Science.gov

Sample records for nanoparticles incorporating kaempferol

  1. Host thin films incorporating nanoparticles

    NASA Astrophysics Data System (ADS)

    Qureshi, Uzma

    The focus of this research project was the investigation of the functional properties of thin films that incorporate a secondary nanoparticulate phase. In particular to assess if the secondary nanoparticulate material enhanced a functional property of the coating on glass. In order to achieve this, new thin film deposition methods were developed, namely use of nanopowder precursors, an aerosol assisted transport technique and an aerosol into atmospheric pressure chemical vapour deposition system. Aerosol assisted chemical vapour deposition (AACVD) was used to deposit 8 series of thin films on glass. Five different nanoparticles silver, gold, ceria, tungsten oxide and zinc oxide were tested and shown to successfully deposit thin films incorporating nanoparticles within a host matrix. Silver nanoparticles were synthesised and doped within a titania film by AACVD. This improved solar control properties. A unique aerosol assisted chemical vapour deposition (AACVD) into atmospheric pressure chemical vapour deposition (APCVD) system was used to deposit films of Au nanoparticles and thin films of gold nanoparticles incorporated within a host titania matrix. Incorporation of high refractive index contrast metal oxide particles within a host film altered the film colour. The key goal was to test the potential of nanopowder forms and transfer the suspended nanopowder via an aerosol to a substrate in order to deposit a thin film. Discrete tungsten oxide nanoparticles or ceria nanoparticles within a titanium dioxide thin film enhanced the self-cleaning and photo-induced super-hydrophilicity. The nanopowder precursor study was extended by deposition of zinc oxide thin films incorporating Au nanoparticles and also ZnO films deposited from a ZnO nanopowder precursor. Incorporation of Au nanoparticles within a VO: host matrix improved the thermochromic response, optical and colour properties. Composite VC/TiC and Au nanoparticle/V02/Ti02 thin films displayed three useful properties photocatalysis, photo-induced super-hydrophilicity and thermochromism.

  2. SERS spectroscopy of kaempferol and galangin under the interaction of human serum albumin with adsorbed silver nanoparticles

    NASA Astrophysics Data System (ADS)

    Zhang, Wei; Bai, Xueyuan; Wang, Yingping; Zhao, Bing; Zhao, Daqing; Zhao, Yu

    Raman and surface-enhanced Raman scattering (SERS) spectroscopy were employed to probe the interaction of the flavonol drugs, kaempferol and galangin, with human serum albumin (HSA). SERS spectra of both flavonol derivatives were obtained from a colloidal silver surface in physiological condition, based on the high performance of the enhanced substrate, the most enhanced modes of kaempferol and galangin were those with certain motions perpendicular to the metal surface. The SERS spectra were allowed to predict similar orientation geometry for both of the drugs on the colloidal surface with minor difference. In addition, both flavonols-HSA complexes were prepared in different concentration ratios and the orientated differences between kaempferol and galangin were investigated by SERS.

  3. Gold nanoparticle incorporation in the cancer cells : imaging and treatment

    NASA Astrophysics Data System (ADS)

    Ahn, Sungsook; Jung, Sung Yong; Seo, Eun Seok; Ryu, Jeongeun; Lee, Sang Joon

    2011-11-01

    Surface modified gold nanoparticles (~ 20 nm) are selectively incorporated in the various cancer cells. Depending on the attached molecules on the gold nanoparticle surface, incorporation efficiency of the gold nanoparticles in the cancer cells are differentiated. Two-photon fluorescence microscopy, energy dispersive X-ray spectroscopy (EDS) and second ion mass spectroscopy (SIMS) are utilized to quantify the gold nanoparticles incorporated in the cancer cells. Static images of the cancer cell are obtained by scanning electron microscopy (SEM) and zone-plate X-ray nanoscopy. On the other hand, dynamic flow images are captured by dynamic X-ray imaging. To enhance the selective incorporation into the cancer cells, specially designed aptamer is introduced on the gold nanoparticles, which changes the mechanisms of gold nanoparticle incorporation through the cancer cell membrane. Anti-cancer drugs are also incorporated, by which sustained drug delivery mechanisms are investigated. This study would contribute to the basic understanding on the nanoparticle- mediated disease treatment and advanced imaging technology.

  4. Incorporation of metal nanoparticles into wood substrate and methods

    DOEpatents

    Rector, Kirk D; Lucas, Marcel

    2015-11-04

    Metal nanoparticles were incorporated into wood. Ionic liquids were used to expand the wood cell wall structure for nanoparticle incorporation into the cell wall structure. Nanoparticles of elemental gold or silver were found to be effective surface enhanced Raman spectroscopy (SERS) imaging contrast or sensing agents. Nanoparticles of elemental iron were found to be efficient microwave absorbers and caused localized heating for disrupting the integrity of the lignocellulosic matrix. Controls suggest that the localized heating around the iron nanoparticles reduces losses of cellulose in the form of water, volatiles and CO.sub.2. The ionic liquid is needed during the incorporation process at room temperature. The use of small amounts of ionic liquid combined with the absence of an ionic liquid purification step and a lower energy and water use are expected to reduce costs in an up-scaled pretreatment process.

  5. Incorporation of platinum nanoparticles in ordered mesoporous carbon.

    PubMed

    Wikander, Kjell; Hungria, Ana B; Midgley, Paul A; Palmqvist, Anders E C; Holmberg, Krister; Thomas, John M

    2007-01-01

    Platinum nanoparticles were incorporated within the pore system of ordered mesoporous carbon (OMC) by impregnating the carbon with a water-in-oil (w/o) microemulsion containing dissolved platinum salt followed by reduction of the platinum ions in situ inside the carbon pore system. The procedure provides preparation of metallic nanoparticles from hydrophilic precursors inside the hydrophobic carbon support structure with simultaneous control of the maximum metal particle size. Electron tomography was used to verify the presence of platinum nanoparticles inside the carbon material. PMID:17069827

  6. Selective methylation of kaempferol via benzylation and deacetylation of kaempferol acetates.

    PubMed

    Mei, Qinggang; Wang, Chun; Yuan, Weicheng; Zhang, Guolin

    2015-01-01

    A strategy for selective mono-, di- and tri-O-methylation of kaempferol, predominantly on the basis of selective benzylation and controllable deacetylation of kaempferol acetates, was developed. From the selective deacetylation and benzylation of kaempferol tetraacetate (1), 3,4',5,-tri-O-acetylkaempferol (2) and 7-O-benzyl-3,4'5,-tri-O-acetylkaempferol (8) were obtained, respectively. By controllable deacetylation and followed selective or direct methylation of these two intermediates, eight O-methylated kaempferols were prepared with 51-77% total yields from kaempferol. PMID:25815082

  7. Kaempferol: a new immunosuppressant of calcineurin.

    PubMed

    Wang, Hu; Zhou, Chun-Lei; Lei, Hong; Zhang, Song-Dong; Zheng, Jianquan; Wei, Qun

    2008-08-01

    Calcineurin (CN), the Ca(2+)/calmodulin (CaM)-dependant protein phosphatase, is the target for immunosuppressive drugs cyclosporine A (CsA) and FK506. These immunosuppressants can inhibit CN activity after binding with respective immunophilins. Based on the model of screening by using p-nitrophenyl phosphate as a substrate for preliminary screening and (32)P-labeled 19-residue phosphopeptide as a specific substrate for final determination, we found Kaempferol, a natural flavonol, could inhibit CN activity in purified enzyme and Jurkat T-cells. Unlike CsA and FK506, CN inhibition by kaempferol is independent of matchmaker protein and the inhibitory manner is noncompetitive. Through investigation of inhibitions for CNA and a series of its truncated mutants, we suggested that Kaempferol could directly act on the catalytic domain. Data also indicated that the CN inhibition by kaempferol could be enhanced when the enzyme was activated in the presence of CaM and CNB. CNB is necessary for mediating inhibition of enzyme by kaempferol. The result of RT-PCR also indicated that kaempferol had an inhibitory activity against IL-2 gene expression in activated Jurkat cells. All data suggested that kaempferol could be a new immunosuppressant of CN. PMID:18506853

  8. A review on the dietary flavonoid kaempferol.

    PubMed

    Calderón-Montaño, J M; Burgos-Morón, E; Pérez-Guerrero, C; López-Lázaro, M

    2011-04-01

    Epidemiological studies have revealed that a diet rich in plant-derived foods has a protective effect on human health. Identifying bioactive dietary constituents is an active area of scientific investigation that may lead to new drug discovery. Kaempferol (3,5,7-trihydroxy-2-(4-hydroxyphenyl)-4H-1-benzopyran-4-one) is a flavonoid found in many edible plants (e.g. tea, broccoli, cabbage, kale, beans, endive, leek, tomato, strawberries and grapes) and in plants or botanical products commonly used in traditional medicine (e.g. Ginkgo biloba, Tilia spp, Equisetum spp, Moringa oleifera, Sophora japonica and propolis). Some epidemiological studies have found a positive association between the consumption of foods containing kaempferol and a reduced risk of developing several disorders such as cancer and cardiovascular diseases. Numerous preclinical studies have shown that kaempferol and some glycosides of kaempferol have a wide range of pharmacological activities, including antioxidant, anti-inflammatory, antimicrobial, anticancer, cardioprotective, neuroprotective, antidiabetic, anti-osteoporotic, estrogenic/antiestrogenic, anxiolytic, analgesic and antiallergic activities. In this article, the distribution of kaempferol in the plant kingdom and its pharmacological properties are reviewed. The pharmacokinetics (e.g. oral bioavailability, metabolism, plasma levels) and safety of kaempferol are also analyzed. This information may help understand the health benefits of kaempferol-containing plants and may contribute to develop this flavonoid as a possible agent for the prevention and treatment of some diseases. PMID:21428901

  9. Redox Reactions between Kaempferol and Illuminated Chloroplasts

    PubMed Central

    Takahama, Umeo

    1983-01-01

    Bleaching of kaempferol by illuminated chloroplasts was observed at 380 nanometers. The photobleaching was stimulated by methyl viologen and suppressed by superoxide dismutase indicating the participation of O2− in the reaction. An electron transfer inhibitor on the oxidizing side of photosystem II, carbonylcyanide m-chlorophenylhydrazone (CCCP), stimulated the photobleaching and 3-(3,4-dichlorophenyl)-1,1-dimethylurea partially suppressed it. The stimulation by CCCP suggests that kaempferol is also bleached on the oxidizing side of photosystem II. The spectrum of kaempferol bleaching in the presence of methyl viologen was the same as that in the presence of CCCP having a maximum in absorbance decrease at around 380 nanometers. When kaempferol was oxidized by KMnO2 or KO2, the oxidized minus reduced difference spectra had also a negative peak at about 380 nanometers. The results suggest that kaempferol was oxidized by illuminated chloroplasts. The rate of kaempferol photooxidation increased as its concentration was increased from 1 to 100 micromolar. The rate of quercetin photooxidation also increased as its concentration was increased from 1 to 100 micromolar. Concentration of quercetin glycosides higher than 10 micromolar was required to detect their photobleaching by illuminated chloroplasts. From these results, it is postulated that flavonols function as antioxidants in chloroplasts. PMID:16662873

  10. Functionalization of medical cotton by direct incorporation of silver nanoparticles.

    PubMed

    Emam, Hossam E; Saleh, N H; Nagy, Khaled S; Zahran, M K

    2015-07-01

    Medical cotton is usually used to clean skin, pack wounds and in other surgical tasks. Such important usages make imparting the antibacterial property to medical cotton is so essential research. The current research focuses on functionalization of medical cotton by direct incorporation of silver nanoparticles (AgNPs) in two-step process namely, pre-alkalization followed by sorption. Decorative color and antibacterial action were accomplished for medical cotton after in situ incorporation of AgNPs without using any other external reducing agent. AgNPs were produced due to the reduction action of alcoholic and aldehydic groups of cotton's skeletal blocks. Cotton fibers were acquired a decorative color attributed to surface plasmon resonance of AgNPs. The treated cotton was characterized by using electron microscope. Results showed that Ag(0) with size distribution of 0-160 nm was formed in the cotton fibers and their size majority (70%) was less than 80 nm. The reduction of Ag(+) to Ag(0) was confirmed by measuring the carboxylic and aldehydic contents. The treated cotton exhibited excellent antibacterial action at low silver contents. The absorbency of cotton was not affected by treatment. The produced medical cotton could be used to safe cleaning of wounds without getting any microbial infections. PMID:25907009

  11. Quantum dots incorporated magnetic nanoparticles for imaging colon carcinoma cells

    PubMed Central

    2013-01-01

    Background Engineered multifunctional nanoparticles (NPs) have made a tremendous impact on the biomedical sciences, with advances in imaging, sensing and bioseparation. In particular, the combination of optical and magnetic responses through a single particle system allows us to serve as novel multimodal molecular imaging contrast agents in clinical settings. Despite of essential medical imaging modalities and of significant clinical application, only few nanocomposites have been developed with dual imaging contrast. A new method for preparing quantum dots (QDs) incorporated magnetic nanoparticles (MNPs) based on layer-by-layer (LbL) self-assembly techniques have developed and used for cancer cells imaging. Methods Here, citrate - capped negatively charged Fe3O4 NPs were prepared and coated with positively - charged hexadecyltrimethyl ammonium bromide (CTAB). Then, thiol - capped negatively charged CdTe QDs were electrostatically bound with CTAB. Morphological, optical and magnetic properties of the fluorescent magnetic nanoparticles (FMNPs) were characterized. Prepared FMNPs were additionally conjugated with hCC49 antibodies fragment antigen binding (Fab) having binding affinity to sialylated sugar chain of TAG-72 region of LS174T cancer cells, which was prepared silkworm expression system, and then were used for imaging colon carcinoma cells. Results The prepared nanocomposites were magnetically responsive and fluorescent, simultaneously that are useful for efficient cellular imaging, optical sensing and magnetic separation. Transmission electron microscopy (TEM) and dynamic light scattering (DLS) revealed that the particle size is around 50 nm in diameter with inner magnetic core and outer CdTe QDs core-shell structure. Cytotoxicity test of prepared FMNPs indicates high viability in Vero cells. NPs conjugated with anti cancer antibodies were successfully labeled on colon carcinoma cells (LS174) in vitro and showed significant specificity to target cells. Conclusion The present report demonstrates a simple synthesis of CdTe QDs-Fe3O4 NPs. The surface of the prepared FMNPs was enabled simple conjugation to monoclonal antibodies by electrostatic interaction. This property further extended their in vitro applications as cellular imaging contrast agents. Such labeling of cells with new fluorescent-magneto nanoprobes for living detection is of interest to various biomedical applications and has demonstrated the potential for future medical use. PMID:23957878

  12. Directly patternable SnO{sub 2} thin films incorporating Pt nanoparticles

    SciTech Connect

    Kim, Hyuncheol; Choi, Yong-June; Kang, Kyung-Mun; Park, Hyung-Ho

    2014-04-01

    Highlights: • Direct-patterning of SnO{sub 2} films incorporated with Pt nanoparticles. • Pt incorporated SnO{sub 2} thin films by using photochemical solution deposition. • Reduction catalytic behavior of Pt nanoparticles. • Progress reduction of SnO{sub 2} with increasing amount of Pt nanoparticles. • Enhanced electrical conductivity of SnO{sub 2} films with Pt nanoparticles incorporation. - Abstract: Direct-patterning of SnO{sub 2} films incorporating Pt nanoparticles was performed by using a photochemical solution deposition without a photoresist or dry etching. Incorporating Pt nanoparticles into these films had a slight effect on their crystallinity and almost no effect on their transmittance. The inclusion of Pt nanoparticles enhanced the electrical conductivity of the SnO{sub 2} thin films compared to their pristine forms. The chemical bonding state of the films was analyzed by X-ray photoelectron spectroscopy to investigate the effect of the Pt nanoparticles on the carrier concentration in the film. It was concluded that the reduction of SnO{sub 2} thin films by Pt nanoparticles progressed as a result of the presence of the Pt nanoparticles, causing an oxygen deficiency to develop in SnO{sub 2} and thereby influencing the carrier concentration of the film.

  13. Kaempferol and inflammation: From chemistry to medicine.

    PubMed

    Devi, Kasi Pandima; Malar, Dicson Sheeja; Nabavi, Seyed Fazel; Sureda, Antoni; Xiao, Jianbo; Nabavi, Seyed Mohammad; Daglia, Maria

    2015-09-01

    Inflammation is an important process of human healing response, wherein the tissues respond to injuries induced by many agents including pathogens. It is characterized by pain, redness and heat in the injured tissues. Chronic inflammation seems to be associated with different types of diseases such as arthritis, allergies, atherosclerosis, and even cancer. In recent years natural product based drugs are considered as the novel therapeutic strategy for prevention and treatment of inflammatory diseases. Among the different types of phyto-constituents present in natural products, flavonoids which occur in many vegetable foods and herbal medicines are considered as the most active constituent, which has the potency to ameliorate inflammation under both in vitro and in vivo conditions. Kaempferol is a natural flavonol present in different plant species, which has been described to possess potent anti-inflammatory properties. Despite the voluminous literature on the anti-inflammatory effects of kaempferol, only very limited review articles has been published on this topic. Hence the present review is aimed to provide a critical overview on the anti-inflammatory effects and the mechanisms of action of kaempferol, based on the current scientific literature. In addition, emphasis is also given on the chemistry, natural sources, bioavailability and toxicity of kaempferol. PMID:25982933

  14. Chemical Dynamics in Energetic Materials Incorporating Aluminum Nanoparticles

    NASA Astrophysics Data System (ADS)

    Lewis, William K.; Harruff, Barbara A.; Fernando, K. A. Shiral; Smith, Marcus J.; Guliants, Elena A.; Bunker, Christopher E.

    2010-06-01

    Aluminum nanoparticles are widely considered attractive as fuels due to the high heat of reaction associated with their oxidation, and the potential for fast reaction due to their small size. However, the reaction dynamics can also be strongly influenced by the passivation layer that coats the reactive metal surface. Typically, this takes the form of a naturally-occurring oxide shell on the nanoparticle, but other passivation schemes are now available. We have recently developed a sonochemical synthesis procedure to produce aluminum nanoparticles capped with oleic acid. These nanoparticles have an aluminum metal core, some organic-provided oxide, and an organic shell. To investigate the effect of the passivation method on the chemical dynamics in energetic materials, we have studied samples consisting of a mixture of a metal nanoparticle fuel and an ammonium nitrate or ammonium perchlorate oxidizer. The metal fuel is either commercially available oxide-coated aluminum nanoparticles, or the oleic acid-capped nanoparticles. The energetic samples are ignited with an IR laser pulse. Following ignition, the chemical dynamics are studied using visible emission spectroscopy and mass spectrometry. Preliminary results suggest that our Al-oleic acid nanoparticles are able to react more rapidly than those that are conventionally passivated with a naturally-occurring oxide shell. K. A. S. Fernando, M. J. Smith, B. A. Harruff, W. K. Lewis, E. A. Guliants and C. E. Bunker J. Phys. Chem. C, 113, 500 (2009).

  15. Curcumin-incorporated albumin nanoparticles and its tumor image

    NASA Astrophysics Data System (ADS)

    Gong, Guangming; Pan, Qinqin; Wang, Kaikai; Wu, Rongchun; Sun, Yong; Lu, Ying

    2015-01-01

    Albumin is an ideal carrier for hydrophobic drugs. This paper reports a facile route to develop human serum albumin (HSA)-curcumin (CCM) nanoparticles, in which β-mercaptoethanol (β-ME) acted as an inducer and CCM acted as a bridge. Fluorescence quenching and conformational changes in HSA-CCM nanoparticles occurred during assembly. Disulfide bonds and hydrophobic interactions may play a key role in assembly. HSA-CCM nanoparticles were about 130 nm in size, and the solubility of CCM increased by more than 500 times. The HSA-CCM nanoparticles could accumulate at the cytoplasm of tumor cells and target the tumor tissues. Therefore, HSA nanoparticles fabricated by β-ME denaturation are promising nanocarriers for hydrophobic substances from chemotherapy drugs to imaging probes.

  16. Curcumin-incorporated albumin nanoparticles and its tumor image.

    PubMed

    Gong, Guangming; Pan, Qinqin; Wang, Kaikai; Wu, Rongchun; Sun, Yong; Lu, Ying

    2015-01-30

    Albumin is an ideal carrier for hydrophobic drugs. This paper reports a facile route to develop human serum albumin (HSA)-curcumin (CCM) nanoparticles, in which β-mercaptoethanol (β-ME) acted as an inducer and CCM acted as a bridge. Fluorescence quenching and conformational changes in HSA-CCM nanoparticles occurred during assembly. Disulfide bonds and hydrophobic interactions may play a key role in assembly. HSA-CCM nanoparticles were about 130 nm in size, and the solubility of CCM increased by more than 500 times. The HSA-CCM nanoparticles could accumulate at the cytoplasm of tumor cells and target the tumor tissues. Therefore, HSA nanoparticles fabricated by β-ME denaturation are promising nanocarriers for hydrophobic substances from chemotherapy drugs to imaging probes. PMID:25558927

  17. Hybrid organic-inorganic monolithic enzymatic reactor with SBA-15 nanoparticles incorporated.

    PubMed

    Zhang, Zhaodi; Zhang, Lingyi; Zhang, Chenggong; Zhang, Weibing

    2014-02-01

    A novel enzymatic reactor was prepared by incorporating SBA-15 nanoparticles into hybrid organic-inorganic monolith and immobilizing trypsin with glutaraldehyde as bridging reagent. Preparation and operation conditions including nanoparticles percentage and residence time were optimized to improve the digestion efficiency. The digestion products were characterized by Matrix Assisted Laser Desorption Ionization Time of Flight Mass Spectrometry (MALDI-TOF-MS) with sequence coverage of 50%, 93% and 71% for bovine serum albumin, myoglobin and cytochrome C, while consuming only about 19s in dynamic mode. Compared with enzymatic reactor without nanoparticles incorporated, the enzymatic reactor with SBA-15 nanoparticles embedded achieved higher digestion efficiency by introducing more trypsin, which was originated from combination of SBA-15 nanoparticles and hybrid organic-inorganic monolith. PMID:24401445

  18. Silver nanoparticles incorporated onto ordered mesoporous silica from Tollen's reagent

    NASA Astrophysics Data System (ADS)

    Zienkiewicz-Strzałka, M.; Pasieczna-Patkowska, S.; Kozak, M.; Pikus, S.

    2013-02-01

    Noble metal nanostructures supported on mesoporous silica are bridge between traditional silica adsorbents and modern catalysts. In this work the Ag/SBA-15 mesoporous materials were synthesized and characterized. Various forms of nanosilver supported on ordered mesoporous template have been successfully obtained via proposed procedures. In all synthesized materials, Tollen's reagent (diammine silver complex [Ag(NH3)2]+) was used as a silver source. Silver nanoparticles were prepared by reduction of ammoniacal silver complex by formaldehyde in the solution of stabilizer. After reduction, Ag nanoparticles could be deposited on SBA-15, or added during traditional synthesis of SBA-15 giving silver or silver chloride nanoparticles in the combination with porous silica. Silver nanostructures as nanoparticles or nanowires were also embedded onto the SBA-15 by incipient wetness impregnation of silver ions. Absorbed silver ions were next reduced under hydrogen at high temperature. There are many advantages of utilized ammoniacal silver complex as a silver source. Proposed method is capable to synthesis of various metal nanostructures with controlled composition and morphology. The silver ammonia complex is composed of two ions surrounding and protecting the central silver ion, so it is possible to obtain very small nanoparticles using simple approach without any functionalization of external and internal surface of SBA-15. This approach allows obtaining greatly small silver nanoparticles on SBA-15 (4 nm) or nanowires depending on the metal loading amount. Moreover, the colloidal silver solution prepared from Tollen's reagent, in the presence of triblock copolymer, remains stable for a long time. Reduction of Tollen's reagent to silver colloidal solution seems to be efficient, fast and interesting approach for the preparation of supported silver nanostructures Obtained samples were characterized by powder X-ray diffraction, small angle X-ray scattering (SAXS), UV-vis spectroscopy, transmission electron microscopy (TEM), nitrogen adsorption-desorption isotherms and photoacoustic spectroscopy (PAS).

  19. Optofluidics incorporating actively controlled micro- and nano-particles

    PubMed Central

    Kayani, Aminuddin A.; Khoshmanesh, Khashayar; Ward, Stephanie A.; Mitchell, Arnan; Kalantar-zadeh, Kourosh

    2012-01-01

    The advent of optofluidic systems incorporating suspended particles has resulted in the emergence of novel applications. Such systems operate based on the fact that suspended particles can be manipulated using well-appointed active forces, and their motions, locations and local concentrations can be controlled. These forces can be exerted on both individual and clusters of particles. Having the capability to manipulate suspended particles gives users the ability for tuning the physical and, to some extent, the chemical properties of the suspension media, which addresses the needs of various advanced optofluidic systems. Additionally, the incorporation of particles results in the realization of novel optofluidic solutions used for creating optical components and sensing platforms. In this review, we present different types of active forces that are used for particle manipulations and the resulting optofluidic systems incorporating them. These systems include optical components, optofluidic detection and analysis platforms, plasmonics and Raman systems, thermal and energy related systems, and platforms specifically incorporating biological particles. We conclude the review with a discussion of future perspectives, which are expected to further advance this rapidly growing field. PMID:23864925

  20. Optofluidics incorporating actively controlled micro- and nano-particles.

    PubMed

    Kayani, Aminuddin A; Khoshmanesh, Khashayar; Ward, Stephanie A; Mitchell, Arnan; Kalantar-Zadeh, Kourosh

    2012-09-01

    The advent of optofluidic systems incorporating suspended particles has resulted in the emergence of novel applications. Such systems operate based on the fact that suspended particles can be manipulated using well-appointed active forces, and their motions, locations and local concentrations can be controlled. These forces can be exerted on both individual and clusters of particles. Having the capability to manipulate suspended particles gives users the ability for tuning the physical and, to some extent, the chemical properties of the suspension media, which addresses the needs of various advanced optofluidic systems. Additionally, the incorporation of particles results in the realization of novel optofluidic solutions used for creating optical components and sensing platforms. In this review, we present different types of active forces that are used for particle manipulations and the resulting optofluidic systems incorporating them. These systems include optical components, optofluidic detection and analysis platforms, plasmonics and Raman systems, thermal and energy related systems, and platforms specifically incorporating biological particles. We conclude the review with a discussion of future perspectives, which are expected to further advance this rapidly growing field. PMID:23864925

  1. Electrospun Polycaprolactone Membrane Incorporated with Biosynthesized Silver Nanoparticles as Effective Wound Dressing Material.

    PubMed

    Thomas, Roshmi; Soumya, K R; Mathew, Jyothis; Radhakrishnan, E K

    2015-08-01

    Biosynthesized silver nanoparticles (AgNPs) incorporated polycaprolactone (PCL) nanomembrane was prepared by electrospinning as a cost-effective nanocomposite for application as an antimicrobial agent against wound infection. The nanocomposite membrane was characterized by Fourier transform infrared (FTIR) spectroscopy, X-ray diffraction (XRD) analysis and Scanning Electron microscopy (SEM). The hydrophilicity analysis of electrospun membranes as evaluated by water contact angle measurement showed the change of hydrophobicity of PCL to hydrophilic upon incorporation of silver nanoparticles. Better mechanical properties were also observed for PCL membrane due to the incorporation of silver nanoparticles and are highly supportive to explore its biomedical applications. Further antibacterial analysis of silver nanoparticle-incorporated PCL membrane against common wound pathogens coagulase-negative Staphylococcus epidermidis and Staphylococcus haemolyticus showed remarkable activity. As biosynthesized AgNPs are least explored for clinical applications, the current study is a promising cost-effective method to explore the development of silver nanoparticle-based electrospun nanocomposite to resist wound-associated infection. PMID:26113218

  2. Superparamagnetic iron oxide nanoparticles incorporated into silica nanoparticles by inelastic collision via ultrasonic field: Role of colloidal stability

    NASA Astrophysics Data System (ADS)

    Sodipo, Bashiru Kayode; Azlan, Abdul Aziz

    2015-04-01

    Superparamagnetic iron oxide nanoparticles (SPION)/Silica composite nanoparticles were prepared by ultrasonically irradiating colloidal suspension of silica and SPION mixture. Both silica and SPION were synthesized independently via co-precipitation and sol-gel method, respectively. Their mixtures were sonicated at different pH between 3 and 5. Electrophoresis measurement and other physicochemical analyses of the products demonstrate that at lower pH SPION was found incorporated into the silica. However, at pH greater than 4, SPION was unstable and unable to withstand the turbulence flow and shock wave from the ultrasonic field. Results suggest that the formation of the SPION/silica composite nanoparticles is strongly related to the inelastic collision induced by ultrasonic irradiation. More so, the formation the composite nanoparticles via the ultrasonic field are dependent on the zeta potential and colloidal stability of the particles.

  3. Superparamagnetic iron oxide nanoparticles incorporated into silica nanoparticles by inelastic collision via ultrasonic field: Role of colloidal stability

    SciTech Connect

    Sodipo, Bashiru Kayode; Azlan, Abdul Aziz

    2015-04-24

    Superparamagnetic iron oxide nanoparticles (SPION)/Silica composite nanoparticles were prepared by ultrasonically irradiating colloidal suspension of silica and SPION mixture. Both silica and SPION were synthesized independently via co-precipitation and sol-gel method, respectively. Their mixtures were sonicated at different pH between 3 and 5. Electrophoresis measurement and other physicochemical analyses of the products demonstrate that at lower pH SPION was found incorporated into the silica. However, at pH greater than 4, SPION was unstable and unable to withstand the turbulence flow and shock wave from the ultrasonic field. Results suggest that the formation of the SPION/silica composite nanoparticles is strongly related to the inelastic collision induced by ultrasonic irradiation. More so, the formation the composite nanoparticles via the ultrasonic field are dependent on the zeta potential and colloidal stability of the particles.

  4. Maximizing dye fluorescence via incorporation of metallic nanoparticles in solution

    NASA Astrophysics Data System (ADS)

    Xu, Yang; Lei, Guangyin; Booker, Annette C.; Linares, Katherine A.; Fleming, Dara L.; Meehan, Kathleen; Lu, Guo-Quan; Love, Nancy G.; Love, Brian J.

    2004-12-01

    Gram-negative bacteria initiate a stress response in which the cells efflux potassium when electrophilic toxins are introduced into their environment. Hence, measurement of K+ concentration in the surrounding water using a fluorescence-based potassium-selective optode has been proposed for environmental and homeland security applications. Unfortunately, the fluorophore commonly used in such an optode is inefficient. Surface enhanced fluorescence (SEF) can be used to increase its fluorescence efficiency, which will improve the sensor's performance. To understand this phenomenon before applying it to the optode system, Rose Bengal (RB), an inexpensive and well characterized dye, in solution with gold and silver nanoparticles was studied. As expected, fluorescence from RB-gold solutions was low since alignment of gold's surface plasmon resonance (SPR) peak and absorption and fluorescence energies in RB favored energy transfer from RB to the gold nanoparticles. The alignment of the silver's SPR peak and the RB transitions favored transfer from silver to RB. SEF was observed in solutions with large dye-to-silver separation. However, little fluorescence was observed when the solution was pumped at the silver's SPR peak. Fluorescence from the dye decreased as dye-to-silver separation decreased. An explanation for these observations is presented; additional research is needed to develop a complete understanding.

  5. E-beam crosslinked, biocompatible functional hydrogels incorporating polyaniline nanoparticles

    NASA Astrophysics Data System (ADS)

    Dispenza, C.; Sabatino, M.-A.; Niconov, A.; Chmielewska, D.; Spadaro, G.

    2012-09-01

    PANI aqueous nanocolloids in their acid-doped, inherently conductive form were synthesised by means of suitable water soluble polymers used as stabilisers. In particular, poly(vinyl alcohol) (PVA) or chitosan (CT) was used to stabilise PANI nanoparticles, thus preventing PANI precipitation during synthesis and upon storage. Subsequently, e-beam irradiation of the PANI dispersions has been performed with a 12 MeV Linac accelerator. PVA-PANI nanocolloid has been transformed into a PVA-PANI hydrogel nanocomposite by radiation induced crosslinking of PVA. CT-PANI nanoparticles dispersion, in turn, was added to PVA to obtain wall-to-wall gels, as chitosan mainly undergoes chain scission under the chosen irradiation conditions. While the obtainment of uniform PANI particle size distribution was preliminarily ascertained with laser light scattering and TEM microscopy, the typical porous structure of PVA-based freeze dried hydrogels was observed with SEM microscopy for the hydrogel nanocomposites. UV-visible absorption spectroscopy demonstrates that the characteristic, pH-dependent and reversible optical absorption properties of PANI are conferred to the otherwise optically transparent PVA hydrogels. Selected formulations have been also subjected to MTT assays to prove the absence of cytotoxicity.

  6. A hybrid twin screw extrusion/electrospinning method to process nanoparticle-incorporated electrospun nanofibres

    NASA Astrophysics Data System (ADS)

    Erisken, Cevat; Kalyon, Dilhan M.; Wang, Hongjun

    2008-04-01

    A new hybrid methodology that fully integrates the processing capabilities of the twin screw extrusion process (conveying solids, melting, dispersive and distributive mixing, pressurization, temperature profiling, devolatilization) with electrospinning is described. The hybrid process is especially suited to the dispersion of nanoparticles into polymeric binders and the generation of nanoparticle-incorporated fibres and nanofibres. The new technology base is demonstrated with the dispersion of β-tricalcium phosphate (β-TCP) nanoparticles into poly(ɛ-caprolactone) (PCL) to generate biodegradable non-woven meshes that can be targeted as scaffolds for tissue engineering applications. The new hybrid method yielded fibre diameters in the range of 200-2000 nm for both PCL and β-TCP/PCL (35% by weight) composite scaffolds. The degree of crystallinity of polycaprolactone meshes could be manipulated in the 35.1-41% range, using the voltage strength as a parameter. The electrospinning process, integrated with dispersive kneading disc elements, facilitated the decrease of the cluster sizes and allowed the continuous compounding of the nanoparticles into the biodegradable polymer prior to electrospinning. Thermogravimetric analysis (TGA) of the non-woven meshes validated the continuous incorporation of 35 ± 1.5% (by weight) β-TCP nanoparticles for a targeted concentration of 35%. Uniaxial tensile testing of the meshes with and without the nanoparticles indicated that the ultimate tensile strength at break of the meshes increased from 0.47 ± 0.04 to 0.79 ± 0.08 MPa upon the incorporation of the β-TCP nanoparticles. This demonstration study suggests that the new technology base is particularly suitable for the concomitant dispersion and electrospinning of nanoparticles in the generation of myriad types of functional nanofibres.

  7. Kaempferol inhibits Entamoeba histolytica growth by altering cytoskeletal functions.

    PubMed

    Bolaños, Verónica; Díaz-Martínez, Alfredo; Soto, Jacqueline; Marchat, Laurence A; Sanchez-Monroy, Virginia; Ramírez-Moreno, Esther

    2015-11-01

    The flavonoid kaempferol obtained from Helianthemum glomeratum, an endemic Mexican medicinal herb used to treat gastrointestinal disorders, has been shown to inhibit growth of Entamoeba histolytica trophozoites in vitro; however, the mechanisms associated with this activity have not been documented. Several works reported that kaempferol affects cytoskeleton in mammalian cells. In order to gain insights into the action mechanisms involved in the anti-amoebic effect of kaempferol, here we evaluated the effect of this compound on the pathogenic events driven by the cytoskeleton during E. histolytica infection. We also carried out a two dimensional gel-based proteomic analysis to evidence modulated proteins that could explain the phenotypical changes observed in trophozoites. Our results showed that kaempferol produces a dose-dependent effect on trophozoites growth and viability with optimal concentration being 27.7μM. Kaempferol also decreased adhesion, it increased migration and phagocytic activity, but it did not affect erythrocyte binding nor cytolytic capacity of E. histolytica. Congruently, proteomic analysis revealed that the cytoskeleton proteins actin, myosin II heavy chain and cortexillin II were up-regulated in response to kaempferol treatment. In conclusion, kaempferol anti-amoebic effects were associated with deregulation of proteins related with cytoskeleton, which altered invasion mechanisms. PMID:26620675

  8. Electrospun PCL membranes incorporated with biosynthesized silver nanoparticles as antibacterial wound dressings

    NASA Astrophysics Data System (ADS)

    Augustine, Robin; Kalarikkal, Nandakumar; Thomas, Sabu

    2016-03-01

    An open wound is highly prone to bacterial colonization and infection. Bacterial barrier property is an important factor that determines the success of a wound coverage material. Apart from the bacterial barrier property, presence of antibacterial agents can successfully eliminate the invasion and colonization of pathogen in the wound. Silver nanoparticles are well-known antimicrobial agents against a wide range of microorganisms. Biosynthesized silver nanoparticles are more acceptable for medical applications due to superior biocompatibility than chemically synthesized ones. Presence of biomolecules on biosynthesized silver nanoparticles enhances its therapeutic efficiency. Polycaprolactone (PCL) is a well-known material for biomedical applications including wound dressings. Electrospinning is an excellent technique for the fabrication of thin membranes for wound coverage applications with barrier property against microbes. In this paper, we report the fabrication and characterization of electrospun PCL membranes incorporated with biosynthesized silver nanoparticles for wound dressing applications.

  9. Platinum-Incorporating Poly(N-vinylpyrrolidone)-poly(aspartic acid) Pseudoblock Copolymer Nanoparticles for Drug Delivery.

    PubMed

    Yao, Xikuang; Xie, Chen; Chen, Weizhi; Yang, Chenchen; Wu, Wei; Jiang, Xiqun

    2015-07-13

    Cisplatin-incorporating pseudoblock copolymer nanoparticles with high drug loading efficiency (ca. 50%) were prepared built on host-guest inclusion complexation between β-cyclodextrin end-capped poly(N-vinylpyrrolidone) block and admantyl end-capped poly(aspartic acid) block, followed by the coordination between cisplatin and carboxyl groups in poly(aspartic acid). The host-guest interaction between the two polymer blocks was examined by two-dimensional nuclear overhauser effect spectroscopy. The size and morphology of nanoparticles formed were characterized by dynamic light scattering, zeta potential, transmission electron microscopy, and atomic force microscopy. The size control of nanoparticles was carried out by varying the ratio of poly(N-vinylpyrrolidone) to poly(aspartic acid). The nanoparticles were stable in the aqueous medium with different pH values but disintegrated in the medium containing Cl(-) ions. The in vitro and in vivo antitumor effects of cisplatin-loaded nanoparticles were evaluated. The biodistribution of the nanoparticles in vivo was studied by noninvasive near-infrared fluorescence imaging and ion-coupled plasma mass spectrometry. It was found that cisplatin-loaded nanoparticles could effectively accumulate in the tumor site and exhibited significant superior in vivo antitumor activity to the commercially available free cisplatin by combining the tumor volume, body weight, and survival rate measurements. PMID:26023705

  10. Antitumor activity of sorafenib-incorporated nanoparticles of dextran/poly(dl-lactide- co-glycolide) block copolymer

    NASA Astrophysics Data System (ADS)

    Kim, Do Hyung; Kim, Min-Dae; Choi, Cheol-Woong; Chung, Chung-Wook; Ha, Seung Hee; Kim, Cy Hyun; Shim, Yong-Ho; Jeong, Young-Il; Kang, Dae Hwan

    2012-01-01

    Sorafenib-incoporated nanoparticles were prepared using a block copolymer that is composed of dextran and poly( DL-lactide- co-glycolide) [Dex bLG] for antitumor drug delivery. Sorafenib-incorporated nanoparticles were prepared by a nanoprecipitation-dialysis method. Sorafenib-incorporated Dex bLG nanoparticles were uniformly distributed in an aqueous solution regardless of the content of sorafenib. Transmission electron microscopy of the sorafenib-incorporated Dex bLG nanoparticles revealed a spherical shape with a diameter < 300 nm. Sorafenib-incorporated Dex bLG nanoparticles at a polymer/drug weight ratio of 40:5 showed a relatively uniform size and morphology. Higher initial drug feeding was associated with increased drug content in nanoparticles and in nanoparticle size. A drug release study revealed a decreased drug release rate with increasing drug content. In an in vitro anti-proliferation assay using human cholangiocarcinoma cells, sorafenib-incorporated Dex bLG nanoparticles showed a similar antitumor activity as sorafenib. Sorafenib-incorporated Dex bLG nanoparticles are promising candidates as vehicles for antitumor drug targeting.

  11. Antitumor activity of sorafenib-incorporated nanoparticles of dextran/poly(dl-lactide-co-glycolide) block copolymer

    PubMed Central

    2012-01-01

    Sorafenib-incoporated nanoparticles were prepared using a block copolymer that is composed of dextran and poly(DL-lactide-co-glycolide) [DexbLG] for antitumor drug delivery. Sorafenib-incorporated nanoparticles were prepared by a nanoprecipitation-dialysis method. Sorafenib-incorporated DexbLG nanoparticles were uniformly distributed in an aqueous solution regardless of the content of sorafenib. Transmission electron microscopy of the sorafenib-incorporated DexbLG nanoparticles revealed a spherical shape with a diameter < 300 nm. Sorafenib-incorporated DexbLG nanoparticles at a polymer/drug weight ratio of 40:5 showed a relatively uniform size and morphology. Higher initial drug feeding was associated with increased drug content in nanoparticles and in nanoparticle size. A drug release study revealed a decreased drug release rate with increasing drug content. In an in vitro anti-proliferation assay using human cholangiocarcinoma cells, sorafenib-incorporated DexbLG nanoparticles showed a similar antitumor activity as sorafenib. Sorafenib-incorporated DexbLG nanoparticles are promising candidates as vehicles for antitumor drug targeting. PMID:22283905

  12. Radiolysis of kaempferol in water/methanol mixtures. Evaluation of antioxidant activity of kaempferol and products formed.

    PubMed

    Marfak, Abdelghafour; Trouillas, Patrick; Allais, Daovy-Paulette; Champavier, Yves; Calliste, Claude-Alain; Duroux, Jean-Luc

    2003-02-26

    Oxidative reaction between hydroxymethyl radical ((*)CH(2)OH) and kaempferol, in methanol and methanol/water mixtures, was studied by gamma-radiolysis using a (60)Co source. Radiolysis was performed with concentrations and doses ranging from 5 x 10(-)(5) M to 5 x 10(-)(3) M and from 0.5 kGy to 14 kGy, respectively. Kaempferol degradation was followed by HPLC. Results showed that (*)CH(2)OH reacts with kaempferol at the 3-OH group and produces two depsides (K1 and K2) and other products including K3. K1, K2, and K3 were identified by NMR, LC-MS, and HRMS. The kaempferol degradation pathway leading to the K1, K2, and K3 formation is proposed. It was observed that the more water concentration in the irradiation medium increases, the more K2 concentration increases. Comprehension of food preservation is not clear because many phenomena occurring during irradiation are not established. Radiolysis of kaempferol in water/methanol mixtures helps to elucidate the phenomenon and it is possible that during the treatment of nutriments by gamma-irradiation, a series of products such as depside K2 could be formed. Antioxidant properties of kaempferol radiolysis products were evaluated according to their capacity to decrease the EPR DPPH (1,1-diphenyl-2-picrylhydrazil) signal and to inhibit superoxide radicals formed by the enzyme reaction "xanthine + xanthine oxidase". PMID:12590467

  13. Associations between iron oxyhydroxide nanoparticle growth and metal adsorption/structural incorporation

    SciTech Connect

    Kim, C.S.; Lentini, C.J.; Waychunas, G.A.

