles cannot leave the matrix. The porous matrix also protects the metal hydride particles from larger and reactive molecules such as oxygen, since the larger gas molecules cannot pass through the small pores easily. Tests show that granules of this composite can absorb hydrogen readily and withstand many cycles without making fines.

  12. Oxygen configurations in silica

    SciTech Connect

    Chelikowsky, James R.; Chadi, D. J.; Binggeli, N.

    2000-07-15

    We propose a transition state for oxygen in silica. This state is produced by the insertion of an oxygen molecule into the Si-O-Si bond, i.e., it consists of producing a Si-O-O-O-Si bond. This state allows molecular oxygen diffusion in silica without breaking the molecular O{sub 2} bond and it is energetically more stable than a peroxy configuration. This configuration may allow for exchange of molecular oxygen with the oxygen in the silica framework. (c) 2000 The American Physical Society.

  13. Silica nanoporous membranes and their applications

    NASA Astrophysics Data System (ADS)

    Khabibullin, Amir

    This thesis describes the development of novel silica and hybrid nanoporous membranes. Nanoporous membranes are widely used in various applications. This thesis focuses on their potential applications in the energy area, such as fuel cells and lithium batteries, and in separations and ultrafiltration. We use silica colloidal spheres and polymer-modified silica spheres to prepare the membranes in a time-, cost- and material-efficient manner. First, we prepared novel silica nanoporous membranes by pressing silica colloidal spheres followed by sintering. The pore size, the thickness, and the area of the membrane are precisely controlled by experiment parameters. The resulting membranes are mechanically and thermally durable, crack-free, and capable of size-selective transport. Next, to demonstrate the utility of the pressed membranes, described above, the proton-conductive pore-filled silica colloidal membranes were prepared and the fuel cells were constructed using these membranes. We modified these membranes by filling the membrane pores with surface-attached proton-conductive polymer brushes and prepared membrane-electrode assemblies to test fuel cell performance. We studied the proton conductivity and fuel cell performance as a function of the amount of sulfonic groups in the membrane. We also prepared and characterized reversible hybrid nanoporous membranes, self-assembled from solution containing polymer-modified silica colloidal spheres. Here we applied the new concept of noncovalent membranes, where the material is held together via noncovalent interactions of polymer brushes. This enables so-called reversible assembly of the membranes, in which membrane can be assembled in one solvent and dissolved in other. This approach provides advantages in recycling and reusing of the material. This work is one of the first of its kind and it opens a whole new area of research on reversible membranes made of polymer-modified nanoparticles. Finally, we applied our

  14. Cellulose-silica aerogels.

    PubMed

    Demilecamps, Arnaud; Beauger, Christian; Hildenbrand, Claudia; Rigacci, Arnaud; Budtova, Tatiana

    2015-05-20

    Aerogels based on interpenetrated cellulose-silica networks were prepared and characterised. Wet coagulated cellulose was impregnated with silica phase, polyethoxydisiloxane, using two methods: (i) molecular diffusion and (ii) forced flow induced by pressure difference. The latter allowed an enormous decrease in the impregnation times, by almost three orders of magnitude, for a sample with the same geometry. In both cases, nanostructured silica gel was in situ formed inside cellulose matrix. Nitrogen adsorption analysis revealed an almost threefold increase in pores specific surface area, from cellulose aerogel alone to organic-inorganic composite. Morphology, thermal conductivity and mechanical properties under uniaxial compression were investigated. Thermal conductivity of composite aerogels was lower than that of cellulose aerogel due to the formation of superinsulating mesoporous silica inside cellulose pores. Furthermore, composite aerogels were stiffer than each of reference aerogels. PMID:25817671

  15. Kinetics of amorphous silica dissolution and the paradox of the silica polymorphs

    PubMed Central

    Dove, Patricia M.; Han, Nizhou; Wallace, Adam F.; De Yoreo, James J.

    2008-01-01

    The mechanisms by which amorphous silica dissolves have proven elusive because noncrystalline materials lack the structural order that allows them to be studied by the classical terrace, ledge, kink-based models applied to crystals. This would seem to imply amorphous phases have surfaces that are disordered at an atomic scale so that the transfer of SiO4 tetrahedra to solution always leaves the surface free energy of the solid unchanged. As a consequence, dissolution rates of amorphous phases should simply scale linearly with increasing driving force (undersaturation) through the higher probability of detaching silica tetrahedra. By examining rate measurements for two amorphous SiO2 glasses we find, instead, a paradox. In electrolyte solutions, these silicas show the same exponential dependence on driving force as their crystalline counterpart, quartz. We analyze this enigma by considering that amorphous silicas present two predominant types of surface-coordinated silica tetrahedra to solution. Electrolytes overcome the energy barrier to nucleated detachment of higher coordinated species to create a periphery of reactive, lesser coordinated groups that increase surface energy. The result is a plausible mechanism-based model that is formally identical with the classical polynuclear theory developed for crystal growth. The model also accounts for reported demineralization rates of natural biogenic and synthetic colloidal silicas. In principle, these insights should be applicable to materials with a wide variety of compositions and structural order when the reacting units are defined by the energies of their constituent species. PMID:18632576

  16. Crystalline Silica Primer

    USGS Publications Warehouse

    Staff- Branch of Industrial Minerals

    1992-01-01

    substance and will present a nontechnical overview of the techniques used to measure crystalline silica. Because this primer is meant to be a starting point for anyone interested in learning more about crystalline silica, a list of selected readings and other resources is included. The detailed glossary, which defines many terms that are beyond the scope of this publication, is designed to help the reader move from this presentation to a more technical one, the inevitable next step.

  17. Physicochemical determinants in the cellular responses to nanostructured amorphous silicas.

    PubMed

    Gazzano, Elena; Ghiazza, Mara; Polimeni, Manuela; Bolis, Vera; Fenoglio, Ivana; Attanasio, Angelo; Mazzucco, Gianna; Fubini, Bice; Ghigo, Dario

    2012-07-01

    Amorphous silicas, opposite to crystalline polymorphs, have been regarded so far as nonpathogenic, but few studies have addressed the toxicity of the wide array of amorphous silica forms. With the advent of nanotoxicology, there has been a rising concern about the safety of silica nanoparticles to be used in nanomedicine. Here, we report a study on the toxicity of amorphous nanostructured silicas obtained with two different preparation procedures (pyrolysis vs. precipitation), the pyrogenic in two very different particle sizes, in order to assess the role of size and origin on surface properties and on the cell damage, oxidative stress, and inflammatory response elicited in murine alveolar macrophages. A quartz dust was employed as positive control and monodispersed silica spheres as negative control. Pyrogenic silicas were remarkably more active than the precipitated one as to cytotoxicity, reactive oxygen species production, lipid peroxidation, nitric oxide synthesis, and production of tumor necrosis factor-α, when compared both per mass and per unit surface. Between the two pyrogenic silicas, the larger one was the more active. Silanols density is the major difference in surface composition among the three silicas, being much larger than the precipitated one as indicated by joint calorimetric and infrared spectroscopy analysis. We assume here that full hydroxylation of a silica surface, with consequent stable coverage by water molecules, reduces/inhibits toxic behavior. The preparation route appears thus determinant in yielding potentially toxic materials, although the smallest size does not always correspond to an increased toxicity. PMID:22491428

  18. Molecular sieving silica membrane fabrication process

    DOEpatents

    Raman, Narayan K.; Brinker, Charles Jeffrey

    1998-01-01

    A process for producing a molecular sieve silica membrane comprising depositing a hybrid organic-inorganic polymer comprising at least one organic constituent and at least one inorganic constituent on a porous substrate material and removing at least a portion of the at least one organic constituent of the hybrid organic-inorganic polymer, forming a porous film.

  19. Molecular sieving silica membrane fabrication process

    DOEpatents

    Raman, Narayan K.; Brinker, Charles Jeffrey

    1999-01-01

    A process for producing a molecular sieve silica membrane comprising depositing a hybrid organic-inorganic polymer comprising at least one organic constituent and at least one inorganic constituent on a porous substrate material and removing at least a portion of the at least one organic constituent of the hybrid organic-inorganic polymer, forming a porous film.

  20. Molecular sieving silica membrane fabrication process

    DOEpatents

    Raman, N.K.; Brinker, C.J.

    1999-08-10

    A process is described for producing a molecular sieve silica membrane comprising depositing a hybrid organic-inorganic polymer comprising at least one organic constituent and at least one inorganic constituent on a porous substrate material and removing at least a portion of the at least one organic constituent of the hybrid organic-inorganic polymer, forming a porous film. 11 figs.

  1. Nanopatterned protein microrings from a diatom that direct silica morphogenesis.

    PubMed

    Scheffel, André; Poulsen, Nicole; Shian, Samuel; Kröger, Nils

    2011-02-22

    Diatoms are eukaryotic microalgae that produce species-specifically structured cell walls made of SiO(2) (silica). Formation of the intricate silica structures of diatoms is regarded as a paradigm for biomolecule-controlled self-assembly of three-dimensional, nano- to microscale-patterned inorganic materials. Silica formation involves long-chain polyamines and phosphoproteins (silaffins and silacidins), which are readily soluble in water, and spontaneously form dynamic supramolecular assemblies that accelerate silica deposition and influence silica morphogenesis in vitro. However, synthesis of diatom-like silica structure in vitro has not yet been accomplished, indicating that additional components are required. Here we describe the discovery and intracellular location of six novel proteins (cingulins) that are integral components of a silica-forming organic matrix (microrings) in the diatom Thalassiosira pseudonana. The cingulin-containing microrings are specifically associated with girdle bands, which constitute a substantial part of diatom biosilica. Remarkably, the microrings exhibit protein-based nanopatterns that closely resemble characteristic features of the girdle band silica nanopatterns. Upon the addition of silicic acid the microrings become rapidly mineralized in vitro generating nanopatterned silica replicas of the microring structures. A silica-forming organic matrix with characteristic nanopatterns was also discovered in the diatom Coscinodiscus wailesii, which suggests that preassembled protein-based templates might be general components of the cellular machinery for silica morphogenesis in diatoms. These data provide fundamentally new insight into the molecular mechanisms of biological silica morphogenesis, and may lead to the development of self-assembled 3D mineral forming protein scaffolds with designed nanopatterns for a host of applications in nanotechnology. PMID:21300899

  2. Structural changes in precipitated silica induced by external forces

    NASA Astrophysics Data System (ADS)

    Schneider, Gerald Johannes; Göritz, Dietmar

    2010-04-01

    The morphology of pure precipitated silica, silica filled in polydimethylsiloxane rubber, and silica filled in styrene butadiene rubber was studied by means of small-angle X-ray scattering experiments. The silica at a length scale of a few nanometers consists of primary particles, which form aggregates, and clusters with aggregates as basic units. It is evidenced that the aggregate branching, represented by the mass fractal dimension, and the aggregate diameter are different if pure silica and silica in rubber are compared. Contrary, the size of the primary particles and their surface are not influenced. It is demonstrated that the change in the aggregate morphology is due to the external mechanical forces appearing during the mixing process. This is achieved by model experiments using a pistil and a mortar and a composite with different silica fractions. By that means, a systematic change in the morphology with grinding time is observed. Then, the experiments on the composite demonstrate that the major contributions to the mass fractal dimensions are due to the external mechanical forces. In order to test reproducibility and universal validity in the case of precipitated silicas, independent experiments on one silica and further silicas are performed. Several important conclusions are obtained from the study. First, it is shown that a comparison of different pure silica samples without knowing their history may be difficult or questionable. Second, it becomes evident that it is not sufficient to provide only a description of the materials, rather than the details of the sample treatment have to be reported. Therefore, solely the characterization of the morphology of the pure silica is not sufficient to be compared to the mechanical properties of the composites.

  3. Silica-metal core-shell nanostructures.

    PubMed

    Jankiewicz, B J; Jamiola, D; Choma, J; Jaroniec, M

    2012-01-15

    Silica-metal nanostructures consisting of silica cores and metal nanoshells attract a lot of attention because of their unique properties and potential applications ranging from catalysis and biosensing to optical devices and medicine. The important feature of these nanostructures is the possibility of controlling their properties by the variation of their geometry, shell morphology and shell material. This review is devoted to silica-noble metal core-shell nanostructures; specifically, it outlines the main methods used for the preparation and surface modification of silica particles and presents the major strategies for the formation of metal nanoshells on the modified silica particles. A special emphasis is given to the Stöber method, which is relatively simple, effective and well verified for the synthesis of large and highly uniform silica particles (with diameters from 100 nm to a few microns). Next, the surface chemistry of these particles is discussed with a special focus on the attachment of specific organic groups such as aminopropyl or mercaptopropyl groups, which interact strongly with metal species. Finally, the synthesis, characterization and application of various silica-metal core-shell nanostructures are reviewed, especially in relation to the siliceous cores with gold or silver nanoshells. Nowadays, gold is most often used metal for the formation of nanoshells due to its beneficial properties for many applications. However, other metals such as silver, platinum, palladium, nickel and copper were also used for fabrication of core-shell nanostructures. Silica-metal nanostructures can be prepared using various methods, for instance, (i) growth of metal nanoshells on the siliceous cores with deposited metal nanoparticles, (ii) reduction of metal species accompanied by precipitation of metal nanoparticles on the modified silica cores, and (iii) formation of metal nanoshells under ultrasonic conditions. A special emphasis is given to the seed

  4. Silica, silicosis and cancer in Finland.

    PubMed

    Partanen, T; Jaakkola, J; Tossavainen, A

    1995-01-01

    Approximately 100 000 Finnish workers are currently employed in jobs and tasks that may involve exposure to airborne silica dust. The major industries involved are mining and quarrying; production of glass, ceramics, bricks and other building materials; metal industry, particularly iron and steel founding; and construction. Over 1500 cases of silicosis have occurred in Finland since 1935. Tuberculosis has been a frequent complication of silicosis. Results of studies from several countries strongly suggest that silica dust also causes lung cancer. The results of the relevant Finnish epidemiologic and industrial hygiene studies addressing cancer risk and exposure to quartz dust are summarized. PMID:8929699

  5. Water-soluble metal-binding polymers with ultrafiltration: A technology for the removal, concentration, and recovery of metal ions from aqueous streams

    SciTech Connect

    Smith, B.F.; Robison, T.W.; Jarvinen, G.D.

    1997-12-31

    The use of water-soluble metal-binding polymers coupled with ultrafiltration (UF) is a technology under development to selectively concentrate and recover valuable or regulated metal-ions from dilute process or waste waters. The polymers have a sufficiently large molecular size that they can be separated and concentrated using commercially available UF technology. The polymers can then be reused by changing the solution conditions to release the metal-ions, which are recovered in a concentrated form for recycle or disposal. Pilot-scale demonstrations have been completed for a variety of waste streams containing low concentrations of metal ions including electroplating wastes (zinc and nickel) and nuclear waste streams (plutonium and americium). Many other potential commercial applications exist including remediation of contaminated solids. An overview of both the pilot-scale demonstrated applications and small scale testing of this technology are presented.

  6. Spectroscopic characterization of the metal-binding sites in the periplasmic metal-sensor domain of CnrX from Cupriavidus metallidurans CH34.

    PubMed

    Trepreau, Juliette; de Rosny, Eve; Duboc, Carole; Sarret, Géraldine; Petit-Hartlein, Isabelle; Maillard, Antoine P; Imberty, Anne; Proux, Olivier; Covès, Jacques

    2011-10-25

    CnrX, the dimeric metal sensor of the three-protein transmembrane signal transduction complex CnrYXH of Cupriavidus metallidurans CH34, contains one metal-binding site per monomer. Both Ni and Co elicit a biological response and bind the protein in a 3N2O1S coordination sphere with a nearly identical octahedral geometry as shown by the X-ray structure of CnrXs, the soluble domain of CnrX. However, in solution CnrXs is titrated by 4 Co-equiv and exhibits an unexpected intense band at 384 nm that was detected neither by single-crystal spectroscopy nor under anaerobiosis. The data from a combination of spectroscopic techniques (spectrophotometry, electron paramagnetic resonance, X-ray absorption spectroscopy) showed that two sites correspond to those identified by crystallography. The two extra binding sites accommodate Co(II) in an octahedral geometry in the absence of oxygen and are occupied in air by a mixture of low-spin Co(II) as well as EPR-silent Co(III). These extra sites, located at the N-terminus of the protein, are believed to participate to the formation of peroxo-bridged dimers. Accordingly, we hypothesize that the intense band at 384 nm relies on the formation of a binuclear μ-peroxo Co(III) complex. These metal binding sites are not physiologically relevant since they are not detected in full-length NccX, the closest homologue of CnrX. X-ray absorption spectroscopy demonstrates that NccX stabilizes Co(II) in two-binding sites similar to those characterized by crystallography in its soluble counterpart. Nevertheless, the original spectroscopic properties of the extra Co-binding sites are of interest because they are susceptible to be detected in other Co-bound proteins. PMID:21942751

  7. Metal-binding properties and structural characterization of a self-assembled coiled coil: formation of a polynuclear Cd-thiolate cluster.