    2008-09-15

    The interaction of metal ions and oxyanions with nanoscale mineral phases has not yet been extensively studied despite the increased recognition of their prevalence in natural systems as a significant component of geomedia. A combination of macroscopic uptake studies to investigate the adsorption behavior of As(V), Cu(II), Hg(II), and Zn(II) onto nanoparticulate goethite ({alpha}-FeOOH) as a function of aging time at elevated temperature (75 C) and synchrotron-based X-ray studies to track changes in both the sorption mode and the rate of nanoparticle growth reveal the effects that uptake has on particle growth. Metal(loid) species which sorb quickly to the iron oxyhydroxide particles (As(V), Cu(II)) appear to passivate the particle surface, impeding the growth of the nanoparticles with progressive aging; in contrast, species that sorb more slowly (Hg(II), Zn(II)) have considerably less impact on particle growth. Progressive changes in the speciation of these particular metals with time suggest shifts in the mode of metal uptake with time, possibly indicating structural incorporation of the metal(loid) into the nanoparticle; this is supported by the continued increase in uptake concomitant with particle growth, implying that metal species may transform from surface-sorbed species to more structurally incorporated forms. This type of incorporation would have implications for the long-term fate and mobility of metals in contaminated regions, and affect the strategy for potential remediation/modeling efforts.

  14. Ionic liquid pretreatment of poplar wood at room temperature: swelling and incorporation of nanoparticles

    SciTech Connect

    Lucas, Marcel; Macdonald, Brian A; Wagner, Gregory L; Joyce, Steven A; Rector, Kirk D

    2010-01-01

    Lignocellulosic biomass represents a potentially sustainable source of liquid fuels and commodity chemicals. It could satisfy the energy needs for transportation and electricity generation, while contributing substantially to carbon sequestration and limiting the accumulation of greenhouse gases in the atmosphere. Potential feedstocks are abundant and include crops, agricultural wastes, forest products, grasses, and algae. Among those feedstocks, wood is mainly constituted of three components: cellulose, hemicellulose, and lignin. The conversion process of lignocellulosic biomass typically consists of three steps: (1) pretreatment; (2) hydrolysis of cellulose and hemicellulose into fermentable sugars; and (3) fermentation of the sugars into liquid fuels (ethanol) and other commodity chemicals. The pretreatment step is necessary due to the complex structure of the plant cell wall and the chemical resistance of lignin. Most current pretreatments are energy-intensive and/or polluting. So it is imperative to develop new pretreatments that are economically viable and environmentally friendly. Recently, ionic liquids have attracted considerable interest, due to their ability to dissolve biopolymers, such as cellulose, lignin, native switchgrass, and others. Ionic liquids are also considered green solvents, since they have been successfully recycled at high yields for further use with limited efficiency loss. Also, a few microbial cellulases remain active at high ionic liquid concentration. However, all studies on the dissolution of wood in ionic liquids have been conducted so far at high temperatures, typically above 90 C. Development of alternative pretreatments at room temperature is desirable to eliminate the additional energy cost. In this study, thin sections of poplar wood were swollen at room temperature by a 3 h ionic liquid (1-ethyl-3-methylimidazolium acetate or EMIMAc) pretreatment. The pretreated sample was then exposed to an aqueous suspension of nanoparticles that resulted in the sample contraction and the deposition of nanoparticles onto the surface and embedded into the cell wall. To date, both silver and gold particles ranging in size from 40-100 nm have been incorporated into wood. Penetration of gold nanoparticles of 100 nm diameter in the cell walls was best confirmed by near-infrared confocal Raman microscopy, since the deposition of gold nanoparticles induces a significant enhancement of the Raman signal from the wood in their close proximity, an enhancement attributed to the surface-enhanced Raman effect (SERS). After rinsing with water, scanning electron microscopy (SEM) and Raman images of the same areas show that most nanoparticles remained on the pretreated sample. Raman images at different depths reveal that a significant number of nanoparticles were incorporated into the wood sample, at depths up to 4 {micro}m, or 40 times the diameter of the nanoparticles. Control experiments on an untreated wood sample resulted in the deposition of nanoparticles only at the surface and most nanoparticles were removed upon rinsing. This particle incorporation process enables the development of new pretreatments, since the nanoparticles have a high surface-to-volume ratio and could be chemically functionalized. Other potential applications for the incorporated nanoparticles include isotope tracing, catalysis, imaging agents, drug-delivery systems, energy-storage devices, and chemical sensors.

  15. Impact of magnetite nanoparticle incorporation on the eigenfrequencies of nanocomposite microcapsules

    NASA Astrophysics Data System (ADS)

    Glukhova, O. E.; Grishina, O. A.

    2015-03-01

    Modern researches showed that nanocomposite films with magnetite nanoparticle incorporation have good perspectives for applications in electronics to create antireflective coatings and also for biomedical applications to create coatings with remote control of physical properties using alternative magnetic field or microwave radiation, which is very important for fabrication of new generation substrates in tissue engineering and advanced drug delivery systems. In particular, the unique properties of advanced nanocomposite microcapsules allowed developing of the supramolecular system of targeted drug delivery. A study of the behavior of the nanocomposite shell of microcapsules, which consists of alternate layers of negatively charged iron oxide nanoparticles and cationic polyallylamine hydrochloride molecules, was carried out. The aim of the present study was to investigate the effect of the number of nanoparticle layers on magnetic properties of polyelectrolyte/nanoparticles nanocomposite microcapsules prepared via layer-by-layer technique using iron oxide colloids. In result of numerical simulation using ANSYS Workbench software the behavior of the nanocomposite shell of microcapsules depending on the concentration of magnetite particles in it was investigated. Modal and harmonic analysis of behavior of the microcapsules shell was conducted in water at a temperature of 37°. As a result of numerical experiment the eigenfrequencies and mode shape were first time defined for any modifications of the nanocomposite microcapsules. It has been established that the magnetic permeability value depends on the number of iron oxide nanoparticle layers in a nanocomposite microcapsule.

  16. Preparation of polylactide-co-glycolide nanoparticles incorporating celecoxib and their antitumor activity against brain tumor cells

    PubMed Central

    Kim, Tae-Ho; Jeong, Young-Il; Jin, Shu-Guang; Pei, Jian; Jung, Tae-Young; Moon, Kyung-Sub; Kim, In-Young; Kang, Sam-Suk; Jung, Shin

    2011-01-01

    Background Celecoxib, a cyclo-oxygenase (COX)-2 inhibitor, has been reported to mediate growth inhibitory effects and to induce apoptosis in various cancer cell lines. In this study, we examined the potential effects of celecoxib on glioma cell proliferation, migration, and inhibition of COX-2 expression in vitro. Methods Celecoxib was incorporated into poly DL-lactide-co-glycolide (PLGA) nanoparticles for antitumor drug delivery. Results PLGA nanoparticles incorporating celecoxib had spherical shapes and their particle sizes were in the range of 50–200 nm. Drug-loading efficiency was not significantly changed according to the solvent used, except for acetone. Celecoxib was released from the PLGA nanoparticles for more than 2 days, and the higher the drug content, the longer the duration of drug release. PLGA nanoparticles incorporating celecoxib showed cytotoxicity against U87MG tumor cells similar to that of celecoxib administered alone. Furthermore, celecoxib did not affect the degree of migration of U87MG cells. PLGA nanoparticles incorporating celecoxib showed dose-dependent cytotoxicity similar to that of celecoxib alone in C6 rat glioma cells. Western blot assay of the C6 cells showed that neither celecoxib alone nor PLGA nanoparticles incorporating celecoxib affected COX-2 expression. Conclusion PLGA nanoparticles incorporating celecoxib had antitumor activity similar to that of celecoxib alone, even though these particles did not affect the degree of migration or COX-2 expression in the tumor cells. PMID:22114493

  17. Effect of silver nanoparticles incorporation on viscoelastic properties of acrylic resin denture base material

    PubMed Central

    Mahross, Hamada Zaki; Baroudi, Kusai

    2015-01-01

    Objective: The objective was to investigate the effect of silver nanoparticles (AgNPs) incorporation on viscoelastic properties of acrylic resin denture base material. Materials and Methods: A total of 20 specimens (60 × 10 × 2 mm) of heat cured acrylic resin were constructed and divided into four groups (five for each), according to the concentration of AgNPs (1%, 2%, and 5% vol.) which incorporated into the liquid of acrylic resin material and one group without additives (control group). The dynamic viscoelastic test for the test specimens was performed using the computerized material testing system. The resulting deflection curves were analyzed by material testing software NEXYGEN MT. Results: The 5% nanoparticles of silver (NAg) had significantly highest mean storage modulus E’ and loss tangent Tan δ values followed by 2% NAg (P < 0.05). For 1% nanosilver incorporation (group B), there were no statistically significant differences in storage modulus E’, lost modulus E” or loss tangent Tan δ with other groups (P > 0.05). Conclusion: The AgNPs incorporation within the acrylic denture base material can improve its viscoelastic properties. PMID:26038651

  18. Monolithic stationary phases with incorporated fumed silica nanoparticles. Part II. Polymethacrylate-based monolithic column with "covalently" incorporated modified octadecyl fumed silica nanoparticles for reversed-phase chromatography.

    PubMed

    Aydoğan, Cemil; El Rassi, Ziad

    2016-05-01

    This study is concerned with the incorporation of surface modified fumed silica nanoparticles (FSNPs) into polymethacrylate based monolithic columns for use in reversed phase chromatography (RPC) of small solutes and proteins. First, FSNPs were modified with 3-(trimethoxysilyl)propylmethacrylate (TMSPM) to yield the "hybrid" methacryloyl fumed silica nanoparticle (MFSNP) monomer. The resulting MFSNP was then mixed with glyceryl monomethacrylate (GMM) and ethylene dimethacrylate (EDMA) in a binary porogenic solvent composed of cyclohexanol and dodecanol, and the in situ copolymerization of MFSNP, GMM and EDMA was performed in a stainless steel column of 4.6 mm i.d. The silanol groups of the hybrid monolith thus obtained were grafted with octadecyl ligands by perfusing the hybrid monolithic column with a solution of 4% w/v of dimethyloctadecylchlorosilane (DODCS) in toluene while the column was maintained at 110°C for 6h (in a heated HPLC oven). One of the originalities of this study was to demonstrate MFSNP as a novel derivatized "hybrid monomer" in making RPC monolithic columns with surface bound octadecyl ligands. In this respect, the RPC behavior of the monolithic column with "covalently" incorporated FNSPs having surface grafted octadecyl ligands was evaluated with alkylbenzenes, aniline derivatives and phenolic compounds. The results showed that the hybrid poly(GMA-EDMA-MFSNP) having surface bound octadecyl ligands exhibited hydrophobic interactions under reversed phase elution conditions. Furthermore, six standard proteins were baseline separated on the column using a 10min linear gradient elution at increasing ACN concentration in the mobile phase at a flow rate of 1.0mL/min using a 10 cm×4.6mm i.d. column. The relative standard deviations (RSDs) for the retention times of the tested solutes were lower than 2.1% and 2.4% under isocratic elution and gradient elution conditions, respectively. PMID:27059396

  19. Formation mechanism of incorporating metal nanoparticles into highly stable metal-organic-frameworks

    NASA Astrophysics Data System (ADS)

    Tang, Yang

    Incorporating shape and size controlled metal nanoparticles (NPs) into metal-organic-frameworks (MOFs) shows great potential in heterogeneous catalysis. The combination of ordered nanoporous structure of MOFs and the well-defined surfaces of metal NPs provides a new tool to modulate the catalysis on the metal surface. Due to the large pore size, framework flexibility and selective interaction with gas molecules, MOFs have been widely used for gas storage with high selectivity. Among which have been developed to date, Zeolitic Imidazolate Frameworks-8 (ZIF-8) and UiO-66 show advantageous properties. The solvent resistivity and high thermal stability makes them stand out to be good candidates as shell materials in core shell catalysts. In our work, we developed an efficient way to create a yolk-shell structure of Pd nanoparticles in ZIF-8 and, at the same time, a method to incorporate the shape/size controlled Pt nanoparticles into well-defined octahedral UiO-66 nanocrystals with the control of concentration and dispersion. The formation mechanisms of both yolk-shell and core-shell structures were also studied in the work.

  20. Claudin 4-targeted protein incorporated into PLGA nanoparticles can mediate M cell targeted delivery

    PubMed Central

    Rajapaksa, Thejani E.; Stover-Hamer, Mary; Fernandez, Xiomara; Eckelhoefer, Holly A.; Lo, David D.

    2009-01-01

    Polymer-based microparticles are in clinical use mainly for their ability to provide controlled release of peptides and compounds, but they are also being explored for their potential to deliver vaccines and drugs as suspensions directly into mucosal sites. It is generally assumed that uptake is mediated by epithelial M cells, but this is often not directly measured. To study the potential for optimizing M cell uptake of polymer microparticles in vivo, we produced sub-micron size PLGA particles incorporating a recombinant protein. This recombinant protein was produced with or without a c-terminal peptide previously shown to have high affinity binding to Claudin 4, a protein associated with M cell endocytosis. While the PLGA nanoparticles incorporate the protein throughout the matrix, much of the protein was also displayed on the surface, allowing us to take advantage of the binding activity of the targeting peptide. Accordingly, we found that instillation of these nanoparticles into the nasal passages or stomach of mice was found to significantly enhance their uptake by upper airway and intestinal M cells. Our results suggest that a reasonably simple nanoparticle manufacture method can provide insight into developing an effective needle-free delivery system. PMID:19896996

  1. Kaempferol, a potential cytostatic and cure for inflammatory disorders.

    PubMed

    Rajendran, Peramaiyan; Rengarajan, Thamaraiselvan; Nandakumar, Natarajan; Palaniswami, Rajendran; Nishigaki, Yutaka; Nishigaki, Ikuo

    2014-10-30

    Kaempferol (3,5,7-trihydroxy-2-(4-hydroxyphenyl)-4H-1-benzopyran-4-one) is a flavonoid found in many edible plants (e.g., tea, broccoli, cabbage, kale, beans, endive, leek, tomato, strawberries, and grapes) and in plants or botanical products commonly used in traditional medicine (e.g., Ginkgo biloba, Tilia spp, Equisetum spp, Moringa oleifera, Sophora japonica and propolis). Its anti-oxidant/anti-inflammatory effects have been demonstrated in various disease models, including those for encephalomyelitis, diabetes, asthma, and carcinogenesis. Moreover, kaempferol act as a scavenger of free radicals and superoxide radicals as well as preserve the activity of various anti-oxidant enzymes such as catalase, glutathione peroxidase, and glutathione-S-transferase. The anticancer effect of this flavonoid is mediated through different modes of action, including anti-proliferation, apoptosis induction, cell-cycle arrest, generation of reactive oxygen species (ROS), and anti-metastasis/anti-angiogenesis activities. In addition, kaempferol was found to exhibit its anticancer activity through the modulation of multiple molecular targets including p53 and STAT3, through the activation of caspases, and through the generation of ROS. The anti-tumor effects of kaempferol have also been investigated in tumor-bearing mice. The combination of kaempferol and conventional chemotherapeutic drugs produces a greater therapeutic effect than the latter, as well as reduces the toxicity of the latter. In this review, we summarize the anti-oxidant/anti-inflammatory and anticancer effects of kaempferol with a focus on its molecular targets and the possible use of this flavonoid for the treatment of inflammatory diseases and cancer. PMID:25147152

  2. The incorporation of nanoparticles into conventional glass-ionomer dental restorative cements.

    PubMed

    Gjorgievska, Elizabeta; Van Tendeloo, Gustaaf; Nicholson, John W; Coleman, Nichola J; Slipper, Ian J; Booth, Samantha

    2015-04-01

    Conventional glass-ionomer cements (GICs) are popular restorative materials, but their use is limited by their relatively low mechanical strength. This paper reports an attempt to improve these materials by incorporation of 10 wt% of three different types of nanoparticles, aluminum oxide, zirconium oxide, and titanium dioxide, into two commercial GICs (ChemFil® Rock and EQUIA™ Fil). The results indicate that the nanoparticles readily dispersed into the cement matrix by hand mixing and reduced the porosity of set cements by filling the empty spaces between the glass particles. Both cements showed no significant difference in compressive strength with added alumina, and ChemFil® Rock also showed no significant difference with zirconia. By contrast, ChemFil® Rock showed significantly higher compressive strength with added titania, and EQUIA™ Fil showed significantly higher compressive strength with both zirconia and titania. Fewer air voids were observed in all nanoparticle-containing cements and this, in turn, reduced the development of cracks within the matrix of the cements. These changes in microstructure provide a likely reason for the observed increases in compressive strength, and overall the addition of nanoparticles appears to be a promising strategy for improving the physical properties of GICs. PMID:25691120

  3. Incorporation of Ag metallic nanoparticles in 3D gelatin matrix via the green strategy solution plasma.

    PubMed

    Pootawang, Panuphong; Kim, Seong Cheol; Kim, Jung Wan; Lee, Sang Yul

    2013-01-01

    The environmental concern pays much attention to the recent cause of the global warming effect. The reduction of the chemical uses is one of many ways to avoid this crucial problem. Herein, the green process for silver nanometallic particle formation and incorporation in gelatin are proposed. By using a novel discharge process in solution named solution plasma, the silver nanometallic particle formation and its incorporation in gelatin could be accomplished in one-batch reactor during discharge by using silver nitrate (AgNO3) solution as the precursor and controlling systematical parameters. The three-dimensional scaffolds of gelatin/silver biocomposite were fabricated using lyophilizer and the water-soluble property of gelatin was improved by irradiation of ultraviolet ray. The well dispersed silver nanoparticles with the mean particle size 10-20 nm in the good texture of gelatin matrix were obtained. The density of micropore in gelatin/silver scaffold was proportional to the gelatin concentration. In addition, thermal stability of prepared samples had no change comparing with pure gelatin, indicating that the incorporation of silver nanoparticles in gelatin matrix did not affect to the nature of gelatin. PMID:23646779

  4. Incorporation of liquid lipid in lipid nanoparticles for ocular drug delivery enhancement

    NASA Astrophysics Data System (ADS)

    Shen, Jie; Sun, Minjie; Ping, Qineng; Ying, Zhi; Liu, Wen

    2010-01-01

    The present work investigates the effect of liquid lipid incorporation on the physicochemical properties and ocular drug delivery enhancement of nanostructured lipid carriers (NLCs) and attempts to elucidate in vitro and in vivo the potential of NLCs for ocular drug delivery. The CyA-loaded or fluorescein-marked nanocarriers composed of Precifac ATO 5 and Miglyol 840 (as liquid lipid) were prepared by melting-emulsion technology, and the physicochemical properties of nanocarriers were determined. The uptake of nanocarriers by human corneal epithelia cell lines (SDHCEC) and rabbit cornea was examined. Ex vivo fluorescence imaging was used to investigate the ocular distribution of nanocarriers. The in vitro cytotoxicity and in vivo acute tolerance were evaluated. The higher drug loading capacity and improved in vitro sustained drug release behavior of lipid nanoparticles was found with the incorporation of liquid lipid in lipid nanoparticles. The uptake of nanocarriers by the SDHCEC was increased with the increase in liquid lipid loading. The ex vivo fluorescence imaging of the ocular tissues indicated that the liquid lipid incorporation could improve the ocular retention and penetration of ocular therapeutics. No alternation was macroscopically observed in vivo after ocular surface exposure to nanocarriers. These results indicated that NLC was a biocompatible and potential nanocarrier for ocular drug delivery enhancement.

  5. Facilitating the mineralization of oligo(poly(ethylene glycol) fumarate) hydrogel by incorporation of hydroxyapatite nanoparticles.

    PubMed

    Nejadnik, M Reza; Mikos, Antonios G; Jansen, John A; Leeuwenburgh, Sander C G

    2012-05-01

    Exploring strategies to induce the mineralization of hydrogels is an important step toward the development of hydrogel-based materials for bone regeneration. In the current study, the effect of incorporating hydroxyapatite (HA) nanoparticles on the mineralization capacity of an inert poly(ethylene glycol) (PEG)-based hydrogel was investigated. HA nanoparticles were either directly loaded into oligo(poly(ethylene glycol) fumarate) (OPF) hydrogel or loaded into commonly used gelatin microsphere porogens that were subsequently integrated in the OPF matrix. Mineralization of composites after immersion of the samples in simulated body fluid up to 28 days was assessed. In contrast to the blank OPF hydrogel, the HA-containing constructs strongly mineralized such that the average rate of calcium uptake by the material was enhanced by orders of magnitude. The mineral formed was observed to be apatitic and needle shaped. The presented method allows modification of inert PEG-based hydrogels into bioactive biomaterials for applications in bone regeneration. PMID:22374694

  6. Incorporation and release of drug into/from superparamagnetic iron oxide nanoparticles

    NASA Astrophysics Data System (ADS)

    Maver, Uroš; Bele, Marjan; Makovec, Darko; Čampelj, Stanislav; Jamnik, Janko; Gaberšček, Miran

    2009-10-01

    The aim of this study was to attach a model drug (naproxen) onto superparamagnetic iron oxide nanoparticles (SPION). First, SPION were coated with thin layer of silica that contained micropores. We demonstrated that such surface functionalization could be optimized by the use of citric acid which prevented SPION agglomeration during the procedure. HRTEM investigation showed a uniform 1-2-nm-thick silica coating around SPION. This coating did not affect significantly the magnetic properties of the SPION. Into the coated SPION we successfully incorporated about 30 wt% of naproxen. The latter was readily released after immersion into a testing solution. The composites could be interesting for potential use in diagnostics.

  7. The chemopreventive effect of the dietary compound kaempferol on the MCF-7 human breast cancer cell line is dependent on inhibition of glucose cellular uptake.

    PubMed

    Azevedo, Cláudia; Correia-Branco, Ana; Araújo, João R; Guimarães, João T; Keating, Elisa; Martel, Fátima

    2015-01-01

    Our aim was to investigate the effect of several dietary polyphenols on glucose uptake by breast cancer cells. Uptake of (3)H-deoxy-D-glucose ((3)H-DG) by MCF-7 cells was time-dependent, saturable, and inhibited by cytochalasin B plus phloridzin. In the short-term (26 min), myricetin, chrysin, genistein, resveratrol, kaempferol, and xanthohumol (10-100 µM) inhibited (3)H-DG uptake. Kaempferol was found to be the most potent inhibitor of (3)H-DG uptake [IC50 of 4 µM (1.6-9.8)], behaving as a mixed-type inhibitor. In the long-term (24 h), kaempferol (30 µM) was also able to inhibit (3)H-DG uptake, associated with a 40% decrease in GLUT1 mRNA levels. Interestingly enough, kaempferol (100 µM) revealed antiproliferative (sulforhodamine B and (3)H-thymidine incorporation assays) and cytotoxic (extracellular lactate dehydrogenase activity determination) properties, which were mimicked by low extracellular (1 mM) glucose conditions and reversed by high extracellular (20 mM) glucose conditions. Finally, exposure of cells to kaempferol (30 µM) induced an increase in extracellular lactate levels over time (to 731 ± 32% of control after a 24 h exposure), due to inhibition of MCT1-mediated lactate cellular uptake. In conclusion, kaempferol potently inhibits glucose uptake by MCF-7 cells, apparently by decreasing GLUT1-mediated glucose uptake. The antiproliferative and cytotoxic effect of kaempferol in these cells appears to be dependent on this effect. PMID:25719685

  8. TOPO-capped silver selenide nanoparticles and their incorporation into polymer nanofibers using electrospinning technique

    SciTech Connect

    More, D.S.; Moloto, M.J.; Moloto, N.; Matabola, K.P.

    2015-05-15

    Highlights: • Ag{sub 2}Se nanoparticles produced spherical particles with sizes 12 nm (180 °C) and 27 nm (200 °C). • Higher temperature produced increased particle size (∼75 nm) and changed in shape. • Ag{sub 2}Se nanoparticles (0.2–0.6%) added into PVP (35–45%) to yield reduced fiber beading. • Polymer nanofibers electrospun at 11–20 kV produced fiber diameters of 425–461 nm. • Optical properties in the fibers were observed due to the Ag{sub 2}Se nanoparticles loaded. - Abstract: Electrospinning is the most common technique for fabricating polymer fibers as well as nanoparticles embedded polymer fibers. Silver selenide nanoparticles were synthesized using tri-n-octylphosphine (TOP) as solvent and tri-n-octylphosphine oxide (TOPO) as capping environment. Silver selenide was prepared by reacting silver nitrate and selenium with tri-n-octylphosphine (TOP) to form TOP–Ag and TOP–Se solutions. Both absorption and emission spectra signify the formation of nanoparticles as well as the TEM which revealed spherical particles with an average particle size of 22 nm. The polymer, PVP used was prepared at concentrations ranging from (35 to 45 wt%) and the TOPO-capped silver selenide nanoparticles (0.2 and 0.6 wt%) were incorporated into them and electrospun by varying the voltage from 11 to 20 kV. The SEM images of the Ag{sub 2}Se/PVP composite fibers revealed the fibers of diameters with average values of 425 and 461 nm. The X-ray diffraction results show peaks which were identified due to α-Ag{sub 2}Se body centered cubic compound. The sharp peak observed for all the samples at 2θ = 44.5 suggest the presence of Ag in the face centered cubic which can be attributed to higher concentration of silver nitrate used with molar ratio of selenium to silver and the abundance of silver in the silver selenide crystal. Fourier transform infrared spectroscopy, thermogravimetric analysis (TGA) and ultraviolet–visible spectroscopy were used to characterize the structure of the PVP/Ag{sub 2}Se composite fibers.

  9. Monolithic stationary phases with incorporated fumed silica nanoparticles. Part I. Polymethacrylate-based monolithic column with incorporated bare fumed silica nanoparticles for hydrophilic interaction liquid chromatography.

    PubMed

    Aydoğan, Cemil; El Rassi, Ziad

    2016-05-01

    Fumed silica nanoparticles (FSNPs), were incorporated for the first time into a polymethacrylate monolithic column containing glyceryl monomethacrylate (GMM) and ethylene dimethacrylate (EDMA) in order to develop a new monolithic column for hydrophilic interaction high performance liquid chromatography (HILIC). When compared to poly(GMM-EDMA) monolithic column without FSNPs, the same monolithic column with incorporated FSNPs yielded important effects on HILIC separations. The effects of monomers and FSNPs content of the polymerization mixture on the performance of the monolithic column were examined in details, and the optimized stationary phase was investigated over a wide range of mobile phase composition with polar acidic, weakly basic and neutral analytes including hydroxy benzoic acids, nucleotides, nucleosides, dimethylformamide, formamide and thiourea. The retention of these analytes was mainly controlled by hydrophilic interactions with the FSNPs and electrostatic repulsion from the negatively charged silica surface in the case of hydroxy benzoic acids and nucleotides. The electrostatic repulsion was minimized by decreasing the pH of the aqueous component of the mobile phase, which in turn enhanced the retention of acidic solutes. Nucleotides were best separated using step gradient elution at decreasing pH as well as ACN concentration in the mobile phase. Improved peak shape and faster analysis of nucleosides were attained by a fast linear gradient elution with a shallow decrease in the ACN content of the ACN-rich mobile phase. The run-to-run and column-to-column reproducibility were satisfactory. The percent relative standard deviations (%RSDs) for the retention times of tested solutes were lower than 2.5% under isocratic conditions and lower than 3.5 under gradient conditions. PMID:27059399

  10. Recent Updates of DNA Incorporated in Carbon Nanotubes and Nanoparticles for Electrochemical Sensors and Biosensors

    PubMed Central

    Yogeswaran, Umasankar; Thiagarajan, Soundappan; Chen, Shen-Ming

    2008-01-01

    Innovations in the field of electrochemical sensors and biosensors are of much importance nowadays. These devices are designed with probes and micro electrodes. The miniaturized designs of these sensors allow analyses of materials without damaging the samples. Some of these sensors are also useful for real time analysis within the host system, so these sensors are considered to be more advantageous than other types of sensors. The active sensing materials used in these types of sensors can be any material that acts as a catalyst for the oxidation or reduction of particular analyte or set of analytes. Among various kinds of sensing materials, deoxyribonucleic acid (DNA), carbon nanotubes (CNTs) and nanoparticles have received considerable attraction in recent years. DNA is one of the classes of natural polymers, which can interact with CNTs and nanoparticles to form new types of composite materials. These composite materials have also been used as sensing materials for sensor applications. They have advantages in characteristics such as extraordinary low weight and multifunctional properties. In this article, advantages of DNA incorporated in CNT and nanoparticle hybrids for electrochemical sensors and biosensors are presented in detail, along with some key results noted from the literature.

  11. Paclitaxel-incorporated nanoparticles using block copolymers composed of poly(ethylene glycol)/poly(3-hydroxyoctanoate)

    PubMed Central

    2014-01-01

    Block copolymers composed of poly(3-hydroxyoctanoate) (PHO) and methoxy poly(ethylene glycol) (PEG) were synthesized to prepare paclitaxel-incorporated nanoparticle for antitumor drug delivery. In a 1H-NMR study, chemical structures of PHO/PEG block copolymers were confirmed and their molecular weight (M.W.) was analyzed with gel permeation chromatography (GPC). Paclitaxel as a model anticancer drug was incorporated into the nanoparticles of PHO/PEG block copolymer. They have spherical shapes and their particle sizes were less than 100 nm. In a 1H-NMR study in D2O, specific peaks of PEG solely appeared while peaks of PHO disappeared, indicating that nanoparticles have core-shell structures. The higher M.W. of PEG decreased loading efficiency and particle size. The higher drug feeding increased drug contents and average size of nanoparticles. In the drug release study, the higher M.W. of PEG block induced the acceleration of drug release rate. The increase in drug contents induced the slow release rate of drug. In an antitumor activity study in vitro, paclitaxel nanoparticles have practically similar anti-proliferation activity against HCT116 human colon carcinoma cells. In an in vivo animal study using HCT116 colon carcinoma cell-bearing mice, paclitaxel nanoparticles have enhanced antitumor activity compared to paclitaxel itself. Therefore, paclitaxel-incorporated nanoparticles of PHO/PEG block copolymer are a promising vehicle for antitumor drug delivery. PMID:25288916

  12. Preparation and Characterization of Selenium Incorporated Guar Gum Nanoparticle and Its Interaction with H9c2 Cells

    PubMed Central

    Soumya, Rema Sreenivasan; Vineetha, Vadavanath Prabhakaran; Reshma, Premachandran Latha; Raghu, Kozhiparambil Gopalan

    2013-01-01

    This study deals with the preparation and characterization of selenium incorporated guar gum nanoparticle (SGG), and its effect on H9c2 cardiomyoblast. Herein, nanoprecipitation techniques had been employed for the preparation of SGG nanoparticle. The prepared nanoparticle had been subjected to various types of analytical techniques like transmission electron microscopy (TEM), X-ray diffraction (XRD) and particle size analysis to confirm the characteristics of nanoparticle as well as for selenium incorporation. Physical characterization of nanoparticle showed that the size of nanoparticles increase upto ∼69–173 nm upon selenium incorporation from ∼41–132 nm. Then the prepared nanoparticles were evaluated for its effect on H9c2 cells. In this regard, the effect of nanoparticle on various vital parameters of H9c2 cells was studied. Parameters like cell viability, uptake of selenium incorporated guar gum nanoparticle by the cells, effect of SGG on DNA integrity, apoptosis, reactive oxygen species generation, alteration in transmembrane potential of mitochondria and cytoskeletal integrity had been investigated. Viability results showed that up to 25 nM of SGG was safe (10.31%) but beyond that it induces cytotoxicity. Cellular uptake of selenium showed that cell permeability for SGG is significantly high compared to normal selenium (7.2 nM of selenium for 25 nM SGG compared with 5.2 nM selenium for 25 nM sodium selenite). There was no apoptosis with SGG and also it protects DNA from hydroxyl radical induced breakage. Likewise no adverse effect on mitochondria and cytoskeleton was observed for 25 nM of SGG. Overall results reveal that SGG is highly suitable for biomedical research application. PMID:24098647

  13. Kaempferol is an estrogen-related receptor alpha and gamma inverse agonist.

    PubMed

    Wang, Junjian; Fang, Fang; Huang, Zhiyan; Wang, Yanfei; Wong, Chiwai

    2009-02-18

    Kaempferol is a dietary flavonoid that is thought to function as a selective estrogen receptor modulator. In this study, we established that kaempferol also functions as an inverse agonist for estrogen-related receptors alpha and gamma (ERRalpha and ERRgamma). We demonstrated that kaempferol binds to ERRalpha and ERRgamma and blocks their interaction with coactivator peroxisome proliferator-activated receptor gamma coactivator-1alpha (PGC-1alpha). Kaempferol also suppressed the expressions of ERR-target genes pyruvate dehydrogenase kinase 2 and 4 (PDK2 and PDK4). This evidence suggests that kaempferol may exert some of its biological effect through both estrogen receptors and estrogen-related receptors. PMID:19171140

  14. Nanocomposites Fabricated by a Combination of Green Compact Nanoparticle Incorporation and Ultrasonic Treatment of the Melted Compact

    NASA Astrophysics Data System (ADS)

    Kandemir, Sinan; Atkinson, Helen V.; Weston, David P.; Hainsworth, Sarah V.

    2014-11-01

    Thixoforming is a type of semi-solid processing which is based on forming metals in the semi-solid state rather than fully liquid or solid state. There have been no reports of the thixoforming of nanocomposites in the literature. The incorporation of ceramic nanoparticles into liquid metals is a challenging task for the fabrication of metal matrix nanocomposites due to their large surface-to-volume ratio and poor wettability. Previous research work by a number of workers has highlighted the challenges with the incorporation of nanoparticles into liquid aluminum alloy. In the present study, SiC and TiB2 nanoparticles with an average diameter between 20 and 30 nm were firstly incorporated into green compacts by a powder forming route, and then the compacts were melted and treated ultrasonically. The microstructural studies reveal that the engulfment and relatively effective distribution of the nanoparticles into the melt were achieved. The hardness was considerably improved with only 0.8 wt pct addition of the nanoparticles. The nanocomposites were successfully thixoformed at a solid fraction between 0.65 and 0.70. The microstructures, hardness, and tensile mechanical properties of the thixoformed nanocomposites were investigated and compared with those of the as-received A356 and thixoformed A356 alloys. The tensile properties of the thixoformed nanocomposites were significantly enhanced compared to thixoformed A356 alloy without reinforcement, indicating the strengthening effects of the nanoparticles.

  15. Antimicrobial activity of cream incorporated with silver nanoparticles biosynthesized from Withania somnifera.

    PubMed

    Marslin, Gregory; Selvakesavan, Rajendran K; Franklin, Gregory; Sarmento, Bruno; Dias, Alberto C P

    2015-01-01

    We report on the antimicrobial activity of a cream formulation of silver nanoparticles (AgNPs), biosynthesized using Withania somnifera extract. Aqueous extracts of leaves promoted efficient green synthesis of AgNPs compared to fruits and root extracts of W. somnifera. Biosynthesized AgNPs were characterized for their size and shape by physical-chemical techniques such as UV-visible spectroscopy, laser Doppler anemometry, transmission electron microscopy, scanning electron microscopy, atomic force microscopy, X-ray diffraction, and X-ray energy dispersive spectroscopy. After confirming the antimicrobial potential of AgNPs, they were incorporated into a cream. Cream formulations of AgNPs and AgNO3 were prepared and compared for their antimicrobial activity against human pathogens (Staphylococcus aureus, Pseudomonas aeruginosa, Proteus vulgaris, Escherichia coli, and Candida albicans) and a plant pathogen (Agrobacterium tumefaciens). Our results show that AgNP creams possess significantly higher antimicrobial activity against the tested organisms. PMID:26445537

  16. Antimicrobial activity of cream incorporated with silver nanoparticles biosynthesized from Withania somnifera

    PubMed Central

    Marslin, Gregory; Selvakesavan, Rajendran K; Franklin, Gregory; Sarmento, Bruno; Dias, Alberto CP

    2015-01-01

    We report on the antimicrobial activity of a cream formulation of silver nanoparticles (AgNPs), biosynthesized using Withania somnifera extract. Aqueous extracts of leaves promoted efficient green synthesis of AgNPs compared to fruits and root extracts of W. somnifera. Biosynthesized AgNPs were characterized for their size and shape by physical-chemical techniques such as UV-visible spectroscopy, laser Doppler anemometry, transmission electron microscopy, scanning electron microscopy, atomic force microscopy, X-ray diffraction, and X-ray energy dispersive spectroscopy. After confirming the antimicrobial potential of AgNPs, they were incorporated into a cream. Cream formulations of AgNPs and AgNO3 were prepared and compared for their antimicrobial activity against human pathogens (Staphylococcus aureus, Pseudomonas aeruginosa, Proteus vulgaris, Escherichia coli, and Candida albicans) and a plant pathogen (Agrobacterium tumefaciens). Our results show that AgNP creams possess significantly higher antimicrobial activity against the tested organisms. PMID:26445537

  17. Removal of diatrizoate with catalytically active membranes incorporating microbially produced palladium nanoparticles.

    PubMed

    Hennebel, Tom; De Corte, Simon; Vanhaecke, Lynn; Vanherck, Katrien; Forrez, Ilse; De Gusseme, Bart; Verhagen, Pieter; Verbeken, Kim; Van der Bruggen, Bart; Vankelecom, Ivo; Boon, Nico; Verstraete, Willy

    2010-03-01

    There is an increasing concern about the fate of iodinated contrast media (ICM) in the environment. Limited removal efficiencies of currently applied techniques such as advanced oxidation processes require more performant strategies. The aim of this study was to establish an innovative degradation process for diatrizoate, a highly recalcitrant ICM, by using biogenic Pd nanoparticles as free suspension or immobilized in polyvinylidene fluoride (PVDF) and polysulfone (PSf) membranes. As measured by HPLC-UV, the removal of 20mg L(-1) diatrizoate by a 10mg L(-1) Pd suspension was completed after 4h at a pH of 10. LC-MS analysis provided evidence for the sequential hydrodeiodination of diatrizoate. Pd did not lose its activity after incorporation in the PVDF and PSf matrix and the highest activity (k(cat)=30.0+/-0.4h(-1) L g(-1) Pd) was obtained with a casting solution of 10% PSf and 500mg L(-1) Pd. Subsequently, water containing 20mg L(-1) diatrizoate was treated in a membrane contactor, in which the water was supplied at one side of the membrane while hydrogen was provided at the other side. In a fed batch configuration, a removal efficiency of 77% after a time period of 48h was obtained. This work showed that membrane contactors with encapsulated biogenic nanoparticles can be instrumental for treatment of water contaminated with diatrizoate. PMID:19939433

  18. Enhanced recovery and dissolution of griseofulvin nanoparticles from surfactant-free nanocomposite microparticles incorporating wet-milled swellable dispersants.

    PubMed

    Bhakay, Anagha; Azad, Mohammad; Vizzotti, Emanuel; Dave, Rajesh N; Bilgili, Ecevit

    2014-11-01

    Nanocomposite microparticles (NCMPs) incorporating drug nanoparticles and wet-milled swellable dispersant particles were investigated as a surfactant-free drug delivery vehicle with the goal of enhancing the nanoparticle recovery and dissolution rate of poorly water-soluble drugs. Superdisintegrants were used as inexpensive, model, swellable dispersant particles by incorporating them into NCMP structure with or without wet-stirred media milling along with the drug. Suspensions of griseofulvin (GF, model drug) along with various dispersants produced by wet-milling were coated onto Pharmatose® to prepare NCMPs in a fluidized bed process. Hydroxypropyl cellulose (HPC, polymer) alone and with sodium dodecyl sulfate (SDS, surfactant) was used as base-line stabilizer/dispersant during milling. Croscarmellose sodium (CCS, superdisintegrant) and Mannitol were used as additional dispersants to prepare surfactant-free NCMPs. Nanoparticle recovery during redispersion and dissolution of the various GF-laden NCMPs were examined. Suspensions prepared by co-milling GF/HPC/CCS or milling GF/HPC/SDS were stable after 30 h of storage. After drying, due to its extensive swelling capacity, incorporation of wet-milled CCS in the NCMPs caused effective breakage of the NCMP structure and bursting of nanoparticle clusters, ultimately leading to fast recovery of the GF nanoparticles. Optimized wet co-milling and incorporation of CCS in NCMP structure led to superior dispersant performance over incorporation of unmilled CCS or physically mixed unmilled CCS with NCMPs. The enhanced redispersion correlated well with the fast GF dissolution from the NCMPs containing either CCS particles or SDS. Overall, swellable dispersant (CCS) particles, preferably in multimodal size distribution, enable a surfactant-free formulation for fast recovery/dissolution of the GF nanoparticles. PMID:23981202

  19. Electrospun strontium titanata nanofibers incorporated with nickel oxide nanoparticles for improved photocatalytic activities

    NASA Astrophysics Data System (ADS)

    Alharbi, Abdulaziz; Alarifi, Ibrahim M.; Khan, Waseem S.; Asmatulu, Ramazan

    2015-03-01

    The inexpensive sources of fossil fuels in the world are limited, and will deplete soon because of the huge demand on the energy and growing economies worldwide. Thus, many research activities have been focused on the non-fossil fuel based energy sources, and this will continue next few decades. Water splitting using photocatalysts is one of the major alternative energy technologies to produce hydrogen directly from water using photon energy of the sun. Numerous solid photocatalysts have been used by researchers for water splitting. In the present study, nickel oxide and strontium titanata were chosen as photocatalysts for water splitting. Poly (vinyl pyrrolidone) (PVP) was incorporated with nickel oxide [Ni2O3] (co-catalyst), while poly (vinyl acetate) (PVAc) was mixed with titanium (IV) isopropoxide [C12H28O4Ti] and strontium nitrate [Sr(NO3)2]. Then, two solutions were electrospun using coaxial electrospinning technique to generate nanoscale fibers incorporated with NiOx nanoparticles. The fibers were then heat treated at elevated temperatures for 2hr in order to transform the strontium titanata and nickel oxide into crystalline form for a better photocatalytic efficiency. The morphology of fibers was characterized via scanning electron microscopy (SEM), while the surface hydrophobicity was determined using water contact angle goniometer. The UV-vis spectrophotometer was also used to determine the band gap energy values of the nanofibers. This study may open up new possibilities to convert water into fuel directly using the novel photocatalysts.