    PubMed

    Zaytsev, Daniil V; Morozov, Vasily A; Fan, Jiufeng; Zhu, Xianchun; Mukherjee, Madhumita; Ni, Shuisong; Kennedy, Michael A; Ogawa, Michael Y

    2013-02-01

    This paper describes the design, characterization, and metal-binding properties of a 32-residue polypeptide called AQ-C16C19. The sequence of this peptide is composed of four repeats of the seven residue sequence Ile-Ala-Ala-Leu-Glu-Gln-Lys but with a Cys-X-X-Cys metal-binding motif substituted at positions 16-19. Size exclusion chromatography with multiangle light scattering detection (SEC-MALS) and circular dichroism (CD) spectroscopy studies showed that the apo peptide exhibits a pH-dependent oligomerization state in which a three-stranded α-helical coiled coil is dominant between pH5.4 and 8.5. The Cd(2+)-binding properties of the AQ-C16C19 peptide were studied by ultraviolet-visible spectroscopy (UV-vis), electrospray ionization mass spectrometry (ESI MS), and (113)Cd NMR techniques. The holoprotein was found to contain a polynuclear cadmium-thiolate center formed within the hydrophobic core of the triple-stranded α-helical coiled-coil structure. The X-ray crystal structure of the Cd-loaded peptide, resolved at 1.85Å resolution, revealed an adamantane-like configuration of the polynuclear metal center consisting of four cadmium ions, six thiolate sulfur ligands from cysteine residues and four oxygen-donor ligands. Three of these are from glutamic acid residues and one is from an exogenous water molecule. Thus, each cadmium ion is coordinated in a distorted tetrahedral S(3)O geometry. The metal cluster was found to form cooperatively at pH5.4 but in a stepwise fashion at pH>7. The results demonstrate that synthetic coiled-coils can be designed to incorporate multinuclear metal clusters, a proof-of-concept for their potential use in developing synthetic metalloenzymes and multi-electron redox agents. PMID:23160144

  8. High resolution patterning of silica aerogels

    SciTech Connect

    Bertino, M.F.; Hund, J.F.; Sosa, J.; Zhang, G.; Sotiriou-Leventis, C.; Leventis, N.; Tokuhiro, A.T.; Terry, J.

    2008-10-30

    Three-dimensional metallic structures are fabricated with high spatial resolution in silica aerogels. In our method, silica hydrogels are prepared with a standard base-catalyzed route, and exchanged with an aqueous solution typically containing Ag{sup +} ions (1 M) and 2-propanol (0.2 M). The metal ions are reduced photolytically with a table-top ultraviolet lamp, or radiolytically, with a focused X-ray beam. We fabricated dots and lines as small as 30 x 70 {micro}m, protruding for several mm into the bulk of the materials. The hydrogels are eventually supercritically dried to yield aerogels, without any measurable change in the shape and spatial resolution of the lithographed structures. Transmission electron microscopy shows that illuminated regions are composed by Ag clusters with a size of several {micro}m, separated by thin layers of silica.

  9. Developing a Process for Commercial Silica Production from Geothermal Brines

    SciTech Connect

    Bourcier, W; Martin, S; Viani, B; Bruton, C

    2001-04-11

    Useful mineral by-products can be produced from geothermal brines. Although silica has many commercial uses, problems remain in producing a marketable product. We are conducting laboratory and modeling studies aimed at optimizing for rubber additive use, the properties of silica precipitates from Salton Sea and Coso-like geothermal fluids, Our goal is to develop a robust technique for producing silicas that have desirable physical and chemical properties for commercial use, while developing a generic understanding of silica precipitation that will allow extraction to be extended to additional fluid types, and to be easily modified to produce new types of marketable silica. Our experiments start with an acidified geothermal fluid similar to those treated by pH modification technology. Silica precipitation is induced by adding base and/or adding Mg or Ca salts to affect the nature of the precipitate. For the analog Salton Sea fluids, adding base alone caused silica to precipitate fairly rapidly. To date, we have characterized precipitates from experiments in which the final pH varied from 4 to 8, where NaOH and Na{sub 2}C0{sub 3} were added as bases, and CaCl{sub 2} and MgCl{sub 2} were added as salts. SEM photos of the silica precipitates from the Salton Sea and Cos0 fluids show that the silica particles are clusters of smaller silica particles down to the resolution of the SEM (about 80-100 nm in diameter). The particle sizes and surface areas of silicas from the Salton Sea and Coso analog brines are similar to the properties of the Degussa silica commonly used as a rubber additive. An evaluation of the strength of the silica-organic bond as tested by dispersion in oil (polybutadiene) was inconclusive. Neither the Degussa materials nor our laboratory precipitates dispersed readily in nor dispersed down to the fundamental particle size. Preliminary NMR data indicates that the Degussa silica has a smaller degree of silica polymerization (a slightly smaller average

  10. Carbon nanomaterials in silica aerogel matrices

    SciTech Connect

    Hamilton, Christopher E; Chavez, Manuel E; Duque, Juan G; Gupta, Gautam; Doorn, Stephen K; Dattelbaum, Andrew M; Obrey, Kimberly A D

    2010-01-01

    Silica aerogels are ultra low-density, high surface area materials that are extremely good thermal insulators and have numerous technical applications. However, their mechanical properties are not ideal, as they are brittle and prone to shattering. Conversely, single-walled carbon nanotubes (SWCNTs) and graphene-based materials, such as graphene oxide, have extremely high tensile strength and possess novel electronic properties. By introducing SWCNTs or graphene-based materials into aerogel matrices, it is possible to produce composites with the desirable properties of both constituents. We have successfully dispersed SWCNTs and graphene-based materials into silica gels. Subsequent supercritical drying results in monolithic low-density composites having improved mechanical properties. These nanocomposite aerogels have great potential for use in a wide range of applications.

  11. Composite Silica Aerogels Opacified with Titania

    NASA Technical Reports Server (NTRS)

    Paik, Jon-Ah; Sakamoto, Jeffrey; Jones, Steven; Fleurial, Jean-Pierre; DiStefano, Salvador; Nesmith, Bill

    2009-01-01

    A further improvement has been made to reduce the high-temperature thermal conductivities of the aerogel-matrix composite materials described in Improved Silica Aerogel Composite Materials (NPO-44287), NASA Tech Briefs, Vol. 32, No. 9 (September 2008), page 50. Because the contribution of infrared radiation to heat transfer increases sharply with temperature, the effective high-temperature thermal conductivity of a thermal-insulation material can be reduced by opacifying the material to reduce the radiative contribution. Therefore, the essence of the present improvement is to add an opacifying constituent material (specifically, TiO2 powder) to the aerogel-matrix composites.

  12. Kinetics of silica polymerization

    SciTech Connect

    Weres, O.; Yee, A.; Tsao, L.

    1980-05-01

    The polymerization of silicic acid in geothermal brine-like aqueous solutions to produce amorphous silica in colloidal form has been studied experimentally and theoretically. A large amount of high quality experimental data has been generated over the temperature rang 23 to 100{sup 0}C. Wide ranges of dissolved silica concentration, pH, and sodium chloride concentration were covered. The catalytic effects of fluoride and the reaction inhibiting effects of aluminum and boron were studied also. Two basic processes have been separately studied: the formation of new colloidal particles by the homogeneous nucleation process and the deposition of dissolved silica on pre-existing colloidal particles. A rigorous theory of the formation of colloidal particles of amorphous silica by homogeneous nucleation was developed. This theory employs the Lothe-Pound formalism, and is embodied in the computer code SILNUC which quantitatively models the homogeneous nucleation and growth of colloidal silica particles in more than enough detail for practical application. The theory and code were extensively used in planning the experimental work and analyzing the data produced. The code is now complete and running in its final form. It is capable of reproducing most of the experimental results to within experimental error. It is also capable of extrapolation to experimentally inaccessible conditions, i.e., high temperatures, rapidly varying temperature and pH, etc.

  13. Silica Synthesis by Sponges: Unanticipated Molecular Mechanism

    NASA Astrophysics Data System (ADS)

    Morse, D. E.; Weaver, J. C.

    2001-12-01

    Oceanic diatoms, sponges and other organisms synthesize gigatons per year of silica from silicic acid, ultimately obtained from the weathering of rock. This biogenic silica exhibits a remarkable diversity of structures, many of which reveal a precision of nanoarchitectural control that exceeds the capabilities of human engineering. In contrast to the conditions of anthropogenic and industrial manufacture, the biological synthesis of silica occurs under mild physiological conditions of low temperatures and pressures and near-neutral pH. In addition to the differentiation between biological and abiotic processes governing silica formation, the biomolecular mechanisms controlling synthesis of these materials may offer insights for the development of new, environmentally benign routes for synthesis of nanostructurally controlled silicas and high-performance polysiloxane composites. We found that the needle-like silica spicules made by the marine sponge, Tethya aurantia, each contain an occluded axial filament of protein composed predominantly of repeating assemblies of three similar subunits we named "silicateins." To our surprise, analysis of the purified protein subunits and the cloned silicatein DNAs revealed that the silicateins are highly homologous to a family of hydrolytic enzymes. As predicted from this finding, we discovered that the silicatein filaments are more than simple, passive templates; they actively catalyze and spatially direct polycondensation to form silica, (as well as the phenyl- and methyl-silsesquioxane) from the corresponding silicon alkoxides at neutral pH and low temperature. Catalytic activity also is exhibited by the silicatein subunits obtained by disaggregation of the protein filaments and those produced from recombinant DNA templates cloned in bacteria. This catalytic activity accelerates the rate-limiting hydrolysis of the silicon alkoxide precursors. Genetic engineering, used to produce variants of the silicatein molecule with

  14. Silica in alkaline brines

    USGS Publications Warehouse

    Jones, B.F.; Rettig, S.L.; Eugster, H.P.

    1967-01-01

    Analysis of sodium carbonate-bicarbonate brines from closed basins in volcanic terranes of Oregon and Kenya reveals silica contents of up to 2700 parts per million at pH's higher than 10. These high concentrations of SiO 2 can be attributed to reaction of waters with silicates, and subsequent evaporative concentration accompanied by a rise in pH. Supersaturation with respect to amorphous silica may occur and persist for brines that are out of contact with silicate muds and undersaturated with respect to trona; correlation of SiO2 with concentration of Na and total CO2 support this interpretation. Addition of moredilute waters to alkaline brines may lower the pH and cause inorganic precipitation of substantial amounts of silica.

  15. Silica Precipitation and Lithium Sorption

    SciTech Connect

    Jay Renew

    2015-09-20

    This file contains silica precipitation and lithium sorption data from the project. The silica removal data is corrected from the previous submission. The previous submission did not take into account the limit of detection of the ICP-MS procedure.

  16. Design of a full-silica pulse-compression grating.

    PubMed

    Bonod, Nicolas; Neauport, Jérôme

    2008-03-01

    A diffraction grating engraved on a two-dimensional photonic crystal composed of square air holes in a silica matrix is numerically studied for the compression of ultrashort pulses. The silica is therefore the only solid material of the grating, and the reflection of the incident beam is based on the contrast of the air and silica refractive indices. This optical component enables the single use of silica as a solid material, presenting a high laser-induced damage threshold. In comparison to gratings engraved on a dielectric stack, multilayer dielectric, it offers the advantage of avoiding the presence of interfaces between two solid materials with different mechanical properties and sources of mechanical constraints that can distort the grating. PMID:18311291

  17. Facile Fabrication of Ultrafine Hollow Silica and Magnetic Hollow Silica Nanoparticles by a Dual-Templating Approach

    NASA Astrophysics Data System (ADS)

    Wu, Wei; Xiao, Xiangheng; Zhang, Shaofeng; Fan, Lixia; Peng, Tangchao; Ren, Feng; Jiang, Changzhong

    2010-01-01

    The development of synthetic process for hollow silica materials is an issue of considerable topical interest. While a number of chemical routes are available and are extensively used, the diameter of hollow silica often large than 50 nm. Here, we report on a facial route to synthesis ultrafine hollow silica nanoparticles (the diameter of ca. 24 nm) with high surface area by using cetyltrimethylammmonium bromide (CTAB) and sodium bis(2-ethylhexyl) sulfosuccinate (AOT) as co-templates and subsequent annealing treatment. When the hollow magnetite nanoparticles were introduced into the reaction, the ultrafine magnetic hollow silica nanoparticles with the diameter of ca. 32 nm were obtained correspondingly. Transmission electron microscopy studies confirm that the nanoparticles are composed of amorphous silica and that the majority of them are hollow.

  18. A solubility model for amorphous silica in concentrated electrolytes

    SciTech Connect

    Felmy, A.R.; Schroeder, C.C.; Mason, M.J.

    1994-08-01

    Silica is one of the major constituents of the earth`s crust and is ubiquitously present in most natural materials. The solubility of silica and other silica-containing compounds is, therefore, of primary concern in geochemistry and in chemical processing applications where silica scale formation, resulting from changes in temperature and electrolyte composition, can cause problems in process design and operation. This paper describes the development of an aqueous thermodynamic model for accurately predicting the solubility of amorphous silica and other silica-containing compounds in the system Na{sup +}-H{sup +}-Mg{sup 2+}-NO{sub 3}{sup {minus}}-SO{sub 4}{sup 2{minus}}-Cl{sup {minus}}-H{sub 2}O to high concentration and across the temperature range 25--100 C. This model, which utilizes the aqueous thermodynamic model of Pitzer, includes only one dissolved silica species, H{sub 4}SiO{sub 4}(aq), and is valid in neutral to very acidic solutions. The model is parameterized from the extensive set of solubility data in the literature as well as from new experimental data on amorphous silica solubility in HNO{sub 3} and HCl developed as part of this study. The accuracy of the model is tested on solutions more complex than those used in model parameterization.

  19. Epoxy Grout With Silica Thickener

    NASA Technical Reports Server (NTRS)

    Mcclung, C. E.

    1984-01-01

    Grout cures quickly, even in presence of hydraulic oil. Grout is mixture of aggregate particles, finely-divided silica, epoxy resin, and triethylenetetramine curing agent, with mixture containing about 85 percent silica and aggregate particle sand 15 percent resin and curing agent. Silica is thickening agent and keeps grout from sagging.

  20. Fluid diffusion in porous silica

    NASA Astrophysics Data System (ADS)

    McCann, Lowell I.

    Fluid motion in porous media has received a great deal of theoretical and experimental attention due to its importance in systems as diverse as ground water aquifers, catalytic processes, and size separation schemes. Often, the motion of interest is the random thermal motion of molecules in a fluid undergoing no net flow. This diffusive motion is particularly important when the size of the pores is nearly the same as the size of the molecules. In this study, fluid diffusion is measured in several varieties of porous silica whose pore structure is determined by the process by which it is made. The samples in this study have porosities (φ, the ratio of the pore volume to the total sample volume) that vary from 0.3 to 0.75 and average pore radii that range from approximately 15 to 120 A. Determining the effect of the pore structure on the diffusion of a liquid in a porous material is complicated by the chemical interactions between the diffusing molecules and the pore surface. In this study, ions in a hydrophilic fluid are used to block the adsorption of the diffusing dye molecules to the hydroxyl groups covering the silica surface. This technique is unlike typical surface treatments of silica in that it does not permanently alter the pore geometry. In this work, fluid diffusion is measured with a transient holographic grating technique where interfering laser beams create a periodic refractive index modulation in the fluid. The diffraction of a third laser off this grating is monitored to determine how quickly the grating relaxes, thereby determining the diffusion coefficient of the molecules in the fluid. Varying the grating periodicity controls the length scale of the diffusion measurement from 1.2 to 100 μm which is much larger than the average pore sizes of the samples. Therefore, over these large scales, we measure 'normal' diffusion, where the mean squared displacement of a diffusing particle varies linearly with time. In one particular type of porous silica

  1. Incorporation of antimicrobial compounds in mesoporous silica film monolith.

    PubMed

    Izquierdo-Barba, Isabel; Vallet-Regí, María; Kupferschmidt, Natalia; Terasaki, Osamu; Schmidtchen, Artur; Malmsten, Martin

    2009-10-01

    Incorporation of the antimicrobial peptide LL-37 (LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES), as well as low molecular weight antimicrobial chlorhexidine, into mesoporous silica was obtained using an EISA one-pot synthesis method. FTIR confirmed efficient encapsulation of both LL-37 and chlorhexidine into mesoporous silica, while XRD and TEM showed that antimicrobial agent incorporation can be achieved without greatly affecting the structure of the mesoporous silica. The modified mesoporous silica released LL-37 and chlorhexidine slowly, reaching maximum release after about 200 h. The release rate could also be controlled through incorporation of SH groups in the pore walls, adding to pore hydrophobicity and reducing the release rate by about 50% compared to the unmodified mesoporous silica. Mesoporous silica containing either LL-37 or chlorhexidine displayed potent bactericidal properties against both Gram-positive Staphylococcus aureus and Gram-negative Escherichia coli. While chlorhexidine-loaded mesoporous silica displayed an accompanying high toxicity, as judged from hemolysis, LDH release, and MTT assay, the corresponding material containing LL-37 showed very low toxicity by all these assays, comparable to that observed for mesoporous silica in the absence of antibacterial drug, as well as to the negative controls in the respective assays. Mesoporous silica containing LL-37 therefore holds potential as an implantable material or a surface coating for such materials, as it combines potent bactericidal action with low toxicity, important features for controlling implant-related infections, e.g., for multi-resistant pathogens or for cases where access to the infection site of systemically administered antibiotics is limited due to collagen capsule formation or other factors. PMID:19628277

  2. Fast determination of Ziziphora tenuior L. essential oil by inorganic-organic hybrid material based on ZnO nanoparticles anchored to a composite made from polythiophene and hexagonally ordered silica.

    PubMed

    Piryaei, Marzieh; Abolghasemi, Mir Mahdi; Nazemiyeh, Hossein

    2015-01-01

    In this paper, for the first time, an inorganic-organic hybrid material based on ZnO nanoparticles was anchored to a composite made from polythiophene and hexagonally ordered silica (ZnO/PT/SBA-15) for use in solid-phase fibre microextraction (SPME) of medicinal plants. A homemade SPME apparatus was used for the extraction of volatile components of Ziziphora tenuior L. A simplex method was used for optimisation of five different parameters affecting the efficiency of the extraction. The main constituents extracted by ZnO/PT/SBA-15 and PDMS fibres and hydrodistillation (HD) methods, respectively, included pulegone (51.25%, 53.64% and 56.68%), limonene (6.73%, 6.58% and 8.3%), caryophyllene oxide (5.33%, 4.31% and 4.53%) and 1,8-cineole (4.21%, 3.31% and 3.18%). In comparison with the HD method, the proposed technique could equally monitor almost all the components of the sample, in an easier way, in a shorter time and requiring a much lower amount of the sample. PMID:25496469

  3. Industrial hygiene sampling and applications to ambient silica monitoring.

    PubMed

    Hearl, F J

    1997-01-01

    Interest in ambient exposures to silica has prompted an evaluation of the applicability of the industrial hygiene sampling and analysis experience. Exposure to excessive levels of silica in the workplace has long been recognized as a risk factor for the development of a variety of disabling and sometimes fatal lung diseases. Initial efforts to control occupational exposure to dust were based on reducing exposures as measured by particle-counting techniques. Because silicosis, the disease resulting from exposure to silica, occurs in the lower airways, which can be reached only by small "respirable dust" particles, size selective sampling procedures were introduced for dust monitoring. The analysis of silica in collected dust samples also has undergone development. Initial methods used involved acid digestion of soluble silicates, with subsequent chemical analysis of the insoluble "free silica" fraction. Current methodology relies on the use of X-ray diffraction and infrared technologies to quantify these materials. However, these methods are sensitive to the particle size distribution of the samples. Standard reference materials (SRMs) have been developed for use with respirable size dust samples. Ambient particulate matter is now measured using the U.S. Environmental Protection Agency sampling methods for particulate matter < or = 10 microns, which approximate the collection efficiency for thoracic fraction samplers. Because the existing calibration SRMs were produced for the measurement of occupational crystalline silica, the need to develop appropriate standards and methods for ambient silica measurements should be evaluated. PMID:9246591

  4. N-terminal region of CusB is sufficient for metal binding and metal transfer with the metallochaperone CusF.

    PubMed

    Mealman, Tiffany D; Zhou, Mowei; Affandi, Trisiani; Chacón, Kelly N; Aranguren, Mariana E; Blackburn, Ninian J; Wysocki, Vicki H; McEvoy, Megan M

    2012-08-28

    Gram-negative bacteria, such as Escherichia coli, utilize efflux resistance systems in order to expel toxins from their cells. Heavy-metal resistance is mediated by resistance nodulation cell division (RND)-based efflux pumps composed of a tripartite complex that includes an RND-transporter, an outer-membrane factor (OMF), and a membrane fusion protein (MFP) that spans the periplasmic space. MFPs are necessary for complex assembly and have been hypothesized to play an active role in substrate efflux. Crystal structures of MFPs are available, however incomplete, as large portions of the apparently disordered N- and C-termini are unresolved. Such is the case for CusB, the MFP of the E. coli Cu(I)/Ag(I) efflux pump CusCFBA. In this work, we have investigated the structure and function of the N-terminal region of CusB, which includes the metal-binding site and is missing from previously determined crystal structures. Results from mass spectrometry and X-ray absorption spectroscopy show that the isolated N-terminal 61 residues (CusB-NT) bind metal in a 1:1 stoichiometry with a coordination site composed of M21, M36, and M38, consistent with full-length CusB. NMR spectra show that CusB-NT is mostly disordered in the apo state; however, some slight structure is adopted upon metal binding. Much of the intact protein's function is maintained in this fragment as CusB-NT binds metal in vivo and in vitro, and metal is transferred between the metallochaperone CusF and CusB-NT in vitro. Functional analysis in vivo shows that full-length CusB is necessary in an intact polypeptide for full metal resistance, though CusB-NT alone can contribute partial metal resistance. These findings reinforce the theory that the role of CusB is not only to bind metal but also to play an active role in efflux. PMID:22812620

  5. The N-terminal region of CusB is sufficient for metal binding and metal transfer with the metallochaperone CusF

    PubMed Central

    Mealman, Tiffany D.; Zhou, Mowei; Affandi, Trisiani; Chacón, Kelly N.; Aranguren, Mariana E.; Blackburn, Ninian J.; Wysocki, Vicki H.; McEvoy, Megan M.

    2012-01-01

    Gram-negative bacteria, such as Escherichia coli, utilize efflux resistance systems in order to expel toxins from their cells. Heavy-metal resistance is mediated by resistance nodulation cell division (RND)-based efflux pumps composed of a tripartite complex that includes an RND-transporter, an outer-membrane factor (OMF), and a membrane fusion protein (MFP) that spans the periplasmic space. MFPs are necessary for complex assembly and have been hypothesized to play an active role in substrate efflux. Crystal structures of MFPs are available, however incomplete, as large portions of the apparently disordered N and C termini are unresolved. Such is the case for CusB, the MFP of the E. coli Cu(I)/Ag(I) efflux pump, CusCFBA. In this work, we have investigated the structure and function of the N-terminal region of CusB, which includes the metal-binding site and is missing from previously determined crystal structures. Results from mass spectrometry and X-ray absorption spectroscopy show that the isolated N-terminal 61 residues (CusB-NT) bind metal in a 1:1 stoichiometry with a coordination site composed of M21, M36, and M38, consistent with full-length CusB. NMR spectra show that CusB-NT is mostly disordered in the apo state; however, some slight structure is adopted upon metal binding. Much of the intact protein’s function is maintained in this fragment as CusB-NT binds metal in vivo and in vitro, and metal is transferred between the metallochaperone CusF and CusB-NT in vitro. Functional analysis in vivo shows that full-length CusB is necessary in an intact polypeptide for full metal resistance, though CusB-NT alone can contribute partial metal resistance. These findings reinforce the theory that the role of CusB is not only to bind metal, but also to play an active role in efflux. PMID:22812620

  6. Distributions of noble metal Pd and Pt in mesoporous silica

    NASA Astrophysics Data System (ADS)

    Arbiol, J.; Cabot, A.; Morante, J. R.; Chen, Fanglin; Liu, Meilin

    2002-10-01

    Mesoporous silica nanostructures have been synthesized and loaded with Pd and Pt catalytic noble metals. It is found that Pd forms small nanoclusters (3-5 nm) on the surface of the mesoporous structure whereas Pt impregnation results in the inclusion of Pt nanostructures within the silica hexagonal pores (from nanoclusters to nanowires). It is observed that these materials have high catalytic properties for CO-CH4 combustion, even in a thick film form. In particular, results indicate that the Pt and Pd dispersed in mesoporous silica are catalytically active as a selective filter for gas sensors.

  7. Cellulose-silica/gold nanomaterials for electronic applications.

    PubMed

    Kim, Gwang-Hoon; Ramesh, Sivalingam; Kim, Joo-Hyung; Jung, Dongsoo; Kim, Heung Soo

    2014-10-01

    Cellulose and one dimensional nano-material composite has been investigated for various industrial applications due to their optical, mechanical and electrical properties. In present investigation, cellulose/silica and silica-gold hybrid biomaterials were prepared by sol-gel covalent cross-linking process. The tetraethoxysiliane (TEOS) and gold precursors and γ-aminopropyltriethoxysilane (γ-APTES) as coupling agent were used for sol-gel cross-linking process. The chemical and morphological properties of cellulose/silica and cellulose/silica-gold nano-materials via covalent cross-linking hybrids were confirmed by FTIR, XRD, SEM, and TEM analysis. In the sol-gel process, the inorganic particles were dispersed in the cellulose host matrix at the nanometer scale, bonding to the cellulose through the covalent bonds. PMID:25942815

  8. Mesostructured silica and aluminosilicate carriers for oxytetracycline delivery systems.

    PubMed

    Berger, D; Nastase, S; Mitran, R A; Petrescu, M; Vasile, E; Matei, C; Negreanu-Pirjol, T

    2016-08-30

    Oxytetracycline delivery systems containing various MCM-type silica and aluminosilicate with different antibiotic content were developed in order to establish the influence of the support structural and textural properties and aluminum content on the drug release profile. The antibiotic molecules were loaded into the support mesochannels by incipient wetness impregnation method using a drug concentrated aqueous solution. The carriers and drug-loaded materials were investigated by small- and wide-angle XRD, FTIR spectroscopy, TEM and N2 adsorption-desorption isotherms. Faster release kinetics of oxytetracycline from uncalcined silica and aluminosilicate supports was observed, whereas higher drug content led to lower delivery rate. The presence of aluminum into the silica network also slowed down the release rate. The antimicrobial assays performed on Staphylococcus aureus clinical isolates showed that the oxytetracycline-loaded materials containing MCM-41-type mesoporous silica or aluminosilicate carriers inhibited the bacterial development. PMID:26861688

  9. A study of the metal binding capacity of saccharinic acids formed during the alkali catalysed decomposition of cellulosic materials: nickel complexation by glucoisosaccharinic acids and xyloisosaccharinic acids.

    PubMed

    Almond, Michael; Belton, Daniel; Humphreys, Paul N; Laws, Andrew P

    2016-06-01

    The stoichiometry of the metal complexes formed between nickel and the ligand β-glucoisosaccharinic acid (β-GISA) and a racemic mixture of enantiomers of xyloisosaccharinic acid (XISA) has been determined at both neutral and alkaline pHs. Bjerrum plots, Job's plots and conductance measurements indicated that for each of the systems one to one Ni(ligand) complexes were formed at near neutral pHs (<7.5). At intermediate alkaline pHs (7.5-13) there is evidence to support the formation and precipitation of Ni2(ligand)(OH)3 complexes, finally, at high pH (>13) sparingly soluble Ni2(ligand)(OH)4 complexes were formed. The stability constants for the Ni(β-GISA), Ni(α-GISA) and Ni(XISA) complexes formed at neutral pH were determined under identical conditions using polarographic studies. The measured stability constants for Ni(β-GISA) (log10 β = 1.94 ± 0.15) and for Ni(α-GISA)(log10 β = 2.07 ± 0.13) are very similar; the value measured for the Ni(XISA) complex (log10 β = 0.83) was an order of magnitude smaller. The stability constants for the Ni2(Ligand)(OH)4 complexes formed at highly alkaline pHs were determined using the Schubert method. The measured stability constant for Ni2(β-GISA)(OH)4 (log10 β = 30.6 ± 0.5) was an order of magnitude bigger than the value for Ni2(α-GISA)(OH)4 (log10 β = 29.0 ± 0.5) measured under identical conditions. Attempts to measure the stability constant for Ni2(XISA)(OH)4 were unsuccessful; Ni2(XISA)(OH)4 complexes were not present in significant amounts at high pH to allow the log10β value to be determined by the Schubert method. PMID:27107221

  10. Silica-Fayalite-bearing Chondrules in Ordinary Chondrites: Evidence of Oxidation in the Solar Nebula

    NASA Astrophysics Data System (ADS)

    Krot, A. N.; Wasson, J. T.

    1993-07-01

    above; the principal difference between them is the presence of fayalite-forming veins within or rims around the silica grains. The continuum between these chondrule categories implies that they are genetically related: We infer that the fayalite veins and rims formed by nebular alteration of the silica grains. Fayalite forms veins along the silica grain boundaries in granular silica-fayalite-bearing chondrules. Fragments of granular silica chondrules occur as relict clasts within two pyroxene chondrules in Sharps. These fragments were altered after chondrule solidification. Conclusions: (1) Silica-bearing chondrules have similar textures to common mafic silicate chondrules and were formed by melting silica-rich precursor material that possibly formed by nonequilibrium condensation. (2) The higher abundance of silica-bearing chondrules in H than in L and LL chondrites may indicate a greater degree of silica condensation in the H-formation region. (3) Silica-fayalite-bearing chondrules formed by alteration of silica-bearing chondrules. The common occurrence of both categories within the same chondrite suggests that oxidation and fayalite formation by nebular gas was an inefficient process.

  11. Micron-size metal-binding hydrogel particles improve germination and radicle elongation of Australian metallophyte grasses in mine waste rock and tailings.

    PubMed

    Guterres, J; Rossato, L; Pudmenzky, A; Doley, D; Whittaker, M; Schmidt, S

    2013-03-15

    Metal contamination of landscapes as a result of mining and other industrial activities is a pervasive problem worldwide. Metal contaminated soils often lack effective vegetation cover and are prone to contaminant leaching and dispersion through erosion, leading to contamination of the environment. Metal-binding hydrogel particle amendments could ameliorate mine wastes prior to planting and enhance seedling emergence. In this study, micron-size thiol functional cross-linked acrylamide polymer hydrogel particles (X3) were synthesised and tested in laboratory-scale experiments on phytotoxic mine wastes to determine their capacity to: (i) increase substrate water holding capacity (WHC); (ii) reduce metal availability to plants to below the phytotoxicity threshold; and (iii) enhance germination characteristics and early radicle development of two Australian metallophyte grasses under limiting and non-limiting water conditions. Addition of X3 to mine wastes significantly increased their WHC and lowered toxic soluble metal concentrations in mine waste leachates. Germination percentages and radicle elongation of both grasses in wastes were significantly increased. Highest germination percentages and greater radicle development recorded in X3 amended wastes under water limited conditions suggests that X3 was able to ameliorate metal toxicity to radicles, and provide moisture, which improved the imbibition and consequent germination of the seeds. PMID:23416872

  12. Interactions between Metal-binding Domains Modulate Intracellular Targeting of Cu(I)-ATPase ATP7B, as Revealed by Nanobody Binding*

    PubMed Central

    Huang, Yiping; Nokhrin, Sergiy; Hassanzadeh-Ghassabeh, Gholamreza; Yu, Corey H.; Yang, Haojun; Barry, Amanda N.; Tonelli, Marco; Markley, John L.; Muyldermans, Serge; Dmitriev, Oleg Y.; Lutsenko, Svetlana

    2014-01-01

    The biologically and clinically important membrane transporters are challenging proteins to study because of their low level of expression, multidomain structure, and complex molecular dynamics that underlies their activity. ATP7B is a copper transporter that traffics between the intracellular compartments in response to copper elevation. The N-terminal domain of ATP7B (N-ATP7B) is involved in binding copper, but the role of this domain in trafficking is controversial. To clarify the role of N-ATP7B, we generated nanobodies that interact with ATP7B in vitro and in cells. In solution NMR studies, nanobodies revealed the spatial organization of N-ATP7B by detecting transient functionally relevant interactions between metal-binding domains 1–3. Modulation of these interactions by nanobodies in cells enhanced relocalization of the endogenous ATP7B toward the plasma membrane linking molecular and cellular dynamics of the transporter. Stimulation of ATP7B trafficking by nanobodies in the absence of elevated copper provides direct evidence for the important role of N-ATP7B structural dynamics in regulation of ATP7B localization in a cell. PMID:25253690

  13. Structural and metal binding characterization of the C-terminal metallochaperone domain of membrane fusion protein SilB from Cupriavidus metallidurans CH34.

    PubMed

    Bersch, Beate; Derfoufi, Kheiro-Mouna; De Angelis, Fabien; Auquier, Vanessa; Ekendé, Elisabeth Ngonlong; Mergeay, Max; Ruysschaert, Jean-Marie; Vandenbussche, Guy

    2011-03-29

    Detoxification of heavy metal ions in Proteobacteria is tightly controlled by various systems regulating their sequestration and transport. In Cupriavidus metallidurans CH34, a model organism for heavy metal resistance studies, the sil determinant is potentially involved in the efflux of silver and copper ions. Proteins SilA, SilB, and SilC form a resistance nodulation cell division (RND)-based transport system in which SilB is the periplasmic adaptor protein belonging to the membrane fusion protein (MFP) family. In addition to the four domains typical of known MFPs, SilB has a fifth additional C-terminal domain, called SilB(440-521), which is characterized here. Structure and backbone dynamics of SilB(440-521) have been investigated using nuclear magnetic resonance, and the residues of the metal site were identified from (15)N- and (13)C-edited HSQC spectra. The solution structure and additional metal binding experiments demonstrated that this C-terminal domain folds independently of the rest of the protein and has a conformation and a Ag(+) and Cu(+) binding specificity similar to those determined for CusF from Escherichia coli. The small protein CusF plays a role in metal trafficking in the periplasm. The similarity with CusF suggests a potential metallochaperone role for SilB(440-521) that is discussed in the context of simultaneous expression of different determinants involved in copper resistance in C. metallidurans CH34. PMID:21299248

  14. TDPAC studies of the metal-binding sites in serum transferrin: comparison between 181Hf-labeled human- and rat-serum transferrin.

    PubMed

    Appel, H; Duffield, J; Taylor, D M; Then, G M; Thies, W G

    1987-12-01

    The binding of hafnium to human serum transferrin was studied using the time differential perturbed angular correlation (TDPAC-) technique. The samples were prepared in vitro by adding 181Hf-NTA solution to human serum. Two specific electric quadrupole interactions were observed, which correspond to two well-defined binding configurations. Their relative intensities depend on the pH, salt- and hafnium-concentrations, and on the incubation time. The present data may be compared with the results of a previous rat serum study, where the hafnium binding to transferrin behaved rather similarly. Small but significant differences, however, can be deduced from the TDPAC-parameters for these human and rat transferrin species. For either binding configuration, the electric field gradient (EFG) is slightly higher in the case of rat transferrin. The most characteristic difference, however, concerns the asymmetry parameter eta 2 of the second binding configuration, which is about 10% smaller for rat serum transferrin. The TDPAC-technique might be used as a sensitive and reliable analytical method to study the metal-binding sites of different transferrin species. PMID:3437277

  15. TDPAC studies of the metal-binding sites in serum transferrin: comparison between /sup 181/Hf-labeled human- and rat-serum transferrin

    SciTech Connect

    Appel, H.; Duffield, J.; Taylor, D.M.; Then, G.M.; Thies, W.G.