  20. Surface plasmon-enhanced quantum dot light-emitting diodes by incorporating gold nanoparticles.

    PubMed

    Pan, Jiangyong; Chen, Jing; Zhao, Dewei; Huang, Qianqian; Khan, Qasim; Liu, Xiang; Tao, Zhi; Zhang, Zichen; Lei, Wei

    2016-01-25

    Surface plasmon-enhanced electroluminescence (EL) has been demonstrated by incorporating gold (Au) nanoparticles (NPs) in quantum dot light-emitting diode (QLED). Time-resolved photoluminescence (TRPL) spectroscopy reveals that the EL enhancement is ascribed to the near-field enhancement through an effective coupling between excitons of the quantum dot emitters and localized surface plasmons around Au NPs. It is found that the size of Au NPs and the distance between the Au NPs and the emissive layer have significant effects on the performance of QLED. The enhancement can be maximized as the SP resonance wavelength of Au NPs matches well with the PL emission wavelength of the QD film and the distance between Au NPs and the emissive layer maintains 15 nm. The photoluminance (PL) and EL intensity can be enhanced by 4.4 and 1.7 folds with the incorporation of Au NPs. The maximum current efficiency of 4.56 cd/A can be achieved for the resulting QLEDs by incorprating Au NPs with an enhancement factor of 2.0. In addition, the enhancement ratio of 2.2 can be achieved for the lifetime of resulting QLED. PMID:26832585

  1. Beneficial properties of selenium incorporated guar gum nanoparticles against ischemia/reperfusion in cardiomyoblasts (H9c2).

    PubMed

    Soumya, R S; Vineetha, V P; Salin Raj, P; Raghu, K G

    2014-11-01

    Nanotechnology for the treatment and diagnosis has been emerging recently as a potential area of research and development. In the present study, selenium incorporated guar gum nanoparticles have been prepared by nanoprecipitation and characterized by transmission electron microscopy and particle size analysis. The nanoparticles were screened for antioxidant potential (metal chelation, total reducing power and hydroxyl radical scavenging activity) and were evaluated against the cell line based cardiac ischemia/reperfusion model with special emphasis on oxidative stress and mitochondrial parameters. The cell based cardiac ischemia model was employed using H9c2 cell lines. Investigations revealed that there was a significant alteration (P ≤ 0.05) in the innate antioxidant status (glutathione↓, glutathione peroxidase↓, thioredoxin reductase↓, superoxide dismutase↓, catalase↓, lipid peroxidation↑, protein carbonyl↑, xanthine oxidase↑ and caspase 3 activity↑), mitochondrial functions (reactive oxygen species generation, membrane potential, and pore opening) and calcium homeostasis (calcium ATPase and intracellular calcium overload) during both ischemia and reperfusion. For comparative evaluation, selenium, guar gum and selenium incorporated guar gum nanoparticles were evaluated for their protective properties against ischemia/reperfusion. The study reveals that selenium incorporated guar gum nanoparticles were better at protecting the cells from ischemia/reperfusion compared to selenium and guar gum nanoparticles. The potent antioxidant capability shown by the sample in in vitro assays may be the biochemical basis of its better biological activity. Further, the nanodimensions of the particle may be the additional factor responsible for its better effect. PMID:25307064

  2. Core-shell nano-architectures: the incorporation mechanism of hydrophobic nanoparticles into the aqueous core of a microemulsion.

    PubMed

    Scorciapino, Mariano A; Sanna, Roberta; Ardu, Andrea; Orr, Federica; Casu, Mariano; Musinu, Anna; Cannas, Carla

    2013-10-01

    This work presents an in-depth investigation of the molecular interactions in the incorporation mechanism of colloidal hydrophobic-capped nanoparticles into the hydrophilic core of reverse microemulsions. (1)H Nuclear Magnetic Resonance (NMR) was employed to obtain molecular level details of the interaction between the nanoparticles capping amphiphiles and the microemulsion surfactants. The model system of choice involved oleic acid (OAC) and oleylamine (OAM) as capping molecules, while igepal-CO520 was the surfactant. The former were studied both in their "free" state and "ligated" one, i.e., bound to nanoparticles. The latter was investigated either in cyclohexane (micellar solution) or in water/cyclohexane microemulsions. The approach was extremely useful to gain a deeper understanding of the equilibria involved in this complex system (oleic acid capped-Bi2S3 in igepal/water/cyclohexane microemulsions). In difference to previously proposed mechanisms, the experimental data showed that the high affinity of the capping ligands for the reverse micelle interior was the drivingforce for the incorporation of the nanoparticles. A simple ligand-exchange mechanism could be ruled out. The collected information about the nanoparticle incorporation mechanism is extremely useful to develop new synthetic routes with an improved/tuned coating efficiency, in order to tailor the core-shell structure preparation. PMID:23910706

  3. Effect of titanium oxide nanoparticle incorporation into nm thick coatings deposited using an atmospheric pressure plasma.

    PubMed

    Denis, Dowling P; Barry, Twomey; Gerry, Byrne

    2010-04-01

    This study reports on the use of an atmospheric plasma technique to incorporate metal oxide nanoparticles into nm thick siloxane coatings. Titanium dioxide (TiO2) particles with diameters of 30-80 nm, were mixed with a number of different siloxanes-polydimethylsiloxane, hexamethyldisiloxane and tetraethylorthosilicate (TEOS). The TiO2/TEOS mixture was found to give the most stable suspension, possibly due to the higher surface tension of TEOS compared with the other siloxanes. TiO2/TEOS mixtures with 2 to 10% by weight of the metal oxide were prepared and were then nebulised into a helium/oxygen atmospheric plasma. Polyethylene terepthalate (PET) and silicon wafer substrates were passed through this plasma using a reel-to-reel substrate manipulation system. SEM combined with EDX was used to examine the distribution of the metal oxide particles in the resultant coatings. The TEOS coating thickness without TiO2 addition was 9 nm. The composite coating consisted of a relatively homogeneous distribution of small agglomerates of the TiO2 nanoparticles in TEOS. A linear increase in the titanium surface concentration was observed with increase in the quantity of TiO2 added into the siloxane precursor. The chemical functionality of the siloxane coating was examined using FTIR spectroscopy and no significant spectrum differences was observed with the incorporation of the different concentrations of TiO2 into the polymer. There were also no changes observed in coating surface energy with TiO2 incorporation. Coating morphology was examined using optical profilometry and surface roughness (Ra) values increased from typical values of 0.8 nm for the TEOS coating to 4.1 nm for the TiO2/TEOS coating. The adhesion of the deposited coatings was compared using fragmentation tests. These were carried out through uniaxial tensile loading. The coating cracking pattern after applied strain of 20% was not observed to change significantly with the addition of TiO2 into the siloxane. PMID:20355495

  4. Kaempferol ameliorates symptoms of metabolic syndrome by regulating activities of liver X receptor-β.

    PubMed

    Hoang, Minh-Hien; Jia, Yaoyao; Mok, Boram; Jun, Hee-jin; Hwang, Kwang-Yeon; Lee, Sung-Joon

    2015-08-01

    Kaempferol is a dietary flavonol previously shown to regulate cellular lipid and glucose metabolism. However, its molecular mechanisms of action and target proteins have remained elusive, probably due to the involvement of multiple proteins. This study investigated the molecular targets of kaempferol. Ligand binding of kaempferol to liver X receptors (LXRs) was quantified by time-resolved fluorescence resonance energy transfer and surface plasmon resonance analyses. Kaempferol directly binds to and induces the transactivation of LXRs, with stronger specificity for the β-subtype (EC50 = 0.33 μM). The oral administration of kaempferol in apolipoprotein-E-deficient mice (150 mg/day/kg body weight) significantly reduced plasma glucose and increased high-density lipoprotein cholesterol levels and insulin sensitivity compared with the vehicle-fed control. Kaempferol also reduced plasma triglyceride concentrations and did not cause liver steatosis, a common side effect of potent LXR activation. In immunoblotting analysis, kaempferol reduced the nuclear accumulation of sterol regulatory element-binding protein-1 (SREBP-1). Our results show that the suppression of SREBP-1 activity and the selectivity for LXR-β over LXR-α by kaempferol contribute to the reductions of plasma and hepatic triglyceride concentrations in mice fed kaempferol. They also suggest that kaempferol activates LXR-β and suppresses SREBP-1 to enhance symptoms in metabolic syndrome. PMID:25959373

  5. Rapid synthesis of ordered hexagonal mesoporous silica and their incorporation with Ag nanoparticles by solution plasma

    SciTech Connect

    Pootawang, Panuphong; Saito, Nagahiro; Takai, Osamu; Lee, Sang Yul

    2012-10-15

    Graphical abstract: Overall reactions of mesoporous silica and AgNPs-incorporated mesoporous silica syntheses by solution plasma process (SPP). Highlights: ► SPP for rapid synthesis of mesoporous silica. ► SPP for rapid synthesis of mesoporous silica and AgNPs incorporation. ► Higher surface area and larger pore diameter of mesoporous silica synthesized by SPP. -- Abstract: Rapid synthesis of silica with ordered hexagonal mesopore arrangement was obtained using solution plasma process (SPP) by discharging the mixture of P123 triblock copolymer/TEOS in acid solution. SPP, moreover, was utilized for Ag nanoparticles (AgNPs) incorporation in silica framework as one-batch process using silver nitrate (AgNO{sub 3}) solution as precursor. The turbid silicate gel was clearly observed after discharge for 1 min and the white precipitate formed at 3 min. The mesopore with hexagonal arrangement and AgNPs were observed in mesoporous silica. Two regions of X-ray diffraction patterns (2θ < 2° and 2θ = 35–90°) corresponded to the mesoporous silica and Ag nanocrystal characteristics. Comparing with mesoporous silica prepared by a conventional sol–gel route, surface area and pore diameter of mesoporous silica prepared by solution plasma were observed to be larger. In addition, the increase in Ag loading resulted in the decrease in surface area with insignificant variation in the pore diameter of mesoporous silica. SPP could be successfully utilized not only to enhance gelation time but also to increase surface area and pore diameter of mesoporous silica.

  6. Enhancement of Transdermal Penetration and Bioavailability of Poorly Soluble Acyclovir Using Solid Lipid Nanoparticles Incorporated in Gel Cream

    PubMed Central

    Gide, P. S.; Gidwani, S. K.; Kothule, K. U.

    2013-01-01

    The objective of this work was to increase the amount of acyclovir in the basal epidermis, site of herpes virus simplex infection, using the solid lipid nanoparticles loaded gel cream as carriers. Solid lipid nanoparticles were prepared by high pressure homogenisation method and incorporated in a semisolid submicron gel cream. Acyclovir distribution into rat skin after topical application of solid lipid nanoparticles loaded gel cream was determined by fabricated Franz diffusion cell. The results showed that, the quantity of the acyclovir in the basal epidermis with the solid lipid nanoparticles loaded submicron gel cream was two folds times more than marketed acyclovir gel cream. This type of carrier can improve acyclovir loaded therapy since it increases drug retention in the basal epidermis. PMID:24019560

  7. Novel insights into the inhibitory mechanism of kaempferol on xanthine oxidase.

    PubMed

    Wang, Yajie; Zhang, Guowen; Pan, Junhui; Gong, Deming

    2015-01-21

    Xanthine oxidase (XO), a key enzyme in purine catabolism, is widely distributed in human tissues. It can catalyze xanthine to generate uric acid and cause hyperuricemia and gout. Inhibition kinetics assay showed that kaempferol inhibited XO activity reversibly in a competitive manner. Strong fluorescence quenching and conformational changes of XO were found due to the formation of a kaempferol-XO complex, which was driven mainly by hydrophobic forces. The molecular docking further revealed that kaempferol inserted into the hydrophobic cavity of XO to interact with some amino acid residues. The main inhibition mechanism of kaempferol on XO activity may be due to the insertion of kaempferol into the active site of XO occupying the catalytic center of the enzyme to avoid the entrance of the substrate and inducing conformational changes of XO. In addition, luteolin exhibited a stronger synergistic effect with kaempferol than did morin at the lower concentration. PMID:25539132

  8. Hydrothermally synthesized PEGylated calcium phosphate nanoparticles incorporating Gd-DTPA for contrast enhanced MRI diagnosis of solid tumors.

    PubMed

    Mi, Peng; Kokuryo, Daisuke; Cabral, Horacio; Kumagai, Michiaki; Nomoto, Takahiro; Aoki, Ichio; Terada, Yasuko; Kishimura, Akihiro; Nishiyama, Nobuhiro; Kataoka, Kazunori

    2014-01-28

    Organic-inorganic hybrid nanoparticles with calcium phosphate (CaP) core and PEGylated shell were developed to incorporate magnetic resonance imaging (MRI) contrast agent diethylenetriaminepentaacetic acid gadolinium (III) (Gd-DTPA) for noninvasive diagnosis of solid tumors. A two-step preparation method was applied to elaborate hybrid nanoparticles with a z-average hydrodynamic diameter about 80nm, neutral surface ξ-potential and high colloidal stability in physiological environments by self-assembly of poly(ethylene glycol)-b-poly(aspartic acid) block copolymer, Gd-DTPA, and CaP in aqueous solution, followed with hydrothermal treatment. Incorporation into the hybrid nanoparticles allowed Gd-DTPA to show significant enhanced retention ratio in blood circulation, leading to high accumulation in tumor positions due to enhanced permeability and retention (EPR) effect. Moreover, Gd-DTPA revealed above 6 times increase of relaxivity in the nanoparticle system compared to free form, and eventually, selective and elevated contrast enhancements in the tumor positions were observed. These results indicate the high potential of Gd-DTPA-loaded PEGylated CaP nanoparticles as a novel contrast agent for noninvasive cancer diagnosis. PMID:24211705

  9. Kaempferol inhibits cancer cell growth by antagonizing estrogen-related receptor α and γ activities.

    PubMed

    Wang, Haibin; Gao, Minghui; Wang, Junjian

    2013-11-01

    Kaempferol is a dietary flavonoid that can function as a selective estrogen receptor modulator (SERM). Estrogen-related receptors alpha and gamma (ERRα and ERRγ) are orphan nuclear receptors that play important roles in mitochondrial biogenesis and cancer development. We have shown that kaempferol can functionally antagonize the activities of ERRs based on both response element reporter systems and target gene analysis. Kaempferol modulation of mitochondrial function and suppression cancer cell growth has been confirmed. These findings suggest that kaempferol may exert their anti-cancer activities through antagonizing ERRs activities. PMID:23852933

  10. Kaempferol inhibits UVB-induced COX-2 expression by suppressing Src kinase activity

    PubMed Central

    Lee, Kyung Mi; Lee, Ki Won; Jung, Sung Keun; Lee, Eun Jung; Heo, Yong-Seok; Bode, Ann M.; Lubet, Ronald A.; Lee, Hyong Joo; Dong, Zigang

    2010-01-01

    Ultraviolet (UV) radiation is the primary environmental risk factor in the development of nonmelanoma skin cancer, and UVB in particular promotes tumor growth through various signaling pathways. Kaempferol, a flavonoid with anti-inflammatory and anti-oxidative properties, has been studied as a chemopreventive agent; however, little is known regarding its effects on UVB-induced photo-carcinogenesis. Here, we examined the effect of kaempferol on UVB-induced skin inflammation. We found that kaempferol suppressed UVB-induced cyclooxygenase-2 (COX-2) protein expression in mouse skin epidermal JB6 P+ cells and attenuated the UVB-induced transcriptional activities of cox-2 and activator protein-1 (AP-1). Kaempferol attenuated the UVB-induced phosphorylation of several mitogen-activated protein kinases (MAPKs), including ERKs, p38, and JNKs, but had no effect on the phosphorylation of the upstream MAPK regulator Src. However, in vitro and ex vivo kinase assays demonstrated that kaempferol suppressed Src kinase activity. Furthermore, in vivo data from mouse skin support the idea that kaempferol suppresses UVB-induced COX-2 expression by blocking Src kinase activity. A pull-down assay revealed that kaempferol competes with ATP for direct binding to Src. Docking data suggest that kaempferol docks easily into the ATP-binding site of Src, which is located between the N and C lobes of the kinase domain. Taken together, these results suggest that kaempferol is a potent chemopreventive agent against skin cancer through its inhibitory interaction with Src. PMID:20599768

  11. A review of the dietary flavonoid, kaempferol on human health and cancer chemoprevention

    PubMed Central

    Chen, Allen Y.; Chen, Yi Charlie

    2013-01-01

    Kaempferol is a polyphenol antioxidant found in fruits and vegetables. Many studies have described the beneficial effects of dietary kaempferol in reducing the risk of chronic diseases, especially cancer. Epidemiological studies have shown an inverse relationship between kaempferol intake and cancer. Kaempferol may help by augmenting the bodys antioxidant defense against free radicals, which promote the development of cancer. At the molecular level, kaempferol has been reported to modulate a number of key elements in cellular signal transduction pathways linked to apoptosis, angiogenesis, inflammation, and metastasis. Significantly, kaempferol inhibits cancer cell growth and angiognesis and induces cancer cell apoptosis, but on the other hand, kaempferol appears to preserve normal cell viability, in some cases exerting a protective effect. The aim of this review is to synthesize information concerning the extraction of kaempferol, as well as to provide insights into the molecular basis of its potential chemo-preventative activities, with an emphasis on its ability to control intracellular signaling cascades that regulate the aforementioned processes. Chemoprevention using nanotechnology to improve the bioavailability of kaempferol is also discussed. PMID:23497863

  12. Synthesis, characterization and anticancer activity of kaempferol-zinc(II) complex.

    PubMed

    Tu, Lv-Ying; Pi, Jiang; Jin, Hua; Cai, Ji-Ye; Deng, Sui-Ping

    2016-06-01

    According to the previous studies, the anticancer activity of flavonoids could be enhanced when they are coordinated with transition metal ions. In this work, kaempferol-zinc(II) complex (kaempferol-Zn) was synthesized and its chemical properties were characterized by UV-VIS, FT-IR, (1)H NMR, elemental analysis, electrospray mass spectrometry (ES-MS) and fluorescence spectroscopy, which showed that the synthesized complex was coordinated with a Zn(II) ion via the 3-OH and 4-oxo groups. The anticancer effects of kaempferol-Zn and free kaempferol on human oesophageal cancer cell line (EC9706) were compared. MTT results demonstrated that the killing effect of kaempferol-Zn was two times higher than that of free kaempferol. Atomic force microscopy (AFM) showed the morphological and ultrastructural changes of cellular membrane induced by kaempferol-Zn at subcellular or nanometer level. Moreover, flow cytometric analysis indicated that kaempferol-Zn could induce apoptosis in EC9706 cells by regulating intracellular calcium ions. Collectively, all the data showed that kaempferol-Zn might be served as a kind of potential anticancer agent. PMID:27080177

  13. Colorimetric cholesterol sensor based on peroxidase like activity of zinc oxide nanoparticles incorporated carbon nanotubes.

    PubMed

    Hayat, Akhtar; Haider, Waqar; Raza, Yousuf; Marty, Jean Louis

    2015-10-01

    A sensitive and selective colorimetric method based on the incorporation of zinc oxide nanoparticles (ZnO NPs) on the surface of carbon nanotubes (CNTs) was shown to posses synergistic peroxidase like activity for the detection of cholesterol. The proposed nanocomposite catalyzed the oxidation of 2,2'-azino-bis(3-ethylbenzthiazoline-6-sulfonic acid (ABTS) in the presence of hydrogen peroxide (H2O2) to produce a green colored product which can be monitored at 405 nm. H2O2 is the oxidative product of cholesterol in the presence of cholesterol oxidase. Therefore, the oxidation of cholesterol can be quantitatively related to the colorimetric response by combining these two reactions. Under the optimal experimental conditions, the colorimetric response was proportional to the concentration of cholesterol in the range of 0.5-500 nmol/L, with a detection limit of 0.2 nmol/L. The applicability of the proposed assays was demonstrated for the determination of cholesterol in milk powder samples with good recovery results. PMID:26078143

  14. Preparation,-Characterization and Anti-Glioma Effects of Docetaxel-Incorporated Albumin-Lipid Nanoparticles.

    PubMed

    Gao, Huile; Cao, Shijie; Yang, Zhi; Zhang, Shuang; Zhang, Qizhi; Jiang, Xinguo

    2015-12-01

    Poor aqueous solubility is a serious problem for most chemotherapeutics. Docetaxel (DTX), an inhibitor of microtubule depolymerization, is frequently used to treat many malignancies. However, the surfactant used in its commercial preparation (Taxotere) has proven problematic in clinical use because it has been associated with several side effects. By utilizing the high DTX-loading property of albumin, a new formulation, DTX-incorporated albumin-lipid nanoparticles (DNPs), was prepared and evaluated. DTX was bound to albumin in vitro and dispersed by egg yolk lecithin. The DNP particle size was 110.1 nm, while the average DNP zeta potential was -2.95 mV. The median lethal dose of DNPs was 180.6 mg/kg, which was 75.3% higher than that of Taxotere. DNPs could effectively inhibit the proliferation of several cell lines and induce cell apoptosis. In vivo imaging suggested that DNPs localize to and accumulate at the glioma site, which is likely due to the enhanced permeation and retention effects of DNPs. These pharmacological experiments further confirmed that DNPs can inhibit tumor growth, prolong the median survival time of mice with gliomas and induce higher levels of apoptosis. In conclusion, this novel formulation of DTX (DNPs) displayed lower toxicity and a superior anti-glioma effect relative to standard DTX preparations. PMID:26510308

  15. Hemoglobin–Albumin Cluster Incorporating a Pt Nanoparticle: Artificial O2 Carrier with Antioxidant Activities

    PubMed Central

    Hosaka, Hitomi; Haruki, Risa; Yamada, Kana; Böttcher, Christoph; Komatsu, Teruyuki

    2014-01-01

    A covalent core–shell structured protein cluster composed of hemoglobin (Hb) at the center and human serum albumins (HSA) at the periphery, Hb-HSAm, is an artificial O2 carrier that can function as a red blood cell substitute. Here we described the preparation of a novel Hb-HSA3 cluster with antioxidant activities and its O2 complex stable in aqueous H2O2 solution. We used an approach of incorporating a Pt nanoparticle (PtNP) into the exterior HSA unit of the cluster. A citrate reduced PtNP (1.8 nm diameter) was bound tightly within the cleft of free HSA with a binding constant (K) of 1.1×107 M−1, generating a stable HSA-PtNP complex. This platinated protein showed high catalytic activities for dismutations of superoxide radical anions (O2•–) and hydrogen peroxide (H2O2), i.e., superoxide dismutase and catalase activities. Also, Hb-HSA3 captured PtNP into the external albumin unit (K = 1.1×107 M−1), yielding an Hb-HSA3(PtNP) cluster. The association of PtNP caused no alteration of the protein surface net charge and O2 binding affinity. The peripheral HSA-PtNP shell prevents oxidation of the core Hb, which enables the formation of an extremely stable O2 complex, even in H2O2 solution. PMID:25310133

  16. Designer nanoparticles: Incorporating size, shape, and triggered release into nanoscale drug carriers

    PubMed Central

    Caldorera-Moore, Mary; Guimard, Nathalie; Shi, Li; Roy, Krishnendu

    2009-01-01

    Importance of the field Although significant progress has been made in delivering therapeutic agents through micro and nanocarriers, precise control over in vivo biodistribution and disease-responsive drug release has been difficult to achieve. This is critical for the success of next generation drug delivery devices, since newer drugs, designed to interfere with cellular functions, must be efficiently and specifically delivered to diseased cells. The major constraint in achieving this has been our limited repertoire of particle synthesis methods, especially at the nanoscale. Recent developments in generating shape-specific nanocarriers and the potential to combine stimuli-responsive release with nanoscale delivery devices show great promise in overcoming these limitations. Areas covered in this review Here we discuss how recent advancements in fabrication technology allow synthesis of highly monodisperse, stimuli-responsive, drug-carrying nanoparticles of precise geometries. We also review how particle properties, specifically shape and stimuli responsiveness, affect biodistribution, cellular uptake, and drug release. What the reader will gain The reader is introduced to recent developments in intelligent drug nanocarriers and new nanofabrication approaches that can be combined with disease-responsive biomaterials. This will provide insight into the importance of controlling particle geometry and incorporating stimuli responsive materials into drug delivery. PMID:20331355

  17. Copper Nanoparticle-Incorporated Carbon Fibers as Free-Standing Anodes for Lithium-Ion Batteries

    NASA Astrophysics Data System (ADS)

    Han, Pan; Yuan, Tao; Yao, Long; Han, Zhuo; Yang, Junhe; Zheng, Shiyou

    2016-03-01

    Copper-incorporated carbon fibers (Cu/CF) as free-standing anodes for lithium-ion batteries are prepared by electrospinning technique following with calcination at 600, 700, and 800 °C. The structural properties of materials are characterized by X-ray diffraction (XRD), Raman, thermogravimetry (TGA), scanning electron microscopy (SEM), transmission electron microscope (TEM), and energy dispersive X-ray spectrometry (EDS). It is found that the Cu/CF composites have smooth, regular, and long fibrous morphologies with Cu nanoparticles uniformly dispersed in the carbon fibers. As free-standing anodes, the unique structural Cu/CF composites show stable and high reversible capacities, together with remarkable rate and cycling capabilities in Li-ion batteries. The Cu/CF calcined at 800 °C (Cu/CF-800) has the highest charge/discharge capacities, long-term stable cycling performance, and excellent rate performance; for instance, the Cu/CF-800 anode shows reversible charge/discharge capacities of around 800 mAh g-1 at a current density of 100 mA g-1 with stable cycling performance for more than 250 cycles; even when the current density increases to 2 A g-1, the Cu/CF-800 anode can still deliver a capacity of 300 mAh g-1. This excellent electrochemical performance is attributed to the special 1D structure of Cu/CF composites, the enhanced electrical conductivity, and more Li+ active positions by Cu nanoinclusion.

  18. Triamcinolone acetonide nanoparticles incorporated in thermoreversible gels for age-related macular degeneration.

    PubMed

    Hirani, Anjali; Grover, Aditya; Lee, Yong W; Pathak, Yashwant; Sutariya, Vijaykumar

    2016-02-01

    Age-related macular degeneration (AMD) is one of the leading causes of blindness in the US affecting millions yearly. It is characterized by intraocular neovascularization, inflammation and retinal damage which can be ameliorated through intraocular injections of glucocorticoids. However, the complications that arise from repetitive injections as well as the difficulty posed by targeting the posterior segment of the eye make this interesting territory for the development of novel drug delivery systems (DDS). In the present study, we described the development of a DDS composed of triamcinolone acetonide-encapsulated PEGylated PLGA nanoparticles (NP) incorporated into PLGA-PEG-PLGA thermoreversible gel and its use against VEGF expression characteristic of AMD. We found that the NP with mean size of 208 ± 1.0 nm showed uniform size distribution and exhibited sustained release of the drug. We also demonstrated that the polymer can be injected as a solution and transition to a gel phase based on the biological temperature of the eye. Additionally, the proposed DDS was non-cytotoxic to ARPE-19 cells and significantly reduced VEGF expression by 43.5 ± 3.9% as compared to a 1.53 ± 11.1% reduction with triamcinolone. These results suggest the proposed DDS will contribute to the development of novel therapeutic strategies for AMD. PMID:25259682

  19. Fine-tuning in mineral cross-linking of biopolymer nanoparticle for incorporation and release of cargo.

    PubMed

    Fukui, Yuuka; Kabayama, Narumi; Fujimoto, Keiji

    2015-12-01

    We developed a mineral cross-linking strategy to prepare a biopolymer-based nanoparticle using calcium phosphate (CaP) as a cross-linker. Nanoparticles were first formed by mixing deoxyribonucleic acid (DNA) with cationic surfactants, and were cross-linked by CaP precipitation. After removal of the surfactants, we carried out the alternative dialysis of nanoparticles against CaCl2 aqueous solution and phosphate buffered solution for further mineral cross-linking. XRD and FT-IR studies revealed that the resultant nanoparticles were produced by mineral cross-linkages of hydroxyapatite (HAp) and the crystal amount and properties such as morphology and crystallinity could be well-controlled by the reaction conditions. Chemical dyes could be incorporated into nanoparticles via their affinities with crystal faces of HAp and DNA. Their release was tunable by crystal amount and properties of mineral cross-linkages. Also, the release could be triggered by mineral dissolution in response to pH. Such a mineral cross-linking will open up a potential way to provide a nanoparticle with versatile functions such as cleavable cross-linking, binding affinity for cargos, and pH-responsive release. PMID:26387068

  20. On the incorporation of Rhodamine B and 2‧,7‧-dichlorofluorescein dyes in silica: Synthesis of fluorescent nanoparticles

    NASA Astrophysics Data System (ADS)

    Gomes, Elis C. C.; de Carvalho, Idalina M. M.; Diógenes, Izaura C. N.; de Sousa, Eduardo H. S.; Longhinotti, Elisane

    2014-05-01

    The present paper reports the incorporation of 2‧,7‧-dichlorofluorescein (DCF) and Rhodamine B (RhB) dyes in silica nanoparticles by using the Stöber's method with some modifications. Based on infrared and electronic spectroscopies, these dyes were successfully incorporated resulting in fluorescent nanomaterials of an average size of 80 nm. A composite fluorescent nanomaterial containing both dyes was also synthesized and showed the occurrence of Förster resonant energy transfer process (FRET) with the average distance between the donor (DCF) and acceptor (RhB) of 3.6 nm. Furthermore, these fluorescent nanoparticles were modified with folic acid producing nanomaterials whose Zeta potential values were in the range of -2 to -13 mV. These values are consistent with the low dispersivity observed by TEM micrographs. Altogether, these suitable properties can lead to the development of nanomaterials for cancer bioimaging and drug release.

  1. Effect of silver nanoparticles incorporated with samarium-doped magnesium tellurite glasses

    NASA Astrophysics Data System (ADS)

    Yusoff, N. M.; Sahar, M. R.

    2015-01-01

    Silver nanoparticles (Ag NPs) are incorporated in samarium doped tellurite glass of a composition (89-x)TeO2-10MgO-1Sm2O3-xAgCl, where 0.0≤x≤0.6 mol%, by a melt quenching technique. It is found that all the glasses are amorphous in nature, and the existence of Ag NPs with an average size of 16.94 nm is confirmed by Transmission Electron Microscopy. Meanwhile, their physical properties such as glass density, molar volume and ionic packing density are computed utilizing the normal method. The density and ionic packing density are observed to decrease with increasing Ag NPs, but increase when the Ag NPs are beyond 0.2 mol%. On the other hand, the molar volume behaves exactly opposite to the increase in Ag NPs content. It decreases when the Ag NPs content value is more than 0.2 mol%. The optical energy band gap and Urbach energy are evaluated from the absorption spectra in the range of 200-900 nm at room temperature. It is also observed that the direct and indirect optical energy band gaps reduce with Ag NPs content, but enhance when the Ag NPs are beyond 0.2 mol%. Meanwhile, the Urbach energy is found to increase as the Ag NPs content is increased but decreases when Ag NPs is 0.2 mol%. The refractive index is deduced from indirect optical energy band gap. Meanwhile, molar refraction and electronic polarizability have been calculated from the Lorentz-Lorentz relation. Refractive index and electronic polarizability are also observed to raise with Ag NPs content, but drop off when Ag NPs content is more than 0.2 mol%. In this paper, all properties are discussed with respect to the Ag NPs concentration.

  2. A Au nanoparticle-incorporated sponge as a versatile transmission surface-enhanced Raman scattering substrate.

    PubMed

    Shin, Kayeong; Chung, Hoeil

    2015-08-01

    We report a sponge-based transmission surface-enhanced Raman scattering (TSERS) substrate that combines the bulk sampling capabilities of a transmission measurement to improve the quantitative representation of sample concentration with several sponge properties useful for analysis such as fast sample uptake, easy sample enrichment, and a stable polymeric structure. Among nine commercially available sponges made of different materials, a melamine sponge was ultimately selected for this study because it provided the fastest sample uptake and a low background Raman signal. Simultaneously, the amino groups and three-nitrogen hybrid rings in its structure could easily hold Au nanoparticles (AuNPs) inside the sponge. AuNP-incorporated sponges (AuNP sponges) were prepared by simply soaking a melamine sponge in a AuNP solution; these sponges were initially used to measure 4-nitrobenzenethiol (4-NBT) samples with different concentrations in order to evaluate their ability as TSERS substrates. The intensities of the 4-NBT peaks clearly varied according to changes in the concentration, and the relative standard deviation (RSD) of the peak intensity estimated by the measurements of five independently prepared AuNP sponges was 10.0%. Sample enrichment was easily completed by repeated suctioning of the sample into the AuNP sponges followed by depletion of the solvent, so three-time enrichment doubled the intensity. Furthermore, paraquat samples were prepared in diverse matrices (de-ionized water, tap water, river water, and orange juice) and measured using the AuNP sponges. The paraquat peaks were clearly observed from these samples and their peak intensities became smaller with the increased compositional complexity of the matrices. Our overall results demonstrate that the TSERS sponge substrates are easy to prepare and practically versatile for SERS analysis of diverse samples. PMID:26079472

  3. Palladium Nanoparticle Incorporated Porous Activated Carbon: Electrochemical Detection of Toxic Metal Ions.

    PubMed

    Veerakumar, Pitchaimani; Veeramani, Vediyappan; Chen, Shen-Ming; Madhu, Rajesh; Liu, Shang-Bin

    2016-01-20

    A facile method has been developed for fabricating selective and sensitive electrochemical sensors for the detection of toxic metal ions, which invokes incorporation of palladium nanoparticles (Pd NPs) on porous activated carbons (PACs). The PACs, which were derived from waste biomass feedstock (fruit peels), possess desirable textural properties and porosities favorable for dispersion of Pd NPs (ca. 3-4 nm) on the graphitic PAC substrate. The Pd/PAC composite materials so fabricated were characterized by a variety of different techniques, such as X-ray diffraction, field-emission transmission electron microscopy, gas physisorption/chemisorption, thermogravimetric analysis, and Raman, Fourier-transform infrared, and X-ray photon spectroscopies. The Pd/PAC-modified glassy carbon electrodes (GCEs) were exploited as electrochemical sensors for the detection of toxic heavy metal ions, viz., Cd(2+), Pb(2+), Cu(2+), and Hg(2+), which showed superior performances for both individual as well as simultaneous detections. For simultaneous detection of Cd(2+), Pb(2+), Cu(2+), and Hg(2+), a linear response in the ion concentration range of 0.5-5.5, 0.5-8.9, 0.5-5.0, and 0.24-7.5 μM, with sensitivity of 66.7, 53.8, 41.1, and 50.3 μA μM(-1) cm(-2), and detection limit of 41, 50, 66, and 54 nM, respectively, was observed. Moreover, the Pd/PAC-modified GCEs also show perspective applications in detection of metal ions in real samples, as illustrated in this study for a milk sample. PMID:26700093

  4. Copper Nanoparticle-Incorporated Carbon Fibers as Free-Standing Anodes for Lithium-Ion Batteries.

    PubMed

    Han, Pan; Yuan, Tao; Yao, Long; Han, Zhuo; Yang, Junhe; Zheng, Shiyou

    2016-12-01

    Copper-incorporated carbon fibers (Cu/CF) as free-standing anodes for lithium-ion batteries are prepared by electrospinning technique following with calcination at 600, 700, and 800 °C. The structural properties of materials are characterized by X-ray diffraction (XRD), Raman, thermogravimetry (TGA), scanning electron microscopy (SEM), transmission electron microscope (TEM), and energy dispersive X-ray spectrometry (EDS). It is found that the Cu/CF composites have smooth, regular, and long fibrous morphologies with Cu nanoparticles uniformly dispersed in the carbon fibers. As free-standing anodes, the unique structural Cu/CF composites show stable and high reversible capacities, together with remarkable rate and cycling capabilities in Li-ion batteries. The Cu/CF calcined at 800 °C (Cu/CF-800) has the highest charge/discharge capacities, long-term stable cycling performance, and excellent rate performance; for instance, the Cu/CF-800 anode shows reversible charge/discharge capacities of around 800 mAh g(-1) at a current density of 100 mA g(-1) with stable cycling performance for more than 250 cycles; even when the current density increases to 2 A g(-1), the Cu/CF-800 anode can still deliver a capacity of 300 mAh g(-1). This excellent electrochemical performance is attributed to the special 1D structure of Cu/CF composites, the enhanced electrical conductivity, and more Li(+) active positions by Cu nanoinclusion. PMID:27033848

  5. Microfiber coupler based biosensor incorporating a layer of gold nanoparticles with improved sensitivity

    NASA Astrophysics Data System (ADS)

    Semenova, Yuliya; Bo, Lin; Wang, Pengfei; Tian, Furong; Byrne, Hugh; Farrell, Gerald

    2014-05-01

    We studied the effect of a star-shaped gold nanoparticles layer coated on the surface of the microfiber coupler (MFC) on the sensitivity of the embedded MFC biosensor. It is shown that deposition of the layer of star-shaped gold nanoparticles on the MFC sensor surface results in a significantly increased spectral shift (on average 3.05 nm shift compared to a 1.08 nm shift per layer of electrolyte for the sample without the nanoparticles layer). In addition, introducing the nanoparticle layer results in the decrease of the transmission power; measurement of the changes in transmission also could be used as a means for the sensor interrogation.

  6. Kaempferol Isolated from Nelumbo nucifera Inhibits Lipid Accumulation and Increases Fatty Acid Oxidation Signaling in Adipocytes.

    PubMed

    Lee, Bonggi; Kwon, Misung; Choi, Jae Sue; Jeong, Hyoung Oh; Chung, Hae Young; Kim, Hyeung-Rak

    2015-12-01

    Stamens of Nelumbo nucifera Gaertn have been used as a Chinese medicine due to its antioxidant, hypoglycemic, and antiatherogenic activity. However, the effects of kaempferol, a main component of N. nucifera, on obesity are not fully understood. We examined the effect of kaempferol on adipogenesis and fatty acid oxidation signaling pathways in 3T3-L1 adipocytes. Kaempferol reduced cytoplasmic triglyceride (TG) accumulation in dose and time-dependent manners during adipocyte differentiation. Accumulation of TG was rapidly reversed by retrieving kaempferol treatment. Kaempferol broadly decreased mRNA or protein levels of adipogenic transcription factors and their target genes related to lipid accumulation. Kaempferol also suppressed glucose uptake and glucose transporter GLUT4 mRNA expression in adipocytes. Furthermore, protein docking simulation suggests that Kaempferol can directly bind to and activate peroxisome proliferator-activated receptor (PPAR)-α by forming hydrophobic interactions with VAL324, THR279, and LEU321 residues of PPARα. The binding affinity was higher than a well-known PPARα agonist fenofibrate. Consistently, mRNA expression levels of PPARα target genes were increased. Our study indicates while kaempferol inhibits lipogenic transcription factors and lipid accumulation, it may bind to PPARα and stimulate fatty acid oxidation signaling in adipocytes. PMID:26280739

  7. Studies on the interactions of kaempferol to calcineurin by spectroscopic methods and docking.

    PubMed

    Lei, Hong; Qi, Yao; Jia, Zhi-Guang; Lin, Wei-Lin; Wei, Qun

    2009-08-01

    Kaempferol, in our previous study, was a new immunosuppressant on calcineurin (CN), the Ca(2+)/calmodulin (CaM)-dependent protein phosphatase. Here, we examined the interactions of kaempferol with CN by fluorescence spectroscopy (FS), circular dichroism spectroscopy (CD) and docking. Data of kaempferol with CN catalytic subunit (CN A) and its truncated mutant CNAa obtained by FS method showed that the binding stoichiometry of kaempferol/CN A was 1:1, catalytic domain of CN A was the concrete domain for kaempferol binding while other domains contributed a lot to this binding. Distances from kaempferol to each tryptophan (Trp) in CN A by energy transfer experiments and the subsequent docking study interestingly provided the same binding sites for kaempferol, which all located in the non-active site area of CN A catalytic domain, also consisted with our previous conclusion from CN activity assay. Furthermore, CD results showed a much tighter structure of CN A for the inhibitor binding; on the other hand, presence of Ca(2+) and Mn(2+) decreased kaempferol binding on CN A. PMID:19439201

  8. Kaempferol inhibits gastric cancer tumor growth: An in vitro and in vivo study.

    PubMed

    Song, Haibin; Bao, Junjie; Wei, Yuzhe; Chen, Yang; Mao, Xiaoguang; Li, Jianguo; Yang, Zhiwei; Xue, Yingwei

    2015-02-01

    Kaempferol, which is one of the general flavonoids, has recently been reported to suppress proliferation, induce cell cycle arrest and promote apoptosis in various human cancer cell lines. In the present study, the effect and mechanism of kaempferol on gastric cancer (GC) was examined. The results showed that kaempferol significantly inhibited the proliferation of MKN28 and SGC7901 cell lines. However, no significant inhibition in the GSE-1 normal gastric epithelial cell line in our experimental dose was detected. Additionally, significant apoptosis and G2/M phase cell cycle arrest were identified following the treatment of kaempferol. More importantly, we observed that kaempferol inhibited the growth of the tumor xenografts although no marked effects on liver, spleen or body weight were induced. The expression levels of G2/M cell cycle‑regulating factors, cyclin B1, Cdk1 and Cdc25C, were significantly reduced. In addition, kaempferol treatment markedly decreased the level of Bcl-2 concomitant with an increase in Bax expression, resulting in the upregulation of cleaved caspase-3 and -9, which promoted PARP cleavage. Kaempferol-treated cells also led to a decrease in p-Akt, p-ERK and COX-2 expression levels. The present study therefore provided evidence that kaempferol may be a therapeutic agent for GC. PMID:25500692

  9. Mechanisms Underlying Apoptosis-Inducing Effects of Kaempferol in HT-29 Human Colon Cancer Cells

    PubMed Central

    Lee, Hyun Sook; Cho, Han Jin; Yu, Rina; Lee, Ki Won; Chun, Hyang Sook; Park, Jung Han Yoon

    2014-01-01

    We previously noted that kaempferol, a flavonol present in vegetables and fruits, reduced cell cycle progression of HT-29 cells. To examine whether kaempferol induces apoptosis of HT-29 cells and to explore the underlying molecular mechanisms, cells were treated with various concentrations (0–60 μmol/L) of kaempferol and analyzed by Hoechst staining, Annexin V staining, JC-1 labeling of the mitochondria, immunoprecipitation, in vitro kinase assays, Western blot analyses, and caspase-8 assays. Kaempferol increased chromatin condensation, DNA fragmentation and the number of early apoptotic cells in HT-29 cells in a dose-dependent manner. In addition, kaempferol increased the levels of cleaved caspase-9, caspase-3 and caspase-7 as well as those of cleaved poly (ADP-ribose) polymerase. Moreover, it increased mitochondrial membrane permeability and cytosolic cytochrome c concentrations. Further, kaempferol decreased the levels of Bcl-xL proteins, but increased those of Bik. It also induced a reduction in Akt activation and Akt activity and an increase in mitochondrial Bad. Additionally, kaempferol increased the levels of membrane-bound FAS ligand, decreased those of uncleaved caspase-8 and intact Bid and increased caspase-8 activity. These results indicate that kaempferol induces the apoptosis of HT-29 cells via events associated with the activation of cell surface death receptors and the mitochondrial pathway. PMID:24549175

  10. Modulation of P-glycoprotein-mediated resistance by kaempferol derivatives isolated from Zingiber zerumbet.

    PubMed

    Chung, Soo Yeon; Jang, Dae Sik; Han, Ah-Reum; Jang, Jung Ok; Kwon, Youngjoo; Seo, Eun-Kyoung; Lee, Hwa Jeong

    2007-06-01

    This study examined the effects of the kaempferol derivatives extracted from Zingiber zerumbet on the accumulation and efflux of [(3)H]-daunomycin (DNM) in P-glycoprotein (P-gp) overexpressing multidrug resistant (MDR) human breast cancer cells, MCF-7/ADR. Of six kaempferol derivatives extracted from Z. zerumbet, kaempferol-3-O-methyl ether (1) and kaempferol-3,4'-O-dimethyl ether (2) showed a potent P-gp inhibitory effect as great as verapamil, a well-known P-gp inhibitor. The P-gp inhibitory activity of these two compounds was through a 3-fold increase of the level of [(3)H]-DNM accumulation and a decrease of P-gp-mediated efflux. These results suggest that the kaempferol derivative components of Z. zerumbet can be used as a scaffold for developing agents that reverse P-gp-mediated MDR in human cancer chemotherapy. PMID:17335117

  11. Quercetin, kaempferol, myricetin, and fatty acid content among several Hibiscus sabdariffa accession calyces based on maturity in a greenhouse

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Flavonols including quercetin, kaempferol, myricetin, and fatty acids in plants have many useful health attributes including antioxidants, cholesterol lowering, and cancer prevention. Six accessions of roselle, Hibiscus sabdariffa calyces were evaluated for quercetin, kaempferol, and myricetin conte...