    1987-12-01

    The binding of hafnium to human serum transferrin was studied using the time differential perturbed angular correlation (TDPAC-) technique. The samples were prepared in vitro by adding /sup 181/Hf-NTA solution to human serum. Two specific electric quadrupole interactions were observed, which correspond to two well-defined binding configurations. Their relative intensities depend on the pH, salt- and hafnium-concentrations, and on the incubation time. The present data may be compared with the results of a previous rat serum study, where the hafnium binding to transferrin behaved rather similarly. Small but significant differences, however, can be deduced from the TDPAC-parameters for these human and rat transferrin species. For either binding configuration, the electric field gradient (EFG) is slightly higher in the case of rat transferrin. The most characteristic difference, however, concerns the asymmetry parameter eta 2 of the second binding configuration, which is about 10% smaller for rat serum transferrin. The TDPAC-technique might be used as a sensitive and reliable analytical method to study the metal-binding sites of different transferrin species.

  16. A New Type of Metal-Binding Site in Cobalt- And Zinc-Containing Adenylate Kinases Isolated From Sulfate-Reducers D. Gigas And D. Desulfuricans ATCC 27774

    SciTech Connect

    Gavel, O.Y.; Bursakov, S.A.; Rocco, G.Di; Trincao, J.; Pickering, I.J.; George, G.N.; Calvete, J.J.; Brondino, C.; Pereira, A.S.; Lampreia, J.; Tavares, P.; Moura, J.J.G.; Moura, I.

    2009-05-18

    Adenylate kinase (AK) mediates the reversible transfer of phosphate groups between the adenylate nucleotides and contributes to the maintenance of their constant cellular level, necessary for energy metabolism and nucleic acid synthesis. The AK were purified from crude extracts of two sulfate-reducing bacteria (SRB), Desulfovibrio (D.) gigas NCIB 9332 and Desulfovibrio desulfuricans ATCC 27774, and biochemically and spectroscopically characterized in the native and fully cobalt- or zinc-substituted forms. These are the first reported adenylate kinases that bind either zinc or cobalt and are related to the subgroup of metal-containing AK found, in most cases, in Gram-positive bacteria. The electronic absorption spectrum is consistent with tetrahedral coordinated cobalt, predominantly via sulfur ligands, and is supported by EPR. The involvement of three cysteines in cobalt or zinc coordination was confirmed by chemical methods. Extended X-ray absorption fine structure (EXAFS) indicate that cobalt or zinc are bound by three cysteine residues and one histidine in the metal-binding site of the 'LID' domain. The sequence {sup 129}Cys-X{sub 5}-His-X{sub 15}-Cys-X{sub 2}-Cys of the AK from D. gigas is involved in metal coordination and represents a new type of binding motif that differs from other known zinc-binding sites of AK. Cobalt and zinc play a structural role in stabilizing the LID domain.

  17. Cadmium, metal-binding proteins, and growth in bluegill (Lepomis macrochirus) exposed to contaminated sediments from the upper Mississippi River basin

    USGS Publications Warehouse

    Cope, W.G.; Wiener, J.G.; Steingraeber, M.T.; Atchison, G.J.

    1994-01-01

    We exposed juvenile bluegill (Lepomis macrochirus) to ~1000 mg·L-1 of continuously suspended river sediment in a 28-d test with six treatments (randomized block with one sediment-free control and five sediments ranging from 1.3 to 21.4 μg Cd·g dry weight-1). Each treatment had three replicates, each with 25 fish. Growth was reduced by exposure to suspended sediment, probably due to physical effects of sediment on feeding and to toxicity in the treatment with the greatest concentrations of metals. Mean whole-body concentrations of cadmium (0.04–0.14 μg wet weight-1) were correlated with cadmium concentration in filtered water (8–72 ng·L-1), suspended sediment (0.61–16.8 μg·L-1), and bulk sediment. The concentration of hepatic nonthionein cytosolic cadmium (cadmium not bound by metal-binding proteins, MBP) in fish exposed to the two most contaminated sediments exceeded that in controls. The mean concentration of hepatic MBP was correlated with cadmium concentration in filtered water, suspended sediment, bulk sediment, and whole fish. Whole-body cadmium concentration was the most sensitive indicator of cadmium exposure, with lowest observed effect concentrations of 1.9 μg Cd·L-1 for suspended sediment and 13 ng Cd·L-1 for filtered water. Sediment-associated cadmium was less available than waterborne cadmium for uptake by fish.

  18. Crystal Structure of Phosphatidylglycerophosphatase (PGPase), a Putative Membrane-Bound Lipid Phosphatase, Reveals a Novel Binuclear Metal Binding Site and Two Proton Wires

    SciTech Connect

    Kumaran,D.; Bonnano, J.; Burley, S.; Swaminathan, S.

    2006-01-01

    Phosphatidylglycerophosphatase (PGPase), an enzyme involved in lipid metabolism, catalyzes formation of phosphatidylglycerol from phosphatidylglycerophosphate. Phosphatidylglycerol is a multifunctional phospholipid, found in the biological membranes of many organisms. Here, we report the crystal structure of Listeria monocytogenes PGPase at 1.8 Angstroms resolution. PGPase, an all-helical molecule, forms a homotetramer. Each protomer contains an independent active site with two metal ions, Ca{sup 2+} and Mg{sup 2+}, forming a hetero-binuclear center located in a hydrophilic cavity near the surface of the molecule. The binuclear center, conserved ligands, metal-bound water molecules, and an Asp-His dyad form the active site. The catalytic mechanism of this enzyme is likely to proceed via binuclear metal activated nucleophilic water. The binuclear metal-binding active-site environment of this structure should provide insights into substrate binding and metal-dependent catalysis. A long channel with inter-linked linear water chains, termed 'proton wires', is observed at the tetramer interface. Comparison of similar water chain structures in photosynthetic reaction centers (RCs), Cytochrome f, gramicidin, and bacteriorhodopsin, suggests that PGPase may conduct protons via proton wires.

  19. Amyloid fibril formation in vitro from halophilic metal binding protein: Its high solubility and reversibility minimized formation of amorphous protein aggregations

    PubMed Central

    Tokunaga, Yuhei; Matsumoto, Mitsuharu; Tokunaga, Masao; Arakawa, Tsutomu; Sugimoto, Yasushi

    2013-01-01

    Halophilic proteins are characterized by high net negative charges and relatively small fraction of hydrophobic amino acids, rendering them aggregation resistant. These properties are also shared by histidine-rich metal binding protein (HP) from moderate halophile, Chromohalobacter salexigens, used in this study. Here, we examined how halophilic proteins form amyloid fibrils in vitro. His-tagged HP, incubated at pH 2.0 and 58°C, readily formed amyloid fibrils, as observed by thioflavin fluorescence, CD spectra, and transmission or atomic force microscopies. Under these low-pH harsh conditions, however, His-HP was promptly hydrolyzed to smaller peptides most likely responsible for rapid formation of amyloid fibril. Three major acid-hydrolyzed peptides were isolated from fibrils and turned out to readily form fibrils. The synthetic peptides predicted to form fibrils in these peptide sequences by Waltz software also formed fibrils. Amyloid fibril was also readily formed from full-length His-HP when incubated with 10–20% 2,2,2-trifluoroethanol at pH 7.8 and 25°C without peptide bond cleavage. PMID:24038709

  20. Crystal Structures of Apo and Metal-Bound Forms of the UreE Protein from Helicobacter pylori: Role of Multiple Metal Binding Sites

    SciTech Connect

    Shi, Rong; Munger, Christine; Asinas, Abdalin; Benoit, Stephane L.; Miller, Erica; Matte, Allan; Maier, Robert J.; Cygler, Miroslaw

    2010-10-22

    The crystal structure of the urease maturation protein UreE from Helicobacter pylori has been determined in its apo form at 2.1 {angstrom} resolution, bound to Cu{sup 2+} at 2.7 {angstrom} resolution, and bound to Ni{sup 2+} at 3.1 {angstrom} resolution. Apo UreE forms dimers, while the metal-bound enzymes are arranged as tetramers that consist of a dimer of dimers associated around the metal ion through coordination by His102 residues from each subunit of the tetramer. Comparison of independent subunits from different crystal forms indicates changes in the relative arrangement of the N- and C-terminal domains in response to metal binding. The improved ability of engineered versions of UreE containing hexahistidine sequences at either the N-terminal or C-terminal end to provide Ni{sup 2+} for the final metal sink (urease) is eliminated in the H102A version. Therefore, the ability of the improved Ni{sup 2+}-binding versions to deliver more nickel is likely an effect of an increased local concentration of metal ions that can rapidly replenish transferred ions bound to His102.

  1. Cd2+ and the N-terminal metal-binding domain protect the putative membranous CPC motif of the Cd2+-ATPase of Listeria monocytogenes.

    PubMed Central

    Bal, Nathalie; Wu, Chen Chou; Catty, Patrice; Guillain, Florent; Mintz, Elisabeth

    2003-01-01

    CadA, the Cd(2+)-ATPase of Listeria monocytogenes, contains four cysteine residues: two in the CTNC (Cys-Thr-Asn-Cys) sequence in the cytoplasmic metal-binding domain (MBD), and two in the CPC (Cys-Pro-Cys) sequence in the membrane domain. Taking advantage of DeltaMBD, a truncated version of CadA that lacks the MBD but which still acts as a functional Cd(2+)-ATPase [Bal, Mintz, Guillain and Catty (2001) FEBS Lett. 506, 249-252], we analysed the role of the membrane cysteine residues (studied using DeltaMBD) separately from that of the cysteine residues of the MBD, which were studied using full-length CadA. The role of the cysteines was assessed by reacting DeltaMBD and CadA with N -ethylmaleimide (NEM), an SH-specific reagent, in the presence or absence of Cd(2+). We show here that (i) in both DeltaMBD and CadA, the cysteine residues in the CPC motif are essential for phosphorylation; (ii) in both proteins, Cd(2+) protects against alkylation by NEM; and (iii) in the absence of Cd(2+), the MBD of CadA also protects against alkylation by NEM. Our results suggest that the CPC motif is present in the membrane Cd(2+) transport site(s) and that the MBD protects these site(s). PMID:12383056

  2. An all sulfur analogue of the smallest subunit of F420-non-reducing hydrogenase from Methanococcus voltae--metal binding and structure.

    PubMed

    Pfeiffer, M; Klein, A; Steinert, P; Schomburg, D

    The 25 amino acid long subunit VhuU of the F420-non-reducing hydrogenase from Methanococcus voltae contains selenocysteine within the consensus sequence of known [NiFe] hydrogenases DP(C or U)CxxCxxH (U = selenocysteine). The sulfur-analogue VhuUc was chemically synthesized, purified and its metal binding capability, the catalytic properties, and structural features were investigated. The polypeptide was able to bind nickel, but did not catalyse the heterolytic activation of H2. 2D-NMR spectroscopy revealed an alpha-helical secondary structure for the 15 N-terminal amino acids in 50% TFE. Nickel only binds to the C-terminus, which contains the conserved amino acid motif. Structures derived from the NMR data are compatible with the participation of both sulfur atoms from the conserved cysteine residues in a metal ion binding. Structures obtained from the data sets for Ni.VhuUc as well as Zn.VhuUc showed no further ligands. The informational value for Ni.VhuUc was low due to paramagnetism. PMID:9084873

  3. A highly ordered cubic mesoporous silica/graphene nanocomposite.

    PubMed

    Lee, Chang-Wook; Roh, Kwang Chul; Kim, Kwang-Bum

    2013-10-21

    A highly ordered cubic mesoporous silica (KIT-6)/graphene nanocomposite and 2D KIT-6 nanoflakes were synthesized using a novel synthesis methodology. The non-ionic triblock copolymer, P123, played a dual role as a structure-directing agent in the formation of the cubic mesoporous structure and as a cross-linking agent between mesoporous silica and graphene. The prepared (KIT-6)/graphene nanocomposite could act as a template for the preparation of mesoporous material/graphene nanocomposites. PMID:24057016

  4. Drug release from ordered mesoporous silicas.

    PubMed

    Doadrio, Antonio L; Salinas, Antonio J; Sánchez-Montero, José M; Vallet-Regí, M

    2015-01-01

    The state-of-the-art in the investigation of drugs release from Silica-based ordered Mesoporous Materials (SMMs) is reviewed. First, the SMM systems used like host matrixes are described. Then, the model drugs studied until now, including their pharmacological action, structure and the mesoporous matrix employed for each drug, are comprehensively listed. Next, the factors influencing the release of drugs from SMMs and the strategies used to control the drug delivery, specially the chemical functionalization of the silica surface, are discussed. In addition, how all these factors were gathered in a kinetic equation that describes the drug release from the mesoporous matrixes is explained. The new application of molecular modeling and docking in the investigation of the drug delivery mechanisms from SMMs is also presented. Finally, the new approaches under investigation in this field are mentioned including the design of smart stimuli-responsive materials and other recent proposals for a future investigation. PMID:26549760

  5. Cell viability in a wet silica gel.

    PubMed

    Nieto, Alejandra; Areva, Sami; Wilson, Timothy; Viitala, Reeta; Vallet-Regi, Maria

    2009-11-01

    A modified two-step sol-gel route using silicon ethoxide (TEOS) has been used to synthesize amorphous sol-gel-derived silica, which has been successfully used as a cell encapsulation matrix for 3T3 mouse fibroblasts and CRL-2595 epithelial cells due to its non-toxicity. The sol-gel procedure comprised a first, low pH hydrolysis step, followed by a neutral condensation-gelation step. A high water-to-TEOS ratio and the addition of d-glucose as a porogen and source of nutrients were chosen to minimize silica dissolution and improve the biocompatibility of the process. Indeed, the cell integrity in the encapsulation process was preserved by alcohol removal from the starting solution. Cells were then added in a buffered medium, causing rapid gelation and entrapment of the cells within a randomly structured siloxane matrix in the shape of a monolith, which was maintained in the wet state. MTT and alamarBlue assays were used to check the cytotoxicity of the silica gels and the viability of entrapped cells at initial times in contact with silica. To improve cell attachment, cell clumping experiments - where groups of cells were formed - were designed, rendering improved viability. The obtained materials are therefore excellent candidates for designing tissue-culture scaffolds and implantable bioreactors for biomedical applications. PMID:19481618

  6. Optical properties of polyimide/silica nanocomposite

    NASA Astrophysics Data System (ADS)

    Tommalieh, M. J.; Zihlif, A. M.

    2010-12-01

    The optical properties of thin films of polyimide/silica nanocomposites prepared via sol-gel process were investigated as a function of nanosilica particles content. Absorption and reflectance spectra were collected by a spectrophotometer giving UV-radiation of wavelength range 200-800 nm. The optical data obtained were analyzed in terms of absorption formula for non-crystalline materials. The calculated values of the optical energy gap and the width of the energy tails of the localized states exhibited silica concentration dependence. The direct optical energy gap for neat polyimide is about 1.95 eV, and decreases to a value of 1.8 eV for nanocomposite of 25 wt% nanosilica content. It was found that the calculated refractive index and dielectric constants of nanocomposites increase with silica particles content. The overall dependence of the optical and dielectrical constants on silica content in polyimide matrix is argued on the basis of the observed morphology and overlap of the localized energy sates of different color centers. The EMT model was fitted to the observed dielectric data.

  7. The synthesis and application of two mesoporous silica nanoparticles as drug delivery system with different shape

    NASA Astrophysics Data System (ADS)

    Wang, Jiayi; Wang, Zhuyuan; Chen, Hui; Zong, Shenfei; Cui, Yiping

    2015-05-01

    Mesoporous silica nanospheres(MSNSs) have been obtained utilizing the conventional reverse micelles synthesis method while the mesoporous silica nanorods(MSNRs) have been acquired by means of changing certain parameters. Afterwards, the prepared mesoporous silica nanospheres and nanorods were used as drug carriers to load and release the classical cancer therapeutic drug—DOX. According to the absorption spectra, the encapsulation efficiency of the mesoporous silica nanospheres is almost as high as that of the nanospheres. Different from the familiar encapsulation efficiency, the release characteristic curves of the mesoporous silica nanospheres and nanorods possessed certain differences during the release process. Finally incellular fluorescence imaging was achieved to observe the endocytosis of the mesoporous silica materials. Our results show that although both of the two kinds of nanoparticles possess favourable properties for loading and releasing drugs, the mesoporous silica nanospheres perform better in dispersity and controlled release than the nanorods, which probably endow them the potential as incellular drug delivery system.

  8. The use of Reactive Ion Etching for obtaining “free” silica nano test tubes

    NASA Astrophysics Data System (ADS)

    Buyukserin, Fatih; Martin, Charles R.

    2010-10-01

    Silica nano test tubes are one-dimensional inorganic nanostructures with several biotechnological applications including biosensing, magnetic resonance imaging, and targeted cancer therapeutics. They are generally prepared by sol-gel deposition of silica to nanoporous alumina templates. Preparing samples composed of isolated free silica nano test tubes can be a challenging process due to the conformal coating of silica on the template. This causes the formation of a top-surface silica layer which laterally connects the nano test tubes. Herein, we detailed the use of Reactive Ion Etching to remove this top-surface silica layer which yields free silica nano test tubes with template dissolution. Compared with the mechanical polishing approach, Reactive Ion Etching treatment allows a fine manipulation ability of the surface material at the nanoscale level. When used excessively, Reactive Ion Etching causes an orifice closing phenomenon that may be employed to create novel one-dimensional nanocapsules.

  9. Fast Glazing of Alumina/Silica Tiles

    NASA Technical Reports Server (NTRS)

    Creedon, J. F.; Gzowski, E. R.; Wheeler, W. H.

    1986-01-01

    Technique for applying ceramic coating to fibrous silica/alumina insulation tiles prevents cracks and substantially reduces firing time. To reduce thermal stresses in tile being coated, high-temperature, shorttime firing schedule implemented. Such schedule allows coating to mature while substrate remains at relatively low temperature, reducing stress differential between coating and substrate. Technique used to repair tiles with damaged coatings and possibly used in heat-treating objects made of materials having different thermal-expansion coefficients.