  12. Anthocyanin indexes, quercetin, kaempferol, and myricetin concentration in leaves and fruit of Abutilon theophrasti Medik. genetic resources

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Anthocyanin indexes, quercetin, kaempferol, and myricetin may provide industry with potential new medicines or nutraceuticals. Velvetleaf (Abutilon theophrasti Medik) leaves from 42 accessions were analyzed for anthocyanin indexes while both leaves and fruit were used for quercetin, kaempferol, and ...

  13. Kaempferol regulates OPN-CD44 pathway to inhibit the atherogenesis of apolipoprotein E deficient mice

    SciTech Connect

    Xiao, Hong-Bo; Lu, Xiang-Yang; Sun, Zhi-Liang; Zhang, Heng-Bo

    2011-12-15

    Recent studies show that osteopontin (OPN) and its receptor cluster of differentiation 44 (CD44) are two pro-inflammatory cytokines contributing to the development of atherosclerosis. The objective of this study was to explore the inhibitory effect of kaempferol, a naturally occurring flavonoid compound, on atherogenesis and the mechanisms involved. The experiments were performed in aorta and plasma from C57BL/6J control and apolipoprotein E-deficient (ApoE{sup -/-}) mice treated or not with kaempferol (50 or 100 mg/kg, intragastrically) for 4 weeks. Kaempferol treatment decreased atherosclerotic lesion area, improved endothelium-dependent vasorelaxation, and increased the maximal relaxation value concomitantly with decrease in the half-maximum effective concentration, plasma OPN level, aortic OPN expression, and aortic CD44 expression in ApoE{sup -/-} mice. In addition, treatment with kaempferol also significantly decreased reactive oxygen species production in mice aorta. The present results suggest that kaempferol regulates OPN-CD44 pathway to inhibit the atherogenesis of ApoE{sup -/-} mice. -- Graphical abstract: Kaempferol regulates OPN-CD44 pathway to inhibit the atherogenesis of ApoE{sup -/-} mice. Highlights: Black-Right-Pointing-Pointer OPN-CD44 pathway plays a critical role in the development of atherosclerosis. Black-Right-Pointing-Pointer We examine lesion area, OPN and CD44 changes after kaempferol treatment. Black-Right-Pointing-Pointer Kaempferol treatment decreased atherosclerotic lesion area in ApoE{sup -/-} mice. Black-Right-Pointing-Pointer Kaempferol treatment decreased aortic OPN and CD44 expressions in ApoE{sup -/-} mice. Black-Right-Pointing-Pointer Kaempferol regulates OPN-CD44 pathway to inhibit the atherogenesis.

  14. Incorporation of essential oils and nanoparticles in pullulan films to control foodborne pathogens on meat and poultry products.

    PubMed

    Morsy, Mohamed K; Khalaf, Hassan H; Sharoba, Ashraf M; El-Tanahi, Hassan H; Cutter, Catherine N

    2014-04-01

    The incorporation of essential oils and nanotechnology into edible films has the potential to improve the microbiological safety of foods. The aim of this study was to evaluate the effectiveness of pullulan films containing essential oils and nanoparticles against 4 foodborne pathogens. Initial experiments using plate overlay assays demonstrated that 2% oregano essential oil was active against Staphylococcus aureus and Salmonella Typhimurium, whereas Listeria monocytogenes and Escherichia coli O157:H7 were not inhibited. Two percent rosemary essential oil was active against S. aureus, L. monocytogenes, E. coli O157:H7, and S. Typhimurium, when compared with 1%. Zinc oxide nanoparticles at 110 nm were active against S. aureus, L. monocytogenes, E. coli O157:H7, and S. Typhimurium, when compared with 100 or 130 nm. Conversely, 100 nm silver (Ag) nanoparticles were more active against S. aureus than L. monocytogenes. Using the results from these experiments, the compounds exhibiting the greatest activity were incorporated into pullulan films and found to inhibit all or some of the 4 pathogens in plate overlay assays. In challenge studies, pullulan films containing the compounds effectively inhibited the pathogens associated with vacuum packaged meat and poultry products stored at 4 °C for up to 3 wk, as compared to control films. Additionally, the structure and cross-section of the films were evaluated using electron microscopy. The results from this study demonstrate that edible films made from pullulan and incorporated with essential oils or nanoparticles may improve the safety of refrigerated, fresh or further processed meat and poultry products. PMID:24621108

  15. Covalent Incorporation of SiO2 Nanoparticles in CO2-Based Copolymers: Synthesis, Characterization, Morphology and Property Studies.

    PubMed

    Tran, Thi Nga; Mai, Thanh Binh; Bach, Long Giang; Islam, Md Rafiqul; Gal, Yeong Soon; Lim, Kwon Taek

    2015-01-01

    A new strategy has been developed for covalent incorporation of SiO2 nanoparticles (N-'s) in the CO2-based copolymer, poly(propylene carbonate-co-propylene oxide) (poly(PC-co-PO)). The poly(PC-co-PO)-g-SiO2 nanocomposites was prepared by the combination of epoxy-CO2 ring-opening polymerization and the condensation reaction of chloride and hydroxyl groups of the polymer and the SiO2 surface. FT-IR and NMR were employed for the characterization of the copolymers as well as nanocomposites. A uniform and spherical core-shell structure of poly(PC-co-PO)-g-SiO2 nanocomposites was demonstrated from TEM and SEM images. An improved thermal property of the polymer matrix with incorporating SiO2 nanoparticles was revealed by TGA study. The grafting of poly(PC-co-PO) considerably prevented the aggregation and improved the dispersibility of SiO2 nanoparticles in toluene. PMID:26328378

  16. Gd{sup 3+} incorporated ZnO nanoparticles: A versatile material

    SciTech Connect

    Kumar, Surender Sahare, P.D.

    2014-03-01

    Graphical abstract: - Highlights: • Chemically synthesized Gd{sup 3+} doped ZnO nanoparticles. • The broad visible emission of the ZnO is dependent on the surface defects and can be tailored by Gd{sup 3+} doing. • PL and magnetic properties are modified by Gd{sup 3+} doping. • Photocatalysis experiment reveals that the ZnO: Gd{sup 3+} degrades the Rh B dye faster than the undoped ZnO. - Abstract: Gd{sup 3+} doped ZnO nanoparticles are synthesized by wet chemical route method and investigated through structural, optical, magnetic and photocatalytic properties. Transmission Electron Microscopy technique has been performed on undoped and Gd{sup 3+} doped ZnO nanoparticles. X-ray diffraction, X-ray photoelectron spectroscopy and Raman analyses are carried out in order to examine the desired phase formation and substitution of Gd{sup 3+} in the ZnO matrix. Gd{sup 3+} doped ZnO nanoparticles show enhanced photoluminescent and ferromagnetic properties as compared to undoped ZnO. The broad visible emission of ZnO is found to be largely dependent on the surface defects and these surface defects can be tailored by Gd{sup 3+} doping concentration. Furthermore, Gd{sup 3+} doped ZnO nanoparticles also show improved photocatalytic properties as compared with undoped ZnO nanoparticles under ultraviolet irradiation.

  17. Antimicrobial properties of poly (methyl methacrylate) acrylic resins incorporated with silicon dioxide and titanium dioxide nanoparticles on cariogenic bacteria

    PubMed Central

    Sodagar, Ahmad; Khalil, Soufia; Kassaee, Mohammad Zaman; Shahroudi, Atefe Saffar; Pourakbari, Babak; Bahador, Abbas

    2016-01-01

    Aim: To assess the effects of adding nano-titanium dioxide (nano-TiO2) and nano-silicon dioxide (nano-SiO2) and their mixture to poly (methyl methacrylate) (PMMA) to induce antimicrobial activity in acrylic resins. Materials and Methods: Acrylic specimens in size of 20 mm × 20 mm × 1 mm of 0.5% and 1% of nano-TiO2 (21 nm) and nano-SiO2 (20 nm) and their mixture (TiO2/SiO2 nanoparticles) (1:1 w/w) were prepared from the mixture of acrylic liquid containing nanoparticles and acrylic powder. To obtain 0.5% and 1% concentration, 0.02 g and 0.04 g of the nanoparticles was added to each milliliter of the acrylic monomer, respectively. Antimicrobial properties of six specimens of these preparations, as prepared, were assessed against planktonic Lactobacillus acidophilus and Streptococcus mutans at 0, 15, 30, 45, 60, 75, and 90 min follow-up by broth dilution assay. The specimens of each group were divided into three subgroups: Dark, daylight, or ultraviolet A (UVA). The percent of bacterial reduction is found out from the counts taken at each time point. Statistical Analysis: Data were analyzed using one-way analysis of variance and Tukey's post hoc analysis. Results: Exposure to PMMA containing the nanoparticles reduced the bacterial count by 3.2–99%, depending on the nanoparticles, bacterial types, and light conditions. Planktonic cultures of S. mutans and L. acidophilus exposed to PMMA containing 1% of TiO2/SiO2 nanoparticles showed a significant decrease (P < 0.001) (98% and 99%, respectively) in a time-dependent manner under UVA. The S. mutans and L. acidophilus counts did not significantly decrease in PMMA containing 0.5% nano-TiO2 and PMMA containing 0.5% nano-SiO2 in the dark. No statistically significant reduction (P > 0.05) was observed in the counts of S. mutans and L. acidophilus in PMMA without the nanoparticles exposed to UVA. Conclusions: PMMA resins incorporated with TiO2/SiO2 nanoparticles showed strong antimicrobial activity against the cariogenic bacteria. PMID:26998471

  18. Incorporation of copper nanoparticles into paper for point-of-use water purification

    PubMed Central

    Smith, James A.

    2014-01-01

    As a cost-effective alternative to silver nanoparticles, we have investigated the use of copper nanoparticles in paper filters for point-of-use water purification. This work reports an environmentally benign method for the direct in situ preparation of copper nanoparticles (CuNPs) in paper by reducing sorbed copper ions with ascorbic acid. Copper nanoparticles were quickly formed in less than 10 minutes and were well distributed on the paper fiber surfaces. Paper sheets were characterized by x-ray diffraction, scanning electron microscopy, energy dispersive x-ray spectroscopy, and atomic absorption spectroscopy. Antibacterial activity of the CuNP sheets was assessed for by passing Escherichia coli bacteria suspensions through the papers. The effluent was analyzed for viable bacteria and copper release. The CuNP papers with higher copper content showed a high bacteria reduction of log 8.8 for E. coli. The paper sheets containing copper nanoparticles were effective in inactivating the test bacteria as they passed through the paper. The copper levels released in the effluent water were below the recommended limit for copper in drinking water (1 ppm). PMID:25014431

  19. Incorporation of copper nanoparticles into paper for point-of-use water purification.

    PubMed

    Dankovich, Theresa A; Smith, James A

    2014-10-15

    As a cost-effective alternative to silver nanoparticles, we have investigated the use of copper nanoparticles in paper filters for point-of-use water purification. This work reports an environmentally benign method for the direct in situ preparation of copper nanoparticles (CuNPs) in paper by reducing sorbed copper ions with ascorbic acid. Copper nanoparticles were quickly formed in less than 10 min and were well distributed on the paper fiber surfaces. Paper sheets were characterized by x-ray diffraction, scanning electron microscopy, energy dispersive x-ray spectroscopy, and atomic absorption spectroscopy. Antibacterial activity of the CuNP sheets was assessed for by passing Escherichia coli bacteria suspensions through the papers. The effluent was analyzed for viable bacteria and copper release. The CuNP papers with higher copper content showed a high bacteria reduction of log 8.8 for E. coli. The paper sheets containing copper nanoparticles were effective in inactivating the test bacteria as they passed through the paper. The copper levels released in the effluent water were below the recommended limit for copper in drinking water (1 ppm). PMID:25014431

  20. Large sensitivity enhancement in semiconducting organic field effect transistor sensors through incorporation of ultra-fine platinum nanoparticles

    SciTech Connect

    Zheng, Haisheng; Ramalingam, Balavinayagam; Korampally, Venumadhav; Gangopadhyay, Shubhra

    2013-11-04

    We report remarkable improvement in sensitivity of pentacene-based field effect transistor devices towards trace nitro-aromatic explosive vapors through the incorporation of high density, sub-2 nm platinum nanoparticles (NPs) within these structures. Exploiting the unique electronic properties of these NPs, we have demonstrated a detection limit of 56.6 parts per billion of 2,4-dinitrotoluene (DNT) vapor while control samples without any embedded NPs showed no observable sensitivity to DNT vapor. We attribute this remarkable enhancement in sensitivity to the ability of these NPs to function as discrete nodes, participating in the charge transfer with adsorbed nitro-aromatic molecules.

  1. Microwave-assisted incorporation of silver nanoparticles in paper for point-of-use water purification

    PubMed Central

    Dankovich, Theresa A.

    2014-01-01

    This work reports an environmentally benign method for the in situ preparation of silver nanoparticles (AgNPs) in paper using microwave irradiation. Through thermal evaporation, microwave heating with an excess of glucose relative to the silver ion precursor yields nanoparticles on the surface of cellulose fibers within three minutes. Paper sheets were characterized by electron microscopy, UV-Visible reflectance spectroscopy, and atomic absorption spectroscopy. Antibacterial activity and silver release from the AgNP sheets were assessed for model Escherichia coli and Enterococci faecalis bacteria in deionized water and in suspensions that also contained with various influent solution chemistries, i.e. with natural organic matter, salts, and proteins. The paper sheets containing silver nanoparticles were effective in inactivating the test bacteria as they passed through the paper. PMID:25400935

  2. Antibacterial properties of composite resins incorporating silver and zinc oxide nanoparticles on Streptococcus mutans and Lactobacillus

    PubMed Central

    Kasraei, Shahin; Sami, Lida; Hendi, Sareh; AliKhani, Mohammad-Yousef; Rezaei-Soufi, Loghman

    2014-01-01

    Objectives Recurrent caries was partly ascribed to lack of antibacterial properties in composite resin. Silver and zinc nanoparticles are considered to be broad-spectrum antibacterial agents. The aim of the present study was to evaluate the antibacterial properties of composite resins containing 1% silver and zinc-oxide nanoparticles on Streptococcus mutans and Lactobacillus. Materials and Methods Ninety discoid tablets containing 0%, 1% nano-silver and 1% nano zinc-oxide particles were prepared from flowable composite resin (n = 30). The antibacterial properties of composite resin discs were evaluated by direct contact test. Diluted solutions of Streptococcus mutans (PTCC 1683) and Lactobacillus (PTCC 1643) were prepared. 0.01 mL of each bacterial species was separately placed on the discs. The discs were transferred to liquid culture media and were incubated at 37℃ for 8 hr. 0.01 mL of each solution was cultured on blood agar and the colonies were counted. Data was analyzed with Kruskall-Wallis and Mann-Whitney U tests. Results Composites containing nano zinc-oxide particles or silver nanoparticles exhibited higher antibacterial activity against Streptococcus mutans and Lactobacillus compared to the control group (p < 0.05). The effect of zinc-oxide on Streptococcus mutans was significantly higher than that of silver (p < 0.05). There were no significant differences in the antibacterial activity against Lactobacillus between composites containing silver nanoparticles and those containing zinc-oxide nanoparticles. Conclusions Composite resins containing silver or zinc-oxide nanoparticles exhibited antibacterial activity against Streptococcus mutans and Lactobacillus. PMID:24790923

  3. An Approach for Enhancement of Saturation Magnetization in Cobalt Ferrite Nanoparticles by Incorporation of Terbium Cation

    NASA Astrophysics Data System (ADS)

    Sodaee, Tahmineh; Ghasemi, Ali; Paimozd, Ebrahim; Paesano, Andrea; Morisako, Akimitsu

    2013-09-01

    Cobalt ferrite nanoparticles were synthesized by a reverse micelle process. The optimum processing conditions required to fabricate nanocrystalline cobalt ferrite using a reverse micelle technique, especially the effect of water-to-surfactant molar ratios including w = 8, 10, 12, and 14, pH values in the range of 8 to 11, and annealing temperatures in the range of 400°C to 800°C, were evaluated. x-Ray diffraction (XRD), field-emission scanning electron microscopy (FE-SEM), vibrating-sample magnetometry, and superconducting quantum interference device analysis were employed to evaluate the structural and magnetic properties of synthesized nanoparticles. XRD analysis confirms that the nanoparticles have a single-phase cubic spinel structure. The average particle size increases with increasing pH value and annealing temperature. Magnetization study reveals that the cobalt ferrite nanoparticles exhibit a superparamagnetic trend. The zero-field-cooled magnetization curves of cobalt ferrite nanoparticles indicated that, with an increase in pH value, the blocking temperature increases. Based on the obtained optimum parameters, terbium-substituted cobalt ferrite nanoparticles with composition CoFe2- x Tb x O4 ( x = 0.1 to 0.5) were prepared by a reverse micelle process. XRD and field-emission scanning electron microscopy evaluation demonstrated that single-phase spinel ferrites with narrow size distribution were obtained. Mössbauer spectroscopy was used to determine the site preference of terbium cation. The results confirm that terbium cations were distributed at tetrahedral and octahedral sites, but with a preference for the former. It was observed that, with an increase in terbium content, the saturation magnetization increases.

  4. Incorporation of Ln-Doped LaPO4 Nanocrystals as Luminescent Markers in Silica Nanoparticles.

    PubMed

    van Hest, Jacobine J H A; Blab, Gerhard A; Gerritsen, Hans C; Donega, Celso de Mello; Meijerink, Andries

    2016-12-01

    Lanthanide ions are promising for the labeling of silica nanoparticles with a specific luminescent fingerprint due to their sharp line emission at characteristic wavelengths. With the increasing use of silica nanoparticles in consumer products, it is important to label silica nanoparticles in order to trace the biodistribution, both in the environment and living organisms.In this work, we synthesized LaPO4 nanocrystals (NCs) with sizes ranging from 4 to 8 nm doped with europium or cerium and terbium. After silica growth using an inverse micelle method, monodisperse silica spheres were obtained with a single LaPO4 NC in the center. We demonstrate that the size of the silica spheres can be tuned in the 25-55 nm range by addition of small volumes of methanol during the silica growth reaction. Both the LaPO4 core and silica nanocrystal showed sharp line emission characteristic for europium and terbium providing unique optical labels in silica nanoparticles of variable sizes. PMID:27209405

  5. CuO nanoparticles incorporated in hierarchical MFI zeolite as highly active electrocatalyst for non-enzymatic glucose sensing.

    PubMed

    Dong, Junping; Tian, Taolei; Ren, Linxiao; Zhang, Yuan; Xu, Jiaqiang; Cheng, Xiaowei

    2015-01-01

    A hierarchical MFI zeolite, with typical micro/meso bimodal pore structures, was prepared by desilication method. CuO nanoparticles (NPs) were incorporated into the hierarchical MFI zeolite by impregnation method. CuO/hierarchical zeolite composites were characterized by X-ray diffraction, transmission electron microscopy and nitrogen sorption. It is shown that the CuO nanoparticles are mostly dispersed in the mesopores with remaining of the crystallinity and morphology of the host zeolite. CuO nanoparticles located in hierarchical zeolite exhibit the excellent electrocatalytic performances to oxidation of glucose in alkaline media. The electrocatalytic activity enhances with increasing the loading content of CuO from 5% to 15%. The composites were fabricated for nonenzyme glucose sensing. Under the optimal conditions, the sensor shows a wide linear range from 5×10(-7) to 1.84×10(-2) M with a low detection limit of 3.7×10(-7) M. The sensor also exhibits good repeatability, long-term stability as well as high selectivity against interfering species. PMID:25499226

  6. Oxidation and sensing of ascorbic acid and dopamine on self-assembled gold nanoparticles incorporated within polyaniline film

    NASA Astrophysics Data System (ADS)

    Chu, Wenya; Zhou, Qun; Li, Shuangshuang; Zhao, Wei; Li, Na; Zheng, Junwei

    2015-10-01

    Electrochemical biosensors based on conducting polymers incorporated with metallic nanoparticles can greatly enhance sensitivity and selectivity. Herein, we report a facile fabrication approach for polyaniline (PAN) incorporated with a gold nanoparticle (AuNP) composite electrode by electrodeposition of PAN on a self-assembled AuNP layer on the surface of an indium tin oxide electrode. The resulting AuNP/PAN composite electrode exhibits a remarkable synergistic effect on the electrocatalytic oxidation of ascorbic acid (AA) and dopamine (DA). It is demonstrated that the oxidation reaction of AA mainly occurs at AuNPs inside the PAN film as the ascorbate anions are doped into the polymer during the oxidation of the PAN film. Conversely, the oxidation of positively charged DA may only take place at the PAN/solution interface. The different mechanisms of the electrode reactions result in the oxidation of AA and DA occurring at different potentials. As a result, the AuNP/PAN composite electrode can be employed to simultaneously detect AA and DA with a good linear range, high sensitivity, and low detection limit.

  7. Kaempferol, a dietary flavonoid, ameliorates acute inflammatory and nociceptive symptoms in gastritis, pancreatitis, and abdominal pain.

    PubMed

    Kim, Shi Hyoung; Park, Jae Gwang; Sung, Gi-Ho; Yang, Sungjae; Yang, Woo Seok; Kim, Eunji; Kim, Jun Ho; Ha, Van Thai; Kim, Han Gyung; Yi, Young-Su; Kim, Ji Hye; Baek, Kwang-Soo; Sung, Nak Yoon; Lee, Mi-nam; Kim, Jong-Hoon; Cho, Jae Youl

    2015-07-01

    Kaempferol (KF) is the most abundant polyphenol in tea, fruits, vegetables, and beans. However, little is known about its in vivo anti-inflammatory efficacy and mechanisms of action. To study these, several acute mouse inflammatory and nociceptive models, including gastritis, pancreatitis, and abdominal pain were employed. Kaempferol was shown to attenuate the expansion of inflammatory lesions seen in ethanol (EtOH)/HCl- and aspirin-induced gastritis, LPS/caerulein (CA) triggered pancreatitis, and acetic acid-induced writhing. PMID:25917334

  8. Synthesis of icariin from kaempferol through regioselective methylation and para-Claisen-Cope rearrangement.

    PubMed

    Mei, Qinggang; Wang, Chun; Zhao, Zhigang; Yuan, Weicheng; Zhang, Guolin

    2015-01-01

    The hemisynthesis of the naturally occurring bioactive flavonoid glycoside icariin (1) has been accomplished in eleven steps with 7% overall yield from kaempferol. The 4'-OH methylation of kaempferol, the 8-prenylation of 3-O-methoxymethyl-4'-O-methyl-5-O-prenyl-7-O-benzylkaempferol (8) via para-Claisen-Cope rearrangement catalyzed by Eu(fod)3 in the presence of NaHCO3, and the glycosylation of icaritin (3) are the key steps. PMID:26425179

  9. Protective effects of kaempferol against cardiac sinus node dysfunction via CaMKII deoxidization

    PubMed Central

    An, Minae

    2015-01-01

    Kaempferol exerts cardioprotective actions through incompletely understood mechanisms. This study investigated the molecular mechanisms underlying the cardioprotective effects of kaempferol in sinus node dysfunction (SND) heart. Here, we demonstrate that angiotensin II (Ang II) infusion causes SND through oxidized calmodulin kinase II (CaMKII). In contrast to this, kaempferol protects sinus node against Ang II-induced SND. Ang II evoked apoptosis with caspase-3 activation in sinus nodal cells. However, kaempferol lowered the CaMKII oxidization and the sinus nodal cell death. To block the CaMKII oxidization, gene of p47phox, a cytosolic subunit of NADPH oxidase, was deleted using Cas9 KO plasmid. In the absence of p47phox, sinus nodal cells were highly resistance to Ang II-induced apoptosis, suggesting that oxidized-CaMKII contributed to sinus nodal cell death. In Langendorff heart from Ang II infused mice, kaempferol preserved normal impulse formation at right atrium. These data suggested that kaempferol protects sinus node via inhibition of CaMKII oxidization and may be useful for preventing SND in high risk patients. PMID:26770873

  10. Tailoring acidity of HZSM-5 nanoparticles for methyl bromide dehydrobromination by Al and Mg incorporation.

    PubMed

    Liu, Zhen; Zhang, Zhongdong; Xing, Wei; Komarneni, Sridhar; Yan, Zifeng; Gao, Xionghou; Zhou, Xiaoping

    2014-01-01

    Three kinds of HZSM-5 nanoparticles with different acidity were tailored by impregnating MgO or varying Si/Al ratios. Both the textural and acidic properties of the as-prepared nanoparticles were characterized by nitrogen adsorption-desorption measurements, X-ray diffraction (XRD), scanning electron microscopy (SEM), ammonia temperature-programmed desorption (NH3-TPD) and Fourier transform infrared spectroscopy (FTIR or Py-FTIR). It was found that the intensity of Lewis acid sites with weak strength was enhanced by impregnating MgO or reducing Al concentration, and such an enhancement could be explained by the formation of Mg(OH)(+) or charge unbalance of the MgO framework on the surface of HZSM-5 support. The effect of HZSM-5 nanoparticles' acidity on methyl bromide dehydrobromination as catalyst was evaluated. As the results, MgHZ-360 catalyst with the highest concentration of Lewis acid sites showed excellent stability, which maintained methyl bromide conversion of up 97% in a period of 400 h on stream. Coke characterization by BET measurements and TGA/DTA and GC/MS analysis revealed that polymethylated naphthalenes species were formed outside the channels of the catalyst with higher acid intensity and higher Brønsted acid concentration during the initial period of reaction, while graphitic carbon formed in the channels of catalyst with lower acid intensity and higher Lewis acid concentration during the stable stage. PMID:25328502

  11. Tailoring acidity of HZSM-5 nanoparticles for methyl bromide dehydrobromination by Al and Mg incorporation

    PubMed Central

    2014-01-01

    Three kinds of HZSM-5 nanoparticles with different acidity were tailored by impregnating MgO or varying Si/Al ratios. Both the textural and acidic properties of the as-prepared nanoparticles were characterized by nitrogen adsorption-desorption measurements, X-ray diffraction (XRD), scanning electron microscopy (SEM), ammonia temperature-programmed desorption (NH3-TPD) and Fourier transform infrared spectroscopy (FTIR or Py-FTIR). It was found that the intensity of Lewis acid sites with weak strength was enhanced by impregnating MgO or reducing Al concentration, and such an enhancement could be explained by the formation of Mg(OH)+ or charge unbalance of the MgO framework on the surface of HZSM-5 support. The effect of HZSM-5 nanoparticles' acidity on methyl bromide dehydrobromination as catalyst was evaluated. As the results, MgHZ-360 catalyst with the highest concentration of Lewis acid sites showed excellent stability, which maintained methyl bromide conversion of up 97% in a period of 400 h on stream. Coke characterization by BET measurements and TGA/DTA and GC/MS analysis revealed that polymethylated naphthalenes species were formed outside the channels of the catalyst with higher acid intensity and higher Brønsted acid concentration during the initial period of reaction, while graphitic carbon formed in the channels of catalyst with lower acid intensity and higher Lewis acid concentration during the stable stage. PMID:25328502

  12. Development of new active packaging film made from a soluble soybean polysaccharide incorporating ZnO nanoparticles.

    PubMed

    Salarbashi, Davoud; Mortazavi, Seyed Ali; Noghabi, Mostafa Shahidi; Fazly Bazzaz, Bibi Sedigheh; Sedaghat, Naser; Ramezani, Mohammad; Shahabi-Ghahfarrokhi, Iman

    2016-04-20

    This study aimed to develop a soluble soybean polysaccharide (SSPS) nanocomposite incorporating ZnO nanoparticles. The nanocomposites were prepared using the solvent-casting method. SEM, AFM, DSC and X-ray diffraction methods were applied to characterize the resulting films. Furthermore, the antibacterial and anti-mold activities of SSPS/ZN films were assessed against the selected microorganisms. The results indicated that incorporating ZNs into the SSPS film affected the tensile strength and elongation at break significantly. In addition, the antibacterial, antifungal and yeasticidal activities of ZnO/SSPS films have been approved. XRD results showed a crystal plane of hexagonal ZN, while SEM showed that there was not a good affinity between ZN and SSPS. Mono-dispersed particles with clearly spherical morphology and with no voids on the surface were observed using AFM. Fluctuation in Tg and Tm resulted from incorporating ZN. In summary, the potential of ZNs as a functional filler in SSPS film has been demonstrated. PMID:26876847

  13. Improved photovoltaic performance of silicon nanowire/organic hybrid solar cells by incorporating silver nanoparticles

    PubMed Central

    2013-01-01

    Silicon nanowire (SiNW) arrays show an excellent light-trapping characteristic and high mobility for carriers. Surface plasmon resonance of silver nanoparticles (AgNPs) can be used to increase light scattering and absorption in solar cells. We fabricated a new kind of SiNW/organic hybrid solar cell by introducing AgNPs. Reflection spectra confirm the improved light scattering of AgNP-decorated SiNW arrays. A double-junction tandem structure was designed to manufacture our hybrid cells. Both short-circuit current and external quantum efficiency measurements show an enhancement in optical absorption of organic layer, especially at lower wavelengths. PMID:23418988

  14. Kaempferol targets RSK2 and MSK1 to suppress UV radiation-induced skin cancer.

    PubMed

    Yao, Ke; Chen, Hanyong; Liu, Kangdong; Langfald, Alyssa; Yang, Ge; Zhang, Yi; Yu, Dong Hoon; Kim, Myoung Ok; Lee, Mee-Hyun; Li, Haitao; Bae, Ki Beom; Kim, Hong-Gyum; Ma, Wei-Ya; Bode, Ann M; Dong, Ziming; Dong, Zigang

    2014-09-01

    Solar UV (SUV) irradiation is a major factor in skin carcinogenesis, the most common form of cancer in the United States. The MAPK cascades are activated by SUV irradiation. The 90 kDa ribosomal S6 kinase (RSK) and mitogen and stress-activated protein kinase (MSK) proteins constitute a family of protein kinases that mediate signal transduction downstream of the MAPK cascades. In this study, phosphorylation of RSK and MSK1 was upregulated in human squamous cell carcinoma (SCC) and SUV-treated mouse skin. Kaempferol, a natural flavonol, found in tea, broccoli, grapes, apples, and other plant sources, is known to have anticancer activity, but its mechanisms and direct target(s) in cancer chemoprevention are unclear. Kinase array results revealed that kaempferol inhibited RSK2 and MSK1. Pull-down assay results, ATP competition, and in vitro kinase assay data revealed that kaempferol interacts with RSK2 and MSK1 at the ATP-binding pocket and inhibits their respective kinase activities. Mechanistic investigations showed that kaempferol suppresses RSK2 and MSK1 kinase activities to attenuate SUV-induced phosphorylation of cAMP-responsive element binding protein (CREB) and histone H3 in mouse skin cells. Kaempferol was a potent inhibitor of SUV-induced mouse skin carcinogenesis. Further analysis showed that skin from the kaempferol-treated group exhibited a substantial reduction in SUV-induced phosphorylation of CREB, c-Fos, and histone H3. Overall, our results identify kaempferol as a safe and novel chemopreventive agent against SUV-induced skin carcinogenesis that acts by targeting RSK2 and MSK1. PMID:24994661

  15. Kaempferol targets RSK2 and MSK1 to suppress ultraviolet radiation-induced skin cancer

    PubMed Central

    Langfald, Alyssa; Yang, Ge; Zhang, Yi; Yu, Dong Hoon; Kim, Myoung Ok; Lee, Mee-Hyun; Li, Haitao; Bae, Ki Beom; Kim, Hong-Gyum; Ma, Wei-Ya; Bode, Ann M.; Dong, Ziming; Dong, Zigang

    2014-01-01

    Solar ultraviolet (SUV) irradiation is a major factor in skin carcinogenesis, the most common form of cancer in the USA. The mitogen-activated protein (MAP) kinase cascades are activated by SUV irradiation. The 90 kDa ribosomal S6 kinase (RSK) and mitogen and stress activated protein kinase (MSK) proteins constitute a family of protein kinases that mediate signal transduction downstream of the MAP kinase cascades. In this study, phosphorylation of RSK and MSK1 was up-regulated in human squamous cell carcinoma (SCC) and solar UV-treated mouse skin. Kaempferol, a natural flavonol, found in tea, broccoli, grapes, apples and other plant sources, is known to have anticancer activity, but its mechanisms and direct target(s) in cancer chemoprevention are unclear. Kinase array results revealed that kaempferol inhibited RSK2 and MSK1. Pull-down assay results, ATP competition and in vitro kinase assay data revealed that kaempferol interacts with RSK2 and MSK1 at the ATP-binding pocket and inhibits their respective kinase activities. Mechanistic investigations showed that kaempferol suppresses RSK2 and MSK1 kinase activities to attenuate solar UV-induced phosphorylation of CREB and histone H3 in mouse skin cells. Kaempferol was a potent inhibitor of solar UV-induced mouse skin carcinogenesis. Further analysis showed that skin from the kaempferol-treated group exhibited a substantial reduction in solar UV-induced phosphorylation of cAMP response element-binding protein (CREB), c-Fos and histone H3. Overall, our results identify kaempferol as a safe and novel chemopreventive agent against solar UV-induced skin carcinogenesis that acts by targeting RSK2 and MSK1. PMID:24994661

  16. Incorporating Diblock Copolymer Nanoparticles into Calcite Crystals: Do Anionic Carboxylate Groups Alone Ensure Efficient Occlusion?

    PubMed Central

    2016-01-01

    New spherical diblock copolymer nanoparticles were synthesized via RAFT aqueous dispersion polymerization of 2-hydroxypropyl methacrylate (HPMA) at 70 °C and 20% w/w solids using either poly(carboxybetaine methacrylate) or poly(proline methacrylate) as the steric stabilizer block. Both of these stabilizers contain carboxylic acid groups, but poly(proline methacrylate) is anionic above pH 9.2, whereas poly(carboxybetaine methacrylate) has zwitterionic character at this pH. When calcite crystals are grown at an initial pH of 9.5 in the presence of these two types of nanoparticles, it is found that the anionic poly(proline methacrylate)-stabilized particles are occluded uniformly throughout the crystals (up to 6.8% by mass, 14.0% by volume). In contrast, the zwitterionic poly(carboxybetaine methacrylate)-stabilized particles show no signs of occlusion into calcite crystals grown under identical conditions. The presence of carboxylic acid groups alone therefore does not guarantee efficient occlusion: overall anionic character is an additional prerequisite. PMID:27042383

  17. Gold nanoparticle incorporated inverse opal photonic crystal capillaries for optofluidic surface enhanced Raman spectroscopy.

    PubMed

    Zhao, Xiangwei; Xue, Jiangyang; Mu, Zhongde; Huang, Yin; Lu, Meng; Gu, Zhongze

    2015-10-15

    Novel transducers are needed for point of care testing (POCT) devices which aim at facile, sensitive and quick acquisition of health related information. Recent advances in optofluidics offer tremendous opportunities for biological/chemical analysis using extremely small sample volumes. This paper demonstrates nanostructured capillary tubes for surface enhanced Raman spectroscopy (SERS) analysis in a flow-through fashion. The capillary tube integrates the SERS sensor and the nanofluidic structure to synergistically offer sample delivery and analysis functions. Inside the capillary tube, inverse opal photonic crystal (IO PhC) was fabricated using the co-assembly approach to form nanoscale liquid pathways. In the nano-voids of the IO PhC, gold nanoparticles were in situ synthesized and functioned as the SERS hotspots. The advantages of the flow-through SERS sensor are multifold. The capillary effect facilities the sample delivery process, the nanofluidic channels boosts the interaction of analyte and gold nanoparticles, and the PhC structure strengthens the optical field near the SERS hotspots and results in enhanced SERS signals from analytes. As an exemplary demonstration, the sensor was used to measure creatinein spiked in artificial urine samples with detection limit of 0.9 mg/dL. PMID:25988995

  18. Nanoparticles incorporating pH-responsive surfactants as a viable approach to improve the intracellular drug delivery.

    PubMed

    Nogueira, Daniele R; Scheeren, Laís E; Pilar Vinardell, M; Mitjans, Montserrat; Rosa Infante, M; Rolim, Clarice M B

    2015-12-01

    The pH-responsive delivery systems have brought new advances in the field of functional nanodevices and might allow more accurate and controllable delivery of specific cargoes, which is expected to result in promising applications in different clinical therapies. Here we describe a family of chitosan-TPP (tripolyphosphate) nanoparticles (NPs) for intracellular drug delivery, which were designed using two pH-sensitive amino acid-based surfactants from the family N(α),N(ε)-dioctanoyl lysine as bioactive compounds. Low and medium molecular weight chitosan (LMW-CS and MMW-CS, respectively) were used for NP preparation, and it was observed that the size distribution for NPs with LMW-CS were smaller (~168 nm) than that for NPs prepared with MMW-CS (~310 nm). Hemolysis assay demonstrated the pH-dependent biomembrane disruptional capability of the constructed NPs. The nanostructures incorporating the surfactants cause negligible membrane permeabilization at pH7.4. However, at acidic pH, prevailing in endosomes, membrane-destabilizing activity in an erythrocyte lysis assay became evident. When pH decreased to 6.6 and 5.4, hemolytic capability of chitosan NPs increased along with the raise of concentration. Furthermore, studies with cell culture showed that these pH-responsive NPs displayed low cytotoxic effects against 3T3 fibroblasts. The influence of chitosan molecular weight, chitosan to TPP weight ratio, nanoparticle size and nature of the surfactant counterion on the membrane-disruptive properties of nanoparticles was discussed in detail. Altogether, the results achieved here showed that by inserting the lysine-based amphiphiles into chitosan NPs, pH-sensitive membranolytic and potentially endosomolytic nanocarriers were developed, which, therefore, demonstrated ideal feasibility for intracellular drug delivery. PMID:26354244

  19. Improvement of poly(amphiphilic pyrrole) enzyme electrodes via the incorporation of synthetic laponite-clay-nanoparticles.

    PubMed

    Besombes, J L; Cosnier, S; Labbé, P

    1997-12-01

    The electropolymerization of an enzyme-amphiphilic pyrrole ammonium-laponite nanoparticles mixture preadsorbed on the electrode surface provides the simultaneous immobilization of the enzyme and the hydrophilic laponite-clay-nanoparticles in a functionalized polypyrrole film. The presence of incorporated laponite particles within the electrogenerated polymer induces a strong improvement of the analytical performances (I(max) and sensitivity) of amperometric biosensors based on polyphenol oxidase. These beneficial effects have been attributed to a marked enhancement of the apparent specific activity of the immobilized enzyme (from 0.21 to 0.85% of the specific activity of the free enzyme), the permeability of the host polymer being unchanged. This strategy of biosensor performance improvement was tested with cholesterol oxidase as an enzyme model. The presence of laponite additive in the poly(amphiphilic pyrrole) host matrix induces a similar enhancement of sensitivity and I(max) for cholesterol biosensing as well as a large improvement of the storage stability of the polypyrrole-cholesterol oxidase electrode. PMID:18966970

  20. Bacteriostatic and anti-collagenolytic dental materials through the incorporation of polyacrylic acid modified CuI nanoparticles

    DOEpatents

    Renne, Walter George; Mennito, Anthony Samuel; Schmidt, Michael Gerard; Vuthiganon, Jompobe; Chumanov, George

    2015-05-19

    Provided are antibacterial and antimicrobial surface coatings and dental materials by utilizing the antimicrobial properties of copper chalcogenide and/or copper halide (CuQ, where Q=chalcogens including oxygen, or halogens, or nothing). An antimicrobial barrier is created by incorporation of CuQ nanoparticles of an appropriate size and at a concentration necessary and sufficient to create a unique bioelectrical environment. The unique bioelectrical environment results in biocidal effectiveness through a multi-factorial mechanism comprising a combination of the intrinsic quantum flux of copper (Cu.sup.0, Cu.sup.1+, Cu.sup.2+) ions and the high surface-to-volume electron sink facilitated by the nanoparticle. The result is the constant quantum flux of copper which manifests and establishes the antimicrobial environment preventing or inhibiting the growth of bacteria. The presence of CuQ results in inhibiting or delaying bacterial destruction and endogenous enzymatic breakdown of the zone of resin inter-diffusion, the integrity of which is essential for dental restoration longevity.

  1. Protective and detrimental effects of kaempferol in rat H4IIE cells: Implication of oxidative stress and apoptosis

    SciTech Connect

    Niering, Petra; Michels, Gudrun; Waetjen, Wim . E-mail: wim.waetjen@uni-duesseldorf.de; Ohler, Sandra; Steffan, Baerbel; Chovolou, Yvonni; Kampkoetter, Andreas; Proksch, Peter; Kahl, Regine

    2005-12-01

    Flavonoids are ubiquitous substances in fruits and vegetables. Among them, the flavonol kaempferol contributes up to 30% of total dietary flavonoid intake. Flavonoids are assumed to exert beneficial effects on human health, e.g., anticancer properties. For this reason, they are used in food supplements at high doses. The aim of this project was to determine the effects of kaempferol on oxidative stress and apoptosis in H4IIE rat hepatoma cells over a broad concentration range. Kaempferol is rapidly taken up and glucuronidated by H4IIE cells. The results demonstrate that kaempferol protects against H{sub 2}O{sub 2}-induced cellular damage at concentrations which lead to cell death and DNA strand breaks in the absence of H{sub 2}O{sub 2}-mediated oxidative stress. Preincubation with 50 {mu}M kaempferol exerts protection against the loss of cell viability induced by 500 {mu}M H{sub 2}O{sub 2} (2 h) while the same concentration of kaempferol reduces cell viability by 50% in the absence of H{sub 2}O{sub 2} (24 h). Preincubation with 50 {mu}M kaempferol ameliorates the strong DNA damage induced by 500 {mu}M H{sub 2}O{sub 2} while 50 {mu}M kaempferol leads to a significant increase of DNA breakage in the absence of H{sub 2}O{sub 2}. Preincubation with 50 {mu}M kaempferol reduces H{sub 2}O{sub 2}-mediated caspase-3 activity by 40% (4 h) while the same concentration of kaempferol leads to the formation of a DNA ladder in the absence of H{sub 2}O{sub 2} (24 h). It is concluded that the intake of high dose kaempferol in food supplements may not be advisable because in our cellular model protective kaempferol concentrations can also induce DNA damage and apoptosis by themselves.

  2. Kaempferol induces ATM/p53-mediated death receptor and mitochondrial apoptosis in human umbilical vein endothelial cells.

    PubMed

    Lee, Chiu-Fang; Yang, Jai-Sing; Tsai, Fuu-Jen; Chiang, Ni-Na; Lu, Chi-Cheng; Huang, Yu-Syuan; Chen, Chun; Chen, Fu-An

    2016-05-01

    Kaempferol is a member of the flavonoid compounds found in vegetables and fruits. It is shown to exhibit biological impact and anticancer activity, but no report exists on the angiogenic effect of kaempferol and induction of cell apoptosis in vitro. In this study, we investigated the role of kaempferol on anti-angiogenic property and the apoptotic mechanism of human umbilical vein endothelial cells (HUVECs). Our results demonstrated that kaempferol decreased HUVEC viability in a time- and concentration-dependent manner. Kaempferol also induced morphological changes and sub-G1 phase cell population (apoptotic cells). Kaempferol triggered apoptosis of HUVECs as detecting by DNA fragmentation, comet assay and immunofluorescent staining for activated caspase-3. The caspase signals, including caspase-8, -9 and -3, were time-dependently activated in HUVECs after kaempferol exposure. Furthermore, pre-treatment with a specific inhibitor of caspase-8 (Z-IETD-FMK) significantly reduced the activity of caspase-8, -9 and -3, indicating that extrinsic pathway is a major signaling pathway in kaempferol-treated HUVECs. Importantly, kaempferol promoted reactive oxygen species (ROS) evaluated using flow cytometric assay in HUVECs. We further investigated the upstream extrinsic pathway and showed that kaempferol stimulated death receptor signals [Fas/CD95, death receptor 4 (DR4) and DR5] through increasing the levels of phosphorylated p53 and phosphorylated ATM pathways in HUVECs, which can be individually confirmed by N-acetylcysteine (NAC), ATM specific inhibitor (caffeine) and p53 siRNA. Based on these results, kaempferol-induced HUVEC apoptosis was involved in an ROS-mediated p53/ATM/death receptor signaling. Kaempferol might possess therapeutic effects on cancer treatment in anti-vascular targeting. PMID:26984266

  3. Fabrication of Pt nanoparticle incorporated polymer nanowires by high energy ion and electron beam irradiation

    NASA Astrophysics Data System (ADS)

    Tsukuda, Satoshi; Takahasi, Ryouta; Seki, Shu; Sugimoto, Masaki; Idesaki, Akira; Yoshikawa, Masahito; Tanaka, Shun-Ichiro

    2016-01-01

    Polyvinylpyrrolidone (PVP)-Pt nanoparticles (NPs) hybrid nanowires were fabricated by high energy ion beam irradiation to PVP thin films including H2PtCl6. Single ion hitting caused crosslinking reactions of PVP and reduction of Pt ions within local cylindrical area along an ion trajectory (ion track); therefore, the PVP nanowires including Pt NPs were formed and isolated on Si substrate after wet-development procedure. The number of Pt NPs was easily controlled by the mixed ratio of PVP and H2PtCl6. However, increasing the amount of H2PtCl6 led to decreasing the radial size and separation of the hybrid nanowires during the wet-development. Additional electron beam irradiation after ion beam improved separation of the nanowires and controlled radial sizes due to an increase in the density of crosslinking points inner the nanowires.

  4. A comparative study of two different approaches for the incorporation of silver nanoparticles into layer-by-layer films

    PubMed Central

    2014-01-01

    In this work, a comparative study about the incorporation of silver nanoparticles (AgNPs) into thin films is presented using two alternative methods, the in situ synthesis process and the layer-by-layer embedding deposition technique. The influence of several parameters such as color of the films, thickness evolution, thermal post-treatment, or distribution of the AgNPs along the coatings has been studied. Thermal post-treatment was used to induce the formation of hydrogel-like AgNPs-loaded thin films. Cross-sectional transmission electron microscopy micrographs, atomic force microscopy images, and UV-vis spectra reveal significant differences in the size and distribution of the AgNPs into the films as well as the maximal absorbance and wavelength position of the localized surface plasmon resonance absorption bands before and after thermal post-treatment. This work contributes for a better understanding of these two approaches for the incorporation of AgNPs into thin films using wet chemistry. PMID:24982607

  5. Enhanced Photovoltaic Performance in Polypyrrole Nanoparticles Counter Electrode Due to Incorporation of Multi-Walled Carbon Nanotubes.

    PubMed

    Baro, Mridula; Vijayan, C; Ramaprabhu, Sundara

    2015-07-01

    In this present work, Multi-walled carbon nanotubes (MWNTs) with different content by weight (10%, 20%, 30%, 50% and 70%) are introduced into Polypyrrole nanoparticles (PPy NP) matrix and fabricated as Pt free counter electrodes (CEs) for dye-sensitized solar cell (DSSC). For comparison DSSCs using pristine PPy NP, MWNTs and Platinum (Pt) were also fabricated. The incorporation of MWNTs acts as conductive channel and co-catalyst to the PPy NP CEs in the reduction of li to I-. The electrochemical catalytic activities of different CEs were analysed by Cyclic Voltammetry (CV) and Electrochemical Impedance Spectroscopy (EIS) and photovoltaic performance was studied under standard AM 1.5 sunlight illumination. It was observed that incorporation of MWNTs in the PPy NP CE greatly enhanced the catalytic activity for I3 reduction and significantly reduced the charge transfer resistance in the PPy NP/MWNTs composite CE finally improving short-circuit photocurrent density, fill factor, open circuit voltage and power conversion efficiency of DSSC. DSSC fabricated from PPy NP/MWNTs composite CE with 50% MWNTs content reached the highest photoconversion efficiency of 5.80% which is 91% that of Pt CE based DSSC (6.37%). PMID:26373060

  6. Delivery of imatinib-incorporated nanoparticles into lungs suppresses the development of monocrotaline-induced pulmonary arterial hypertension.

    PubMed

    Akagi, Satoshi; Nakamura, Kazufumi; Miura, Daiji; Saito, Yukihiro; Matsubara, Hiromi; Ogawa, Aiko; Matoba, Tetsuya; Egashira, Kensuke; Ito, Hiroshi

    2015-05-13

    Platelet-derived growth factor (PDGF) is implicated in the pathogenesis of pulmonary arterial hypertension (PAH). Imatinib, a PDGF-receptor tyrosine kinase inhibitor, improved hemodynamics, but serious side effects and drug discontinuation are common when treating PAH. A drug delivery system using nanoparticles (NPs) enables the reduction of side effects while maintaining the effects of the drug. We examined the efficacy of imatinib-incorporated NPs (Ima-NPs) in a rat model and in human PAH-pulmonary arterial smooth muscle cells (PASMCs). Rats received a single intratracheal administration of PBS, FITC-NPs, or Ima-NPs immediately after monocrotaline injection. Three weeks after monocrotaline injection, intratracheal administration of Ima-NPs suppressed the development of pulmonary hypertension, small pulmonary artery remodeling, and right ventricular hypertrophy in the rat model of monocrotaline-induced PAH. We also examined the effects of imatinib and Ima-NPs on PDGF-induced proliferation of human PAH-PASMCs by (3)H-thymidine incorporation. Imatinib and Ima-NPs significantly inhibited proliferation after 24 hours of treatment. Ima-NPs significantly inhibited proliferation compared with imatinib at 24 hours after removal of these drugs. Delivery of Ima-NPs into lungs suppressed the development of MCT-induced PAH by sustained antiproliferative effects on PAS-MCs. PMID:25902888

  7. Ultra-thin film composite mixed matrix membranes incorporating iron(iii)-dopamine nanoparticles for CO2 separation.

    PubMed

    Kim, Jinguk; Fu, Qiang; Scofield, Joel M P; Kentish, Sandra E; Qiao, Greg G

    2016-04-14

    Iron dopamine nanoparticles (FeDA NPs) are incorporated into a nanoscale thick polyethylene glycol (PEG) matrix for the first time, to form ultra-thin film composite mixed matrix membranes (UTFC-MMMs) via a recently developed continuous assembly of polymers (CAP) nanotechnology. The FeDA NPs are prepared by in situ nano-complexation between Fe(3+) and DA and have a particle size that can be varied from 3 to 74 nanometers by adjusting the molar ratio of DA to Fe(3+) ion. The cross-linked selective layer with sub 100 nanometer thickness is prepared by atom transfer radical polymerisation of a mixture of PEG macrocross-linkers and FeDA NPs on top of a highly permeable poly(dimethyl siloxane) (PDMS) prelayer, which is spin-coated onto a porous polyacrylonitrile (PAN) substrate. The incorporation of the FeDA NPs within the PEG-based selective layer is confirmed by XPS analysis. The UTFC-MMMs (thickness: ∼45 nm) formed present excellent gas separation performance with a CO2 permeance of ∼1200 GPU (1 GPU = 10(-6) cm(3) (STP) cm(-2) s(-1) cmHg(-1)) and an enhanced CO2/N2 selectivity of over 35, which is the best performance for UTFC membranes in the reported literature. PMID:27035774

  8. Polypropylene/glass fiber hierarchical composites incorporating inorganic fullerene-like nanoparticles for advanced technological applications.

    PubMed

    Dez-Pascual, Ana M; Naffakh, Mohammed

    2013-10-01

    Novel isotactic polypropylene (iPP)/glass fiber (GF) laminates reinforced with inorganic fullerene-like tungsten disulfide (IF-WS2) nanoparticles as environmentally friendly fillers have been successfully fabricated by simple melt-blending and fiber impregnation in a hot-press without the addition of any compatibilizer. The influence of IF-WS2 concentration on the morphology, viscosity. and thermal and mechanical behavior of the hierarchical composites has been investigated. Results revealed an unprecedented 62 C increase in the degradation temperature of iPP/GF upon addition of only 4.0 wt % IF-WS2. The coexistence of both micro- and nanoscale fillers resulted in synergistic effects on enhancing the stiffness, strength, crystallinity, thermal stability, glass transition (Tg) and heat distortion temperature (HDT) of the matrix. The approach used in this work is an efficient, versatile, scalable and economic strategy to improve the mechanical and thermal behavior of GF-reinforced thermoplastics with a view to extend their use in advanced technological applications. This new type of composite materials shows great potential to improve the efficiency and sustainability of many forms of transport. PMID:24015820

  9. Luminescence enhancement in nanocomposite consisting of polyvinyl alcohol incorporated gold nanoparticles and Nile blue 690 perchlorate.

    PubMed

    Chubinidze, Ketevan; Partsvania, Besarion; Sulaberidze, Tamaz; Khuskivadze, Aleksandre; Davitashvili, Elene; Koshoridze, Nana

    2014-11-01

    We have experimentally demonstrated that the emission of visible light from the polymer matrix doped with luminescent dye and gold nanoparticles (GNPs) can be enhanced with the use of surface plasmon coupling. GNPs can enhance the luminescence intensity of nearby luminescent dye because of the interactions between the dipole moments of the dye and the surface plasmon field of the GNPs. The electric charge on the GNPs and the distance between GNPs and luminescent dye molecules have a significant effect on the luminescence intensity, and this enhancement depends strongly upon the excitation wavelength of the pumping laser source. In particular, by matching the plasmon frequency of GNPs to the frequency of the laser light source we have observed a strong luminescence enhancement of the nanocomposite consisting of GNPs coupled with luminescent dye Nile blue 690 perchlorate. This ability of controlling luminescence can be beneficially used in developing contrast agents for highly sensitive and specific optical sensing and imaging. This opens new possibilities for plasmonic applications in the solar energy field. PMID:25402873

  10. Bimetal (Ni-Co) nanoparticles-incorporated electrospun carbon nanofibers as an alternative counter electrode for dye-sensitized solar cells

    NASA Astrophysics Data System (ADS)

    Rameez, Md.; Saranya, K.; Subramania, A.; Sivasankar, N.; Mallick, S.

    2016-02-01

    Counter electrode (CE) plays an important role in dye-sensitized solar cells (DSSCs). Electron transfer from external circuit to redox couple is mediated and facilitated by it to complete the DSSC circuit. Platinum (Pt) is widely employed as CE in DSSCs. However, due to its high cost and scarcity, efforts are being made to replace Pt. In this study, a bimetal (Ni-Co) nanoparticles-incorporated carbon nanofibers (CNFs) are prepared by electrospinning technique and used as CE material for DSSC applications. The morphology of prepared CNFs is characterized by field emission scanning electron microscope and transmission electron microscope studies. The structural properties are confirmed by X-ray diffraction and Raman spectroscopy studies. The electrochemical characterization of Ni-Co nanoparticles-incorporated CNFs is carried out using cyclic voltammetry, electrochemical impedance and Tafel polarization studies and compared with CNFs and std. Pt. The photo-conversion efficiency (PCE) of DSSC assembled with Ni-Co nanoparticles-incorporated CNFs as CE is very nearer to that of the same assembled with std. Pt as CE. Hence, Ni-Co nanoparticles-incorporated CNFs can be used as a cost-effective alternative CE for DSSCs.

  11. Kaempferol suppresses lipid accumulation by inhibiting early adipogenesis in 3T3-L1 cells and zebrafish.

    PubMed

    Lee, Yeon-Joo; Choi, Hyeon-Son; Seo, Min-Jung; Jeon, Hui-Jeon; Kim, Kui-Jin; Lee, Boo-Yong

    2015-08-01

    Kaempferol is a flavonoid present in Kaempferia galanga and Opuntia ficus indica var. saboten. Recent studies have suggested that it has anti-oxidant, anti-inflammatory, anti-cancer, and anti-obesity effects. In this study, we focused on the anti-adipogenic effects of kaempferol during adipocyte differentiation. The results showed that kaempferol inhibits lipid accumulation in adipocytes and zebrafish. Oil Red O and Nile Red staining showed that the number of intracellular lipid droplets decreased in adipocytes and zebrafish treated with kaempferol. LPAATθ (lysophosphatidic acid acyltransferase), lipin1, and DGAT1 (triglyceride synthetic enzymes) and FASN and SREBP-1C (fatty acid synthetic proteins) showed decreased expression levels in the presence of kaempferol. In addition, treatment of kaempferol showed an inhibitory activity on cell cycle progression. Kaempferol delayed cell cycle progression from the S to G2/M phase through the regulation of cyclins in a dose-dependent manner. Kaempferol blocked the phosphorylation of AKT (protein kinase B) and mammalian target of rapamycin (mTOR) signaling pathway during the early stages of adipogenesis. In addition, kaempferol down-regulated pro-early adipogenic factors such as CCAAT-enhancer binding proteins β (C/EBPβ), and Krüppel-like factors (KLFs) 4 and 5, while anti-early adipogenic factors, such as KLF2 and pref-1(preadipocyte factor-1), were upregulated. These kaempferol-mediated regulations of early adipogenic factors resulted in the attenuation of late adipogenic factors such as C/EBPα and peroxisome proliferator-activated receptor γ (PPARγ). These results were supported in zebrafish based on the decrease in lipid accumulation and expression of adipogenic factors. Our results indicated that kaempferol might have an anti-obesity effect by regulating lipid metabolism. PMID:26174858

  12. Assessment of MMP-1, MMP-8 and TIMP-2 in experimental periodontitis treated with kaempferol

    PubMed Central

    2016-01-01

    Purpose The objective of this study was to investigate the effect of a dietary flavonoid, kaempferol, which has been shown to possess antiallergic, anti-inflammatory, anticarcinogenic, and antioxidant activities on the periodontium by histomorphometric analysis and on gingival tissue matrix metalloproteinase-1 (MMP-1), MMP-8, and tissue inhibitor of metalloproteinase-2 (TIMP-2) by biochemical analysis of rats after experimental periodontitis induction. Methods Sixty Wistar rats were randomly divided into six groups of ten rats each, and silk ligatures were placed around the cervical area of the mandibular first molars for 15 days, except in the healthy control rats. In the experimental periodontitis groups, systemic kaempferol (10 mg/kg/2d) and saline were administered by oral gavage at two different periods (with and without the presence of dental biofilm) to all rats except for the ten non-medicated rats. Alveolar bone area, alveolar bone level, and attachment level were determined by histomorphometric analysis, and gingival tissue levels of MMP-1, MMP-8, and TIMP-2 were detected by biochemical analysis. Results Significantly greater bone area and significantly less alveolar bone and attachment loss were observed in the kaempferol application groups compared to the control groups (P<0.05). In addition, gingival tissue MMP-1 and -8 levels were significantly lower in the kaempferol application groups compared to the control groups and the periodontitis group (P<0.001). There were no statistically significant differences in TIMP-2 levels between the kaempferol and saline application groups (P>0.05). Conclusions Kaempferol application may be useful in decreasing alveolar bone resorption, attachment loss, and MMP-1 and -8 production in experimental periodontitis. PMID:27127689

  13. Synthesis of icariin from kaempferol through regioselective methylation and para-Claisen–Cope rearrangement

    PubMed Central

    Mei, Qinggang; Wang, Chun; Zhao, Zhigang; Yuan, Weicheng

    2015-01-01

    Summary The hemisynthesis of the naturally occurring bioactive flavonoid glycoside icariin (1) has been accomplished in eleven steps with 7% overall yield from kaempferol. The 4′-OH methylation of kaempferol, the 8-prenylation of 3-O-methoxymethyl-4′-O-methyl-5-O-prenyl-7-O-benzylkaempferol (8) via para-Claisen–Cope rearrangement catalyzed by Eu(fod)3 in the presence of NaHCO3, and the glycosylation of icaritin (3) are the key steps. PMID:26425179

  14. Incorporation of lapatinib into human serum albumin nanoparticles with enhanced anti-tumor effects in HER2-positive breast cancer.

    PubMed

    Wan, Xu; Zheng, Xiaoyao; Pang, Xiaoying; Zhang, Zheming; Zhang, Qizhi

    2015-12-01

    Lapatinib, a selective small-molecule dual-tyrosine kinase inhibitor of HER2 and EGFR, is effective in HER2-positive patients with advanced metastatic breast cancer. However, its low and variable oral absorption, large required daily dose and serious gastrointestinal side effects all limit its clinical use. Intravenous administration offers a good option to overcome these disadvantages. However, the poor solubility of lapatinib in water and organic solvents causes lapatinib to fail in a common injectable preparation. Considering lapatinib's high albumin binding ability (>99%), in this study, we developed human serum albumin nanoparticles loaded with lapatinib (LHNPs) by Nab technology for intravenous administration and investigated its efficacy against HER2-positive breast cancer. Raman shift, X-ray diffraction and X-ray photoelectron spectroscopy studies demonstrated that lapatinib was successfully incorporated into nanoparticles, and LHNPs exhibited good stability and sustained-release effect in vitro. LHNPs could be effectively taken up by SKBr3 cells in a concentration- and time-dependent manner, and the uptake was mediated by energy-dependent endocytosis, which involved clathrin-dependent pinocytosis. Furthermore, in vitro and in vivo data indicated that LHNPs presented the strong ability to induce apoptosis and superior anti-tumor efficacy in tumor-bearing mice to the commercial tablet Tykerb through the inhibition of HER2 phosphorylation. Subchronic toxicity assays indicated that LHNPs had no hepatic or kidney toxicity. With mature technology for industrial production and enhanced therapeutic effects, LHNPs are likely to have great potential as a safe therapeutic candidate against HER2-positive breast cancer in the clinic. PMID:26539808

  15. Gold nanoparticle incorporated polymer/bioactive glass composite for controlled drug delivery application.

    PubMed

    Jayalekshmi, A C; Sharma, Chandra P

    2015-02-01

    The present study discusses the development of a biodegradable polymer encapsulated-nanogold incorporated-bioactive glass composite (AuPBG) by a low-temperature method. The composite was analyzed by atomic force microscopy (AFM), X-ray diffraction (XRD), Fourier transform infrared (FTIR) spectroscopy, thermogravimetry (TG), fluorescence and dissolution analysis. The composite exhibited aggregation behaviour in solid and solution states and exhibited negative zeta potential (-13.3 ± 1.4 mV). The composite exhibited fast degradation starting from the 5(th) day onwards in phosphate buffered saline (PBS) for a period of 14 days. The composite showed fluorescence quenching effect at pH 7 and the fluorescence recovered at pH 5. The composite has been found to be suitable for the release of doxorubicin at high rates at acidic pH (∼ 5) which is the intracellular pH of tumour cells. The drug loading ratio is also high and it exhibited a controlled release for a period of 8 days in PBS. The system serves as a promising material for targeted drug delivery applications. PMID:25576810

  16. Monodisperse magnetic core/shell microspheres with Pd nanoparticles-incorporated-carbon shells.

    PubMed

    Fang, Qunling; Cheng, Qing; Xu, Huajian; Xuan, Shouhu

    2014-02-14

    This work reports a hard self-template method to synthesize core/shell like Fe3O4@C microparticles, in which the Pd nanocrystals can be alternatively incorporated into the carbon shells. The Fe3O4@polyaniline core/shell microspheres were first synthesized as the precursor by in situ polymerization of aniline onto the surface of the Fe3O4 microspheres. In a subsequent carbonization of the precursor under a vacuum oven, the Fe3O4 core was preserved and the polyaniline shell transferred into carbon shells enveloping the magnetic sphere, forming magnetic Fe3O4@C microspheres. The Pd ions could be impregnated into the polyaniline shell, and thus the obtained composites were transformed into Fe3O4@C/Pd microspheres under the same vacuum heating progress. The as-obtained system demonstrates superparamagnetic characteristics, which would benefit its potential application in nanocatalysts. This strategy provides an efficient approach for tailoring core/shell materials with desired functionalities and structures by adjusting the precursors and structure-directing agents. PMID:24323164

  17. Kaempferol induced apoptosis via endoplasmic reticulum stress and mitochondria-dependent pathway in human osteosarcoma U-2 OS cells.

    PubMed

    Huang, Wen-Wen; Chiu, Yu-Jen; Fan, Ming-Jen; Lu, Hsu-Feng; Yeh, Hsiu-Feng; Li, Kun-Hong; Chen, Po-Yuan; Chung, Jing-Gung; Yang, Jai-Sing

    2010-11-01

    Kaempferol is a natural flavonoid. Previous studies have reported that kaempferol has anti-proliferation activities and induces apoptosis in many cancer cell lines. However, there are no reports on human osteosarcoma. In this study, we investigate the anti-cancer effects and molecular mechanisms of kaempferol in human osteosarcoma cells. Our results demonstrate that kaempferol significantly reduces cell viabilities of U-2 OS, HOB and 143B cells, especially U-2 OS cells in a dose-dependent manner, but exerts low cytotoxicity on human fetal osteoblast progenitor hFOB cells. Comet assay, DAPI staining and DNA gel electrophoresis confirm the effects of DNA damage and apoptosis in U-2 OS cells. Flow cytometry detects the increase of cytoplasmic Ca(2+) levels and the decrease of mitochondria membrane potential. Western blotting and fluorogenic enzymatic assay show that kaempferol treatment influences the time-dependent expression of proteins involved in the endoplasmic reticulum stress pathway and mitochondrial signaling pathway. In addition, pretreating cells with caspase inhibitors, BAPTA or calpeptin before exposure to kaempferol increases cell viabilities. The anti-cancer effects of kaempferol in vivo are evaluated in BALB/c(nu/nu) mice inoculated with U-2 OS cells, and the results indicate inhibition of tumor growth. In conclusion, kaempferol inhibits human osteosarcoma cells in vivo and in vitro. PMID:20564475

  18. Ultra-thin film composite mixed matrix membranes incorporating iron(iii)-dopamine nanoparticles for CO2 separation

    NASA Astrophysics Data System (ADS)

    Kim, Jinguk; Fu, Qiang; Scofield, Joel M. P.; Kentish, Sandra E.; Qiao, Greg G.

    2016-04-01

    Iron dopamine nanoparticles (FeDA NPs) are incorporated into a nanoscale thick polyethylene glycol (PEG) matrix for the first time, to form ultra-thin film composite mixed matrix membranes (UTFC-MMMs) via a recently developed continuous assembly of polymers (CAP) nanotechnology. The FeDA NPs are prepared by in situ nano-complexation between Fe3+ and DA and have a particle size that can be varied from 3 to 74 nanometers by adjusting the molar ratio of DA to Fe3+ ion. The cross-linked selective layer with sub 100 nanometer thickness is prepared by atom transfer radical polymerisation of a mixture of PEG macrocross-linkers and FeDA NPs on top of a highly permeable poly(dimethyl siloxane) (PDMS) prelayer, which is spin-coated onto a porous polyacrylonitrile (PAN) substrate. The incorporation of the FeDA NPs within the PEG-based selective layer is confirmed by XPS analysis. The UTFC-MMMs (thickness: ~45 nm) formed present excellent gas separation performance with a CO2 permeance of ~1200 GPU (1 GPU = 10-6 cm3 (STP) cm-2 s-1 cmHg-1) and an enhanced CO2/N2 selectivity of over 35, which is the best performance for UTFC membranes in the reported literature.Iron dopamine nanoparticles (FeDA NPs) are incorporated into a nanoscale thick polyethylene glycol (PEG) matrix for the first time, to form ultra-thin film composite mixed matrix membranes (UTFC-MMMs) via a recently developed continuous assembly of polymers (CAP) nanotechnology. The FeDA NPs are prepared by in situ nano-complexation between Fe3+ and DA and have a particle size that can be varied from 3 to 74 nanometers by adjusting the molar ratio of DA to Fe3+ ion. The cross-linked selective layer with sub 100 nanometer thickness is prepared by atom transfer radical polymerisation of a mixture of PEG macrocross-linkers and FeDA NPs on top of a highly permeable poly(dimethyl siloxane) (PDMS) prelayer, which is spin-coated onto a porous polyacrylonitrile (PAN) substrate. The incorporation of the FeDA NPs within the PEG-based selective layer is confirmed by XPS analysis. The UTFC-MMMs (thickness: ~45 nm) formed present excellent gas separation performance with a CO2 permeance of ~1200 GPU (1 GPU = 10-6 cm3 (STP) cm-2 s-1 cmHg-1) and an enhanced CO2/N2 selectivity of over 35, which is the best performance for UTFC membranes in the reported literature. Electronic supplementary information (ESI) available: Details of the synthesis of polymer precursors and the fabrication of ultra-thin film composite mixed matrix membranes. See DOI: 10.1039/c5nr08840b

  19. Non-covalent functionalization of graphene oxide by polyindole and subsequent incorporation of Ag nanoparticles for electrochemical applications

    NASA Astrophysics Data System (ADS)

    Dubey, Prashant; Kumar, Ashish; Prakash, Rajiv

    2015-11-01

    Reduced graphene oxide (r-GO) sheets have been modified by polyindole (PIn) via in situ chemical oxidation method to obtain stable dispersion in water and furthermore incorporation of Ag nanoparticles (Ag NPs); the resulting Ag NPs/PIn-r-GO nanocomposite is demonstrated for electrochemical applications. Ag NPs/r-GO and PIn/GO nanocomposites have also been prepared for its comparative study with Ag NPs/PIn-r-GO. Non-covalent functionalization of GO by PIn polymer leads to PIn-GO dispersion, which is stable for several months without any precipitation. This dispersed solution is used for formation of Ag NPs/PIn-r-GO nanocomposite. Various experimental tools like UV-vis, FTIR and TEM have been used to characterize as-synthesized materials. Thereafter electrochemical performance of as-synthesized nanocomposites have been compared for their charge capacitive behaviour (without its poisoning compared to Ag NPs/r-GO) which leads to be an excellent candidate for the possible applications such as electrocatalysis, charge storage devices, etc. We observed that Ag NPs/PIn-r-GO nanocomposite exhibits better processability and electroactivity as electrode material in comparison to Ag NPs/r-GO and PIn/GO nanocomposites due to synergistic effect of individual components.

  20. One-step synthesis of size-tunable Ag nanoparticles incorporated in electrospun PVA/cyclodextrin nanofibers.

    PubMed

    Celebioglu, Asli; Aytac, Zeynep; Umu, Ozgun C O; Dana, Aykutlu; Tekinay, Turgay; Uyar, Tamer

    2014-01-01

    One-step synthesis of size-tunable silver nanoparticles (Ag-NP) incorporated into electrospun nanofibers was achieved. Initially, in situ reduction of silver salt (AgNO3) to Ag-NP was carried out in aqueous solution of polyvinyl alcohol (PVA). Here, PVA was used as reducing agent and stabilizing polymer as well as electrospinning polymeric matrix for the fabrication of PVA/Ag-NP nanofibers. Afterwards, hydroxypropyl-beta-cyclodextrin (HPβCD) was used as an additional reducing and stabilizing agent in order to control size and uniform dispersion of Ag-NP. The size of Ag-NP was ∼8 nm and some Ag-NP aggregates were observed for PVA/Ag-NP nanofibers, conversely, the size of Ag-NP decreased from ∼8 nm down to ∼2 nm within the fiber matrix without aggregation were attained for PVA/HPβCD nanofibers. The PVA/Ag-NP and PVA/HPβCD/Ag-NP nanofibers exhibited surface enhanced Raman scattering (SERS) effect. Moreover, antibacterial properties of PVA/Ag-NP and PVA/HPβCD/Ag-NP nanofibrous mats were tested against Gram-negative (Escherichia coli) and Gram-positive (Staphylococcus aureus) bacteria. PMID:24274573

  1. Study of incorporation of silver nanoparticles onto PE-g-PAAc nonwoven fabric by γ-irradiation for water treatment

    NASA Astrophysics Data System (ADS)

    Phu, Dang Van; Quoc, Le Anh; Duy, Nguyen Ngoc; Hien, Nguyen Quoc

    2013-07-01

    Polyethylene nonwoven (PE) fabric was grafted with acrylic acid (PE-g-PAAc) by the γ-ray pre-irradiation process. The effect of dose and acrylic acid concentration on the grafting degree was investigated. The dose of about 20-30 kGy, acrylic acid concentration of 20-30%, and the reaction time of about 2 h at ˜90 °C were selected as suitable parameters for grafting. The PE-g-PAAc fabric was then impregnated in colloidal silver nanoparticles (AgNPs) solution for incorporating AgNPs. The resultant PE-g-PAAc/AgNPs fabric containing ˜10,000 ppm AgNPs exhibits high antimicrobial activity (η>99%) against Escherichia coli in water. The release of silver into water filtrate determined by ICP-MS was less than 0.1 mg/L. The PE-g-PAAc/AgNPs fabric can be potentially applied for water and/or air treatment as an antimicrobial membrane filter.

  2. Nanoparticles of gadolinium-incorporated Prussian blue with PEG coating as an effective oral MRI contrast agent for gastrointestinal tract imaging.

    PubMed

    Perera, Vindya S; Chen, Guojun; Cai, Qing; Huang, Songping D

    2016-03-01

    Biocompatible nanoparticles of gadolinium-incorporated Prussian blue with the empirical formula K0.94Gd0.02Fe[Fe(CN)6] exhibit extremely high stability against the release of Gd(3+) and CN(-) ions under the acidic conditions similar to stomach juice. The high r1 relaxivity, low cytotoxicity and the ability of such nanoparticles to penetrate the cell membrane suggest that this coordination-polymer structural platform offers a unique opportunity for developing the next generation of T1-weighted oral cellular MRI probes for the early detection of tumors in the gastrointestinal tract. PMID:26890149

  3. Pollination- or Wound-Induced Kaempferol Accumulation in Petunia Stigmas Enhances Seed Production.

    PubMed Central

    Vogt, T.; Pollak, P.; Tarlyn, N.; Taylor, L. P.

    1994-01-01

    Flavonols are essential for pollen germination and tube growth in petunia and can be supplied by either the pollen or stigma at pollination. HPLC analysis and a sensitive bioassay demonstrated that both pollination and wounding induce flavonol accumulation, especially kaempferol, in the outer cell layers and exudate of the stigma. Pollination and wounding induced nearly identical flavonol kinetics and patterns of accumulation in the same target tissue, suggesting that they share elements of a common signal transduction pathway. The wound response was systemic, because kaempferol accumulated in the stigma when distal tissues, such as the corolla, stamens, or sepals, were wounded. We have exploited the germination requirement for flavonols and the high level of kaempferol that accumulates after wounding to enhance plant fecundity. Seed set was significantly increased by mechanically wounding the corolla and stamens prior to the application of pollen to the stigma. A reproductive role for a plant secondary metabolite and the specific function of stigmatic kaempferol are discussed from an evolutionary perspective. PMID:12244218

  4. Effect of Glucuronidation on the Potential of Kaempferol To Inhibit Serine/Threonine Protein Kinases.

    PubMed

    Beekmann, Karsten; de Haan, Laura H J; Actis-Goretta, Lucas; van Bladeren, Peter J; Rietjens, Ivonne M C M

    2016-02-17

    To study the effect of metabolic conjugation of flavonoids on the potential to inhibit protein kinase activity, the inhibitory effects of the dietary flavonol kaempferol and its major plasma conjugate kaempferol-3-O-glucuronide on protein kinases were studied. To this end, the inhibition of the phosphorylation activity of recombinant protein kinase A (PKA) and of cell lysate from the hepatocellular carcinoma cell line HepG2 on 141 putative serine/threonine phosphorylation sites derived from human proteins was assessed. Glucuronidation reduced the inhibitory potency of kaempferol on the phosphorylation activity of PKA and HepG2 lysate on average about 16 and 3.5 times, respectively, but did not appear to affect the target selectivity for kinases present in the lysate. The data demonstrate that, upon glucuronidation, kaempferol retains part of its intrinsic kinase inhibition potential, which implies that K3G does not necessarily need to be deconjugated to the aglycone for a potential inhibitory effect on protein kinases. PMID:26808477

  5. Extension of optical properties of ZnO/SiO2 materials induced by incorporation of Au or NiO nanoparticles

    NASA Astrophysics Data System (ADS)

    Rogozea, Elena Adina; Olteanu, Nicoleta Liliana; Petcu, Adina Roxana; Lazar, Cosmina Andreea; Meghea, Aurelia; Mihaly, Maria

    2016-06-01

    Incorporating noble metal nanoparticles (NPs) and oxides has been proved to be an effective method to tune the optical properties of silica based materials. In this paper the optical and photocatalytic properties have been studied for ZnO/SiO2 modified with Au or NiO nanoparticles. Changes in the optical properties of semiconductor ZnO particles have been observed due to the deposition of coloured Au and NiO nanoparticles by reducing the band gap energy and thus extending light absorption to visible domain. The excellent surface characteristics of NiO/ZnO/SiO2 and Au/ZnO/SiO2 favour the adsorption behaviour of these materials and limit the recombination of electron-holes pairs. Crystal Violet degradation under VIS light proved to have higher efficiency in the presence of Au/ZnO/SiO2 (97%) than for NiO/ZnO/SiO2 (60%).

  6. Kaempferol-3-O-rutinoside from Afgekia mahidoliae promotes keratinocyte migration through FAK and Rac1 activation.

    PubMed

    Petpiroon, Nareerat; Suktap, Chalermlat; Pongsamart, Sunanta; Chanvorachote, Pithi; Sukrong, Suchada

    2015-07-01

    The restoration of the epidermal epithelium through re-epithelialization is a critical process in wound healing. Directed keratinocyte migration to the wound is required, and the retardation of this process may result in a chronic, non-healing wound. The present study contributes to research aiming to identify promising compounds that promote wound healing using a human keratinocyte model. The effects of three kaempferol glycosides from an Afgekia mahidoliae leaf extract, kaempferol-3-O-arabinoside, kaempferol-3-O-glucoside, and kaempferol-3-O-rutinoside, on keratinocyte migration were determined. Interestingly, kaempferol-3-O-rutinoside exhibited a pronounced effect on wound closure in comparison to the parental kaempferol and other glycosides. The mechanism by which kaempferol-3-O-rutinoside enhances cell migration involves the induction of filopodia and lamellipodia formation, increased cellular levels of phosphorylated FAK (Tyr 397) and phosphorylated Akt (Ser 473), and up-regulation of active Rac1-GTP. The data obtained in this study may support the development of this compound for use in wound healing therapies. PMID:25783411

  7. Kaempferol Inhibits Pancreatic Cancer Cell Growth and Migration through the Blockade of EGFR-Related Pathway In Vitro

    PubMed Central

    Lee, Jungwhoi; Kim, Jae Hoon

    2016-01-01

    Pancreatic cancer is one of the most appalling cancers with a pessimistic prognosis. Despite many therapies, there has been no improvement of survival rates. In this study, we assessed the anti-cancer effects of kaempferol, a well known flavonoid having functional bio-activity against various malignant tumors. Kaempferol had anti-cancer effects on Miapaca-2, Panc-1, and SNU-213 human pancreatic cancer cells. In a dose-dependent manner, kaempferol decreased viability of these pancreatic cancer cells by increasing apoptosis. In particular, kaempferol effectively inhibited the migratory activity of human pancreatic cancer cells at relatively low dosages without any toxicity. The anti-cancer effect of kaempferol was mediated by inhibition of EGFR related Src, ERK1/2, and AKT pathways. These results collectively indicate that kaempferol, a phytochemical ingredient reported to have anti-viability and anti-oxidant properties, can act as a safety anti-migration reagent in human pancreatic cancer cells, which provide the rationale for further investigation of kaempferol as a strong candidate for the potential clinical trial of malignant pancreatic cancers. PMID:27175782

  8. Incorporation of mesoporous silica nanoparticles into random electrospun PLGA and PLGA/gelatin nanofibrous scaffolds enhances mechanical and cell proliferation properties.

    PubMed

    Mehrasa, Mohammad; Asadollahi, Mohammad Ali; Nasri-Nasrabadi, Bijan; Ghaedi, Kamran; Salehi, Hossein; Dolatshahi-Pirouz, Alireza; Arpanaei, Ayyoob

    2016-09-01

    Poly(lactic-co-glycolic acid) (PLGA) and PLGA/gelatin random nanofibrous scaffolds embedded with different amounts of mesoporous silica nanoparticles (MSNPs) were fabricated using electrospinning method. To evaluate the effects of nanoparticles on the scaffolds, physical, chemical, and mechanical properties as well as in vitro degradation behavior of scaffolds were investigated. The mean diameters of nanofibers were 974±68nm for the pure PLGA scaffolds vs 832±70, 764±80, and 486±64 for the PLGA/gelatin, PLGA/10wt% MSNPs, and the PLGA/gelatin/10wt% MSNPs scaffolds, respectively. The results suggested that the incorporation of gelatin and MSNPs into PLGA-based scaffolds enhances the hydrophilicity of scaffolds due to an increase of hydrophilic functional groups on the surface of nanofibers. With porosity examination, it was concluded that the incorporation of MSNPs and gelatin decrease the porosity of scaffolds. Nanoparticles also improved the tensile mechanical properties of scaffolds. Using in vitro degradation analysis, it was shown that the addition of nanoparticles to the nanofibers matrix increases the weight loss percentage of PLGA-based samples, whereas it decreases the weight loss percentage in the PLGA/gelatin composites. Cultivation of rat pheochromocytoma cell line (PC12), as precursor cells of dopaminergic neural cells, on the scaffolds demonstrated that the introduction of MSNPs into PLGA and PLGA/gelatin matrix leads to improved cell attachment and proliferation and enhances cellular processes. PMID:27207035

  9. Regulation of heme oxygenase-1 expression and MAPK pathways in response to kaempferol and rhamnocitrin in PC12 cells

    SciTech Connect

    Hong, J.-T.; Yen, J.-H.; Wang Lisu; Lo, Y.-H.; Chen, Z.-T.; Wu, M.-J.

    2009-05-15

    Oxidative stress has been considered as a major cause of cellular injuries in a variety of clinical abnormalities, especially neural diseases. Our aim of research is to investigate the protective effects and mechanisms of kaempferol and rhamnocitrin (kaempferol-7-methyl ether) on oxidative damage in rat pheochromocytoma PC12 cells induced by a limited supply of serum and hydrogen peroxide (H{sub 2}O{sub 2}). The current result demonstrated that kaempferol protected PC12 cells from serum deprivation-induced apoptosis. Pretreatment of cells with kaempferol also diminished intracellular generation of reactive oxygen species (ROS) in response to H{sub 2}O{sub 2} and strongly elevated cell viability. RT-Q-PCR and Western blotting revealed that kaempferol and rhamnocitrin significantly induced heme oxygenase (HO)-1 gene expression. Addition of zinc protoporphyrin (Znpp), a HO-1 competitive inhibitor, significantly attenuated their protective effects in H{sub 2}O{sub 2}-treated cells, indicating the vital role of HO-1 in cell resistance to oxidative injury. While investigating the signaling pathways responsible for HO-1 induction, we observed that kaempferol induced sustained extracellular signal-regulated protein kinase 1/2 (ERK1/2) in PC12 cells grown in low serum medium; while rhamnocitrin only stimulated transient ERK cascade. Addition of U0126, a highly selective inhibitor of MEK1/2, which is upstream of ERK1/2, had no effect on kaempferol- or rhamnocitrin-induced HO-1 mRNA expression, indicating no direct cross-talk between these two pathways. Furthermore, both kaempferol and rhamnocitrin were able to persistently attenuate p38 phosphorylation. Taking together, the above findings suggest that kaempferol and rhamnocitrin can augment cellular antioxidant defense capacity, at least in part, through regulation of HO-1 expression and MAPK signal transduction.