  10. Modeling vitreous silica bilayers

    NASA Astrophysics Data System (ADS)

    Kumar, Avishek; Wilson, Mark; Sherrington, David; Thorpe, Michael

    2014-03-01

    The recent synthesis and imaging of bilayers of vitreous silica has led to a wealth of new information. We have modeled the experimentally-observed bilayer using a computer assembly procedure to form a network of corner-sharing tetrahedra, which is then mirror-reflected to form a bilayer. We show that the vitreous silica bilayer has additional macroscopic degrees of freedom iff there is a symmetry plane through the center of the bilayer going through the central layer of oxygen ions that join the upper and lower monolayers. We have computer-refined the experimental coordinates to determine the density, and other structural characteristics such as the Si-Si pair distribution function, Si-O-Si bond angle distribution and the Aboav-Weaire law.

  11. Viscoelasticity of silica gels

    SciTech Connect

    Scherer, G.W.

    1995-12-01

    The response of silica gels to mechanical loads depends on the properties of the solid phase and the permeability of the network. Understanding this behavior is essential for modeling of stresses developed during drying or heating of gels. The permeability and the mechanical properties are readily determined from a simple beam-bending experiment, by measuring the load relaxation that occurs at constant deflection. Load decay results from movement of the liquid within the network; in addition, there may be viscoelastic relaxation of the network itself. Silica gel is viscoelastic in chemically aggressive media, but in inert liquids (such as ethanol or acetone) it is elastic. Experiments show that the viscoelastic relaxation time decreases as the concentration and pH of the water in the pore liquid increase. During drying, the permeability decreases and the viscosity increases, both exhibiting a power-law dependence on density of the gel network.

  12. Luminescent Silica Nanoparticles for cancer diagnosis

    PubMed Central

    Montalti, Marco; Petrizza, Luca; Rampazzo, Enrico; Zaccheroni, Nelsi; Marchiò, Serena

    2015-01-01

    Fluorescence imaging techniques are becoming essential in preclinical investigations, and the research of suitable tools for in vivo measurements is gaining more and more importance and attention. Nanotechnology entered the field to try to find solutions for many limitation at the state of the art, and luminescent nanoparticles (NPs) are one of the most promising materials proposed for future diagnostic implementation. NPs constitute also a versatile platform that can allow facile multi-functionalization to perform multimodal imaging or theranostic (simultaneous diagnosis and therapy). In this contribution we have focussed our attention only on dye doped silica or silica-based NPs conjugated with targeting moieties to enable specific cancer cells imaging and differentiation, even if also a few non targeted systems have been cited and discussed for completeness. We have summarized common synthetic approaches to these materials and then surveyed the most recent imaging applications of silica-based nanoparticles in cancer. The field of theranostic is so important and stimulating that, even if it is not the central topic of this paper, we have included some significant examples. We have then concluded with short hints on systems already in clinical trials and examples of specific applications in children tumours. This review tries to describe and discuss, through focussed examples, the great potentialities of these materials in the medical field, with the aim to encourage further research to implement applications that are still rare. PMID:23458621

  13. Sorption of radiocesium by active silica.

    PubMed

    McCulloch, C E; Crawford, R W; Angus, M J; Glasser, F P; Rahman, A A

    1984-05-01

    Cement and cement components have previously been shown to exhibit negligible sorption for cesium. Pyrogenic silica has been examined as an additive to cement materials for its ability to reduce the leachability of cesium and to provide a host material with permanent sorption sites. The incorporation of silica into cement composites can also improve the physical characteristics and strength of these materials as long ages. At neutral pH values, there is significant sorption of cesium by silica, but in high pH regimes, such as occur in cement environments, initial sorption is enhanced but this high level of sorption is followed by a gradual release of Cs. This apparent desorption is due to the consumption of SiO2 by Ca(OH)2 to form products which have little sorption potential for cesium. If, however, sufficient SiO2 is added to the system initially such that an excess remains after satisfying the demands of the Ca(OH)2 reaction, permanent sorption sites for cesium may be created. PMID:6327573

  14. 21 CFR 182.1711 - Silica aerogel.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 21 Food and Drugs 3 2014-04-01 2014-04-01 false Silica aerogel. 182.1711 Section 182.1711 Food and... GENERALLY RECOGNIZED AS SAFE Multiple Purpose GRAS Food Substances § 182.1711 Silica aerogel. (a) Product. Silica aerogel as a finely powdered microcellular silica foam having a minimum silica content of...

  15. 21 CFR 582.1711 - Silica aerogel.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Silica aerogel. 582.1711 Section 582.1711 Food and....1711 Silica aerogel. (a) Product. Silica aerogel as a finely powdered microcellular silica foam having a minimum silica content of 89.5 percent. (b) (c) Limitations, restrictions, or explanation....

  16. 21 CFR 582.1711 - Silica aerogel.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 21 Food and Drugs 6 2012-04-01 2012-04-01 false Silica aerogel. 582.1711 Section 582.1711 Food and....1711 Silica aerogel. (a) Product. Silica aerogel as a finely powdered microcellular silica foam having a minimum silica content of 89.5 percent. (b) (c) Limitations, restrictions, or explanation....

  17. 21 CFR 182.1711 - Silica aerogel.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 21 Food and Drugs 3 2011-04-01 2011-04-01 false Silica aerogel. 182.1711 Section 182.1711 Food and....1711 Silica aerogel. (a) Product. Silica aerogel as a finely powdered microcellular silica foam having a minimum silica content of 89.5 percent. (b) (c) Limitations, restrictions, or explanation....

  18. 21 CFR 582.1711 - Silica aerogel.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 21 Food and Drugs 6 2014-04-01 2014-04-01 false Silica aerogel. 582.1711 Section 582.1711 Food and....1711 Silica aerogel. (a) Product. Silica aerogel as a finely powdered microcellular silica foam having a minimum silica content of 89.5 percent. (b) (c) Limitations, restrictions, or explanation....

  19. 21 CFR 582.1711 - Silica aerogel.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 21 Food and Drugs 6 2011-04-01 2011-04-01 false Silica aerogel. 582.1711 Section 582.1711 Food and....1711 Silica aerogel. (a) Product. Silica aerogel as a finely powdered microcellular silica foam having a minimum silica content of 89.5 percent. (b) (c) Limitations, restrictions, or explanation....

  20. 21 CFR 182.1711 - Silica aerogel.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Silica aerogel. 182.1711 Section 182.1711 Food and....1711 Silica aerogel. (a) Product. Silica aerogel as a finely powdered microcellular silica foam having a minimum silica content of 89.5 percent. (b) (c) Limitations, restrictions, or explanation....

  1. 21 CFR 182.1711 - Silica aerogel.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 21 Food and Drugs 3 2012-04-01 2012-04-01 false Silica aerogel. 182.1711 Section 182.1711 Food and....1711 Silica aerogel. (a) Product. Silica aerogel as a finely powdered microcellular silica foam having a minimum silica content of 89.5 percent. (b) (c) Limitations, restrictions, or explanation....

  2. Nanoscale plasticity in silica glass

    SciTech Connect

    Glosli, J.N.; Boercker, D.B.; Tesar, A.; Belak, J.

    1993-10-01

    Mechanisms of nano-scale plasticity and damage initiation in silica glass is examined using molecular dynamics simulation. Computer experiments are carried out by indenting a sharp diamond-like tool, containing 4496 atoms, into a silica slab consisting of 12288 atoms. Both elastic and plastic deformation of silica is observed during nanoindentation simulation; this transition occurs at an indentation of 1.25 nm, and the calculated hardness (15GPa for 1.5 nm indentation) agrees with experiment.

  3. Agricultural waste as a source for the production of silica nanoparticles

    NASA Astrophysics Data System (ADS)

    Vaibhav, Vineet; Vijayalakshmi, U.; Roopan, S. Mohana

    2015-03-01

    The major interest of the paper deals with the extraction of silica from four natural sources such as rice husk, bamboo leaves, sugarcane bagasse and groundnut shell. These waste materials in large quantities can create a serious environmental problem. Hence, there is a need to adopt proper strategy to reduce the waste. In the present investigation, all the waste materials are subjected to moisture removal in a hot plate and sintered at 900 °C for 7 h. The sintered powder was treated with 1 M NaOH to form sodium silicate and then with 6 M H2SO4 to precipitate silica. The prepared silica powders were characterized by FT-IR, XRD and SEM-EDAX analysis. The silica recovered from different sources was found to vary between 52% and 78%. Magnesium substituted silica was formed from the groundnut waste and further treatment is required to precipitate silica.

  4. Agricultural waste as a source for the production of silica nanoparticles.

    PubMed

    Vaibhav, Vineet; Vijayalakshmi, U; Roopan, S Mohana

    2015-03-15

    The major interest of the paper deals with the extraction of silica from four natural sources such as rice husk, bamboo leaves, sugarcane bagasse and groundnut shell. These waste materials in large quantities can create a serious environmental problem. Hence, there is a need to adopt proper strategy to reduce the waste. In the present investigation, all the waste materials are subjected to moisture removal in a hot plate and sintered at 900°C for 7 h. The sintered powder was treated with 1 M NaOH to form sodium silicate and then with 6M H2SO4 to precipitate silica. The prepared silica powders were characterized by FT-IR, XRD and SEM-EDAX analysis. The silica recovered from different sources was found to vary between 52% and 78%. Magnesium substituted silica was formed from the groundnut waste and further treatment is required to precipitate silica. PMID:25576950

  5. Fabrication of keratin-silica hydrogel for biomedical applications.

    PubMed

    Kakkar, Prachi; Madhan, Balaraman

    2016-09-01

    In the recent past, keratin has been fabricated into different forms of biomaterials like scaffold, gel, sponge, film etc. In lieu of the myriad advantages of the hydrogels for biomedical applications, a keratin-silica hydrogel was fabricated using tetraethyl orthosilicate (TEOS). Textural analysis shed light on the physical properties of the fabricated hydrogel, inturn enabling the optimization of the hydrogel. The optimized keratin-silica hydrogel was found to exhibit instant springiness, optimum hardness, with ease of spreadability. Moreover, the hydrogel showed excellent swelling with highly porous microarchitecture. MTT assay and DAPI staining revealed that keratin-silica hydrogel was biocompatible with fibroblast cells. Collectively, these properties make the fabricated keratin-silica hydrogel, a suitable dressing material for biomedical applications. PMID:27207052

  6. Quantification of residual stress from photonic signatures of fused silica

    NASA Astrophysics Data System (ADS)

    Cramer, K. Elliott; Hayward, Maurice; Yost, William T.

    2014-02-01

    A commercially available grey-field polariscope (GFP) instrument for photoelastic examination is used to assess impact damage inflicted upon the outer-most pane of Space Shuttle windows made from fused silica. A method and apparatus for calibration of the stress-optic coefficient using four-point bending is discussed. The results are validated on known material (acrylic) and are found to agree with literature values to within 6%. The calibration procedure is then applied to fused-silica specimens and the stress-optic coefficient is determined to be 2.43 ± 0.54 × 10-12 Pa-1. Fused silica specimens containing impacts artificially made at NASA's Hypervelocity Impact Technology Facility (HIT-F), to simulate damage typical during space flight, are examined. The damage sites are cored from fused silica window carcasses and examined with the GFP. The calibrated GFP measurements of residual stress patterns surrounding the damage sites are presented.

  7. In situ synthesis of polysulfides covalently bonded to silica.

    PubMed

    Ossenkamp, Gabriel C; Kemmitt, Tim; Johnston, Jim H

    2002-05-15

    Silanol groups, triple bond SiOH, on the surface of silica were esterified with unsaturated alcohols and long-chain alcohols bearing thiol groups. The modified silicas obtained were used as substrates for a vulcanization-analogous reaction with sulfur catalyzed by zinc dimethyldithiocarbamate. Surface-esterified thiols could be smoothly converted to bridged polysulfides bonded to the silica surface, whereas the use of surface-esterified unsaturated alcohols led to removal of the surface-esterified alcohol from the silica surface. The materials were characterized by solid-state NMR and thermal and microanalytical analysis. The linking of surface-esterified alkenols and thiols by sulfide bridges was investigated by a numerical model for a flat surface. This showed that for a typical density of 3-4 micromol/m(2) surface groups, a statistical maximum of 70-75% of groups could be linked by S(n) bridges (n=2-4). PMID:16290622

  8. Stable and responsive fluorescent carbon nanotube silica gels

    SciTech Connect

    Dattelbaum, Andrew M; Gupta, Gautam; Doorn, Stephen K; Duque, Juan G

    2010-05-03

    Here we report a general route to prepare silica nanocomposite gels doped with fluorescent single walled carbon nanotubes (SWNT). We show that tetramethylorthosilicate (TMOS) vapors can be used to gel an aqueous suspension of surfactant-wrapped SWNT while maintaining fluorescence from the semiconducting nanotubes. The vapor phase silica process is performed at room temperature and is simple, reproducible, relatively quick, and requires no dilution of SWNT dispersions. However, exposure of aqueous SWNT suspensions to TMOS vapors resulted in an acidification of the suspension prior to gelation that caused a decrease in the emission signal from sodium dodecylsulfate (SDS) wrapped SWNT. We also show that although the SWNT are encapsulated in silica the emission signal from the encapsulated SWNT may be attenuated by exposing the nanocomposites to small aromatic molecules known to mitigate SWNT emission. These results demonstrate a new route for the preparation of highly luminescent SWNT/silica composite materials that are potentially useful for future sensing applications.

  9. Twisted and tubular silica structures by anionic surfactant fibers encapsulation.

    PubMed

    Chekini, Mahshid; Guénée, Laure; Marchionni, Valentina; Sharma, Manish; Bürgi, Thomas

    2016-09-01

    Organic molecules imprinting can be used for introducing specific properties and functionalities such as chirality to mesoporous materials. Particularly organic self-assemblies can work as a scaffold for templating inorganic materials such as silica. During recent years chiral imprinting of anionic surfactant for fabrication of twisted rod-like silica structures assisted by co-structuring directing agent were thoroughly investigated. The organic self-assemblies of anionic surfactants can also be used for introducing other shapes in rod-like silica structures. Here we report the formation of amphiphilic N-miristoyl-l-alanine self-assemblies in aqueous solution upon stirring and at presence of l-arginine. These anionic surfactant self-assemblies form fibers that grow by increasing the stirring duration. The fibers were studied using transmission electron microscopy, infra-red spectroscopy and vibrational circular dichroism. Addition of silica precursor 1,2-bis(triethoxysilyl)ethylene and co-structuring directing agent N-trimethoxysilylpropyl-N,N,N-trimethylammonium chloride at different stages of fibers' growth leads to formation of different silica structures. By controlling stirring duration, we obtained twisted tubular silica structures as a result of fibers encapsulation. We decorated these structures with gold nanoparticles by different methods and measured their optical activity. PMID:27267039

  10. Pentalysine clusters mediate silica targeting of silaffins in Thalassiosira pseudonana.

    PubMed

    Poulsen, Nicole; Scheffel, André; Sheppard, Vonda C; Chesley, Patrick M; Kröger, Nils

    2013-07-12

    The biological formation of inorganic materials (biomineralization) often occurs in specialized intracellular vesicles. Prominent examples are diatoms, a group of single-celled eukaryotic microalgae that produce their SiO2 (silica)-based cell walls within intracellular silica deposition vesicles (SDVs). SDVs contain protein-based organic matrices that control silica formation, resulting in species specifically nanopatterned biosilica, an organic-inorganic composite material. So far no information is available regarding the molecular mechanisms of SDV biogenesis. Here we have investigated by fluorescence microscopy and subcellular membrane fractionation the intracellular transport of silaffin Sil3. Silaffins are a group of phosphoproteins constituting the main components of the organic matrix of diatom biosilica. We demonstrate that the N-terminal signal peptide of Sil3 mediates import into a specific subregion of the endoplasmic reticulum. Additional segments from the mature part of Sil3 are required to reach post-endoplasmic reticulum compartments. Further transport of Sil3 and incorporation into the biosilica (silica targeting) require protein segments that contain a high density of modified lysine residues and phosphoserines. Silica targeting of Sil3 is not dependent on a particular peptide sequence, yet a lysine-rich 12-14-amino acid peptide motif (pentalysine cluster), which is conserved in all silaffins, strongly promotes silica targeting. The results of the present work provide the first insight into the molecular mechanisms for biogenesis of mineral-forming vesicles from an eukaryotic organism. PMID:23720751

  11. Intrinsic disorder and metal binding in UreG proteins from Archae hyperthermophiles: GTPase enzymes involved in the activation of Ni(II) dependent urease.