  10. ZnO nanoparticle incorporated nanostructured metallic titanium for increased mesenchymal stem cell response and antibacterial activity

    NASA Astrophysics Data System (ADS)

    Elizabeth, Elmy; Baranwal, Gaurav; Krishnan, Amit G.; Menon, Deepthy; Nair, Manitha

    2014-03-01

    Recent trends in titanium implants are towards the development of nanoscale topographies that mimic the nanoscale properties of bone tissue. Although the nanosurface promotes the integration of osteoblast cells, infection related problems can also occur, leading to implant failure. Therefore it is imperative to reduce bacterial adhesion on an implant surface, either with or without the use of drugs/antibacterial agents. Herein, we have investigated two different aspects of Ti surfaces in inhibiting bacterial adhesion and concurrently promoting mammalian cell adhesion. These include (i) the type of nanoscale topography (Titania nanotube (TNT) and Titania nanoleaf (TNL)) and (ii) the presence of an antibacterial agent like zinc oxide nanoparticles (ZnOnp) on Ti nanosurfaces. To address this, periodically arranged TNT (80-120 nm) and non-periodically arranged TNL surfaces were generated by the anodization and hydrothermal techniques respectively, and incorporated with ZnOnp of different concentrations (375 μM, 750 μM, 1.125 mM and 1.5 mM). Interestingly, TNL surfaces decreased the adherence of staphylococcus aureus while increasing the adhesion and viability of human osteosarcoma MG63 cell line and human mesenchymal stem cells, even in the absence of ZnOnp. In contrast, TNT surfaces exhibited an increased bacterial and mammalian cell adhesion. The influence of ZnOnp on these surfaces in altering the bacterial and cell adhesion was found to be concentration dependent, with an optimal range of 375-750 μM. Above 750 μM, although bacterial adhesion was reduced, cellular viability was considerably affected. Thus our study helps us to infer that nanoscale topography by itself or its combination with an optimal concentration of antibacterial ZnOnp would provide a differential cell behavior and thereby a desirable biological response, facilitating the long term success of an implant.

  11. Cu-Au-Ag alloy nanoparticles incorporated silica films using a new three-layer deposition technique.

    PubMed

    Pal, Sudipto; Bysakh, Sandip; De, Goutam

    2010-02-01

    Formation of Au-Ag-Cu ternary alloy nanoparticles (NPs) is difficult mainly because the system Cu/Ag is immiscible. We present a new synthetic technique to generate such ternary alloy NPs in silica film matrix employing a three-layer (3L) coating design. In this methodology three successive coating layers were deposited on silica glass substrates from separately prepared Cu-, Au- and Ag-ion incorporated inorganic-organic hybrid silica sols by dipping method. The Au layer is kept in the middle because it is miscible with both the Ag and Cu. The 3L film assembly was subjected to UV- and heat-treatment at 450-750 degrees C in H2-N2 atmosphere. UV-treatment generates small Au and Ag NPs in the respective layers and Cu remains as Cu2+; subsequent heat-treatment in H2-N2 induces the formation of ternary alloy NPs by the interlayer diffusion of nanometals. The final heat-treated film (750 degrees C/H2-N2) shows single and sharp plasmon band centered at 480 nm in the UV-visible spectrum indicating the formation of alloy (solid solution) NPs. GIXRD study shows one set of diffraction peaks which are shifted towards higher angle with respect to the Au or Ag diffraction peaks. FESEM, GIXRD, HRTEM, and SAED analyses reveal that the alloy has a composition close to (Au + Ag)0.88Cu0.12. The EDS analyses using the nano probe attached with TEM confirm the presence of Au, Ag and Cu in all the alloy NPs. PMID:20352717

  12. CdS nanoparticles incorporated onion-like mesoporous silica films: Ageing-induced large stokes shifted intense PL emission

    NASA Astrophysics Data System (ADS)

    Mishra, Manish Kr; Mandal, Abhijit; Saha, Jony; De, Goutam

    2013-10-01

    CdS nanoparticles (NPs) were generated in onion-like ordered mesoporous SiO2 films through a modified sol-gel process using P123 as a structure directing agent. Initially Cd2+ doped (12 equivalent mol% with respect to the SiO2) mesoporous SiO2 films were prepared on glass substrate. These films after heat-treatment at 350 °C in air yielded transparent mesoporous SiO2 films having hexagonally ordered onion-like pore channels embedded with uniformly dispersed CdO NPs. The generated CdO NPs were transformed into CdS NPs after exposing the films in H2S gas at 200 °C for 2 h. The as-prepared CdS NPs incorporated mesoporous SiO2 films (transparent and bright yellow in color) showed a band-edge emission at 485 nm and a weak surface defect related emission at 530 nm. During ageing of the films in ambient condition the band-edge emission gradually weakened with time and almost disappeared after about 15 days with concomitant increase of defect related strong surface state emission band near 615 nm. This transformation was related to the decay of initially formed well crystalline CdS to relatively smaller and weakly crystalline CdS NPs with surface defects due to gradual oxidation of surface sulfide. At this condition the embedded CdS NPs show large Stokes shifted (˜180 nm) intense broad emission which could be useful for luminescent solar concentrators. The detailed process was monitored by UV-Visible, FTIR and Raman spectroscopy, XPS, XRD and TEM studies. The evolution of photoluminescence (PL) and life times of CdS/SiO2 films were monitored with respect to the ageing time.

  13. In situ incorporation of nickel nanoparticles into the mesopores of MCM-41 by manipulation of solvent-solute interaction and its activity toward adsorptive desulfurization of gas oil.

    PubMed

    Samadi-Maybodi, Abdolraouf; Teymouri, Mohammad; Vahid, Amir; Miranbeigi, Aliakbar

    2011-09-15

    In this contribution, different amounts of nickel were incorporated into the mesopores of MCM-41 via an in situ approach. A hydrophobic nickel precursor was incorporated into the nanochannels of mesoporous silica by manipulation of solvent-solute interaction. The synthesized material was characterized using X-ray diffraction, nitrogen physisorption, temperature programmed reduction, and transmission electron microscopy. The results implicate the formation of MCM-41 with well-ordered hexagonal structure and establish also the presence of nickel nanoparticles inside the nanochannels of mesoporous silica. Adsorptive desulfurization of gas oil was conducted using the nickel-incorporated MCM-41 samples. The effects of nickel concentration, temperature of process and feed flow rate on the desulfurization process were examined. The MCM-41 containing 6 wt.% of nickel had both the highest breakthrough sulfur adsorption capacity and total sulfur adsorption capacity, which were 0.69 and 1.67 mg sulfur/g adsorbent, respectively. The breakthrough sulfur adsorption capacity was almost regained after reductive regeneration of spent adsorbent. The obtained results suggest that the method applied for the synthesis of Niy/MCM resulted in formation of well-dispersed, accessible and small nickel nanoparticles incorporated into the pores of MCM-41 which might be an advantage for adsorption of refractory sulfur compounds from low sulfur gas oil. PMID:21820806

  14. Kaempferol glycosides and cardenolide glycosides, cytotoxic constituents from the seeds of Draba nemorosa (Brassicaceae).

    PubMed

    Moon, Surk-Sik; Rahman, Md Aziz Abdur; Manir, Md Maniruzzaman; Jamal Ahamed, V S

    2010-08-01

    Bioassay-directed fractionation of a methanolic extract from the seeds of Draba nemorosa (Brassicaceae) led to isolation of a new flavonol glycoside, drabanemoroside (5, kaempferol 3-O-alpha-L-rhamnopyranosyl-(1-->2)-alpha-L-arabinopyranose) along with four known flavonoid derivatives (1-4), four cardenolide glycosides (6-9). Kaempferol glycosides 2 and 5 showed strong cytotoxicity against human small lung cancer cell line A549 and melanoma SK-Mel-2 with an IC(50) of 0.5 microg/mL and 1.9 microg/mL, respectively. Cardenolide glycosides 6-9 showed potent cytotoxicity (A549) in the range of 0.01-0.032 microg/mL. Their structures were characterized based on spectroscopic data (2D NMR, HRTOFMS, IR, and UV) and comparison of literature values. The carbohydrate units were also confirmed by comparing the hydrolysate of 5 with authentic monosaccharides. PMID:20803119

  15. Improved performance of poly(3,4-ethylenedioxythiophene):poly(stylene sulfonate)/n-Si hybrid solar cell by incorporating silver nanoparticles

    NASA Astrophysics Data System (ADS)

    Khatri, Ishwor; Liu, Qiming; Ueno, Keiji; Shirai, Hajime

    2014-11-01

    We report an enhancement in the efficiency of poly(3,4-ethylenedioxythiophene):poly(stylene sulfonate) (PEDOT:PSS)/n-Si hybrid solar cell by incorporating silver nanoparticles (AgNPs) with PEDOT:PSS. AgNPs were prepared by reducing silver nitrate in green-tea solution, which showed characteristic absorption peak due to the surface plasmonic resonance effect. AgNPs incorporated PEDOT:PSS/n-Si hybrid device shows power conversion efficiency (η) of 10.21%, which is comparatively higher to the performance of pristine device without AgNPs. Here, we noticed that incorporation of AgNPs decreases sheet resistance and enlarged surface roughness of PEDOT:PSS film for the efficient collection of charges, rather than plasmonic effect.

  16. Petals of Crocus sativus L. as a potential source of the antioxidants crocin and kaempferol.

    PubMed

    Zeka, Keti; Ruparelia, Ketan C; Continenza, Maria A; Stagos, Dimitrios; Vegliò, Francesco; Arroo, Randolph R J

    2015-12-01

    Saffron from the province of L'Aquila, in the Abruzzo region of Italy, is highly prized and has been awarded a formal recognition by the European Union with EU Protected Designation of Origin (PDO) status. Despite this, the saffron regions are abandoned by the younger generations because the traditional cultivation of saffron (Crocus sativus L.) is labour intensive and yields only one crop of valuable saffron stamens per year. Petals of the saffron Crocus have had additional uses in traditional medicine and may add value to the crops for local farmers. This is especially important because the plant only flowers between October and November, and farmers will need to make the best use of the flowers harvested in this period. Recently, the petals of C. sativus L., which are considered a waste material in the production of saffron spice, were identified as a potential source of natural antioxidants. The antioxidants crocin and kaempferol were purified by flash column chromatography, and identified by thin layer chromatography (TLC), HPLC-DAD, infrared (IR), and nuclear magnetic resonance ((1)H &(13)C NMR) spectroscopy. The antioxidant activity was determined with the ABTS and DPPH tests. The antioxidant activities are mainly attributed to carotenoid and flavonoid compounds, notably glycosides of crocin and kaempferol. We found in dried petals 0.6% (w/w) and 12.6 (w/w) of crocin and kaempferol, respectively. Petals of C. sativus L. have commercial potential as a source for kaempferol and crocetin glycosides, natural compounds with antioxidant activity that are considered to be the active ingredients in saffron-based herbal medicine. PMID:26012879

  17. Blood micromolar concentrations of kaempferol afford protection against ischemia/reperfusion-induced damage in rat brain.

    PubMed

    López-Sánchez, Carmen; Martín-Romero, Francisco Javier; Sun, Fei; Luis, Laura; Samhan-Arias, Alejandro K; García-Martínez, Virginio; Gutiérrez-Merino, Carlos

    2007-11-28

    The slow time course of neurodegeneration after brain ischemia/reperfusion opened a realistic time window for the application of protective therapies to prevent spreading of brain damage. In this work, we studied the ability of micromolar concentrations of this flavonoid in the blood to protect against brain damage induced by transient focal cerebral ischemia in rats. Transient focal cerebral ischemia was induced by middle cerebral artery occlusion in adult rats and brain damage has been monitored by 2,3,5-triphenyltetrazolium chloride (TTC) staining, hematoxylin-eosin (H-E) staining, 'in situ' terminal deoxyribonucleotidyl transferase-mediated dUTP-fluorescein nick end labeling (TUNEL), 'in situ' metalloproteinase activity using DQ-gelatin and loss of anti-laminin staining. Intravenous injections of kaempferol, at a dose of 10-15 mumol/L of blood 30 min before the induction of a 60 min ischemia-episode and just after reperfusion, led to >90% and 70-80% (TTC, H-E, TUNEL) decrease of brain damage in the temporal-frontal areas of neocortex and striatum, respectively, but only 40-50% decrease of brain damage was observed in the hippocampus and vicinal caudal areas of the striatum. This treatment with kaempferol also produced a similar reduction of metalloproteinase activation and loss of anti-laminin staining in cortical and striatum infarct areas. Kaempferol treatment efficiently protected against nitrosative-oxidative stress after ischemia/reperfusion, as shown by nearly complete protection against the increase of protein nitrotyrosines, and also afforded strong protection against the increase of apoptotic cell death (TUNEL) and biochemical markers of apoptosis, such as caspase-9 activity and poly-(ADP-ribose) polymerase degradation. On these grounds, a potential new therapeutic role of kaempferol to acute treatment of ischemic stroke is suggested. PMID:17950707

  18. Induction of caspase cascade pathway by kaempferol-3-O-rhamnoside in LNCaP prostate cancer cell lines

    PubMed Central

    HALIMAH, ELI; DIANTINI, AJENG; DESTIANI, DIKA P.; PRADIPTA, IVAN S.; SASTRAMIHARDJA, HERRI S.; LESTARI, KERI; SUBARNAS, ANAS; ABDULAH, RIZKY; KOYAMA, HIROSHI

    2015-01-01

    Prostate cancer has become a leading cause of mortality in humans. Previous studies have shown the potential anticancer properties of kaempferol-3-O-rhamnoside in breast cancer cell lines. In the present study, the anticancer potential of kaempferol-3-O-rhamnoside was investigated in LNCaP human prostate cancer cell lines. The inhibition of cell proliferation was investigated using MTT assays, whereas its ability to induce the caspase-cascade pathway was investigated by western blotting. The results showed that kaempferol-3-O-rhamnoside inhibits the proliferation of LNCaP cells in a dose-dependent manner by upregulating the expression of caspase-8, caspase-9, caspase-3 and poly (ADP-ribose) polymerase proteins. Although further studies are required, the results of the present study indicate the potential application of kaempferol-3-O-rhamnoside in cancer treatment. PMID:25469259

  19. Critical evaluation of the therapeutic potential of bassic acid incorporated in oil-in-water microemulsions and poly-D,L-lactide nanoparticles against experimental leishmaniasis.

    PubMed

    Lala, Sanchaita; Gupta, Syamasri; Sahu, Niranjan P; Mandal, Debayan; Mondal, Nirup B; Moulik, Satya P; Basu, Mukul K

    2006-05-01

    Bassic acid, an unsaturated triterpene acid isolated from Mimusops elangii, was tested for its antileishmanial properties both in vitro and in vivo. The in vitro antileishmanial activity of bassic acid being encouraging, its activity in vivo was evaluated in hamster models of visceral leishmaniasis, both in free form, as well as incorporated in two different delivery systems, viz microemulsions and polylactide nanoparticles. The delivery systems were prepared by published protocols. The percentage intercalation of bassic acid in nanoparticles and microemulsion was found to be about 50 and 100, respectively, when determined at its absorption maxima (lambda(max)) 285 nm (epsilon(m) = 2.3 x 10(2) M(-1) cm(-1)). At an equivalent dose of 2 mg kg(-1) body weight, when injected subcutaneously for a total of six doses in 15 days, bassic acid was found to reduce spleen parasite loads by 45, 62 and 78% in free, microemulsion-incorporated and nanoparticle-incorporated forms, respectively. A comparison of specific biochemical tests related to normal liver and kidney functions revealed that the nanoparticulate form was successful in significantly reducing the hepatotoxicity and nephrotoxicity of the free drug, but the microemulsion delivery system was less effective and toxic to liver and kidney to some extent. Confocal microscopic images of Leishmania donovani promastigotes treated with bassic acid revealed that the drug induced necrotic cell death due to non-specific membrane damage. Because of its high efficacy as well as non-hepatotoxicity and non-nephrotoxicity, the nanoparticulate form of bassic acid may be considered for clinical application in humans rather than the microemulsion incorporated form. PMID:16777677

  20. The dietary flavonoid kaempferol effectively inhibits HIF-1 activity and hepatoma cancer cell viability under hypoxic conditions

    SciTech Connect

    Mylonis, Ilias; Lakka, Achillia; Tsakalof, Andreas; Institute of Biomedical Research and Technology , 51 Papanastasiou str., 41222 Larissa ; Simos, George; Institute of Biomedical Research and Technology , 51 Papanastasiou str., 41222 Larissa

    2010-07-16

    Research highlights: {yields} Kaempferol inhibits HIF-1 activity in hepatocarcinoma cells; {yields} Kaempferol causes cytoplasmic mislocalization of HIF-1{alpha} by impairing the MAPK pathway. {yields} Viability of hepatocarcinoma cells under hypoxia is reduced by kaempferol. -- Abstract: Hepatocellular carcinoma (HCC) is characterized by high mortality rates and resistance to conventional treatment. HCC tumors usually develop local hypoxia, which stimulates proliferation of cancer cells and renders them resilient to chemotherapy. Adaptation of tumor cells to the hypoxic conditions depends on the hypoxia-inducible factor 1 (HIF-1). Over-expression of its regulated HIF-1{alpha} subunit, an important target of anti-cancer therapy, is observed in many cancers including HCC and is associated with severity of tumor growth and poor patient prognosis. In this report we investigate the effect of the dietary flavonoid kaempferol on activity, expression levels and localization of HIF-1{alpha} as well as viability of human hepatoma (Huh7) cancer cells. Treatment of Huh7 cells with kaempferol under hypoxic conditions (1% oxygen) effectively inhibited HIF-1 activity in a dose-dependent manner (IC{sub 50} = 5.16 {mu}M). The mechanism of this inhibition did not involve suppression of HIF-1{alpha} protein levels but rather its mislocalization into the cytoplasm due to inactivation of p44/42 MAPK by kaempferol (IC{sub 50} = 4.75 {mu}M). Exposure of Huh7 cells to 10 {mu}{Mu} kaempferol caused significant reduction of their viability, which was remarkably more evident under hypoxic conditions. In conclusion, kaempferol, a non-toxic natural food component, inhibits both MAPK and HIF-1 activity at physiologically relevant concentrations (5-10 {mu}M) and suppresses hepatocarcinoma cell survival more efficiently under hypoxia. It has, therefore, potential as a therapeutic or chemopreventive anti-HCC agent.

  1. Kaempferol Inhibits Endoplasmic Reticulum Stress-Associated Mucus Hypersecretion in Airway Epithelial Cells And Ovalbumin-Sensitized Mice

    PubMed Central

    Choi, Yean-Jung; Kang, Min-Kyung; Kim, Yun-Ho; Kang, Young-Hee

    2015-01-01

    Mucus hypersecretion is an important pathological feature of chronic airway diseases, such as asthma and pulmonary diseases. MUC5AC is a major component of the mucus matrix forming family of mucins in the airways. The initiation of endoplasmic reticulum (ER)-mediated stress responses contributes to the pathogenesis of airway diseases. The present study investigated that ER stress was responsible for airway mucus production and this effect was blocked by the flavonoid kaempferol. Oral administration of ≥10 mg/kg kaempferol suppressed mucus secretion and goblet cell hyperplasia observed in the bronchial airway and lung of BALB/c mice sensitized with ovalbumin (OVA). TGF-β and tunicamycin promoted MUC5AC induction after 72 h in human bronchial airway epithelial BEAS-2B cells, which was dampened by 20 μM kaempferol. Kaempferol inhibited tunicamycin-induced ER stress of airway epithelial cells through disturbing the activation of the ER transmembrane sensor ATF6 and IRE1α. Additionally, this compound demoted the induction of ER chaperones such as GRP78 and HSP70 and the splicing of XBP-1 mRNA by tunicamycin. The in vivo study further revealed that kaempferol attenuated the induction of XBP-1 and IRE1α in epithelial tissues of OVA-challenged mice. TGF-β and tunicamycin induced TRAF2 with JNK activation and such induction was deterred by kaempferol. The inhibition of JNK activation encumbered the XBP-1 mRNA splicing and MUC5AC induction by tunicamycin and TGF-β. These results demonstrate that kaempferol alleviated asthmatic mucus hypersecretion through blocking bronchial epithelial ER stress via the inhibition of IRE1α-TRAF2-JNK activation. Therefore, kaempferol may be a potential therapeutic agent targeting mucus hypersecretion-associated pulmonary diseases. PMID:26599511

  2. Kaempferol inhibits VEGF expression and in vitro angiogenesis through a novel ERK-NFκB-cMyc-p21 pathway

    PubMed Central

    Luo, Haitao; Rankin, Gary O.; Juliano, Noelle; Jiang, Bing-Hua; Chen, Yi Charlie

    2011-01-01

    Kaempferol has been reported to reduce the risk of ovarian cancer, but the mechanism is not completely understood. In this study, we tend to expand our understanding on how kaempferol regulates VEGF expression and angiogenesis in ovarian cancer cells. We timed VEGF secretion, and studied in-vitro angiogenesis by kaempferol treatment. Gene expression was examined by qRT-PCR, ELISA, Western Blotting, or luciferase assay, and pathways were examined by manipulating genetic components with plasmid or siRNA transfection. It was found that kaempferol time-dependently inhibited VEGF secretion, and suppressed in-vitro angiogenesis. Kaempferol down-regulated ERK phosphorelation as well as NFκB and cMyc expression, but promoted p21 expression. Examination of relationship between these genes suggested a novel ERK-NFκB-cMyc-p21-VEGF pathway, which accounts for kaempferol’s angioprevention effects in ovarian cancer cells. This data supplements our comprehension of the mechanisms behind kaempferol’s biological influence in ovarian cancer cells, and better characterized kaempferol toward chemoprevention. PMID:21927533

  3. Dietary flavonoids as therapeutics for preterm birth: luteolin and kaempferol suppress inflammation in human gestational tissues in vitro.

    PubMed

    Wall, Courtney; Lim, Ratana; Poljak, Marin; Lappas, Martha

    2013-01-01

    Infection/inflammation is commonly associated with preterm birth (PTB), initiating uterine contractions and rupture of fetal membranes. Proinflammatory cytokines induce matrix metalloproteinases (MMPs) that degrade the extracellular matrix (ECM) and prostaglandins which initiate uterine contractions. Nuclear factor-κB (NF-κB) and activator-protein- (AP-)1 have key roles in the formation of these prolabour mediators. In nongestational tissues, dietary flavonoids such as luteolin and kaempferol inhibit NF-κB, AP-1, and their downstream targets. The aim of this study was to determine if luteolin and kaempferol reduce infection-induced prolabour mediators in human gestational tissues. Fetal membranes were incubated with LPS, and primary amnion cells and myometrial cells were incubated with IL-1β in the absence or presence of luteolin or kaempferol. Luteolin and kaempferol significantly reduced LPS-induced secretion of proinflammatory cytokines (IL-6 and IL-8) and prostaglandins (PGE(2) and PGF(2α)) in fetal membranes, IL-1β-induced COX-2 gene expression and prostaglandin production in myometrium, and IL-1β-induced MMP-9 activity in amnion and myometrial cells. Luteolin and kaempferol decreased IL-1β-induced NF-κB p65 DNA binding activity and nuclear c-Jun expression. In conclusion, luteolin and kaempferol inhibit prolabour mediators in human gestational tissues. Given the central role of inflammation in provoking preterm labour, phytophenols may be a therapeutic approach to reduce the incidence of PTB. PMID:23840918

  4. Effect of crystallographic phase on green and yellow emissions in Mn-doped zinc silicate nanoparticles incorporated in silica host matrix

    NASA Astrophysics Data System (ADS)

    El Mir, L.; Omri, K.; El Ghoul, J.

    2015-09-01

    Silica host matrix reached by manganese-doped zinc silicate nanoparticles (SiO2/Zn2SiO4:Mn) were in-situ synthesized by a sol-gel process. In our approach, we synthesis ZnO:Mn nanoparticles in supercritical conditions of ethanol. After the incorporation of these nanoparticles in silica host matrix, a heat treatment at 1200 C and 1500 C for 2 h was performed for the elaboration of SiO2/Zn2SiO4:Mn nanocomposites. Then, these samples were characterized by various techniques such as X-ray diffraction (XRD), transmission electron microscopy (TEM), scanning electron microscopy (SEM) and photoluminescence (PL). These samples exhibit broad green and yellow PL bands depending on synthesis temperature. The SiO2/Zn2SiO4:Mn prepared at 1200 C exhibit a green emission centered at about 525 nm while the yellow emission centered at 575 nm resulted from SiO2/Zn2SiO4:Mn prepared at 1500 C. These two emissions are originated from internal transition in Mn2+ ion doped zinc silicate nanoparticles and the emission wavelength is correlated to the local crystalline field which is fixed by the crystallographic phase.

  5. Antimicrobial and antioxidant activity of kaempferol rhamnoside derivatives from Bryophyllum pinnatum

    PubMed Central

    2012-01-01

    Background Bryophyllum pinnatum (Lank.) Oken (Crassulaceae) is a perennial succulent herb widely used in traditional medicine to treat many ailments. Its wide range of uses in folk medicine justifies its being called "life plant" or "resurrection plant", prompting researchers' interest. We describe here the isolation and structure elucidation of antimicrobial and/or antioxidant components from the EtOAc extract of B. pinnatum. Results The methanol extract displayed both antimicrobial activities with minimum inhibitory concentration (MIC) values ranging from 32 to 512 μg/ml and antioxidant property with an IC50 value of 52.48 μg/ml. Its partition enhanced the antimicrobial activity in EtOAc extract (MIC = 16-128 μg/ml) and reduced it in hexane extract (MIC = 256-1024 μg/ml). In addition, this process reduced the antioxidant activity in EtOAc and hexane extracts with IC50 values of 78.11 and 90.04 μg/ml respectively. Fractionation of EtOAc extract gave seven kaempferol rhamnosides, including; kaempferitrin (1), kaempferol 3-O-α-L-(2-acetyl)rhamnopyranoside-7-O-α-L-rhamnopyranoside (2), kaempferol 3-O-α-L-(3-acetyl)rhamnopyranoside-7-O-α-L-rhamnopyranoside (3), kaempferol 3-O-α-L-(4-acetyl)rhamnopyranoside-7-O-α-L-rhamnopyranoside (4), kaempferol 3-O-α-D- glucopyranoside-7-O-α-L-rhamnopyranoside (5), afzelin (6) and α-rhamnoisorobin (7). All these compounds, except 6 were isolated from this plant for the first time. Compound 7 was the most active, with MIC values ranging from 1 to 2 μg/ml and its antioxidant activity (IC50 = 0.71 μg/ml) was higher than that of the reference drug (IC50 = 0.96 μg/ml). Conclusion These findings demonstrate that Bryophyllum pinnatum and some of its isolated compounds have interesting antimicrobial and antioxidant properties, and therefore confirming the traditional use of B. pinnatum in the treatment of infectious and free radical damages. PMID:22433844

  6. Effects of magnetic nanoparticle-incorporated human bone marrow-derived mesenchymal stem cells exposed to pulsed electromagnetic fields on injured rat spinal cord.

    PubMed

    Cho, Hyunjin; Choi, Yun-Kyong; Lee, Dong Heon; Park, Hee Jung; Seo, Young-Kwon; Jung, Hyun; Kim, Soo-Chan; Kim, Sung-Min; Park, Jung-Keug

    2013-01-01

    Transplanting mesenchymal stem cells into injured lesions is currently under study as a therapeutic approach for spinal cord injury. In this study, the effects of a pulsed electromagnetic field (PEMF) on injured rat spinal cord were investigated in magnetic nanoparticle (MNP)-incorporated human bone marrow-derived mesenchymal stem cells (hBM-MSCs). A histological analysis revealed significant differences in MNP-incorporated cell distribution near the injured site under the PEMF in comparison with that in the control group. We confirmed that MNP-incorporated cells were widely distributed in the lesions under PEMF. The results suggest that MNP-incorporated hBM-MSCs were guided by the PEMF near the injured site, and that PEMF exposure for 8 H per day over 4 weeks promoted behavioral recovery in spinal cord injured rats. The results show that rats with MNP-incorporated hBM-MSCs under a PEMF were more effective on the Basso, Beattie, and Bresnahan behavioral test and suggest that the PEMF enhanced the action of transplanted cells for recovery of the injured lesion. PMID:24033637

  7. Fabrication of hybrid nanocomposite scaffolds by incorporating ligand-free hydroxyapatite nanoparticles into biodegradable polymer scaffolds and release studies

    PubMed Central

    Farkas, Balazs; Rodio, Marina; Romano, Ilaria; Diaspro, Alberto; Intartaglia, Romuald

    2015-01-01

    Summary We report on the optical fabrication approach of preparing free-standing composite thin films of hydroxyapatite (HA) and biodegradable polymers by combining pulsed laser ablation in liquid and mask-projection excimer laser stereolithography (MPExSL). Ligand-free HA nanoparticles were prepared by ultrafast laser ablation of a HA target in a solvent, and then the nanoparticles were dispersed into the liquid polymer resin prior to the photocuring process using MPExSL. The resin is poly(propylene fumarate) (PPF), a photo-polymerizable, biodegradable material. The polymer is blended with diethyl fumarate in 7:3 w/w to adjust the resin viscosity. The evaluation of the structural and mechanical properties of the fabricated hybrid thin film was performed by means of SEM and nanoindentation, respectively, while the chemical and degradation studies were conducted through thermogravimetric analysis, and FTIR. The photocuring efficiency was found to be dependent on the nanoparticle concentration. The MPExSL process yielded PPF thin films with a stable and homogenous dispersion of the embedded HA nanoparticles. Here, it was not possible to tune the stiffness and hardness of the scaffolds by varying the laser parameters, although this was observed for regular PPF scaffolds. Finally, the gradual release of the hydroxyapatite nanoparticles over thin film biodegradation is reported. PMID:26734513

  8. Fabrication of hybrid nanocomposite scaffolds by incorporating ligand-free hydroxyapatite nanoparticles into biodegradable polymer scaffolds and release studies.

    PubMed

    Farkas, Balazs; Rodio, Marina; Romano, Ilaria; Diaspro, Alberto; Intartaglia, Romuald; Beke, Szabolcs

    2015-01-01

    We report on the optical fabrication approach of preparing free-standing composite thin films of hydroxyapatite (HA) and biodegradable polymers by combining pulsed laser ablation in liquid and mask-projection excimer laser stereolithography (MPExSL). Ligand-free HA nanoparticles were prepared by ultrafast laser ablation of a HA target in a solvent, and then the nanoparticles were dispersed into the liquid polymer resin prior to the photocuring process using MPExSL. The resin is poly(propylene fumarate) (PPF), a photo-polymerizable, biodegradable material. The polymer is blended with diethyl fumarate in 7:3 w/w to adjust the resin viscosity. The evaluation of the structural and mechanical properties of the fabricated hybrid thin film was performed by means of SEM and nanoindentation, respectively, while the chemical and degradation studies were conducted through thermogravimetric analysis, and FTIR. The photocuring efficiency was found to be dependent on the nanoparticle concentration. The MPExSL process yielded PPF thin films with a stable and homogenous dispersion of the embedded HA nanoparticles. Here, it was not possible to tune the stiffness and hardness of the scaffolds by varying the laser parameters, although this was observed for regular PPF scaffolds. Finally, the gradual release of the hydroxyapatite nanoparticles over thin film biodegradation is reported. PMID:26734513

  9. Enhanced energy transfer between Co-dopants Pyronin-Y and Thionine incorporated into modified polymethyl methacrylate with addition of ZnO nanoparticles.

    PubMed

    Vijayaraghavan, G V; Basheer Ahamed, M

    2016-04-01

    Using a prism dye cell arrangement, the study investigated spectral energy transfer between co-dopants Pyronin-Y and Thionine incorporated into ethanol-modified polymethyl methacrylate. The spectral parameters of the absorption and fluorescence spectra of the donor and acceptor dyes in the so designed solid-state dye laser were calculated theoretically. Fluorescence lasing properties and slope efficiency of the solid-state dye laser were investigated both with and without addition of ZnO nanoparticles. The dye pair generally improved lasing efficiency and tunability in the range from 582 to 689nm. PMID:26803748

  10. Enhanced energy transfer between Co-dopants Pyronin-Y and Thionine incorporated into modified polymethyl methacrylate with addition of ZnO nanoparticles

    NASA Astrophysics Data System (ADS)

    Vijayaraghavan, G. V.; Basheer Ahamed, M.

    2016-04-01

    Using a prism dye cell arrangement, the study investigated spectral energy transfer between co-dopants Pyronin-Y and Thionine incorporated into ethanol-modified polymethyl methacrylate. The spectral parameters of the absorption and fluorescence spectra of the donor and acceptor dyes in the so designed solid-state dye laser were calculated theoretically. Fluorescence lasing properties and slope efficiency of the solid-state dye laser were investigated both with and without addition of ZnO nanoparticles. The dye pair generally improved lasing efficiency and tunability in the range from 582 to 689 nm.

  11. Dietary Compound Kaempferol Inhibits Airway Thickening Induced by Allergic Reaction in a Bovine Serum Albumin-Induced Model of Asthma

    PubMed Central

    Shin, Daekeun; Park, Sin-Hye; Choi, Yean-Jung; Kim, Yun-Ho; Antika, Lucia Dwi; Habibah, Nurina Umy; Kang, Min-Kyung; Kang, Young-Hee

    2015-01-01

    Asthma is characterized by aberrant airways including epithelial thickening, goblet cell hyperplasia, and smooth muscle hypertrophy within the airway wall. The current study examined whether kaempferol inhibited mast cell degranulation and prostaglandin (PG) release leading to the development of aberrant airways, using an in vitro model of dinitrophenylated bovine serum albumin (DNP-BSA)-sensitized rat basophilic leukemia (RBL-2H3) mast cells and an in vivo model of BSA-challenged asthmatic mice. Nontoxic kaempferol at 10–20 μM suppressed β-hexosaminidase release and cyclooxygenase 2 (COX2)-mediated production of prostaglandin D2 (PGD2) and prostaglandin F2α (PGF2α) in sensitized mast cells. Oral administration of ≤20 mg/kg kaempferol blocked bovine serum albumin (BSA) inhalation-induced epithelial cell excrescence and smooth muscle hypertrophy by attenuating the induction of COX2 and the formation of PGD2 and PGF2α, together with reducing the anti-α-smooth muscle actin (α-SMA) expression in mouse airways. Kaempferol deterred the antigen-induced mast cell activation of cytosolic phospholipase A2 (cPLA2) responsive to protein kinase Cμ (PKCμ) and extracellular signal-regulated kinase (ERK). Furthermore, the antigen-challenged activation of Syk-phospholipase Cγ (PLCγ) pathway was dampened in kaempferol-supplemented mast cells. These results demonstrated that kaempferol inhibited airway wall thickening through disturbing Syk-PLCγ signaling and PKCμ-ERK-cPLA2-COX2 signaling in antigen-exposed mast cells. Thus, kaempferol may be a potent anti-allergic compound targeting allergic asthma typical of airway hyperplasia and hypertrophy. PMID:26694364

  12. Increased efficiency in multijunction solar cells through the incorporation of semimetallic ErAs nanoparticles into the tunnel junction

    SciTech Connect

    Zide, J.M.O.; Kleiman-Shwarsctein, A.; Strandwitz, N.C.; Zimmerman, J.D.; Steenblock-Smith, T.; Gossard, A.C.; Forman, A.; Ivanovskaya, A.; Stucky, G.D.

    2006-04-17

    We report the molecular beam epitaxy growth of Al{sub 0.3}Ga{sub 0.7}As/GaAs multijunction solar cells with epitaxial, semimetallic ErAs nanoparticles at the interface of the tunnel junction. The states provided by these nanoparticles reduce the bias required to pass current through the tunnel junction by three orders of magnitude, and therefore drastically reduce the voltage losses in the tunnel junction. We have measured open-circuit voltages which are 97% of the sum of the constituent cells, which result in nearly double the efficiency of our multijunction cell with a conventional tunnel junction.

  13. Development of Nanoparticles Incorporating a Novel Liposomal Membrane Destabilization Peptide for Efficient Release of Cargos into Cancer Cells

    PubMed Central

    Ohgita, Takashi; Kogure, Kentaro

    2014-01-01

    In anti-cancer therapy mediated by a nanoparticle-based drug delivery system (DDS), overall efficacy depends on the release efficiency of cargos from the nanoparticles in the cancer cells as well as the specificity of delivery to tumor tissue. However, conventional liposome-based DDS have no mechanism for specifically releasing the encapsulated cargos inside the cancer cells. To overcome this barrier, we developed nanoparticles containing a novel liposomal membrane destabilization peptide (LMDP) that can destabilize membranes by cleavage with intramembranous proteases on/in cancer cells. Calcein encapsulated in liposomes modified with LMDP (LMDP-lipo) was effectively released in the presence of a membrane fraction containing an LMDP-cleavable protease. The release was inhibited by a protease inhibitor, suggesting that LMDP-lipo could effectively release its cargo into cells in response to a cancer-specific protease. Moreover, when LMDP-lipo contained fusogenic lipids, the release of cargo was accelerated, suggesting that the fusion of LMDP-lipo with cellular membranes was the initial step in the intracellular delivery. Time-lapse microscopic observations showed that the release of cargo from LMDP-lipo occurred immediately after association of LMDP-lipo with target cells. Consequently, LMDP-lipo could be a useful nanoparticle capable of effective release of cargos specifically into targeted cancer cells. PMID:25343714

  14. Photoacoustic molecular imaging of angiogenesis using theranostic ανβ3-targeted copper nanoparticles incorporating a sn-2 lipase-labile fumagillin prodrug

    NASA Astrophysics Data System (ADS)

    Zhang, Ruiying; Cai, Xin; Yang, Xiaoxia; Senpan, Angana; Allen, John S.; Pan, Dipanjan; Lanza, Gregory M.; Wang, Lihong V.

    2014-03-01

    Photoacoustic (PA) tomography imaging is an emerging, versatile, and noninvasive imaging modality, which combines the advantages of both optical imaging and ultrasound imaging. It opens up opportunities for noninvasive imaging of angiogenesis, a feature of skin pathologies including cancers and psoriasis. In this study, high-density copper oleate encapsulated within a phospholipid surfactant (CuNPs) generated a soft nanoparticle with PA contrast comparable to gold. Within the near-infrared window, the copper nanoparticles can provide a signal more than 7 times higher that of blood. ανβ3-targeted of CuNPs in a Matrigel mouse model demonstrated prominent PA contrast enhancement of the neovasculature compared to mice given nontargeted or competitively inhibited CuNPs. Incorporation of a sn-2 lipase-labile fumagillin prodrug into the CuNPs produced marked antiangiogenesis in the same model, demonstrating the theranostic potential of a PA agent for the first time in vivo. With a PA signal comparable to gold-based nanoparticles yet a lower cost and demonstrated drug delivery potential, ανβ3-targeted CuNPs hold great promise for the management of skin pathologies with neovascular features.

  15. ανβ3-targeted Copper Nanoparticles Incorporating an Sn 2 Lipase-Labile Fumagillin Prodrug for Photoacoustic Neovascular Imaging and Treatment

    PubMed Central

    Zhang, Ruiying; Pan, Dipanjan; Cai, Xin; Yang, Xiaoxia; Senpan, Angana; Allen, John S.; Lanza, Gregory M.; Wang, Lihong V.

    2015-01-01

    Photoacoustic (PA) tomography enables multiscale, multicontrast and high-resolution imaging of biological structures. In particular, contrast-enhanced PA imaging offers high-sensitivity noninvasive imaging of neovessel sprout formation and nascent tubules, which are important biomarkers of malignant tumors and progressive atherosclerotic disease. While gold nanoparticles or nanorods have been used as PA contrast agents, we utilized high-density copper oleate small molecules encapsulated within a phospholipid surfactant (CuNPs) to generate a soft nanoparticle with PA contrast comparable to that from gold. Within the NIR window, the copper nanoparticles provided a 4-fold higher signal than that of blood. ανβ3-integrin targeting of CuNPs in a MatrigelTM angiogenesis mouse model demonstrated prominent (p<0.05) PA contrast enhancement of the neovasculature compared with mice given nontargeted or competitively inhibited CuNPs. Furthermore, incorporation of a Sn 2 lipase-labile fumagillin prodrug into the CuNP outer lipid membrane produced marked antiangiogenesis in the same model when targeted to the ανβ3-integrin, providing proof of concept in vivo for the first targeted PA - drug delivery agent. PMID:25553103

  16. Silica sacrificial layer-assisted in-plane incorporation of Au nanoparticles into mesoporous titania thin films through different reduction methods.

    PubMed

    Liang, Chih-Peng; Yamauchi, Yusuke; Liu, Chia-Hung; Wu, Kevin C-W

    2013-06-28

    This study focuses on the incorporation of gold nanoparticles (Au NPs) into our previously synthesized mesoporous titania thin films consisting of titania nanopillars and inverse mesospace (C. W. Wu, T. Ohsuna, M. Kuwabara and K. Kuroda, J. Am. Chem. Soc., 2006, 128, 4544-4545, denoted as MTTFs). Recently, mesoporous titania materials doped with noble metals such as gold have attracted considerable attention because noble metals can enhance the efficiency of mesoporous titania-based devices. In this research, we attempted to use four different reduction methods (i.e., thermal treatment, photo irradiation, liquid immersion, and vapor contacting) to introduce gold nanoparticles (Au NPs) into MTTFs. The synthesized Au@MTTFs were characterized by scanning electron microscopy (SEM) and transmission electron microscopy (TEM). We further systematically investigated the formation mechanism of gold nanoparticles on the external and internal surfaces of the MTTFs. With the assistance of a silica sacrificial layer, well-dispersed Au NPs with sizes of 4.1 nm were obtained inside the MTTF by photo irradiation. The synthesized Au@MTTF materials show great potential in various photo-electronic and photo-catalytic applications. PMID:23633080

  17. Organic acids and protein compounds causing the photoluminescence properties of natural rubber membranes and the quenching phenomena from Au nanoparticle incorporation.