    PubMed

    Miraula, Manfredi; Ciurli, Stefano; Zambelli, Barbara

    2015-06-01

    Urease is a Ni(II) enzyme present in every domain of life, in charge for nitrogen recycling through urea hydrolysis. Its activity requires the presence of two Ni(II) ions in the active site. These are delivered by the concerted action of four accessory proteins, named UreD, UreF, UreG and UreE. This process requires protein flexibility at different levels and some disorder-to-order transition events that coordinate the mechanism of protein-protein interaction. In particular, UreG, the GTPase in charge of nucleotide hydrolysis required for urease activation, presents a significant degree of intrinsic disorder, existing as a conformational ensemble featuring characteristics that recall a molten globule. Here, the folding properties of UreG were explored in Archaea hyperthermophiles, known to generally feature significantly low level of structural disorder in their proteome. UreG proteins from Methanocaldococcus jannaschii (Mj) and Metallosphaera sedula (Ms) were structurally and functionally analyzed by integrating circular dichroism, NMR, light scattering and enzymatic assays. Metal-binding properties were studied using isothermal titration calorimetry. The results indicate that, as the mesophilic counterparts, both proteins contain a significant amount of secondary structure but maintain a flexible fold and a low GTPase activity. As opposed to other UreGs, secondary structure is lost at high temperatures (68 and 75 °C, respectively) with an apparent two-state mechanism. Both proteins bind Zn(II) and Ni(II), with affinities two orders of magnitude higher for Zn(II) than for Ni(II). No major modifications of the average conformational ensemble are observed, but binding of Zn(II) yields a more compact dimeric form in MsUreG. PMID:25846143

  12. The structures of the CutA1 proteins from Thermus thermophilus and Pyrococcus horikoshii: characterization of metal-binding sites and metal-induced assembly

    PubMed Central

    Bagautdinov, Bagautdin

    2014-01-01

    CutA1 (copper tolerance A1) is a widespread cytoplasmic protein found in archaea, bacteria, plants and animals, including humans. In Escherichia coli it is implicated in divalent metal tolerance, while the mammalian CutA1 homologue has been proposed to mediate brain enzyme acetylcholinesterase activity and copper homeostasis. The X-ray structures of CutA1 from the thermophilic bacterium Thermus thermophilus (TtCutA1) with and without bound Na+ at 1.7 and 1.9 Å resolution, respectively, and from the hyperthermophilic archaeon Pyrococcus horikoshii (PhCutA1) in complex with Na+ at 1.8 Å resolution have been determined. Both are short and rigid proteins of about 12 kDa that form intertwined compact trimers in the crystal and solution. The main difference in the structures is a wide-type β-bulge on top of the TtCutA1 trimer. It affords a mechanism for lodging a single-residue insertion in the middle of β2 while preserving the interprotomer main-chain hydrogen-bonding network. The liganded forms of the proteins provide new structural information about the metal-binding sites and CutA1 assembly. The Na+–TtCutA1 structure unveils a dodecameric assembly with metal ions in the trimer–trimer interfaces and the lateral clefts of the trimer. For Na+–PhCutA1, the metal ion associated with six waters in an octahedral geometry. The structures suggest that CutA1 may contribute to regulating intracellular metal homeostasis through various binding modes. PMID:24699729

  13. The structures of the CutA1 proteins from Thermus thermophilus and Pyrococcus horikoshii: characterization of metal-binding sites and metal-induced assembly.

    PubMed

    Bagautdinov, Bagautdin

    2014-04-01

    CutA1 (copper tolerance A1) is a widespread cytoplasmic protein found in archaea, bacteria, plants and animals, including humans. In Escherichia coli it is implicated in divalent metal tolerance, while the mammalian CutA1 homologue has been proposed to mediate brain enzyme acetylcholinesterase activity and copper homeostasis. The X-ray structures of CutA1 from the thermophilic bacterium Thermus thermophilus (TtCutA1) with and without bound Na(+) at 1.7 and 1.9 Å resolution, respectively, and from the hyperthermophilic archaeon Pyrococcus horikoshii (PhCutA1) in complex with Na(+) at 1.8 Å resolution have been determined. Both are short and rigid proteins of about 12 kDa that form intertwined compact trimers in the crystal and solution. The main difference in the structures is a wide-type β-bulge on top of the TtCutA1 trimer. It affords a mechanism for lodging a single-residue insertion in the middle of β2 while preserving the interprotomer main-chain hydrogen-bonding network. The liganded forms of the proteins provide new structural information about the metal-binding sites and CutA1 assembly. The Na(+)-TtCutA1 structure unveils a dodecameric assembly with metal ions in the trimer-trimer interfaces and the lateral clefts of the trimer. For Na(+)-PhCutA1, the metal ion associated with six waters in an octahedral geometry. The structures suggest that CutA1 may contribute to regulating intracellular metal homeostasis through various binding modes. PMID:24699729

  14. Effects of non-spherical colloidal silica slurry on Al-NiP hard disk substrate CMP application

    NASA Astrophysics Data System (ADS)

    Salleh, Sideq; Sudin, Izman; Awang, Arobi

    2016-01-01

    Spherical and non-spherical colloidal silica size and shape were characterized and its effects on aluminum alloy nickel plated (Al-NiP) hard disk substrate during chemical mechanical polishing (CMP) was investigated. Non-spherical colloidal silica slurry shows significantly higher material removal rate (MRR) with higher coefficient of friction (CoF) when compared to spherical colloidal silica of similar size. CMP evaluations on non-spherical colloidal silica slurry particle size distribution (PSD) reveal that MRR can be further increased by using wider PSD. Conventional slurry for Al-NiP hard disk substrates which use alumina-silica composite slurry induces embedded alumina thermal asperities (TA) defects which can cause reliability failure at product level. CMP comparison between conventional alumina-silica slurry and non-spherical colloidal silica slurry shows substrates polished by using non-spherical colloidal silica slurry have no embedded TA defects, lower surface roughness and lower surface defects.

  15. SOIL METAL BINDING AND PHYTOAVAILABILITY

    EPA Science Inventory

    This study combines plant uptake studies, metal adsorption studies and metal characterization studies using state-of-the art surface and structure sensitive spectroscopies (XAS, XPS,) and high resolution microscopies (SEM, TEM) to determine the mechanisms, and the reaction produc...

  16. Biogeochemistry: Silica cycling over geologic time

    NASA Astrophysics Data System (ADS)

    Conley, Daniel J.; Carey, Joanna C.

    2015-06-01

    The Earth's long-term silica cycle is intimately linked to weathering rates and biogenic uptake. Changes in weathering rates and the retention of silica on land have altered silica availability in the oceans for hundreds of millions of years.

  17. Adsorption of mycotoxins in beverages onto functionalized mesoporous silicas

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Mycotoxins, natural toxins produced by fungi, are a global concern as contaminates of agricultural commodities. Exposure to these toxins can be reduced by the use of binding materials. Templated mesoporous silicas are promising materials with favorable adsorptive properties for dyes, ions, and toxin...

  18. Mesoporous-silica films, fibers, and powders by evaporation

    DOEpatents

    Bruinsma, Paul J.; Baskaran, Suresh; Bontha, Jagannadha R.; Liu, Jun

    2008-05-06

    This invention pertains to surfactant-templated nanometer-scale porosity of a silica precursor solution and forming a mesoporous material by first forming the silica precursor solution into a preform having a high surface area to volume ratio, then rapid drying or evaporating a solvent from the silica precursor solution. The mesoporous material may be in any geometric form, but is preferably in the form of a film, fiber, powder or combinations thereof. The rapid drying or evaporation of solvent from the solution is accomplished by layer thinning, for example spin casting, liquid drawing, and liquid spraying respectively. Production of a film is by layer thinning, wherein a layer of the silica precursor solution is formed on a surface followed by removal of an amount of the silica precursor solution and leaving a geometrically thinner layer of the silica precursor solution from which the solvent quickly escapes via evaporation. Layer thinning may be by any method including but not limited to squeegeeing and/or spin casting. In powder formation by spray drying, the same conditions of fast drying exists as in spin-casting (as well as in fiber spinning) because of the high surface-area to volume ratio of the product. When a powder is produced by liquid spraying, the particles or micro-bubbles within the powder are hollow spheres with walls composed of mesoporous silica. Mesoporous fiber formation starts with a similar silica precursor solution but with an added pre-polymer making a pituitous mixture that is drawn into a thin strand from which solvent is evaporated leaving the mesoporous fiber(s).

  19. Mesoporous-silica films, fibers, and powders by evaporation

    DOEpatents

    Bruinsma, Paul J.; Baskaran, Suresh; Bontha, Jagannadha R.; Liu, Jun

    1999-01-01

    This invention pertains to surfactant-templated nanometer-scale porosity of a silica precursor solution and forming a mesoporous material by first forming the silica precursor solution into a preform having a high surface area to volume ratio, then rapid drying or evaporating a solvent from the silica precursor solution. The mesoporous material may be in any geometric form, but is preferably in the form of a film, fiber, powder or combinations thereof. The rapid drying or evaporation of solvent from the solution is accomplished by layer thinning, for example spin casting, liquid drawing, and liquid spraying respectively. Production of a film is by layer thinning, wherein a layer of the silica precursor solution is formed on a surface followed by removal of an amount of the silica precursor solution and leaving a geometrically thinner layer of the silica precursor solution from which the solvent quickly escapes via evaporation. Layer thinning may be by any method including but not limited to squeegeeing and/or spin casting. In powder formation by spray drying, the same conditions of fast drying exists as in spin-casting (as well as in fiber spinning) because of the high surface-area to volume ratio of the product. When a powder is produced by liquid spraying, the particles or micro-bubbles within the powder are hollow spheres with walls composed of mesoporous silica. Mesoporous fiber formation starts with a similar silica precursor solution but with an added pre-polymer making a pituitous mixture that is drawn into a thin strand from which solvent is evaporated leaving the mesoporous fiber(s).

  20. Mesoporous-silica films, fibers, and powders by evaporation

    DOEpatents

    Bruinsma, P.J.; Baskaran, S.; Bontha, J.R.; Liu, J.

    1999-07-13

    This invention pertains to surfactant-templated nanometer-scale porosity of a silica precursor solution and forming a mesoporous material by first forming the silica precursor solution into a preform having a high surface area to volume ratio, then rapid drying or evaporating a solvent from the silica precursor solution. The mesoporous material may be in any geometric form, but is preferably in the form of a film, fiber, powder or combinations thereof. The rapid drying or evaporation of solvent from the solution is accomplished by layer thinning, for example spin casting, liquid drawing, and liquid spraying respectively. Production of a film is by layer thinning, wherein a layer of the silica precursor solution is formed on a surface followed by removal of an amount of the silica precursor solution and leaving a geometrically thinner layer of the silica precursor solution from which the solvent quickly escapes via evaporation. Layer thinning may be by any method including but not limited to squeegeeing and/or spin casting. In powder formation by spray drying, the same conditions of fast drying exists as in spin-casting (as well as in fiber spinning) because of the high surface-area to volume ratio of the product. When a powder is produced by liquid spraying, the particles or micro-bubbles within the powder are hollow spheres with walls composed of mesoporous silica. Mesoporous fiber formation starts with a similar silica precursor solution but with an added pre-polymer making a pituitous mixture that is drawn into a thin strand from which solvent is evaporated leaving the mesoporous fiber(s). 24 figs.

  1. Synthesis, characterisation and application of silica-magnetite nanocomposites

    NASA Astrophysics Data System (ADS)

    Bruce, Ian J.; Taylor, James; Todd, Michael; Davies, Martin J.; Borioni, Enrico; Sangregorio, Claudio; Sen, Tapas

    2004-12-01

    Silica-magnetite composites were prepared for eventual applications in biomolecular separations (nucleic acids). Their production on large scale has been optimised and they have been extensively characterised in a physical and chemical context. They perform at least as well, if not better than a commercially available equivalent at adsorbing and eluting DNA. Several methods for the preparation of magnetite were compared in order to select one, which produced particles, possessing high magnetic susceptibility, low rate of sedimentation and good chemical stability. Of the main methods studied: (i) oxidative hydrolysis of iron(II) sulphate in alkaline media, (ii) alkaline hydrolysis of iron(II) and iron(III) chloride solutions, and (iii) precipitation from iron(II) and iron(III) chloride solutions by hydrolysis of urea, method (i) produced the 'best' magnetite particles. Silica-magnetite composites were prepared using the 'best' magnetite, and, for comparison, two methods for depositing silica were used to coat the silica onto magnetite nanoparticles, from silicic acid at pH 10 and by acid hydrolysis of tetraethoxysilane (TEOS) at 90 °C. The best method for yielding silica-magnetite composites that worked well in DNA adsorption and elution proved to be that involving silicic acid and this material could be made in 20 g batch sizes. Silica-magnetite composites from the two methods proved to have distinct and different physical and chemical properties. All magnetite and silica-magnetite samples were fully characterised for their relative chemical composition using Fourier-transform infrared, XRF and thermo-gravimetric analysis. Their physical characteristics were determined using scanning electron microscopy and N2 adsorption and Mossbauer spectroscopy was used to confirm the identity of the iron oxides produced. Selected samples were comparatively tested for their ability to adsorb, and subsequently elute, 2-deoxyguanosine-5-monophosphate (GMP) and its non

  2. Adsorption of bacteriocins by ingestible silica compounds.

    PubMed

    Wan, J; Gordon, J; Hickey, M W; Mawson, R F; Coventry, M J

    1996-08-01

    Bacteriocins including nisin, pediocin PO2, brevicin 286 and piscicolin 126 were adsorbed from culture supernates by various food-grade porous silica anti-caking agents and the food colourant, titanium dioxide. All the porous silica (calcium silicate or silicon dioxide) materials showed substantial capacity in adsorbing bacteriocin activities from the culture supernate and biological activity was recovered in the adsorbents. In contrast, the food colourant titanium dioxide adsorbed most of the bacteriocin activity from the supernate, with minimal biological activity retained in the adsorbent. Experiments with piscicolin 126 showed that optimum adsorption could be achieved with Micro-Cel E within 30 min, independent of the supernate pH (2.0-10.0). Piscicolin activity of up to 5 x 10(7) AU g(-1) of Micro-Cel E was obtained after adsorption from culture supernates and the adsorbed piscicolin demonstrated substantial biological activity against Listeria monocytogenes in both broth and a milk growth medium. PMID:8926221

  3. Bright photoluminescent hybrid mesostructured silica nanoparticles.

    PubMed

    Miletto, Ivana; Bottinelli, Emanuela; Caputo, Giuseppe; Coluccia, Salvatore; Gianotti, Enrica

    2012-07-28

    Bright photoluminescent mesostructured silica nanoparticles were synthesized by the incorporation of fluorescent cyanine dyes into the channels of MCM-41 mesoporous silica. Cyanine molecules were introduced into MCM-41 nanoparticles by physical adsorption and covalent grafting. Several photoluminescent nanoparticles with different organic loadings have been synthesized and characterized by X-ray powder diffraction, high resolution transmission electron microscopy and nitrogen physisorption porosimetry. A detailed photoluminescence study with the analysis of fluorescence lifetimes was carried out to elucidate the cyanine molecules distribution within the pores of MCM-41 nanoparticles and the influence of the encapsulation on the photoemission properties of the guests. The results show that highly stable photoluminescent hybrid materials with interesting potential applications as photoluminescent probes for diagnostics and imaging can be prepared by both methods. PMID:22706523

  4. ZBLAN, Silica Fiber Comparison

    NASA Technical Reports Server (NTRS)

    1998-01-01

    This graph depicts the increased signal quality possible with optical fibers made from ZBLAN, a family of heavy-metal fluoride glasses (fluorine combined zirconium, barium, lanthanum, aluminum, and sodium) as compared to silica fibers. NASA is conducting research on pulling ZBLAN fibers in the low-g environment of space to prevent crystallization that limits ZBLAN's usefulness in optical fiber-based communications. In the graph, a line closer to the black theoretical maximum line is better. Photo credit: NASA/Marshall Space Flight Center

  5. Performance of Silica Gel in the Role of Residual Air Drying

    NASA Technical Reports Server (NTRS)

    Jan, Darrell L.; Hogan, John A.; Koss, Brian; Palmer, Gary H.; Richardson, Justine; Linggi, Paul

    2014-01-01

    Removal of carbon dioxide (CO2) is a necessary step in air revitalization and is often accomplished with sorbent materials. Since moisture competes with CO2 in sorbent materials, it is necessary to remove the water first. This is typically accomplished in two stages: bulk removal and residual drying. Silica gel is used as the bulk drying material in the Carbon Dioxide Removal Assembly (CDRA) in operation on ISS. There has been some speculation that silica gel may also be capable of serving as the residual drying material. This paper will describe test apparatus and procedures for determining the performance of silica gel in residual air drying.

  6. Silica Fillers for elastomer Reinforement

    SciTech Connect

    Kohls, D.J.; Schaefer, D.W.

    2012-09-10

    This article summarizes recent work on the structure of precipitated silica used in the reinforcement of elastomers. Silica has a unique morphology, consisting of multiple structural levels that can be controlled through processing. The ability to control and characterize the multiple structures of precipitated silica is an example of morphological engineering for reinforcement applications. In this summary of some recent research efforts using precipitated silica, small-angle scattering techniques are described and their usefulness for determining the morphology of silica in terms of primary particles, aggregates, and agglomerates are discussed. The structure of several different precipitated silica powders is shown as well as the mechanical properties of elastomers reinforced with these silica particles. The study of the mechanical properties of filled elastomer systems is a challenging and exciting topic for both fundamental science and industrial application. It is known that the addition of hard particulates to a soft elastomer matrix results in properties that do not follow a straightforward rule of mixtures. Research efforts in this area have shown that the properties of filled elastomers are influenced by the nature of both the filler and the matrix, as well as the interactions between them. Several articles have reviewed the influence of fillers like silica and carbon black on the reinforcement of elastomers. In general, the structure-property relationships developed for filled elastomers have evolved into the following major areas: Filler structure, hydrodynamic reinforcement, and interactions between fillers and elastomers.

  7. Silica Fillers for elastomer Reinforement

    SciTech Connect

    Kohls, D.J.; Schaefer, D.W.

    2009-08-26

    This article summarizes recent work on the structure of precipitated silica used in the reinforcement of elastomers. Silica has a unique morphology, consisting of multiple structural levels that can be controlled through processing. The ability to control and characterize the multiple structures of precipitated silica is an example of morphological engineering for reinforcement applications. In this summary of some recent research efforts using precipitated silica, small-angle scattering techniques are described and their usefulness for determining the morphology of silica in terms of primary particles, aggregates, and agglomerates are discussed. The structure of several different precipitated silica powders is shown as well as the mechanical properties of elastomers reinforced with these silica particles. The study of the mechanical properties of filled elastomer systems is a challenging and exciting topic for both fundamental science and industrial application. It is known that the addition of hard particulates to a soft elastomer matrix results in properties that do not follow a straightforward rule of mixtures. Research efforts in this area have shown that the properties of filled elastomers are influenced by the nature of both the filler and the matrix, as well as the interactions between them. Several articles have reviewed the influence of fillers like silica and carbon black on the reinforcement of elastomers. In general, the structure-property relationships developed for filled elastomers have evolved into the following major areas: Filler structure, hydrodynamic reinforcement, and interactions between fillers and elastomers.