    PubMed

    Cabrera, Flávio C; Agostini, Deuber L S; Dos Santos, Renivaldo J; Guimarães, Francisco E G; Guerrero, Ariel R; Aroca, Ricardo F; Job, Aldo E

    2014-12-01

    Natural rubber membranes were fabricated using latex from Hevea brasiliensis trees (clone RRIM 600) by casting, and controlling the time and temperature of thermal treatment. Three temperatures were used: 65, 80 and 120 °C and the corresponding annealing times of 6, 8, 10 and 12 h. The centrifugation of the latex produces the constituent phases: solid rubber (F1), serum or protein components (F2) and bottom fraction (F3). The photoluminescence properties could be correlated with organic acid components of latex. Natural rubber membranes were used as the active substrate (reducing agent) for the incorporation of colloidal Au nanoparticles synthesized by in situ reduction at different times. The intensity of photoluminescence bands assigned to the natural rubber decreases with the increase in amount of nanoparticles present on the membrane surface. It can be assumed that Au nanoparticles may be formed by reduction of the Au cation reacting with functional groups that are directly related to photoluminescence properties. However, the quenching of fluorescence may be attributed to the formation of a large amount of metal nanostructures on the natural rubber surface. PMID:24760547

  18. Kaempferol stimulates gene expression of low-density lipoprotein receptor through activation of Sp1 in cultured hepatocytes

    PubMed Central

    Ochiai, Ayasa; Miyata, Shingo; Iwase, Masamori; Shimizu, Makoto; Inoue, Jun; Sato, Ryuichiro

    2016-01-01

    A high level of plasma low-density lipoprotein (LDL) cholesterol is considered a risk factor for atherosclerosis. Because the hepatic LDL receptor (LDLR) is essential for clearing plasma LDL cholesterol, activation of LDLR is a promising therapeutic target for patients with atherosclerotic disease. Here we demonstrated how the flavonoid kaempferol stimulated the gene expression and activity of LDLR in HepG2 cells. The kaempferol-mediated stimulation of LDLR gene expression was completely inhibited by knockdown of Sp1 gene expression. Treatment of HepG2 cells with kaempferol stimulated the recruitment of Sp1 to the promoter region of the LDLR gene, as well as the phosphorylation of Sp1 on Thr-453 and Thr-739. Moreover, these kaempferol-mediated processes were inhibited in the presence of U0126, an ERK pathway inhibitor. These results suggest that kaempferol may increase the activity of Sp1 through stimulation of Sp1 phosphorylation by ERK1/2 and subsequent induction of LDLR expression and activity. PMID:27109240

  19. Protective effects of kaempferol against reactive oxygen species-induced hemolysis and its antiproliferative activity on human cancer cells.

    PubMed

    Liao, Wenzhen; Chen, Luying; Ma, Xiang; Jiao, Rui; Li, Xiaofeng; Wang, Yong

    2016-05-23

    The protective effects of kaempferol against reactive oxygen species (ROS)-induced hemolysis and its antiproliferative activity on human cancer cells were evaluated in this study. Kaempferol exhibited strong cellular antioxidant ability (CAA) with a CAA value of 59.80 ± 0.379 μM of quercetin (QE)/100 μM (EC50 = 7.74 ± 0.049 μM). Pretreatment with kaempferol significantly attenuated the ROS-induced hemolysis of human erythrocyte (87.4% hemolysis suppressed at 100 μg/mL) and reduced the accumulation of toxic lipid peroxidation product malondialdehyde (MDA). The anti-hemolytic activity of kaempferol was mainly through scavenging excessive ROS and preserving the intrinsic antioxidant enzymes (superoxide dismutase, SOD; catalase, CAT; and glutathione peroxidase, GPx) activities in normal levels. Additionally, kaempferol showed significant antiproliferative activity on a panel of human cancer cell lines including human breast carcinoma (MCF-7) cells, human stomach carcinoma (SGC-7901) cells, human cervical carcinoma (Hela) cells and human lung carcinoma (A549) cells. Kaemperol induced apoptosis of MCF-7 cells accompanied with nuclear condensation and mitochondria dysfunction. PMID:26974372

  20. Small Molecule Kaempferol Promotes Insulin Sensitivity and Preserved Pancreatic β-Cell Mass in Middle-Aged Obese Diabetic Mice

    PubMed Central

    Alkhalidy, Hana; Moore, William; Zhang, Yanling; Wang, Aihua; Ali, Mostafa; Suh, Kyung-Shin; Zhen, Wei; Cheng, Zhiyong; Jia, Zhenquan; Hulver, Matthew

    2015-01-01

    Insulin resistance and a progressive decline in functional β-cell mass are hallmarks of developing type 2 diabetes (T2D). Thus, searching for natural, low-cost compounds to target these two defects could be a promising strategy to prevent the pathogenesis of T2D. Here, we show that dietary intake of flavonol kaempferol (0.05% in the diet) significantly ameliorated hyperglycemia, hyperinsulinemia, and circulating lipid profile, which were associated with the improved peripheral insulin sensitivity in middle-aged obese mice fed a high-fat (HF) diet. Kaempferol treatment reversed HF diet impaired glucose transport-4 (Glut4) and AMP-dependent protein kinase (AMPK) expression in both muscle and adipose tissues from obese mice. In vitro, kaempferol increased lipolysis and prevented high fatty acid-impaired glucose uptake, glycogen synthesis, AMPK activity, and Glut4 expression in skeletal muscle cells. Using another mouse model of T2D generated by HF diet feeding and low doses of streptozotocin injection, we found that kaempferol treatment significantly improved hyperglycemia, glucose tolerance, and blood insulin levels in obese diabetic mice, which are associated with the improved islet β-cell mass. These results demonstrate that kaempferol may be a naturally occurring anti-diabetic agent by improving peripheral insulin sensitivity and protecting against pancreatic β-cell dysfunction. PMID:26064984

  1. Sustained release of PTX-incorporated nanoparticles synergized by burst release of DOX⋅HCl from thermosensitive modified PEG/PCL hydrogel to improve anti-tumor efficiency.

    PubMed

    Xu, Shuxin; Wang, Weiwei; Li, Xijing; Liu, Jianping; Dong, Anjie; Deng, Liandong

    2014-10-01

    As drug therapies become increasingly sophisticated, the synergistic benefits of two or more drugs are often required. In this study, we aimed at improving anti-tumor efficiency of paclitaxel (PTX)-incorporated thermo-sensitive injectable hydrogel by the synergy of burst release of doxorubicin hydrochloride (DOX⋅HCl). Thermosensitive injectable hydrogel composed of nanoparticles assembled from amphiphilic copolymer poly(ε-caprolactone-co-1,4,8-trioxa[4.6]spiro-9-undecanone)-poly(ethylene glycol)-poly(ε-caprolaone-co-1,4,8-trioxa[4.6]spiro-9-undecanone) (PECT) was fabricated. Hydrophobic PTX and hydrophilic DOX⋅HCl were loaded simultaneously in the thermo-sensitive injectable hydrogel by a two-stage entrapment. Thermosensitive gelling behaviors of drug-loading PECT nanoparticle aqueous dispersions were studied. In vitro release profiles of PTX and DOX⋅HCl and in vivo anti-tumor effect by dual drugs from PECT hydrogel were investigated. The results showed that hydrophilic and hydrophobic drugs could be successfully entrapped in PECT hydrogel simultaneously without affecting its thermo-sensitive behavior. In vitro release profiles demonstrated the burst release of DOX⋅HCl and the sustained release of PTX. Anti-tumor effect was improved by a fast and tense attack caused by the burst release of hydrophilic DOX⋅HCl from hydrogel, which was continued by the sequent sustained release of PTX-incorporated nanoparticles and remnant DOX⋅HCl. Unintentionally, entrapped in PECT hydrogel, hydrophilic DOX⋅HCl was observed to have a sustained releasing pattern in vitro and in vivo. PMID:24931190

  2. A Novel Acetylcholinesterase Biosensor: Core-Shell Magnetic Nanoparticles Incorporating a Conjugated Polymer for the Detection of Organophosphorus Pesticides.

    PubMed

    Dzudzevic Cancar, Hurija; Soylemez, Saniye; Akpinar, Yeliz; Kesik, Melis; Göker, Seza; Gunbas, Gorkem; Volkan, Murvet; Toppare, Levent

    2016-03-30

    To construct a sensing interface, in the present work, a conjugated polymer and core-shell magnetic nanoparticle containing biosensor was constructed for the pesticide analysis. The monomer 4,7-di(furan-2-yl)benzo[c][1,2,5]thiadiazole (FBThF) and core-shell magnetic nanoparticles were designed and synthesized for fabrication of the biosensing device. The magnetic nanoparticles were first treated with silica and then modified using carboxyl groups, which enabled binding of the biomolecules covalently. For the construction of the proposed sensor a two-step procedure was performed. First, the poly(FBThF) was electrochemically generated on the electrode surface. Then, carboxyl group modified magnetic nanoparticles (f-MNPs) and acetylcholinesterase (AChE), the model enzyme, were co-immobilized on the polymer-coated surface. Thereby, a robust and novel surface, conjugated polymer bearing magnetic nanoparticles with pendant carboxyl groups, was constructed, which was characterized using Fourier transform infrared spectrometer, cyclic voltammetry, scanning electron microscopy, and contact angle measurements. This novel architecture was then applied as an immobilization platform to detect pesticides. To the best of our knowledge, a sensor design that combines both conjugated polymer and magnetic nanoparticles was attempted for the first time, and this approach resulted in improved biosensor characteristics. Hence, this approach opens a new perspective in the field of enzyme immobilization and sensing applications. Paraoxon and trichlorfon were selected as the model toxicants. To obtain best biosensor performance, optimization studies were performed. Under optimized conditions, the biosensor in concern revealed a rapid response (5 s), a low detection limit (6.66 × 10(-3) mM), and high sensitivity (45.01 μA mM(-1) cm(-2)). The KM(app) value of poly(FBThF)/f-MNPs/AChE were determined as 0.73 mM. Furthermore, there was no considerable activity loss for 10 d for poly(FBThF)/f-MNPs/AChE biofilm. PMID:26956086

  3. An Investigation on Effects of TiO2 Nano-Particles Incorporated in Electroless NiP Coatings' Properties

    NASA Astrophysics Data System (ADS)

    Allahkaram, S. R.; Salmi, S.; Tohidlou, E.

    Electroless composite coatings have been vastly used in various industries during last decades due to their good properties, such as corrosion and wear resistance, hardness and uniform thickness. In this paper, co-deposition of TiO2 nano-particles with Nickel-Phosphorus electroless coatings on API-5L-X65 steel substrates was investigated. Surface morphology and composition of coatings were studied via SEM and EDX, respectively. XRD analyses showed that these coatings had amorphous structure with TiO2 crystalline particles. TiO2 nano-particles increased microhardness of coatings. Corrosion resistance of these coatings was tested using linear polarization in 0.5M sulfuric acid electrolyte. Results showed that NiP-TiO2 electroless composite coatings increased corrosion resistance of substrates.

  4. Incorporation of cobalt-ferrite nanoparticles into a conducting polymer in aqueous micellar medium: strategy to get photocatalytic composites.

    PubMed

    Endrődi, Balázs; Hursán, Dorottya; Petrilla, Liliána; Bencsik, Gábor; Visy, Csaba; Chams, Amani; Maslah, Nabiha; Perruchot, Christian; Jouini, Mohamed

    2014-01-01

    In this study an easy strategy for conducting polymer based nanocomposite formation is presented through the deposition of cobalt-ferrite (CoFe(2)O(4)) containing poly(3,4-ethylenedioxythiophene) (PEDOT) thin layers. The electrochemical polymerization has been performed galvanostatically in an aqueous micellar medium in the presence of the nanoparticles and the surface active Triton X-100. The nanoparticles have been characterized by Transmission electron microscopy (TEM), the thin layers has been studied by applying Scanning electron microscopy (SEM), and X-ray diffraction (XRD), and the basic electrochemical properties have been also determined. Moreover, electrocatalytic activity of the composite was demonstrated in the electrooxidation reaction of dopamine (DA). The enhanced sensitivity - related to the cobalt-ferrite content - and the experienced photocatalyitic activity are promising for future application. PMID:25125121

  5. Kaempferol as Selective Human MAO-A Inhibitor: Analytical Detection in Calabrian Red Wines, Biological and Molecular Modeling Studies.

    PubMed

    Gidaro, Maria Concetta; Astorino, Christian; Petzer, Anél; Carradori, Simone; Alcaro, Francesca; Costa, Giosuè; Artese, Anna; Rafele, Giancarlo; Russo, Francesco M; Petzer, Jacobus P; Alcaro, Stefano

    2016-02-17

    The purpose of this work was to determine the kaempferol content in three red wines of Calabria, a southern Italian region with a great number of certified food products. Considering that wine cultivar, climate, and soil influence the qualitative and quantitative composition in flavonoids of Vitis vinifera L. berries, the three analyzed samples were taken from the 2013 vintage. Moreover, the Gaglioppo samples, with assigned Controlled Origin Denomination (DOC), were also investigated in the production of years 2008, 2010, and 2011. In addition to the analysis of kaempferol, which is present in higher concentration than in other Italian wines, in vitro assays were performed to evaluate, for the first time, the inhibition of the human monoamine oxidases (hMAO-A and hMAO-B). Molecular recognition studies were also carried out to provide insight into the binding mode of kaempferol and selectivity of inhibition of the hMAO-A isoform. PMID:26821152

  6. Selective detection toward quercetin and kaempferol on NH3-plasma treated carbon nanotubes modified glassy carbon electrode.

    PubMed

    Song, Jing-Jing; Lu, Yong; Zhu, Si-Wei; Huang, Qin-An; Wei, Yan

    2015-01-01

    NH3-plasma treated multi-walled carbon nanotubes (pn-MWCNTs) were prepared based on the plasma technique and developed as sensing materials for detection of quercetin and kaempferol with the differential pulse voltammetry (DPV) and amperometric measurement. Such experimental parameters as pH values, accumulation potential and accumulation time were carefully investigated. The pn-MWCNTs modified electrode (pn-MWCNTs/GCE) was further explored for the analysis of quercetin and kaempferol in diluted blood serum and average recovery rates of 96.91 and 100.5% were obtained, respectively. In addition, the interference and stability measurements were evaluated under the optimized experimental conditions. More importantly, selective detection toward quercetin and kaempferol was achieved, and the proposed electrochemical sensing strategy was available to distinguish substances with similar oxidation potential. PMID:25765278

  7. The role of size and coating in Au nanoparticles incorporated into bi-component polymeric thin-film transistors.

    PubMed

    Mosciatti, Thomas; Orgiu, Emanuele; Raimondo, Corinna; Samorì, Paolo

    2014-05-21

    We describe the effect of blending poly(3-hexylthiophene) (P3HT) with Au nanoparticles (AuNPs) on the performance of organic thin-film transistors. To this end we have used AuNPs of two different sizes coated with chemisorbed SAMs of oligophenyl-thiols possessing increasing lengths. The electrical characteristics of the hybrid materials revealed changes in the field-effect mobility depending primarily on the AuNP size, as a result of the variable energy level of the coated metallic nanocluster and by the degree of modification of the P3HT crystalline structure. PMID:24604238

  8. ENHANCED GENE DELIVERY IN PORCINE VASCULATURE TISSUE FOLLOWING INCORPORATION OF ADENO-ASSOCIATED VIRUS NANOPARTICLES INTO POROUS SILICON MICROPARTICLES

    PubMed Central

    McConnell, Kellie I.; Rhudy, Jessica; Yokoi, Kenji; Gu, Jianhua; Mack, Aaron; Suh, Junghae; La Francesca, Saverio; Sakamoto, Jason; Serda, Rita E.

    2014-01-01

    There is an unmet clinical need to increase lung transplant successes, patient satisfaction and to improve mortality rates. We offer the development of a nanovector-based solution that will reduce the incidence of lung ischemic reperfusion injury (IRI) leading to graft organ failure through the successful ex vivo treatment of the lung prior to transplantation. The innovation is in the integrated application of our novel porous silicon (pSi) microparticles carrying adeno-associated virus (AAV) nanoparticles, and the use of our ex vivo lung perfusion/ventilation system for the modulation of pro-inflammatory cytokines initiated by ischemic pulmonary conditions prior to organ transplant that often lead to complications. Gene delivery of anti-inflammatory agents to combat the inflammatory cascade may be a promising approach to prevent IRI following lung transplantation. The rationale for the device is that the microparticle will deliver a large payload of virus to cells and serve to protect the AAV from immune recognition. The microparticle-nanoparticle hybrid device was tested both in vitro on cell monolayers and ex vivo using either porcine venous tissue or a pig lung transplantation model, which recapitulates pulmonary IRI that occurs clinically post-transplantation. Remarkably, loading AAV vectors into pSi microparticles increases gene delivery to otherwise non-permissive endothelial cells. PMID:25180449

  9. Colorimetric assay for determination of lead (II) based on its incorporation into gold nanoparticles during their synthesis.

    PubMed

    Ding, Nan; Cao, Qian; Zhao, Hong; Yang, Yimin; Zeng, Lixi; He, Yujian; Xiang, Kaixiang; Wang, Guangwei

    2010-01-01

    In this report, we present a new method for visual detection of Pb2+. Gold nanoparticles (Au-NPs) were synthesized in one step at room temperature, using gallic acid (GA) as reducer and stabilizer. Pb2+ is added during the gold nanoparticle formation. Analysis of Pb2+ is conducted by a dual strategy, namely, colorimetry and spectrometry. During Au-NPs synthesis, addition of Pb2+ would lead to formation of Pb-GA complex, which can induce the aggregation of newly-formed small unstable gold nanoclusters. Consequently, colorimetric detection of trace Pb2+ can be realized. As the Pb2+ concentration increases, the color turns from red-wine to purple, and finally blue. This method offers a sensitive linear correlation between the shift of the absorption band (Δλ) and logarithm of Pb2+ concentration ranging from 5.0×10(-8) to 1.0×10(-6) M with a linear fit coefficient of 0.998, and a high selectivity for Pb2+ detection with a low detection limit down to 2.5×10(-8) M. PMID:22163517

  10. Fibrin-based scaffold incorporating VEGF- and bFGF-loaded nanoparticles stimulates wound healing in diabetic mice.

    PubMed

    Losi, Paola; Briganti, Enrica; Errico, Cesare; Lisella, Antonella; Sanguinetti, Elena; Chiellini, Federica; Soldani, Giorgio

    2013-08-01

    Diabetic skin ulcers are difficult to heal spontaneously due to the reduced levels and activity of endogenous growth factors. Recombinant human vascular endothelial growth factor (VEGF) and basic fibroblast growth factor (bFGF) are known to stimulate cell proliferation and accelerate wound healing. Direct delivery of VEGF and bFGF at the wound site in a sustained and controllable way without loss of bioactivity would enhance their biological effects. The aim of this study was to develop a poly(ether)urethane-polydimethylsiloxane/fibrin-based scaffold containing poly(lactic-co-glycolic acid) (PLGA) nanoparticles loaded with VEGF and bFGF (scaffold/GF-loaded NPs) and to evaluate its wound healing properties in genetically diabetic mice (db/db). The scaffold application on full-thickness dorsal skin wounds significantly accelerated wound closure at day 15 compared to scaffolds without growth factors (control scaffold) or containing unloaded PLGA nanoparticles (scaffold/unloaded NPs). However, the closure rate was similar to that observed in mice treated with scaffolds containing free VEGF and bFGF (scaffold/GFs). Both scaffolds containing growth factors induced complete re-epithelialization, with enhanced granulation tissue formation/maturity and collagen deposition compared to the other groups, as revealed by histological analysis. The ability of the scaffold/GF-loaded NPs to promote wound healing in a diabetic mouse model suggests its potential use as a dressing in patients with diabetic foot ulcers. PMID:23603001

  11. Anti-diabetic effects of a kaempferol glycoside-rich fraction from unripe soybean (Edamame, Glycine max L. Merrill. 'Jindai') leaves on KK-A(y) mice.

    PubMed

    Zang, Yanqing; Sato, Hideyo; Igarashi, Kiharu

    2011-01-01

    The anti-diabetic effects of a kaempferol glycoside-rich fraction (KG) prepared from leaves of unripe Jindai soybean (Edamame) and kaempferol, an aglycone of kaempferol glycoside, were determined in genetically type 2 diabetic KK-A(y) mice. The hemoglobin A(₁c) level was decreased and tended to be decreased by respectively feeding KG and kaempferol (K). The area under the curve (AUC) in the oral glucose tolerance test (OGTT) tended to be decreased by feeding K and KG. The liver triglyceride level and fatty acid synthase activity were both decreased in the mice fed with KG and K when compared to those parameters in the control mice. These results suggest that KG and K would be useful to improve the diabetes condition. The major flavonoids in KG were identified as kaempferol 3-O-β-D-glucopyranosyl(1→2)-O-[α-L-rhamnopyranosyl(1→6)]-β-D-galactopyranoside, kaempferol 3-O-β-D-glucopyranosyl(1→2)-O-[α-L-rhamnopyranosyl(1→6)]-β-D-glucopyranoside, kaempferol 3-O-β-D-(2-O-β-D-glucopyranosyl) galactopyranoside and kaempferol 3-O-β-D-(2,6-di-O-α-L-rhamnopyranosyl) galactopyronoside, suggesting that these compounds or some of them may be concerned with mitigation of diabetes. PMID:21897048

  12. Optimizing stem cell functions and antibacterial properties of TiO2 nanotubes incorporated with ZnO nanoparticles: experiments and modeling

    PubMed Central

    Liu, Wenwen; Su, Penglei; Gonzales, Arthur; Chen, Su; Wang, Na; Wang, Jinshu; Li, Hongyi; Zhang, Zhenting; Webster, Thomas J

    2015-01-01

    To optimize mesenchymal stem cell differentiation and antibacterial properties of titanium (Ti), nano-sized zinc oxide (ZnO) particles with tunable concentrations were incorporated into TiO2 nanotubes (TNTs) using a facile hydrothermal strategy. It is revealed here for the first time that the TNTs incorporated with ZnO nanoparticles exhibited better biocompatibility compared with pure Ti samples (controls) and that the amount of ZnO (tailored by the concentration of Zn(NO3)2 in the precursor) introduced into TNTs played a crucial role on their osteogenic properties. Not only was the alkaline phosphatase activity improved to about 13.8 U/g protein, but the osterix, collagen-I, and osteocalcin gene expressions was improved from mesenchymal stem cells compared to controls. To further explore the mechanism of TNTs decorated with ZnO on cell functions, a response surface mathematical model was used to optimize the concentration of ZnO incorporation into the Ti nanotubes for stem cell differentiation and antibacterial properties for the first time. Both experimental and modeling results confirmed (R2 values of 0.8873–0.9138 and 0.9596–0.9941, respectively) that Ti incorporated with appropriate concentrations (with an initial concentration of Zn(NO3)2 at 0.015 M) of ZnO can provide exceptional osteogenic properties for stem cell differentiation in bone cells with strong antibacterial effects, properties important for improving dental and orthopedic implant efficacy. PMID:25792833

  13. Graphene/graphite paste electrode incorporated with molecularly imprinted polymer nanoparticles as a novel sensor for differential pulse voltammetry determination of fluoxetine.

    PubMed

    Alizadeh, Taher; Azizi, Sorour

    2016-07-15

    Molecularly imprinted polymer (MIP) nanoparticles including highly selective recognition sites for fluoxetine were synthesized, utilizing precipitation polymerization. Methacrylic acid and vinyl benzene were used as functional monomers. Ethylene glycol dimethacrylate was used as cross-linker agent. The obtained polymeric nanoparticles were incorporated with carbon paste electrode (CPE) in order to construct a fluoxetine selective sensor. The response of the MIP-CP electrode to fluoxetine was remarkably higher than the electrode, modified with the non-imprinted polymer, indicating the excellent efficiency of the MIP sites for target molecule recognition. It was found that the addition of a little amount of graphene, synthesized via modified hummer's method, to the MIP-CP resulted in considerable enhancement in the sensitivity of the electrode to fluoxetine. Also, the style of electrode components mixing, before carbon paste preparation, was demonstrated to be influential factor in the electrode response. Some parameters, affecting sensor response, were optimized and then a calibration curve was plotted. A dynamic linear range of 6×10(-9)-1.0×10(-7)molL(-1) was obtained. The detection limit of the sensor was calculated equal to 2.8×10(-9)molL(-1) (3Sb/m). This sensor was used successfully for fluoxetine determination in the spiked plasma samples as well as fluoxetine capsules. PMID:26946258

  14. In-situ electrochemically deposited polypyrrole nanoparticles incorporated reduced graphene oxide as an efficient counter electrode for platinum-free dye-sensitized solar cells

    NASA Astrophysics Data System (ADS)

    Lim, Su Pei; Pandikumar, Alagarsamy; Lim, Yee Seng; Huang, Nay Ming; Lim, Hong Ngee

    2014-06-01

    This paper reports a rapid and in-situ electrochemical polymerization method for the fabrication of polypyrrole nanoparticles incorporated reduced graphene oxide (rGO@PPy) nanocomposites on a ITO conducting glass and its application as a counter electrode for platinum-free dye-sensitized solar cell (DSSC). The scanning electron microscopic images show the uniform distribution of PPy nanoparticles with diameter ranges between 20 and 30 nm on the rGO sheets. The electrochemical studies reveal that the rGO@PPy has smaller charge transfer resistance and similar electrocatalytic activity as that of the standard Pt counter electrode for the I3-/I- redox reaction. The overall solar to electrical energy conversion efficiency of the DSSC with the rGO@PPy counter electrode is 2.21%, which is merely equal to the efficiency of DSSC with sputtered Pt counter electrode (2.19%). The excellent photovoltaic performance, rapid and simple fabrication method and low-cost of the rGO@PPy can be potentially exploited as a alternative counter electrode to the expensive Pt in DSSCs.

  15. In-situ electrochemically deposited polypyrrole nanoparticles incorporated reduced graphene oxide as an efficient counter electrode for platinum-free dye-sensitized solar cells.

    PubMed

    Lim, Su Pei; Pandikumar, Alagarsamy; Lim, Yee Seng; Huang, Nay Ming; Lim, Hong Ngee

    2014-01-01

    This paper reports a rapid and in-situ electrochemical polymerization method for the fabrication of polypyrrole nanoparticles incorporated reduced graphene oxide (rGO@PPy) nanocomposites on a ITO conducting glass and its application as a counter electrode for platinum-free dye-sensitized solar cell (DSSC). The scanning electron microscopic images show the uniform distribution of PPy nanoparticles with diameter ranges between 20 and 30 nm on the rGO sheets. The electrochemical studies reveal that the rGO@PPy has smaller charge transfer resistance and similar electrocatalytic activity as that of the standard Pt counter electrode for the I₃(-)/I(-) redox reaction. The overall solar to electrical energy conversion efficiency of the DSSC with the rGO@PPy counter electrode is 2.21%, which is merely equal to the efficiency of DSSC with sputtered Pt counter electrode (2.19%). The excellent photovoltaic performance, rapid and simple fabrication method and low-cost of the rGO@PPy can be potentially exploited as a alternative counter electrode to the expensive Pt in DSSCs. PMID:24930387

  16. In-situ electrochemically deposited polypyrrole nanoparticles incorporated reduced graphene oxide as an efficient counter electrode for platinum-free dye-sensitized solar cells

    PubMed Central

    Lim, Su Pei; Pandikumar, Alagarsamy; Lim, Yee Seng; Huang, Nay Ming; Lim, Hong Ngee

    2014-01-01

    This paper reports a rapid and in-situ electrochemical polymerization method for the fabrication of polypyrrole nanoparticles incorporated reduced graphene oxide (rGO@PPy) nanocomposites on a ITO conducting glass and its application as a counter electrode for platinum-free dye-sensitized solar cell (DSSC). The scanning electron microscopic images show the uniform distribution of PPy nanoparticles with diameter ranges between 20 and 30 nm on the rGO sheets. The electrochemical studies reveal that the rGO@PPy has smaller charge transfer resistance and similar electrocatalytic activity as that of the standard Pt counter electrode for the I3−/I− redox reaction. The overall solar to electrical energy conversion efficiency of the DSSC with the rGO@PPy counter electrode is 2.21%, which is merely equal to the efficiency of DSSC with sputtered Pt counter electrode (2.19%). The excellent photovoltaic performance, rapid and simple fabrication method and low-cost of the rGO@PPy can be potentially exploited as a alternative counter electrode to the expensive Pt in DSSCs. PMID:24930387

  17. Possible mechanism(s) behind recently observed effects of incorporating gold nanoparticles into a polymer-dispersed liquid crystal

    NASA Astrophysics Data System (ADS)

    Hinojosa, Alfonso; Sharma, Suresh

    2010-10-01

    Recently we reported that addition of relatively small concentrations of about 14-nm diameter gold nanoparticles (Au NPs) to a polymer-dispersed liquid crystal (PDLC) produces rather large changes in the electro-optical properties of the PDLC. For example, addition of Au NPs to PDLC microstructure lowers its threshold voltage by almost 50% and increases optical transmission in a manner that depends on NPs concentration and applied electric field.ootnotetextA. Hinojosa and S. C. Sharma, Applied Physics Letters, 97, 081114 (2010) In order to understand these observations, we have carried out electro-optical measurements on several PDLCs as functions of the polarization of the incident laser beam and applied electric field. In this presentation, we will discuss the results obtained from these experiments and suggest mechanism(s), which might explain NPs-induced changes in the electro-optical properties of PDLCs.

  18. The incorporation of silver nanoparticles in samarium doped magnesium tellurite glass: Effect on the characteristic of bonding and local structure

    NASA Astrophysics Data System (ADS)

    Yusoff, N. M.; Sahar, M. R.

    2015-08-01

    Samarium doped magnesium tellurite glass with and without silver nanoparticles is prepared using melt quenching technique. All glasses are amorphous in nature. The existence of silver nanoparticles in a glass matrix with an average size of 16.94 nm has been confirmed by Transmission Electron Microscopy. The UV-vis spectra are complemented with Judd-Ofelt calculation to get the Judd-Ofelt intensity parameters. It has also been used to calculate nephelauxetic ratio, bonding parameter and Racah parameters. It is found that Judd-Ofelt intensity parameters Ω2 ,Ω4 and Ω6 increase with an increase of Ag NPs contents up to 0.2 mol% and decrease thereafter. Nephelauxetic ratio, β decreases with increasing the concentration of Ag NPs, while bonding parameter, δ increases as the concentration of Ag NPs increases. The value of Racah parameters decreases as the concentration of Ag NPs increases. Fourier Transform Infrared (FTIR) and Raman spectroscopy have been manipulated to observe the structural modification of [TeO4] trigonal bipyramidal structural unit. In the FTIR spectrum, it is found that the structural unit of [TeO4] trigonal bipyramidal, [TeO3+1] polyhedral and/or [TeO3] trigonal pyramidal groups are located at 651-663 cm-1 and 772 cm-1, respectively. It is observed that the [TeO4] tbp wavenumber shifts to a higher wavenumber as the concentration of Ag NPs increases up to 0.2 mol% and decreases thereafter. Meanwhile, for the Raman spectra, it is found that [TeO4] tbp, [TeO3+1] polyhedral and [TeO3] tp groups are located at 646-666 cm-1, 714-741 cm-1, and 745-772 cm-1, respectively.

  19. Route of administration determines the anxiolytic activity of the flavonols kaempferol, quercetin and myricetin--are they prodrugs?

    PubMed

    Vissiennon, Cica; Nieber, Karen; Kelber, Olaf; Butterweck, Veronika

    2012-07-01

    Several in vivo and in vitro studies have confirmed that flavonols are metabolized by the intestinal microflora to their corresponding hydroxyphenylacetic acids. In this article, a comparison of the anxiolytic activity of the flavonols kaempferol, quercetin and myricetin in the elevated plus maze after oral (po) and intraperitoneal (ip) administration to mice in a dose range of 0.1 to 2.0 mg/kg is presented. In addition, their corresponding metabolites p-hydroxyphenylacetic acid (p-HPAA) and 3,4-dihydroxyphenylacetic acid (DOPAC) were tested after intraperitoneal administration. Anxiolytic activity was detected for kaempferol and quercetin only after oral administration. No anxiolytic effects were observed when kaempferol and quercetin were given via the intraperitoneal administration route. The corresponding hydroxyphenylacetic metabolites p-HPAA and DOPAC showed anxiolytic effects after intraperitoneal application. In order to further test the hypothesis that flavonoids are possible prodrugs which require activation by intestinal bacteria, gut sterilization was performed using pretreatment with the antibiotic enrofloxacin (7.5 mg/day, po, for 4 days). After antibiotic treatment, the anxiolytic effect of kaempferol and quercetin disappeared, whereas it was still present for the positive control diazepam. Our results support the hypothesis that flavonoids act as prodrugs which are transformed into their active hydroxyphenylacetic acid metabolites by intestinal microflora. PMID:21840194

  20. Kaempferol Glycosides and Enzymes of Flavonol Biosynthesis in Leaves of a Soybean Strain with Low Photosynthetic Rates

    PubMed Central

    Cosio, Eric G.; McClure, Jerry W.

    1984-01-01

    Soybean (Glycine max L.) strains which accumulate kaempferol 3-(2G-glucosylgentiobioside) in their leaves fix CO2 at rates significantly lower than those lacking this compound (Buttery, Buzzell 1976 Crop Sci 16: 547-550), and kaempferol aglycone is a well known inhibitor of photosynthesis in vitro. However, since neither kaempferol nor any of its glycosides could be detected in mesophyll cells isolated from mature soybean leaves we suspect that kaempferol 3-(2G-glucosylgentiobioside) has no direct inhibitory effect on photosynthesis. The most rapid stage of flavonoid accumulation, and the highest level of activity for several enzymes of phenolic biosynthesis, occurs in leaflets 2.5 to 3 centimeters long. Mesophyll cells isolated from these leaflets contain about 70% of the whole leaf activity for shikimate dehydrogenase, 24% of the 4-coumarate:CoA ligase activity, 35% of the activity for chalcone-flavanone isomerase, but no demonstrable activity for phenylalanine ammonialyase. Our results suggest a highly tissue-specific pattern of secondary phenolic metabolism in soybean leaves. PMID:16663526

  1. Kaempferol glycosides and enzymes of flavonol biosynthesis in leaves of a soybean strain with low photosynthetic rates.

    PubMed

    Cosio, E G; McClure, J W

    1984-04-01

    Soybean (Glycine max L.) strains which accumulate kaempferol 3-(2(G)-glucosylgentiobioside) in their leaves fix CO(2) at rates significantly lower than those lacking this compound (Buttery, Buzzell 1976 Crop Sci 16: 547-550), and kaempferol aglycone is a well known inhibitor of photosynthesis in vitro. However, since neither kaempferol nor any of its glycosides could be detected in mesophyll cells isolated from mature soybean leaves we suspect that kaempferol 3-(2(G)-glucosylgentiobioside) has no direct inhibitory effect on photosynthesis. The most rapid stage of flavonoid accumulation, and the highest level of activity for several enzymes of phenolic biosynthesis, occurs in leaflets 2.5 to 3 centimeters long. Mesophyll cells isolated from these leaflets contain about 70% of the whole leaf activity for shikimate dehydrogenase, 24% of the 4-coumarate:CoA ligase activity, 35% of the activity for chalcone-flavanone isomerase, but no demonstrable activity for phenylalanine ammonialyase. Our results suggest a highly tissue-specific pattern of secondary phenolic metabolism in soybean leaves. PMID:16663526

  2. Intratracheal Administration of Prostacyclin Analogue–incorporated Nanoparticles Ameliorates the Development of Monocrotaline and Sugen-Hypoxia-induced Pulmonary Arterial Hypertension

    PubMed Central

    Matsubara, Hiromi; Kondo, Megumi; Miura, Daiji; Matoba, Tetsuya; Egashira, Kensuke; Ito, Hiroshi

    2016-01-01

    Abstract: Nanoparticles (NPs) have been used as novel drug delivery systems. Drug-incorporated NPs for local delivery might optimize the efficacy and minimize the side effects of drugs. Intravenous prostacyclin improves long-term survival in patients with pulmonary arterial hypertension (PAH), but it causes serious side effects such as catheter-related infections. We investigated the efficacy and safety of intratracheal administration of a prostacyclin analogue, beraprost (BPS), incorporated NPs in Sugen-hypoxia-normoxia and monocrotaline rat models of PAH and in human PAH pulmonary arterial smooth muscle cells (PASMCs). After a single administration, BPS NPs significantly decreased right ventricular pressure, right ventricular hypertrophy, and pulmonary artery muscularization in the 2 rat models. BPS NPs significantly improved the survival rate in the monocrotaline rat model. No infiltration of inflammatory cells, hemorrhage, or fibrosis was found in the liver, kidney, spleen, and heart after the administration of BPS NPs. No liver or kidney dysfunction was found in the blood examinations. BPS and BPS NPs significantly inhibited the proliferation of human PAH PASMCs after 24 hours of treatment. BPS NPs significantly continued to inhibit the proliferation of human PAH PASMCs at 24 hours after the removal of BPS NPs. BPS NPs significantly induced apoptosis in PAH PASMCs compared to that in non-PAH PASMCs. Intratracheal administration of BPS NPs ameliorates pulmonary hypertension in PAH rat models by a sustained antiproliferative effect and a proapoptotic effect on PAH PASMCs. PMID:26745002

  3. Intratracheal Administration of Prostacyclin Analogue-incorporated Nanoparticles Ameliorates the Development of Monocrotaline and Sugen-Hypoxia-induced Pulmonary Arterial Hypertension.

    PubMed

    Akagi, Satoshi; Nakamura, Kazufumi; Matsubara, Hiromi; Kondo, Megumi; Miura, Daiji; Matoba, Tetsuya; Egashira, Kensuke; Ito, Hiroshi

    2016-04-01

    Nanoparticles (NPs) have been used as novel drug delivery systems. Drug-incorporated NPs for local delivery might optimize the efficacy and minimize the side effects of drugs. Intravenous prostacyclin improves long-term survival in patients with pulmonary arterial hypertension (PAH), but it causes serious side effects such as catheter-related infections. We investigated the efficacy and safety of intratracheal administration of a prostacyclin analogue, beraprost (BPS), incorporated NPs in Sugen-hypoxia-normoxia and monocrotaline rat models of PAH and in human PAH pulmonary arterial smooth muscle cells (PASMCs). After a single administration, BPS NPs significantly decreased right ventricular pressure, right ventricular hypertrophy, and pulmonary artery muscularization in the 2 rat models. BPS NPs significantly improved the survival rate in the monocrotaline rat model. No infiltration of inflammatory cells, hemorrhage, or fibrosis was found in the liver, kidney, spleen, and heart after the administration of BPS NPs. No liver or kidney dysfunction was found in the blood examinations. BPS and BPS NPs significantly inhibited the proliferation of human PAH PASMCs after 24 hours of treatment. BPS NPs significantly continued to inhibit the proliferation of human PAH PASMCs at 24 hours after the removal of BPS NPs. BPS NPs significantly induced apoptosis in PAH PASMCs compared to that in non-PAH PASMCs. Intratracheal administration of BPS NPs ameliorates pulmonary hypertension in PAH rat models by a sustained antiproliferative effect and a proapoptotic effect on PAH PASMCs. PMID:26745002

  4. A multifunctional upconverting nanoparticle incorporated polycationic hydrogel for near-infrared triggered and synergistic treatment of drug-resistant bacteria.

    PubMed

    Yin, Meili; Li, Zhenhua; Zhou, Li; Dong, Kai; Ren, Jinsong; Qu, Xiaogang

    2016-03-29

    Recently, antibiotic drug-resistant therapies have become very important due to the emergence of antibiotic-resistant bacterial strains. The development of novel antibacterial materials has received significant attention. Here, quaternized chitosan hydrogels incorporated with NaYF4:Er/Yb/Mn@photosensitizer-doped silica (UCNPs/MB) were synthesized for effective killing of both gram-positive oxacillin-resistant S. aureus (DR-S. aureus) and gram-negative kanamyclin-resistant E. coli (DR-E. coli) bacteria upon near-infrared (NIR) laser irradiation. In this system, the cationic macroporous nature of the hydrogel acts as a molecular 'anion sponge', which sucks the outer part of the anionic microbe membrane into the gel interior voids and causes microbe membrane disruption. By incorporating UCNPs/MB-doped silica into the hydrogel, we have combined photodynamic therapy (PDT) with quaternized chitosan to obtain a high therapeutic index via a synergistic effect. In vitro experiments have demonstrated that our system had excellent antibacterial efficiency to both DR-S. aureus and DR-E. coli bacteria. More importantly, our new synergistic treatment modality provided an excellent therapy platform for drug-resistant bacteria, which could improve antimicrobial efficiency. PMID:26883410

  5. The effect of Ce{sup 4+} incorporation on structural, morphological and photocatalytic characters of ZnO nanoparticles

    SciTech Connect

    Kannadasan, N.; Shanmugam, N. Cholan, S.; Sathishkumar, K.; Viruthagiri, G.; Poonguzhali, R.

    2014-11-15

    We report a simple chemical precipitation method for the preparation of undoped and cerium doped ZnO nanocrystals. The concentration of cerium in the products can be controlled in the range of 0.025–0.125 mol. The structure and chemical compositions of the products were characterized by X-ray diffraction, X-ray photoelectron spectroscopy; energy dispersive spectrum and Fourier transform infrared spectroscopy. The results demonstrate that Ce{sup 4+} ions were successfully incorporated into the lattice position of Zn{sup 2+} ions in ZnO. The morphology of the products was analyzed by field emission scanning electron microscopy and confirmed by high resolution transmission electron microscope analysis. The optical properties of the products were studied by ultraviolet–visible and room temperature photoluminescence measurements. The photoluminescence emission spectra of Ce-doped ZnO showed enhanced visible emissions as a result of 5d → 4f transition of cerium. In particular, a novel photocatalytic activity of the products was assessed using methylene blue. The obtained result reveals that Ce-doped products show higher reduction efficiency for methylene blue than the undoped ZnO. - Highlights: • Nanocrystals of ZnO and ZnO:Ce{sup 4+} were grown. • XPS results confirmed the incorporated cerium in tetravalence. • PL emission exhibited 5d → 4f transition on cerium doping. • Doped ZnO decolorizes MB faster than undoped ZnO.

  6. A multifunctional upconverting nanoparticle incorporated polycationic hydrogel for near-infrared triggered and synergistic treatment of drug-resistant bacteria

    NASA Astrophysics Data System (ADS)

    Yin, Meili; Li, Zhenhua; Zhou, Li; Dong, Kai; Ren, Jinsong; Qu, Xiaogang

    2016-03-01

    Recently, antibiotic drug-resistant therapies have become very important due to the emergence of antibiotic-resistant bacterial strains. The development of novel antibacterial materials has received significant attention. Here, quaternized chitosan hydrogels incorporated with NaYF4:Er/Yb/Mn@photosensitizer-doped silica (UCNPs/MB) were synthesized for effective killing of both gram-positive oxacillin-resistant S. aureus (DR-S. aureus) and gram-negative kanamyclin-resistant E. coli (DR-E. coli) bacteria upon near-infrared (NIR) laser irradiation. In this system, the cationic macroporous nature of the hydrogel acts as a molecular ‘anion sponge’, which sucks the outer part of the anionic microbe membrane into the gel interior voids and causes microbe membrane disruption. By incorporating UCNPs/MB-doped silica into the hydrogel, we have combined photodynamic therapy (PDT) with quaternized chitosan to obtain a high therapeutic index via a synergistic effect. In vitro experiments have demonstrated that our system had excellent antibacterial efficiency to both DR-S. aureus and DR-E. coli bacteria. More importantly, our new synergistic treatment modality provided an excellent therapy platform for drug-resistant bacteria, which could improve antimicrobial efficiency.