  8. Synthesis of mesoporous carbon-silica-polyaniline and nitrogen-containing carbon-silica films and their corrosion behavior in simulated proton exchange membrane fuel cells environment

    NASA Astrophysics Data System (ADS)

    Wang, Tao; He, Jianping; Sun, Dun; Guo, Yunxia; Ma, Yiou; Hu, Yuan; Li, Guoxian; Xue, Hairong; Tang, Jing; Sun, Xin

    In this study, polyaniline is deposited onto mesoporous carbon-silica-coated 304 stainless steel using electropolymerization method. Variation of the electropolymerization time and applied potential can affect the growth of polyaniline, and lead to different structural and electrochemical properties of the films. Nitrogen-containing groups are successfully introduced onto the mesoporous carbon-silica film by pyrolyzing treatment under N 2 atmosphere and the electrical conductivity is improved observably compared with the carbon-silica film. The electrochemical properties of the mesoporous carbon-silica-polyaniline films and nitrogen-containing carbon-silica composite films are examined by using potentiodynamic polarization, potentiostatic polarization and electrochemical impedance spectroscopy. The corrosion tests in 0.5 M H 2SO 4 system display that the carbon-silica-polyaniline films show the optimal protective performance. However, according to potentiostatic polarization process, nitrogen-containing carbon-silica film with a water contact angle 95° is extremely stable and better for the protection of stainless steel in simulated fuel cell environment compared to carbon-silica-polyaniline film. Therefore, the nitrogen-containing carbon-silica-coated 304 stainless steel is a promising candidate for bipolar plate materials in PEMFCs.

  9. Synthesis of microforsterite using derived-amorphous-silica of silica sands

    NASA Astrophysics Data System (ADS)

    Nurbaiti, Upik; Triwikantoro, Zainuri, Mochamad; Pratapa, Suminar

    2016-04-01

    Synthesis of microforsterite (Mg2SiO4) has been successfully done by a simple method benefiting of the local silica sands from Tanah Laut, Indonesia. The starting material was amorphous silica powder which was processed using coprecipitation method from the sands. The silica powder was obtained from a series of stages of the purification process of the sands, namely magnetic separation, grinding and soaking with HCl. The microforsterite synthesis followed the reaction of stoichiometric mole ratio mixing of 1:2 of the amorphous silica and MgO powders with 3 wt% addion of PVA as a catalyst.The mixture was calcined at temperatures between 1150-1400°C with 4 hours holding time. XRD data showed that calcination at a temperature of 1150°C for 4 hours was optimum where the weight fraction of forsterite can reach as much as 93 wt% with MgO as the secondary phase and without MgSiO3. SEM photograph of the microforsterite showed tapered morphology with a relatively homogeneous distribution.

  10. Approaches to separations using silica colloidal membranes

    NASA Astrophysics Data System (ADS)

    Ignacio-de Leon, Patricia Anne Argana

    This thesis describes the synthesis and properties of free-standing nanoporous silica colloidal membranes where the molecular transport is controlled on the basis of size, charge, and chiral selectivity. To achieve this, free-standing membranes were prepared from colloidal solutions of silica nanospheres and the nanopore size and surface functionality were varied. First, Au-coated membranes were prepared and the transport of neutral and charged small molecules through Au-coated silica colloidal membranes modified with poly(methacrylic acid) was studied. Polymer length was controlled by polymerization time to produce pH- and ion-responsive brushes inside the nanopores. By monitoring the flux of a diffusing species, it was demonstrated that the polyelectrolyte brush undergoes swelling and collapse when the pH is increased and decreased, respectively. We also observed an expansion and contraction in the absence and presence of counterions, respectively. We also studied the transport of enantiomers of a chiral dye molecule through silica colloidal membranes with attached chiral moieties. We used small molecules and polymers of amino acid derivatives and chiral calixarenes capable of chiral recognition as a result of stereochemically dependent noncovalent interactions with the diffusing molecule. We found that the selectivity remains approximately the same for membranes modified with small molecules and with polymers. This suggests that enantiopermselectivity depends primarily on the strength of noncovalent interactions rather than the availability of recognition sites. Next, the transport of various generations of dendrimers through silica colloidal membranes was studied in a proof-of-concept experiment to demonstrate the size-selectivity of our materials. Smaller dendrimers were found to diffuse faster and selectivity is improved by using smaller nanopores. Finally, the transport of proteins through silica colloidal membranes was studied as a function of nanopore size

  11. Effects of densified silica fume on microstructure and compressive strength of blended cement pastes

    SciTech Connect

    Ji Yajun; Cahyadi, Jong Herman

    2003-10-01

    Some experimental investigations on the microstructure and compressive strength development of silica fume blended cement pastes are presented in this paper. The silica fume replacement varies from 0% to 20% by weight and the water/binder ratio (w/b) is 0.4. The pore structure by mercury intrusion porosimetry (MIP), the micromorphology by scanning electron microscopy (SEM) and the compressive strength at 3, 7, 14, 28, 56 and 90 days have been studied. The test results indicate that the improvements on both microstructure and mechanical properties of hardened cement pastes by silica fume replacement are not effective due to the agglomeration of silica fume particles. The unreacted silica fume remained in cement pastes, the threshold diameter was not reduced and the increase in compressive strength was insignificant up to 28 days. It is suggested that the proper measures should be taken to disperse silica fume agglomeration to make it more effective on improving the properties of materials.

  12. A research on the radiation shielding effects of clay, silica fume and cement samples

    NASA Astrophysics Data System (ADS)

    Akbulut, Suat; Sehhatigdiri, Arvin; Eroglu, Hayrettin; Çelik, Semet

    2015-12-01

    Nowadays, as the application areas of nuclear technology increases, protection from radiation has become even more important. Especially, the importance of radiation-shielding is important for the environment and employees which are in close proximity. Clays can be used as additives for shielding the radioactive materials. In this study, the shielding properties of micronize clay-white cement, clay-silica fume, gypsum, gypsum-silica fume, cement, white cement, cement-silica fume, white cement-gypsum, white cement-silica fume, red mud-silica fume, silica fume and red mud at different energy levels were examined. Additionally, compaction and unconfined compression tests were carried out on the samples. The results of clays and other samples were compared with each other. As a result, it was found that clays, especially clay-white cement mixture were superior than other samples in radioactive shielding.

  13. Template-assisted synthesis of Janus silica nanobowls.

    PubMed

    Guignard, Florian; Lattuada, Marco

    2015-04-28

    The preparation of anisotropic nanoparticles has drawn much attention in the literature, with most of the efforts being dedicated to convex particles. In this work, instead, we present a reliable method to synthesis silica nanobowls with one well-defined opening, covering a broad range of sizes. The nanobowls have been obtained from asymmetrically functionalized silica-polymer Janus nanodumbbells, used as templates, by removing of the polymer. Polystyrene seeds having different sizes as well as surface chemistry have been used as starting material in a two-step seeded emulsion polymerization, which leads to polymer nanodumbbells. These dumbbells are also asymmetrically functionalized due to the presence of silane groups on only one of their two hemispheres. This allows us to selectively coat the silane-bearing hemisphere of the dumbbells with a silica layer by means of a Stoeber process. The silica nanobowls are eventually obtained after either calcination or dissolution of the polymeric template. Depending on the route followed to remove the polymer, nanobowls made of pure silica (from calcination) or hybrid Janus nanobowls with a silica outer shell and a covalently bound hydrophobic polymer layer inside the cavity (from dissolution) could be prepared. The difference between the two types of nanobowls has been proved by electrostatically binding oppositely charged silica nanoparticles, which adhere selectively only on the outer silica part of the nanobowls prepared by polymer dissolution, while they attach both inside and outside of nanobowls prepared by calcination. We also show that selective functionalization of the outer surface of the Janus nanobowls from dissolution is possible. This work is one of the first examples of concave objects bearing different functionalities in the inner and outer parts of their surface. PMID:25843702

  14. The Optical Properties of Ion Implanted Silica

    NASA Technical Reports Server (NTRS)

    Smith, Cydale C.; Ila, D.; Sarkisov, S.; Williams, E. K.; Poker, D. B.; Hensley, D. K.

    1997-01-01

    We will present our investigation on the change in the optical properties of silica, 'suprasil', after keV through MeV implantation of copper, tin, silver and gold and after annealing. Suprasil-1, name brand of silica glass produced by Hereaus Amerisil, which is chemically pure with well known optical properties. Both linear nonlinear optical properties of the implanted silica were investigated before and after thermal annealing. All implants, except for Sn, showed strong optical absorption bands in agreement with Mie's theory. We have also used Z-scan to measure the strength of the third order nonlinear optical properties of the produced thin films, which is composed of the host material and the metallic nanoclusters. For implants with a measurable optical absorption band we used Doyle's theory and the full width half maximum of the absorption band to calculate the predicted size of the formed nanoclusters at various heat treatment temperatures. These results are compared with those obtained from direct observation using transmission electron microscopic techniques.

  15. Immobilized lipid-bilayer materials

    DOEpatents

    Sasaki, Darryl Y.; Loy, Douglas A.; Yamanaka, Stacey A.

    2000-01-01

    A method for preparing encapsulated lipid-bilayer materials in a silica matrix comprising preparing a silica sol, mixing a lipid-bilayer material in the silica sol and allowing the mixture to gel to form the encapsulated lipid-bilayer material. The mild processing conditions allow quantitative entrapment of pre-formed lipid-bilayer materials without modification to the material's spectral characteristics. The method allows for the immobilization of lipid membranes to surfaces. The encapsulated lipid-bilayer materials perform as sensitive optical sensors for the detection of analytes such as heavy metal ions and can be used as drug delivery systems and as separation devices.

  16. Allyl-silica Hybrid Monoliths For Chromatographic Application

    NASA Astrophysics Data System (ADS)

    Guo, Wenjuan

    Column technology continues to be the most investigated topics in the separation world, since the column is the place where the chromatographic separation happens, making it the heart of the separation system. Allyl-silica hybrid monolithic material has been exploited as support material and potential stationary phases for liquid chromatography; the stationary phase anchored to the silica surface by Si-C bond, which is more pH stable than traditional stationary phase. First, nuclear magnetic resonance spectroscopy has been used to study the sol in the synthesis of allyl-silica hybrid monoliths. Allyl-trimethoxysilane (allyl-TrMOS), dimethyldimethoxysilane (DMDMOS) and tetramethoxysilane (TMOS) have been served as co-precursors in the sol-gel synthesis of organo-silica hybrid monolithic columns for liquid chromatography (LC). 29Si nuclear magnetic resonance (NMR) and 1H NMR spectroscopy were employed to monitor reaction profiles for the acid-catalyzed hydrolysis and initial condensation reactions of the individual precursor and the hybrid system. 29Si-NMR has also been used to identify different silane species formed during the reactions. The overall hydrolysis rate has been found to follow the trend DMDMOS > allyl-TrMOS > TMOS, if each precursor is reacted individually (homo-polymerization). Precursors show different hydrolysis rate when reacted together in the hybrid system than they are reacted individually. Cross-condensation products of TMOS and DMDMOS (QD) arise about 10 minutes of initiation of the reaction. The allyl-silica monolithic columns for capillary liquid chromatography can only be prepared in capillaries with 50 im internal diameter with acceptable performance. One of the most prominent problems related to the synthesis of silica monolithic structures is the volume shrinkage. The synthesis of allylfunctionalized silica hybrid monolithic structures has been studied in an attempt to reduce the volume shrinkage during aging, drying and heat treatment

  17. Bimodal mesoporous silica with bottleneck pores.

    PubMed

    Reber, M J; Brühwiler, D

    2015-11-01

    Bimodal mesoporous silica consisting of two sets of well-defined mesopores is synthesized by a partial pseudomorphic transformation of an ordered mesoporous starting material (SBA-15 type). The introduction of a second set of smaller mesopores (MCM-41 type) establishes a pore system with bottlenecks that restricts the access to the core of the bimodal mesoporous silica particles. The particle size and shape of the starting material are retained, but micropores present in the starting material disappear during the transformation, leading to a true bimodal mesoporous product. A varying degree of transformation allows the adjustment of the pore volume contribution of the two mesopore domains. Information on the accessibility of the mesopores is obtained by the adsorption of fluorescence-labeled poly(amidoamine) dendrimers and imaging by confocal laser scanning microscopy. This information is correlated with nitrogen sorption data to provide insights regarding the spatial distribution of the two mesopore domains. The bimodal mesoporous materials are excellent model systems for the investigation of cavitation effects in nitrogen desorption isotherms. PMID:26399172

  18. Silica research in Glasgow

    NASA Astrophysics Data System (ADS)

    Barr, B. W.; Cagnoli, G.; Casey, M. M.; Clubley, D.; Crooks, D. R. M.; Danzmann, K.; Elliffe, E. J.; Goßler, S.; Grant, A.; Grote, H.; Heptonstall, A.; Hough, J.; Jennrich, O.; Lück, H.; McIntosh, S. A.; Newton, G. P.; Palmer, D. A.; Plissi, M. V.; Robertson, D. I.; Robertson, N. A.; Rowan, S.; Skeldon, K. D.; Sneddon, P.; Strain, K. A.; Torrie, C. I.; Ward, H.; Willems, P. A.; Willke, B.; Winkler, W.

    2002-04-01

    The Glasgow group is involved in the construction of the GEO600 interferometer as well as in R&D activity on technology for advanced gravitational wave detectors. GEO600 will be the first GW detector using quasi-monolithic silica suspensions in order to decrease thermal noise significantly with respect to steel wire suspensions. The results concerning GEO600 suspension mounting and performance will be shown in the first section. Section 2 is devoted to the present results from the direct measurement of thermal noise in mirrors mounted in the 10 m interferometer in Glasgow which has a sensitivity limit of 4 × 10-19 m Hz-1/2 above 1 kHz. Section 3 presents results on the measurements of coating losses. R&D activity has been carried out to understand better how thermal noise in the suspensions affects the detector sensitivity, and in section 4 a discussion on the non-linear thermoelastic effect is presented.

  19. Silica aerogel core waveguide.

    PubMed

    Grogan, M D W; Leon-Saval, S G; England, R; Birks, T A

    2010-10-11

    We have selectively filled the core of hollow photonic crystal fibre with silica aerogel. Light is guided in the aerogel core, with a measured attenuation of 0.2 dB/cm at 1540 nm comparable to that of bulk aerogel. The structure guides light by different mechanisms depending on the wavelength. At long wavelengths the effective index of the microstructured cladding is below the aerogel index of 1.045 and guidance is by total internal reflection. At short wavelengths, where the effective cladding index exceeds 1.045, a photonic bandgap can guide the light instead. There is a small region of crossover, where both index- and bandgap-guided modes were simultaneously observed. PMID:20941148

  20. HVI Ballistic Limit Characterization of Fused Silica Thermal Panes

    NASA Technical Reports Server (NTRS)

    Miller, J. E.; Bohl, W. D.; Christiansen, E. L.; Davis, B. A.; Deighton, K. D.

    2015-01-01

    Fused silica window systems are used heavily on crewed reentry vehicles, and they are currently being used on the next generation of US crewed spacecraft, Orion. These systems improve crew situational awareness and comfort, as well as, insulating the reentry critical components of a spacecraft against the intense thermal environments of atmospheric reentry. Additionally, these materials are highly exposed to space environment hazards like solid particle impacts. This paper discusses impact studies up to 10 km/s on a fused silica window system proposed for the Orion spacecraft. A ballistic limit equation that describes the threshold of perforation of a fuse silica pane over a broad range of impact velocities, obliquities and projectile materials is discussed here.

  1. Microwave attenuation of multiwalled carbon nanotube-fused silica composites

    SciTech Connect

    Xiang Changshu; Pan Yubai; Liu Xuejian; Sun Xingwei; Shi Xiaomei; Guo Jingkun

    2005-09-19

    Multiwalled carbon nanotubes (MWCNTs) were used to convert radome materials to microwave absorbing materials. Dense MWCNT-fused silica composites were prepared by hot-pressing technique. The composites exhibit high complex permittivities at X-band frequencies, depending on the content of MWCNTs. The value of the loss tangent increases three orders over pure fused silica only by incorporating 2.5 vol % MWCNTs into the composites. The average magnitude of microwave transmission reaches -33 dB at 11-12 GHz in the 10 vol % MWCNT-fused silica composites, which indicates the composites have excellent microwave attenuation properties. The attenuation properties mainly originate from the electric loss of MWCNTs by the motion of conducting electrons.

  2. Measuring biogenic silica in marine sediments and suspended matter

    NASA Astrophysics Data System (ADS)

    DeMaster, David J.

    Measuring the biogenic silica content of marine sediments and suspended matter is essential for a variety of geochemical, biological, and sedimentological studies. Biota forming siliceous skeletal material account for as much as one third of the primary productivity in the ocean [Lisitzin, 1972] and a significant portion (2 to 70% by weight) of open-ocean sediments. Biogenic silica measurements reveal important information concerning the bulk chemistry of suspended material or sediment and are essential in any type of silica flux study in the water column or seabed. Analyses of this biogenic phase in marine plankton are useful in characterizing the basic types of biota present and in comparing the distributions of particulate and dissolved silicate when evaluating nutrient dynamics [Nelson and Smith, 1986]. In the marine environment, diatoms, radiolaria, sponges, and silicoflagellates are the common types of siliceous biota.

  3. 21 CFR 584.700 - Hydrophobic silicas.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 21 Food and Drugs 6 2012-04-01 2012-04-01 false Hydrophobic silicas. 584.700 Section 584.700 Food... DRINKING WATER OF ANIMALS Listing of Specific Substances Affirmed as GRAS § 584.700 Hydrophobic silicas. (a) Product. Amorphous fumed hydrophobic silica or precipitated hydrophobic silica (CAS Reg. No....

  4. 21 CFR 584.700 - Hydrophobic silicas.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Hydrophobic silicas. 584.700 Section 584.700 Food... DRINKING WATER OF ANIMALS Listing of Specific Substances Affirmed as GRAS § 584.700 Hydrophobic silicas. (a) Product. Amorphous fumed hydrophobic silica or precipitated hydrophobic silica (CAS Reg. No....

  5. 21 CFR 584.700 - Hydrophobic silicas.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 21 Food and Drugs 6 2011-04-01 2011-04-01 false Hydrophobic silicas. 584.700 Section 584.700 Food... DRINKING WATER OF ANIMALS Listing of Specific Substances Affirmed as GRAS § 584.700 Hydrophobic silicas. (a) Product. Amorphous fumed hydrophobic silica or precipitated hydrophobic silica (CAS Reg. No....

  6. 21 CFR 584.700 - Hydrophobic silicas.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 21 Food and Drugs 6 2014-04-01 2014-04-01 false Hydrophobic silicas. 584.700 Section 584.700 Food... DRINKING WATER OF ANIMALS Listing of Specific Substances Affirmed as GRAS § 584.700 Hydrophobic silicas. (a) Product. Amorphous fumed hydrophobic silica or precipitated hydrophobic silica (CAS Reg. No....

  7. 21 CFR 582.1711 - Silica aerogel.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 21 Food and Drugs 6 2013-04-01 2013-04-01 false Silica aerogel. 582.1711 Section 582.1711 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL DRUGS....1711 Silica aerogel. (a) Product. Silica aerogel as a finely powdered microcellular silica foam...

  8. 21 CFR 182.1711 - Silica aerogel.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 21 Food and Drugs 3 2013-04-01 2013-04-01 false Silica aerogel. 182.1711 Section 182.1711 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN....1711 Silica aerogel. (a) Product. Silica aerogel as a finely powdered microcellular silica foam...

  9. Silica Debris Disk Evidence for Giant Planet Forming Impacts

    NASA Astrophysics Data System (ADS)

    Lisse, C.

    2014-04-01

    Giant impacts are major formation events in the history of our solar system. The final assembly of the planets, as we understand it, had to include massive fast collision events as the planets grew to objects with large escape velocities or in regions of high Keplerian velocities (Chambers 2004; Kenyon & Bromley 2004a,b, 2006; Fegley & Schaefer 2005). These massive impact events should create large amounts of glassy silica material derived from the rapid melting, vaporization, and refreezing of normal silicate rich primitive rocky material. We report here the detection of 4 bright silica-rich debris disks in the Spitzer IRS spectral archive, and the possible identification of 7 others. The stellar types of the system primaries span from A5V to G0V, their ages are 10 - 100 Myr, and the dust is warm, 280 - 480 K, and is located between 1.5 and 6 AU, well inside the systems' terrestrial planet regions. The minimum amount of detected 0.1 - 20 dust mass ranges from 10^21 - 10^23 kg; assuming < 10% dust formation efficiency (Benz 2009, 2011) this implies collisions involving impactors massing at least 10^22 - 10^24 kg, i.e. from Moon to Earth mass. We find possible trends in the mineralogy of the silica, with predominantly amorphous silica found in the 2 younger systems, and crystalline silica in the older systems. We speculate this is due higher velocity impacts found in younger, hotter systems, coupled with the effects of energetic photon annealing of small amorphous silica grains. All of these measures are consistent with the creation of silica rich rubble, or construction debris, during the terrestrial planet formation era of giant impacts.

  10. Quartz/fused silica chip carriers

    NASA Technical Reports Server (NTRS)

    1992-01-01

    The primary objective of this research and development effort was to develop monolithic microwave integrated circuit (MMIC) packaging which will operate efficiently at millimeter-wave frequencies. The packages incorporated fused silica as the substrate material which was selected due to its favorable electrical properties and potential performance improvement over more conventional materials for Ka-band operation. The first step towards meeting this objective is to develop a package that meets standard mechanical and thermal requirements using fused silica and to be compatible with semiconductor devices operating up to at least 44 GHz. The second step is to modify the package design and add multilayer and multicavity capacity to allow for application specific integrated circuits (ASIC's) to control multiple phase shifters. The final step is to adapt the package design to a phased array module with integral radiating elements. The first task was a continuation of the SBIR Phase 1 work. Phase 1 identified fused silica as a viable substrate material by demonstrating various plating, machining, and adhesion properties. In Phase 2 Task 1, a package was designed and fabricated to validate these findings. Task 2 was to take the next step in packaging and fabricate a multilayer, multichip module (MCM). This package is the predecessor to the phased array module and demonstrates the ability to via fill, circuit print, laminate, and to form vertical interconnects. The final task was to build a phased array module. The radiating elements were to be incorporated into the package instead of connecting to it with wire or ribbon bonds.

  11. Biofunctionalization of carbon nanostructures through enzyme immobilization in colloidal silica

    NASA Astrophysics Data System (ADS)

    Goulet, Evan M.

    Multi-walled carbon nanotubes (MWNT) and carbon nanopipettes (CNP) provide interesting high aspect ratio scaffolds on which to base functionally gradient materials. In this dissertation, we present a general method for the production of an enzymatically active composite material based on MWNTs. Polyethyleneimine (PEI) was applied to purified MWNTs, generating a positive electrostatic potential on the MWNTs. This positive potential was used to apply negatively charged colloidal silica particle in the presence of a high concentration of enzyme. The silica coating continued to grow via localized condensation of silica particles driven by the buffered saline conditions, immobilizing the enzyme within the coating. The mesoporous nanostructure was characterized via transmission electron microscopy. Optical spectroscopy experiments on the material employed as an active suspension showed that the immobilized enzymes horseradish peroxidase (HRP) and tyrosinase (TV) retained their activity upon incorporation into the material. Using HRP as a model enzyme, it was determined that the MWNT-HRP-Silica material showed similar pH and temperature dependencies in activity to those of free HRP in solution. An examination of the Michaelis-Menten kinetics showed that the material had a slightly higher value of KM than did free HRP. The MWNT-HRP-Silica material was also employed as an active filter membrane, which allowed us to explore the reusable nature of the material. We were able to show the denaturation of the filter due to the loss of Ca2+ cations at low pH and then restore the activity by soaking the filter membrane in 1 mM CaCl2. The MWNT-HRP-Silica material was used to modify a carbon microelectrode and produce a functioning electrochemical sensor for H2O2 . Utilizing cyclic voltammetry, the sensor was shown to have a linear response in limiting current versus concentration of H2O2 of 4.26 pA/microM. We also determined a lower detection limit of 0.67 microM H2O2. CNPs were

  12. Temperature and moisture dependence of dielectric constant for silica aerogels

    SciTech Connect

    Hrubesh, L.H., LLNL

    1997-03-01

    The dielectric constants of silica aerogels are among the lowest measured for any solid material. The silica aerogels also exhibit low thermal expansion and are thermally stable to temperatures exceeding 500{degrees}C. However, due to the open porosity and large surface areas for aerogels, their dielectric constants are strongly affected by moisture and temperature. This paper presents data for the dielectric constants of silica aerogels as a function of moisture content at 25{degrees}C, and as a function of temperature, for temperatures in the range from 25{degrees}C to 450{degrees}C. Dielectric constant data are also given for silica aerogels that are heat treated in dry nitrogen at 500{degrees}C, then cooled to 25{degrees}C for measurements in dry air. All measurements are made on bulk aerogel spheres at 22GHz microwave frequency, using a cavity perturbation method. The results of the dependence found here for bulk materials can be inferred to apply also to thin films of silica aerogels having similar nano-structures and densities.

  13. Materialism.

    PubMed

    Melnyk, Andrew

    2012-05-01

    Materialism is nearly universally assumed by cognitive scientists. Intuitively, materialism says that a person's mental states are nothing over and above his or her material states, while dualism denies this. Philosophers have introduced concepts (e.g., realization and supervenience) to assist in formulating the theses of materialism and dualism with more precision, and distinguished among importantly different versions of each view (e.g., eliminative materialism, substance dualism, and emergentism). They have also clarified the logic of arguments that use empirical findings to support materialism. Finally, they have devised various objections to materialism, objections that therefore serve also as arguments for dualism. These objections typically center around two features of mental states that materialism has had trouble in accommodating. The first feature is intentionality, the property of representing, or being about, objects, properties, and states of affairs external to the mental states. The second feature is phenomenal consciousness, the property possessed by many mental states of there being something it is like for the subject of the mental state to be in that mental state. WIREs Cogn Sci 2012, 3:281-292. doi: 10.1002/wcs.1174 For further resources related to this article, please visit the WIREs website. PMID:26301463

  14. Prediction of rigid silica based insulation conductivity

    NASA Technical Reports Server (NTRS)

    Williams, Stanley D.; Curry, Donald M.

    1993-01-01

    A method is presented for predicting the thermal conductivity of low density, silica based fibrous insulators. It is shown that the method can be used to extend data values to the upper material temperature limits from those obtained from the test data. It is demonstrated that once the conductivity is accurately determined by the analytical model the conductivity for other atmospheres can be predicted. The method is similar to that presented by previous investigators, but differs significantly in the contribution due to gas and internal radiation.

  15. Detection of silica-mediated dissolution of magnetic grains in sediments using FORC diagrams

    NASA Astrophysics Data System (ADS)

    Wetter, Laura; Verosub, Ken; Russell, James

    2007-06-01

    Recently silica-mediated dissolution has been recognized as a potentially important factor influencing magnetic studies of marine and lacustrine sediments. Although direct evidence for the dissolution of magnetic particles in silica-rich environments is lacking, the process is expected to produce changes in the magnetic grain-size distribution, a hypothesis that is tested in this study on sediments from Lake Tanganyika, East Africa, using First Order Reversal Curves (FORCs). Results from different magnetic intensity zones within the studied samples clearly show changes in the grain-size distribution of magnetic minerals. In particular, zones with high biogenic silica content (BSi) correlated with depletion in fine-grained magnetic material, whereas zones with lower BSi showed no depletion. These results are consistent with the idea that silica-mediated dissolution results in the preferential removal of fine-grained magnetic material, and indicate that FORC diagrams are effective in characterizing silica-mediated dissolution in sediments.

  16. Modulation of microporous/mesoporous structures in self-templated cobalt-silica.

    PubMed

    Martens, Dana L; Wang, David K; Motuzas, Julius; Smart, Simon; da Costa, João C Diniz

    2015-01-01

    Finite control of pore size distributions is a highly desired attribute when producing porous materials. While many methodologies strive to produce such materials through one-pot strategies, oftentimes the pore structure requires post-treatment modification. In this study, modulation of pore size in cobalt-silica systems was investigated by a novel, non-destructive, self-templated method. These systems were produced from two cobalt-containing silica starting materials which differed by extent of condensation. These starting materials, sol (SG') and xerogel (XG'), were mixed with pure silica sol to produce materials containing 5-40 mol% Co. The resultant SG-series materials exhibited typical attributes for cobalt-silica systems: mesoporous characteristics developed at high cobalt concentrations, coinciding with Co3O4 formation; whereas, in the XG-series materials, these mesoporous characteristics were extensively suppressed. Based on an examination of the resultant materials a mechanism describing the pore size formation and modulation of the two systems was proposed. Pore size modulation in the XG-series was caused, in part, by the cobalt source acting as an autogenous template for the condensation of the silica network. These domains could be modified when wetted, allowing for the infiltration and subsequent condensation of silica oligomers into the pre-formed, mesoporous cages, leading to a reduction in the mesoporous content of the final product. PMID:25609189

  17. Modulation of microporous/mesoporous structures in self-templated cobalt-silica

    NASA Astrophysics Data System (ADS)

    Martens, Dana L.; Wang, David K.; Motuzas, Julius; Smart, Simon; da Costa, João C. Diniz

    2015-01-01

    Finite control of pore size distributions is a highly desired attribute when producing porous materials. While many methodologies strive to produce such materials through one-pot strategies, oftentimes the pore structure requires post-treatment modification. In this study, modulation of pore size in cobalt-silica systems was investigated by a novel, non-destructive, self-templated method. These systems were produced from two cobalt-containing silica starting materials which differed by extent of condensation. These starting materials, sol (SG') and xerogel (XG'), were mixed with pure silica sol to produce materials containing 5-40 mol% Co. The resultant SG-series materials exhibited typical attributes for cobalt-silica systems: mesoporous characteristics developed at high cobalt concentrations, coinciding with Co3O4 formation; whereas, in the XG-series materials, these mesoporous characteristics were extensively suppressed. Based on an examination of the resultant materials a mechanism describing the pore size formation and modulation of the two systems was proposed. Pore size modulation in the XG-series was caused, in part, by the cobalt source acting as an autogenous template for the condensation of the silica network. These domains could be modified when wetted, allowing for the infiltration and subsequent condensation of silica oligomers into the pre-formed, mesoporous cages, leading to a reduction in the mesoporous content of the final product.

  18. Modulation of microporous/mesoporous structures in self-templated cobalt-silica

    PubMed Central

    Martens, Dana L.; Wang, David K.; Motuzas, Julius; Smart, Simon; da Costa, João C. Diniz

    2015-01-01

    Finite control of pore size distributions is a highly desired attribute when producing porous materials. While many methodologies strive to produce such materials through one-pot strategies, oftentimes the pore structure requires post-treatment modification. In this study, modulation of pore size in cobalt-silica systems was investigated by a novel, non-destructive, self-templated method. These systems were produced from two cobalt-containing silica starting materials which differed by extent of condensation. These starting materials, sol (SG′) and xerogel (XG′), were mixed with pure silica sol to produce materials containing 5–40 mol% Co. The resultant SG-series materials exhibited typical attributes for cobalt-silica systems: mesoporous characteristics developed at high cobalt concentrations, coinciding with Co3O4 formation; whereas, in the XG-series materials, these mesoporous characteristics were extensively suppressed. Based on an examination of the resultant materials a mechanism describing the pore size formation and modulation of the two systems was proposed. Pore size modulation in the XG-series was caused, in part, by the cobalt source acting as an autogenous template for the condensation of the silica network. These domains could be modified when wetted, allowing for the infiltration and subsequent condensation of silica oligomers into the pre-formed, mesoporous cages, leading to a reduction in the mesoporous content of the final product. PMID:25609189

  19. Toughening Mechanisms in Silica-Filled Epoxy Nanocomposites

    NASA Astrophysics Data System (ADS)

    Patel, Binay S.

    Epoxies are widely used as underfill resins throughout the microelectronics industry to mechanically couple and protect various components of flip-chip assemblies. Generally rigid materials largely surround underfill resins. Improving the mechanical and thermal properties of epoxy resins to better match those of their rigid counterparts can help extend the service lifetime of flip-chip assemblies. Recently, researchers have demonstrated that silica nanoparticles are effective toughening agents for lightly-crosslinked epoxies. Improvements in the fracture toughness of silica-filled epoxy nanocomposites have primarily been attributed to two toughening mechanisms: particle debonding with subsequent void growth and matrix shear banding. Various attempts have been made to model the contribution of these toughening mechanisms to the overall fracture energy observed in silica-filled epoxy nanocomposites. However, disparities still exist between experimental and modeled fracture energy results. In this dissertation, the thermal, rheological and mechanical behavior of eight different types of silica-filled epoxy nanocomposites was investigated. Each nanocomposite consisted of up to 10 vol% of silica nanoparticles with particle sizes ranging from 20 nm to 200 nm, with a variety of surface treatments and particle structures. Fractographical analysis was conducted with new experimental approaches in order to accurately identify morphological evidence for each proposed toughening mechanism. Overall, three major insights into the fracture behavior of real world silica-filled epoxy nanocomposites were established. First, microcracking was observed as an essential toughening mechanism in silica-filled epoxy nanocomposites. Microcracking was observed on the surface and subsurface of fractured samples in each type of silica-filled epoxy nanocomposite. The additional toughening contribution of microcracking to overall fracture energy yielded excellent agreement between experimental

  20. Silica particles cause NADPH oxidase–independent ROS generation and transient phagolysosomal leakage

    PubMed Central

    Joshi, Gaurav N.; Goetjen, Alexandra M.; Knecht, David A.

    2015-01-01

    Chronic inhalation of silica particles causes lung fibrosis and silicosis. Silica taken up by alveolar macrophages causes phagolysosomal membrane damage and leakage of lysosomal material into the cytoplasm to initiate apoptosis. We investigated the role of reactive oxygen species (ROS) in this membrane damage by studying the spatiotemporal generation of ROS. In macrophages, ROS generated by NADPH oxidase 2 (NOX2) was detected in phagolysosomes containing either silica particles or nontoxic latex particles. ROS was only detected in the cytoplasm of cells treated with silica and appeared in parallel with an increase in phagosomal ROS, as well as several hours later associated with mitochondrial production of ROS late in apoptosis. Pharmacological inhibition of NOX activity did not prevent silica-induced phagolysosomal leakage but delayed it. In Cos7 cells, which do not express NOX2, ROS was detected in silica-containing phagolysosomes that leaked. ROS was not detected in phagolysosomes containing latex particles. Leakage of silica-containing phagolysosomes in both cell types was transient, and after resealing of the membrane, endolysosomal fusion continued. These results demonstrate that silica particles can generate phagosomal ROS independent of NOX activity, and we propose that this silica-generated ROS can cause phagolysosomal leakage to initiate apoptosis. PMID:26202463