  7. Incorporation of photosenzitizer hypericin into synthetic lipid-based nano-particles for drug delivery and large unilamellar vesicles with different content of cholesterol

    NASA Astrophysics Data System (ADS)

    Joniova, Jaroslava; Blascakova, Ludmila; Jancura, Daniel; Nadova, Zuzana; Sureau, Franck; Miskovsky, Pavol

    2014-08-01

    Low-density lipoproteins (LDL) and high-density lipoproteins (HDL) are attractive natural occurring vehicles for drug delivery and targeting to cancer tissues. The capacity of both types of the lipoproteins to bind hydrophobic drugs and their functionality as drug carriers have been examined in several studies and it has been also shown that mixing of anticancer drugs with LDL or HDL before administration led to an increase of cytotoxic effects of the drugs in the comparison when the drugs were administered alone. However, a difficult isolation of the lipoproteins in large quantity from a biological organism as well as a variability of the composition and size of these molecules makes practical application of LDL and HDL as drug delivery systems quite complicated. Synthetic LDL and HDL and large unilamellar vesicles (LUV) are potentially suitable candidates to substitute the native lipoproteins for targeted and effective drug delivery. In this work, we have studied process of an association of potent photosensitizer hypericin (Hyp) with synthetic lipid-based nano-particles (sLNP) and large unilamellar vesicles (LUV) containing various amount of cholesterol. Cholesterol is one of the main components of both LDL and HDL particles and its presence in biological membranes is known to be a determining factor for membrane properties. It was found that the behavior of Hyp incorporation into sLNP particles with diameter ca ~ 90 nm is qualitatively very similar to that of Hyp incorporation into LDL (diameter ca. 22 nm) and these particles are able to enter U-87 MG cells by endocytosis. The presence of cholesterol in LUV influences the capacity of these vesicles to incorporate Hyp into their structure.

  8. Charge collection enhancement by incorporation of gold-silica core-shell nanoparticles into P3HT:PCBM/ZnO nanorod array hybrid solar cells.

    PubMed

    Wang, Ting-Chung; Su, Yen-Hsun; Hung, Yun-Kai; Yeh, Chen-Sheng; Huang, Li-Wen; Gomulya, Widianta; Lai, Lai-Hung; Loi, Maria A; Yang, Jih-Sheng; Wu, Jih-Jen

    2015-08-14

    In this work, gold-silica core-shell (Au@silica) nanoparticles (NPs) with various silica-shell thicknesses are incorporated into P3HT:PCBM/ZnO nanorod (NR) hybrid solar cells. Enhancement in the short-circuit current density and the efficiency of the hybrid solar cells is attained with the appropriate addition of Au@silica NPs regardless of the silica-shell thickness. Compared to the P3HT:PCBM/ZnO NR hybrid solar cell, a 63% enhancement in the efficiency is achieved by the P3HT:PCBM/Au@silica NP/ZnO NR hybrid solar cell. The finite difference time domain simulations indicate that the strength of the Fano resonance, i.e., the electric field of the quasi-static asymmetric quadrupole, on the surface of Au@silica NPs in the P3HT:PCBM/ZnO NR hybrid significantly decreases with increasing thickness of the silica shell. Raman characterization reveals that the degree of P3HT order increases when Au@silica NPs are incorporated into the P3HT:PCBM/ZnO NR hybrid. The charge separation at the interface between P3HT and PCBM as well as the electron transport in the active layer are retarded by the electric field of the Fano resonance. Nevertheless, the prolongation of the electron lifetime and the reduction of the electron transit time in the P3HT:PCBM/ZnO NR hybrid solar cells, which result in an enhancement of electron collection, are achieved by the addition of Au@silica NPs. This may be attributed to the improvement in the degree of P3HT order and connectivity of PCBM when Au@silica NPs are incorporated into the P3HT:PCBM active layer. PMID:26159896

  9. Effect of acid or alkaline catalyst and of different capping agents on the optical properties of CdS nanoparticles incorporated within a diureasil hybrid matrix

    NASA Astrophysics Data System (ADS)

    Gonçalves, Luis F. F. F.; Silva, Carlos J. R.; Kanodarwala, Fehmida K.; Stride, John A.; Pereira, Mario R.

    2015-11-01

    CdS nanoparticles (NPs) were synthesized using colloidal methods and incorporated within a diureasil hybrid matrix. The surface capping of the CdS NPs by 3-mercaptopropyltrimethoxysilane (MPTMS) and 3-aminopropyltrimethoxysilane (APTMS) organic ligands during the incorporation of the NPs within the hybrid matrix has been investigated. The matrix is based on poly(ethylene oxide)/poly(propylene oxide) chains grafted to a siliceous skeleton through urea bonds and was produced by sol-gel process. Both alkaline and acidic catalysis of the sol-gel reaction were used to evaluate the effect of each organic ligand on the optical properties of the CdS NPs. The hybrid materials were characterized by absorption, steady-state and time-resolved photoluminescence spectroscopy and High Resolution Transmission Electron Microscopy (HR-TEM). The preservation of the optical properties of the CdS NPs within the diureasil hybrids was dependent on the experimental conditions used. Both organic ligands (APTMS and MPTMS) demonstrated to be crucial in avoiding the increase of size distribution and clustering of the NPs within the hybrid matrix. The use of organic ligands was also shown to influence the level of interaction between the hybrid host and the CdS NPs. The CdS NPs showed large Stokes shifts and long average lifetimes, both in colloidal solution and in the xerogels, due to the origin of the PL emission in surface states. The CdS NPs capped with MPTMS have lower PL lifetimes compared to the other xerogel samples but still larger than the CdS NPs in the original colloidal solution. An increase in PL lifetimes of the NPs after their incorporation within the hybrid matrix is related to interaction between the NPs and the hybrid host matrix.

  10. PEGylated and poloxamer-modified chitosan nanoparticles incorporating a lysine-based surfactant for pH-triggered doxorubicin release.

    PubMed

    Scheeren, Laís E; Nogueira, Daniele R; Macedo, Letícia B; Vinardell, M Pilar; Mitjans, Montserrat; Infante, M Rosa; Rolim, Clarice M B

    2016-02-01

    The growing demand for efficient chemotherapy in many cancers requires novel approaches in target-delivery technologies. Nanomaterials with pH-responsive behavior appear to have potential ability to selectively release the encapsulated molecules by sensing the acidic tumor microenvironment or the low pH found in endosomes. Likewise, polyethylene glycol (PEG)- and poloxamer-modified nanocarriers have been gaining attention regarding their potential to improve the effectiveness of cancer therapy. In this context, DOX-loaded pH-responsive nanoparticles (NPs) modified with PEG or poloxamer were prepared and the effects of these modifiers were evaluated on the overall characteristics of these nanostructures. Chitosan and tripolyphosphate were selected to form NPs by the interaction of oppositely charged compounds. A pH-sensitive lysine-based amphiphile (77KS) was used as a bioactive adjuvant. The strong dependence of 77KS ionization with pH makes this compound an interesting candidate to be used for the design of pH-sensitive devices. The physicochemical characterization of all NPs has been performed, and it was shown that the presence of 77KS clearly promotes a pH-triggered DOX release. Accelerated and continuous release patterns of DOX from CS-NPs under acidic conditions were observed regardless of the presence of PEG or poloxamer. Moreover, photodegradation studies have indicated that the lyophilization of NPs improved DOX stability under UVA radiation. Finally, cytotoxicity experiments have shown the ability of DOX-loaded CS-NPs to kill HeLa tumor cells. Hence, the overall results suggest that these pH-responsive CS-NPs are highly potent delivery systems to target tumor and intracellular environments, rendering them promising DOX carrier systems for cancer therapy. PMID:26674840

  11. Effect of Cudrania tricuspidata and Kaempferol in Endoplasmic Reticulum Stress-Induced Inflammation and Hepatic Insulin Resistance in HepG2 Cells

    PubMed Central

    Kim, Ok-Kyung; Jun, Woojin; Lee, Jeongmin

    2016-01-01

    In this study, we quantitated kaempferol in water extract from Cudrania tricuspidata leaves (CTL) and investigated its effects on endoplasmic reticulum (ER) stress-induced inflammation and insulin resistance in HepG2 cells. The concentration of kaempferol in the CTL was 5.07 ± 0.08 mg/g. The HepG2 cells were treated with 300 µg/mL of CTL, 500 µg/mL of CTL, 1.5 µg/mL of kaempferol or 2.5 µg/mL of kaempferol, followed immediately by stimulation with 100 nM of thapsigargin for ER stress induction for 24 h. There was a marked increase in the activation of the ER stress and inflammation response in the thapsigargin-stimulated control group. The CTL treatment interrupted the ER stress response and ER stress-induced inflammation. Kaempferol partially inhibited the ER stress response and inflammation. There was a significant increase in serine phosphorylation of insulin receptor substrate (IRS)-1 and the expression of C/EBPα and gluconeogenic genes in the thapsigargin-stimulated control group compared to the normal control. Both CTL and kaempferol suppressed serine phosphorylation of IRS-1, and the treatments did not interrupt the C/EBPα/gluconeogenic gene pathway. These results suggest that kaempferol might be the active compound of CTL and that it might protect against ER stress-induced inflammation and hyperglycemia. PMID:26805878

  12. In Vitro Biocompatibility and Antibacterial Efficacy of a Degradable Poly(L-lactide-co-epsilon-caprolactone) Copolymer Incorporated with Silver Nanoparticles

    PubMed Central

    Samberg, Meghan E.; Mente, Peter; He, Ting; King, Martin W.; Monteiro-Riviere, Nancy A.

    2014-01-01

    Silver nanoparticles (Ag-nps) are currently used as a natural biocide to prevent undesired bacterial growth in clothing, cosmetics and medical products. The objective of the study was to impart antibacterial properties through the incorporation of Ag-nps at increasing concentrations to electrospun degradable 50:50 poly(L-lactide-co-epsilon-caprolactone) scaffolds for skin tissue engineering applications. The biocompatibility of the scaffolds containing Ag-nps was evaluated with human epidermal keratinocytes (HEK); cell viability and proliferation were evaluated using Live/Dead and alamarBlue viability assays following 7 and 14 days of cell culture on the scaffolds. Significant decreases in cell viability and proliferation were noted for the 1.0 mg(Ag) g(scaffold)−1 after 7 and 14 days on Ag-nps scaffolds. After 14 days, scanning electron microscopy revealed a confluent layer of HEK on the surface of the 0.0 and 0.1 mg(Ag) g(scaffold)−1. Both 0.5 and 1.0 mg(Ag) g(scaffold)−1 were capable of inhibiting both Gram positive and negative bacterial strains. Uniaxial tensile tests revealed a significant (p < 0.001) decrease in the modulus of elasticity following Ag-nps incorporation compared to control. These findings suggest that a scaffold containing between 0.5 and 1.0 mg(Ag) g(scaffold)−1 is both biocompatible and antibacterial, and is suitable for skin tissue engineering graft scaffolds. PMID:24150238

  13. In vitro biocompatibility and antibacterial efficacy of a degradable poly(L-lactide-co-epsilon-caprolactone) copolymer incorporated with silver nanoparticles.

    PubMed

    Samberg, Meghan E; Mente, Peter; He, Ting; King, Martin W; Monteiro-Riviere, Nancy A

    2014-07-01

    Silver nanoparticles (Ag-nps) are currently used as a natural biocide to prevent undesired bacterial growth in clothing, cosmetics and medical products. The objective of the study was to impart antibacterial properties through the incorporation of Ag-nps at increasing concentrations to electrospun degradable 50:50 poly(L-lactide-co-epsilon-caprolactone) scaffolds for skin tissue engineering applications. The biocompatibility of the scaffolds containing Ag-nps was evaluated with human epidermal keratinocytes (HEK); cell viability and proliferation were evaluated using Live/Dead and alamarBlue viability assays following 7 and 14 days of cell culture on the scaffolds. Significant decreases in cell viability and proliferation were noted for the 1.0 mg(Ag) g(scaffold)(-1) after 7 and 14 days on Ag-nps scaffolds. After 14 days, scanning electron microscopy revealed a confluent layer of HEK on the surface of the 0.0 and 0.1 mg(Ag) g(scaffold)(-1). Both 0.5 and 1.0 mg(Ag) g(scaffold)(-1) were capable of inhibiting both Gram positive and negative bacterial strains. Uniaxial tensile tests revealed a significant (p < 0.001) decrease in the modulus of elasticity following Ag-nps incorporation compared to control. These findings suggest that a scaffold containing between 0.5 and 1.0 mg(Ag) g(scaffold)(-1) is both biocompatible and antibacterial, and is suitable for skin tissue engineering graft scaffolds. PMID:24150238

  14. [Retracted] Retinoic acid‑incorporated glycol chitosan nanoparticles inhibit the expression of Ezh2 in U118 and U138 human glioma cells.

    PubMed

    Lu, Hu-Chen; Ma, Jun; Zhuang, Zong; Zhang, Yao; Cheng, Hui-Lin; Shi, Ji-Xin

    2016-06-01

    We wish to retract our research article entitled "Retinoic acid-incorporated glycol chitosan nanoparticles inhibit Ezh2 expression in U118 and U138 human glioma cells" published in Molecular Medicine Reports 12: 6642-6648, 2015. An interested reader noted some anomalies in the presentation of Fig. 4 in our paper, calling into question the validity of the reported data. In examining our original article, we acknowledge that the data for RA (25 µm) did not show a higher density of cells compared with RA (10 µm), as shown in Fig. 4, and therefore Fig. 4 conveyed inaccurate information for the readers. Owing to the importance of these results, which bear significantly upon the conclusions that one may draw from this work, we have decided to withdraw our paper from Molecular Medicine Reports [the original article was published in Molecular Medicine Reports 12: 6642-6648, 2015; DOI: 10.3892/mmr.2015.4294. PMID:27082936

  15. Kaempferol inhibits the production of ROS to modulate OPN-αvβ3 integrin pathway in HUVECs.

    PubMed

    Xiao, Hong-Bo; Lu, Xiang-Yang; Liu, Zi-Kui; Luo, Zhi-Feng

    2016-06-01

    In the present study, we tested the hypothesis that aldosterone regulates osteopontin (OPN)-related signaling pathways to promote nuclear factor κB (NF-κB) activation in primary human umbilical vein endothelial cells (HUVECs) and that kaempferol, a flavonoid compound, blocks those changes. Aldosterone induced productions of reactive oxygen species (ROS), OPN, interleukin-6 (IL-6), and tumor necrosis factor alpha (TNF-α) and expression of nicotinamide adenine dinucleotide phosphate-oxidase 4 (Nox4), NF-κB, OPN, alphavbeta3 (αvβ3) integrin, and inhibitor of NF-κB alpha phosphorylation (P-IκBα) in HUVEC. HUVECs were pretreated with kaempferol (0, 1, 3, or 10 μM) for 1 h and exposed to aldosterone (10(-6) M) for 24 h. Kaempferol reduced ROS, OPN, NF-κB, IL-6, and TNF-α levels; Nox4, αvβ3 integrin; and P-IκBα expressions. The effect of aldosterone was also abrogated by spironolactone (10(-6) M). In addition, vitamin C (20 mmol/L) reduced ROS production. Vitamin C and LM609 (10 μg/mL) treatment decreased expressions of OPN, αvβ3 integrin, and NF-κB (P < 0.05 or P < 0.01). The present results suggest that kaempferol may modulate OPN-αvβ3 integrin pathway to inhibit NF-κB activation in HUVECs. PMID:27000882

  16. nanoparticles

    NASA Astrophysics Data System (ADS)

    Andreu-Cabedo, Patricia; Mondragon, Rosa; Hernandez, Leonor; Martinez-Cuenca, Raul; Cabedo, Luis; Julia, J. Enrique

    2014-10-01

    Thermal energy storage (TES) is extremely important in concentrated solar power (CSP) plants since it represents the main difference and advantage of CSP plants with respect to other renewable energy sources such as wind, photovoltaic, etc. CSP represents a low-carbon emission renewable source of energy, and TES allows CSP plants to have energy availability and dispatchability using available industrial technologies. Molten salts are used in CSP plants as a TES material because of their high operational temperature and stability of up to 500°C. Their main drawbacks are their relative poor thermal properties and energy storage density. A simple cost-effective way to improve thermal properties of fluids is to dope them with nanoparticles, thus obtaining the so-called salt-based nanofluids. In this work, solar salt used in CSP plants (60% NaNO3 + 40% KNO3) was doped with silica nanoparticles at different solid mass concentrations (from 0.5% to 2%). Specific heat was measured by means of differential scanning calorimetry (DSC). A maximum increase of 25.03% was found at an optimal concentration of 1 wt.% of nanoparticles. The size distribution of nanoparticle clusters present in the salt at each concentration was evaluated by means of scanning electron microscopy (SEM) and image processing, as well as by means of dynamic light scattering (DLS). The cluster size and the specific surface available depended on the solid content, and a relationship between the specific heat increment and the available particle surface area was obtained. It was proved that the mechanism involved in the specific heat increment is based on a surface phenomenon. Stability of samples was tested for several thermal cycles and thermogravimetric analysis at high temperature was carried out, the samples being stable.

  17. Structural rearrangement of mesostructured silica nanoparticles incorporated with ZnO catalyst and its photoactivity: Effect of alkaline aqueous electrolyte concentration

    NASA Astrophysics Data System (ADS)

    Jusoh, N. W. C.; Jalil, A. A.; Triwahyono, S.; Karim, A. H.; Salleh, N. F.; Annuar, N. H. R.; Jaafar, N. F.; Firmansyah, M. L.; Mukti, R. R.; Ali, M. W.

    2015-03-01

    ZnO-incorporated mesostructured silica nanoparticles (MSN) catalysts (ZM) were prepared by the introduction of Zn ions into the framework of MSN via a simple electrochemical system in the presence of various concentrations of NH4OH aqueous solution. The physicochemical properties of the catalysts were studied by XRD, 29Si MAS NMR, nitrogen adsorption-desorption, FE-SEM, TEM, FTIR, and photoluminescence spectroscopy. Characterization results demonstrated that the alkaline aqueous electrolyte simply generated abundant silanol groups on the surface of the catalysts as a consequence of desilication to form the hierarchical-like structure of the MSN. Subsequent restructuring of the silica network by the creation of oxygen vacancies and formation of Si-O-Zn during the electrolysis, as well as formation of new Si-O-Si bonds during calcination seemed to be the main factors that enhanced the catalytic performance of photodecolorization of methyl orange. A ZM prepared in the presence of 1.0 M NH4OH (ZM-1.0) was determined to be the most effective catalyst. The catalyst displays a higher first-order kinetics rate of 3.87 × 10-1 h-1 than unsupported ZnO (1.13 × 10-1 h-1) that prepared under the same conditions in the absence of MSN. The experiment on effect of scavengers showed that hydroxyl radicals generated from the three main sources; reduced O2 at the conduction band, decomposed water at the valence band and irradiated H2O2 in the solution, are key factors that influenced the reaction. It is also noted that the recycled ZM-1.0 catalyst maintained its activity up to five runs without serious catalyst deactivation.

  18. Photothermally actuated interfacial hydration for fast friction switch on hydrophilic polymer brush modified PDMS sheet incorporated with Fe3O4 nanoparticles.

    PubMed

    Liu, Guoqiang; Cai, Meirong; Feng, Yange; Wang, Xiaolong; Zhou, Feng; Liu, Weimin

    2016-02-23

    A near-infrared light triggered fast interfacial friction switch was achieved with polyelectrolyte brush grafted PDMS embedded with Fe3O4 nanoparticles, where the in situ heating up of the photothermal Fe3O4 nanoparticles in the polymer matrix changes the interface humidity and thereafter alters the hydration level of the interfacial polymer brushes. PMID:26856309

  19. Identification of kaempferol as an inhibitor of cigarette smoke-induced activation of the aryl hydrocarbon receptor and cell transformation.

    PubMed

    Puppala, D; Gairola, C G; Swanson, H I

    2007-03-01

    The aryl hydrocarbon receptor (AHR) is a cytosolic receptor which upon activation by its agonists, translocates into the nucleus and forms a dimer with ARNT (aryl hydrocarbon nuclear translocator). The AHR/ARNT dimer regulates the expression of its target genes by binding to DNA recognition elements termed dioxin responsive elements (DREs). Many AHR agonists, like the polyaromatic hydrocarbons and polyhalogenated hydrocarbons are known human carcinogens. Human exposure to these compounds is common due to their presence in air pollution and cigarette smoke. Interestingly, many dietary constituents that have chemo preventative properties have been found to also act as antagonists of the AHR pathway. Thus, a chemopreventive approach that may be effective in decreasing the incidences of many human cancers may involve a dietary regimen that includes a number of these naturally occurring AHR antagonists. With this idea in mind, we have assayed the ability of 15 flavonoids to inhibit AHR activated reporter activity and selected kaempferol for further analysis. Kaempferol proved to be capable of inhibiting binding of agonist and agonist-induced formation of the AHR/ARNT DNA-binding complex and upregulation of the AHR target gene, CYP1A1. Using an in vitro paradigm of events that are thought to occur during cigarette-smoke-induced lung cancer, we found that kaempferol also inhibited the ability of cigarette smoke condensate to induce growth of immortalized lung epithelial (BEAS-2B) cells in soft agar. Taken together, these results illustrate the promise associated with the use of flavonoids, that inhibit both AHR signaling and the carcinogenic actions of AHR agonists, for chemopreventive purposes. PMID:17012224

  20. Kaempferol-3-O-rhamnoside isolated from the leaves of Schima wallichii Korth. inhibits MCF-7 breast cancer cell proliferation through activation of the caspase cascade pathway

    PubMed Central

    DIANTINI, AJENG; SUBARNAS, ANAS; LESTARI, KERI; HALIMAH, ELI; SUSILAWATI, YASMIWAR; SUPRIYATNA; JULAEHA, EUIS; ACHMAD, TRI H.; SURADJI, EKA W.; YAMAZAKI, CHIHO; KOBAYASHI, KENJI; KOYAMA, HIROSHI; ABDULAH, RIZKY

    2012-01-01

    Plants consumed by non-human primates represent potential drug sources for human disease management. In this study, we isolated kaempferol-3-O-rhamnoside as an active compound from the leaves of Schima wallichii Korth., a plant commonly consumed by non-human primates. Its anti-cancer activities, including its ability to induce apoptotic mechanisms, were investigated in MCF-7 breast cancer cells. Results showed that in MCF-7 cells, kaempferol-3-O-rhamnoside inhibits cell proliferation in a dose-dependent manner and promotes apoptosis via the activation of the caspase signaling cascade, which includes caspase-9, caspase-3 and PARP. Our results provide a basis for further exploration of kaempferol-3-O-rhamnoside as an active compound for potential anti-cancer therapeutics. PMID:22783393

  1. A general chelate-assisted co-assembly to metallic nanoparticles-incorporated ordered mesoporous carbon catalysts for Fischer-Tropsch synthesis.

    PubMed

    Sun, Zhenkun; Sun, Bo; Qiao, Minghua; Wei, Jing; Yue, Qin; Wang, Chun; Deng, Yonghui; Kaliaguine, Serge; Zhao, Dongyuan

    2012-10-24

    The organization of different nano objects with tunable sizes, morphologies, and functions into integrated nanostructures is critical to the development of novel nanosystems that display high performances in sensing, catalysis, and so on. Herein, using acetylacetone as a chelating agent, phenolic resol as a carbon source, metal nitrates as metal sources, and amphiphilic copolymers as a template, we demonstrate a chelate-assisted multicomponent coassembly method to synthesize ordered mesoporous carbon with uniform metal-containing nanoparticles. The obtained nanocomposites have a 2-D hexagonally arranged pore structure, uniform pore size (~4.0 nm), high surface area (~500 m(2)/g), moderate pore volume (~0.30 cm(3)/g), uniform and highly dispersed Fe(2)O(3) nanoparticles, and constant Fe(2)O(3) contents around 10 wt %. By adjusting acetylacetone amount, the size of Fe(2)O(3) nanoparticles is readily tunable from 8.3 to 22.1 nm. More importantly, it is found that the metal-containing nanoparticles are partially embedded in the carbon framework with the remaining part exposed in the mesopore channels. This unique semiexposure structure not only provides an excellent confinement effect and exposed surface for catalysis but also helps to tightly trap the nanoparticles and prevent aggregating during catalysis. Fischer-Tropsch synthesis results show that as the size of iron nanoparticles decreases, the mesoporous Fe-carbon nanocomposites exhibit significantly improved catalytic performances with C(5+) selectivity up to 68%, much better than any reported promoter-free Fe-based catalysts due to the unique semiexposure morphology of metal-containing nanoparticles confined in the mesoporous carbon matrix. PMID:23020275

  2. Self-assembly of a model peptide incorporating a hexa-histidine sequence attached to an oligo-alanine sequence, and binding to gold NTA/nickel nanoparticles.

    PubMed

    Hamley, Ian W; Kirkham, Steven; Dehsorkhi, Ashkan; Castelletto, Valeria; Adamcik, Jozef; Mezzenga, Raffaele; Ruokolainen, Janne; Mazzuca, Claudia; Gatto, Emanuela; Venanzi, Mariano; Placidi, Ernesto; Bilalis, Panayiotis; Iatrou, Hermis

    2014-09-01

    Amyloid fibrils are formed by a model surfactant-like peptide (Ala)10-(His)6 containing a hexa-histidine tag. This peptide undergoes a remarkable two-step self-assembly process with two distinct critical aggregation concentrations (cac's), probed by fluorescence techniques. A micromolar range cac is ascribed to the formation of prefibrillar structures, whereas a millimolar range cac is associated with the formation of well-defined but more compact fibrils. We examine the labeling of these model tagged amyloid fibrils using Ni-NTA functionalized gold nanoparticles (Nanogold). Successful labeling is demonstrated via electron microscopy imaging. The specificity of tagging does not disrupt the β-sheet structure of the peptide fibrils. Binding of fibrils and Nanogold is found to influence the circular dichroism associated with the gold nanoparticle plasmon absorption band. These results highlight a new approach to the fabrication of functionalized amyloid fibrils and the creation of peptide/nanoparticle hybrid materials. PMID:25105839

  3. Kaempferol induces apoptosis in human HCT116 colon cancer cells via the Ataxia-Telangiectasia Mutated-p53 pathway with the involvement of p53 Upregulated Modulator of Apoptosis.

    PubMed

    Li, Wei; Du, Bingna; Wang, Tianyi; Wang, Siling; Zhang, Jinghai

    2009-01-27

    Dietary flavonols have been found to possess preventive and therapeutic potential against several kinds of cancers. This study is conducted to investigate the anti-proliferation effects of kaempferol, a major component of food flavonols, against colon cancer cells. In the human HCT116 colon cancer cell line, kaempferol induced p53-dependent growth inhibition and apoptosis. Furthermore, kaempferol was found to induce cytochrome c release from mitochondria and activate caspase-3 cleavage. The Bcl-2 family proteins including PUMA were involved in this process. Kaempferol also induced ATM and H2AX phosphorylation in HCT116 cells, inhibition of ATM by a chemical inhibitor resulted in abrogation of the downstream apoptotic cascades. These findings suggest kaempferol could be a potent candidate for colorectal cancer management. PMID:19028473

  4. Transcriptional profiling in human HaCaT keratinocytes in response to kaempferol and identification of potential transcription factors for regulating differential gene expression

    PubMed Central

    Kang, Byung Young; Lee, Ki-Hwan; Lee, Yong Sung; Hong, Il; Lee, Mi-Ock; Min, Daejin; Chang, Ihseop; Hwang, Jae Sung; Park, Jun Seong; Kim, Duck Hee

    2008-01-01

    Kaempferol is the major flavonol in green tea and exhibits many biomedically useful properties such as antioxidative, cytoprotective and anti-apoptotic activities. To elucidate its effects on the skin, we investigated the transcriptional profiles of kaempferol-treated HaCaT cells using cDNA microarray analysis and identified 147 transcripts that exhibited significant changes in expression. Of these, 18 were up-regulated and 129 were down-regulated. These transcripts were then classified into 12 categories according to their functional roles: cell adhesion/cytoskeleton, cell cycle, redox homeostasis, immune/defense responses, metabolism, protein biosynthesis/modification, intracellular transport, RNA processing, DNA modification/ replication, regulation of transcription, signal transduction and transport. We then analyzed the promoter sequences of differentially-regulated genes and identified over-represented regulatory sites and candidate transcription factors (TFs) for gene regulation by kaempferol. These included c-REL, SAP-1, Ahr-ARNT, Nrf-2, Elk-1, SPI-B, NF-κB and p65. In addition, we validated the microarray results and promoter analyses using conventional methods such as real-time PCR and ELISA-based transcription factor assay. Our microarray analysis has provided useful information for determining the genetic regulatory network affected by kaempferol, and this approach will be useful for elucidating gene-phytochemical interactions. PMID:18446059

  5. Incorporation of negatively charged iron oxide nanoparticles in the shell of anionic surfactant-stabilized microbubbles: The effect of NaCl concentration.

    PubMed

    Kovalenko, Artem; Jouhannaud, Julien; Polavarapu, Prasad; Krafft, Marie Pierre; Waton, Gilles; Pourroy, Geneviève

    2016-06-15

    We report on the key effect of NaCl for the stabilization of nanoparticle-decorated microbubbles coated by an anionic perfluoroalkylated phosphate C10F21(CH2)2OP(O)(OH)2 surfactant and negatively charged iron oxide nanoparticles. We show that hollow microspheres with shells of 100-200nm in thickness can be stabilized even at high pH when a strong ionic force is required to screen the negative charges. Due to the more drastic conditions required to stabilize the hollow microspheres, they appear to be stable enough to be deposited on a surface and dried. That can be a simple way to fabricate porous ceramics. PMID:27038281

  6. Effect of incorporation of different modified Al2O3 nanoparticles on holographic characteristics of PVA/AA photopolymer composites.

    PubMed

    Li, Yunxi; Wang, Chunhui; Li, Hailong; Wang, Xiaoyi; Han, Junhe; Huang, Mingju

    2015-11-20

    Al2O3 nanoparticles modified with different chemical reagents, prepared by using three chemical dispersants [high definition (HD), sodium dodecyl benzene sulfonate, and cetyl trimethyl ammonium chloride], were doped into photopolymer films in a polyvinyl alcohol/acrylamide (PVA/AA) system, respectively. A 647 nm Ar-Kr laser was used to expose and study the holographic properties of the samples. The research shows that doping Al2O3 nanoparticles into PVA/AA photopolymer film leads to different levels of improvement of the holographic characteristics. The diffraction efficiency of the sample can be raised to 93.8%, the maximum refractive index modulation increased to 2.28×10-3, the shrinkage can be depressed to 0.8%, and the Bragg mismatch is 0.04°, while the concentration of 10 nm Al2O3 nanoparticles modified by HD dispersant is 1.02×10-3  mol·L-1. PMID:26836540

  7. In-situ and ex-situ characterization of TiO2 and Au nanoparticle incorporated TiO2 thin films for optical gas sensing at extreme temperatures

    NASA Astrophysics Data System (ADS)

    Ohodnicki, Paul R.; Wang, Congjun; Natesakhawat, Sittichai; Baltrus, John P.; Brown, Thomas D.

    2012-03-01

    Sensor technologies that can operate under extreme conditions including high temperatures, high pressures, highly reducing and oxidizing environments, and corrosive gases are needed for process monitoring and control in advanced fossil energy applications. Sensor technologies based on optical waveguide-based techniques are highly attractive for passive, embedded, and remote sensing. A critical enabling technology for optical waveguide sensors is the development of advanced optical thin film coatings which have a desired set of optical properties that change in a rapid, selective, and sensitive manner to a particular quantity of interest. TiO2 and Au nanoparticle incorporated TiO2 nanocomposite thin films were prepared through sol-gel deposition techniques and their respective optical responses to a 4% H2/N2 mixture were investigated in the visible / near-IR range of 400-1000 nm. A tendency for Au nanoparticles to occupy special sites on the TiO2 microstructure, such as grain boundaries, twin boundaries, and triple points is rationalized in terms of basic surface energy arguments. The Au / TiO2 nanocomposite films showed a useful optical response due to a reversible, rapid, and repeatable shift in the localized surface plasma resonance peak of Au nanoparticles at a temperature of 650 °C and 850 °C. In contrast, high temperature exposure of TiO2 films to reducing gases at 850 °C resulted in the growth of abnormally large grains or "hillocks" that protruded from the sample surface and resulted in light scattering and an irreversible decrease in transmission at short wavelengths. The origin of the observed optical response of Au / TiO2 nanocomposite films is discussed in the context of work by prior investigators in the Au / yttria-stabilized Zirconia (YSZ) system and needs for future research in this area is highlighted.

  8. 13C CP MAS NMR and GIAO-CHF/DFT calculations of flavonoids: Morin, kaempferol, tricin, genistein, formononetin and 3,7-dihydroxyflavone

    NASA Astrophysics Data System (ADS)

    Zielińska, Agnieszka; Paradowska, Katarzyna; Jakowski, Jacek; Wawer, Iwona

    2008-02-01

    13C CP MAS NMR spectra of the flavonoids: morin, kaempferol, 3,7-dihydroxyflavone, tricin and isoflavones: genistein and formononetin were recorded to characterize solid-state conformations. Intramolecular hydrogen bonds forming five-, six- and seven-membered rings are present in the two morin molecules in the crystals - their 13C resonances have been assigned with the aid of the calculated shielding constants. Linear relationships between the calculated shielding constants σDFT (ppm) and chemical shifts ( δCPMAS, ppm) were obtained for all studied compounds. Higher correlation coefficients suggest that the conformation with "clockwise" orientation of both OH groups is more probable in the solid 3,7-dihydroxyflavone, whereas in the solid formononetin the OH and OCH 3 substituents are directed "anticlockwise". The barrier to the rotation of phenyl ring B decreases in the order: morin (2'-OH, 3-OH) > kaempferol (3-OH) > tricin.

  9. Screening of Korean Natural Products for Anti-Adipogenesis Properties and Isolation of Kaempferol-3-O-rutinoside as a Potent Anti-Adipogenetic Compound from Solidago virgaurea.

    PubMed

    Jang, Young Soo; Wang, Zhiqiang; Lee, Jeong-Min; Lee, Jae-Young; Lim, Soon Sung

    2016-01-01

    In this study, the anti-adipogenetic activity of 300 plant extracts was investigated using an Oil Red O staining assay in a 3T3-L1 cell line. Our results indicate that three plants, including the stem and leaf of Physalis angulata, the whole grass of Solidago virgaurea, and the root of Dioscorea nipponica, produced over 90% inhibition of adipogenesis. Kaempferol-3-O-rutinoside, which demonstrated a 48.2% inhibitory effect on adipogenesis without cytotoxicity, was isolated from the butanol layer of a water extract of S. virgaurea guided by the anti-adipogenesis assay in 3T3-L1. PPAR-γ and C/EBPα expression levels were determined using western blot, and our results indicate that kaempferol-3-O-rutinoside has a strong anti-adipogenic effect in 3T3-L1 cells through the suppression of increases in PPAR-γ and C/EBPα expression. PMID:26901177

  10. The dietary flavonoid Kaempferol mediates anti-inflammatory responses via the Src, Syk, IRAK1, and IRAK4 molecular targets.

    PubMed

    Kim, Shi Hyoung; Park, Jae Gwang; Lee, Jongsung; Yang, Woo Seok; Park, Gye Won; Kim, Han Gyung; Yi, Young-Su; Baek, Kwang-Soo; Sung, Nak Yoon; Hossen, Muhammad Jahangir; Lee, Mi-Nam; Kim, Jong-Hoon; Cho, Jae Youl

    2015-01-01

    Even though a lot of reports have suggested the anti-inflammatory activity of kaempferol (KF) in macrophages, little is known about its exact anti-inflammatory mode of action and its immunopharmacological target molecules. In this study, we explored anti-inflammatory activity of KF in LPS-treated macrophages. In particular, molecular targets for KF action were identified by using biochemical and molecular biological analyses. KF suppressed the release of nitric oxide (NO) and prostaglandin E2 (PGE2), downregulated the cellular adhesion of U937 cells to fibronectin (FN), neutralized the generation of radicals, and diminished mRNA expression levels of inflammatory genes encoding inducible NO synthase (iNOS), TNF-α, and cyclooxygenase- (COX-) 2 in lipopolysaccharide- (LPS-) and sodium nitroprusside- (SNP-) treated RAW264.7 cells and peritoneal macrophages. KF reduced NF-κB (p65 and p50) and AP-1 (c-Jun and c-Fos) levels in the nucleus and their transcriptional activity. Interestingly, it was found that Src, Syk, IRAK1, and IRAK4 responsible for NF-κB and AP-1 activation were identified as the direct molecular targets of KF by kinase enzyme assays and by measuring their phosphorylation patterns. KF was revealed to have in vitro and in vivo anti-inflammatory activity by the direct suppression of Src, Syk, IRAK1, and IRAK4, involved in the activation of NF-κB and AP-1. PMID:25922567

  11. The Dietary Flavonoid Kaempferol Mediates Anti-Inflammatory Responses via the Src, Syk, IRAK1, and IRAK4 Molecular Targets

    PubMed Central

    Kim, Shi Hyoung; Park, Jae Gwang; Lee, Jongsung; Yang, Woo Seok; Park, Gye Won; Kim, Han Gyung; Baek, Kwang-Soo; Hossen, Muhammad Jahangir; Lee, Mi-nam; Kim, Jong-Hoon

    2015-01-01

    Even though a lot of reports have suggested the anti-inflammatory activity of kaempferol (KF) in macrophages, little is known about its exact anti-inflammatory mode of action and its immunopharmacological target molecules. In this study, we explored anti-inflammatory activity of KF in LPS-treated macrophages. In particular, molecular targets for KF action were identified by using biochemical and molecular biological analyses. KF suppressed the release of nitric oxide (NO) and prostaglandin E2 (PGE2), downregulated the cellular adhesion of U937 cells to fibronectin (FN), neutralized the generation of radicals, and diminished mRNA expression levels of inflammatory genes encoding inducible NO synthase (iNOS), TNF-α, and cyclooxygenase- (COX-) 2 in lipopolysaccharide- (LPS-) and sodium nitroprusside- (SNP-) treated RAW264.7 cells and peritoneal macrophages. KF reduced NF-κB (p65 and p50) and AP-1 (c-Jun and c-Fos) levels in the nucleus and their transcriptional activity. Interestingly, it was found that Src, Syk, IRAK1, and IRAK4 responsible for NF-κB and AP-1 activation were identified as the direct molecular targets of KF by kinase enzyme assays and by measuring their phosphorylation patterns. KF was revealed to have in vitro and in vivo anti-inflammatory activity by the direct suppression of Src, Syk, IRAK1, and IRAK4, involved in the activation of NF-κB and AP-1. PMID:25922567

  12. Kaempferol Attenuates Myocardial Ischemic Injury via Inhibition of MAPK Signaling Pathway in Experimental Model of Myocardial Ischemia-Reperfusion Injury.

    PubMed

    Suchal, Kapil; Malik, Salma; Gamad, Nanda; Malhotra, Rajiv Kumar; Goyal, Sameer N; Chaudhary, Uma; Bhatia, Jagriti; Ojha, Shreesh; Arya, Dharamvir Singh

    2016-01-01

    Kaempferol (KMP), a dietary flavonoid, has antioxidant, anti-inflammatory, and antiapoptotic effects. Hence, we investigated the effect of KMP in ischemia-reperfusion (IR) model of myocardial injury in rats. We studied male albino Wistar rats that were divided into sham, IR-control, KMP-20 + IR, and KMP 20 per se groups. KMP (20 mg/kg; i.p.) was administered daily to rats for the period of 15 days, and, on the 15th day, ischemia was produced by one-stage ligation of left anterior descending coronary artery for 45 min followed by reperfusion for 60 min. After completion of surgery, rats were sacrificed; heart was removed and processed for biochemical, morphological, and molecular studies. KMP pretreatment significantly ameliorated IR injury by maintaining cardiac function, normalizing oxidative stress, and preserving morphological alterations. Furthermore, there was a decrease in the level of inflammatory markers (TNF-α, IL-6, and NFκB), inhibition of active JNK and p38 proteins, and activation of ERK1/ERK2, a prosurvival kinase. Additionally, it also attenuated apoptosis by reducing the expression of proapoptotic proteins (Bax and Caspase-3), TUNEL positive cells, and increased level of antiapoptotic proteins (Bcl-2). In conclusion, KMP protected against IR injury by attenuating inflammation and apoptosis through the modulation of MAPK pathway. PMID:27087891

  13. Synthesis, Characterization, DNA Interaction, and Antitumor Activities of La (III) Complex with Schiff Base Ligand Derived from Kaempferol and Diethylenetriamine

    PubMed Central

    Wang, Qin; Huang, Yu; Zhang, Jin-Sheng; Yang, Xin-Bin

    2014-01-01

    A novel La (III) complex, [LaL(H2O)3]NO3·3H2O, with Schiff base ligand L derived from kaempferol and diethylenetriamine, has been synthesized and characterized by elemental analysis, IR, UV-visible, 1H NMR, thermogravimetric analysis, and molar conductance measurements. The fluorescence spectra, circular dichroism spectra, and viscosity measurements and gel electrophoresis experiments indicated that the ligand L and La (III) complex could bind to CT-DNA presumably via intercalative mode and the La (III) complex showed a stronger ability to bind and cleave DNA than the ligand L alone. The binding constants (Kb) were evaluated from fluorescence data and the values ranged from 0.454 to 0.659 × 105 L mol−1 and 1.71 to 17.3 × 105 L mol−1 for the ligand L and La (III) complex, respectively, in the temperature range of 298–310 K. It was also found that the fluorescence quenching mechanism of EB-DNA by ligand L and La (III) complex was a static quenching process. In comparison to free ligand L, La (III) complex exhibited enhanced cytotoxic activities against tested tumor cell lines HL-60 and HepG-2, which may correlate with the enhanced DNA binding and cleaving abilities of the La (III) complex. PMID:25371657

  14. Kaempferol Attenuates Myocardial Ischemic Injury via Inhibition of MAPK Signaling Pathway in Experimental Model of Myocardial Ischemia-Reperfusion Injury

    PubMed Central

    Suchal, Kapil; Malik, Salma; Gamad, Nanda; Malhotra, Rajiv Kumar; Goyal, Sameer N.; Chaudhary, Uma; Bhatia, Jagriti; Ojha, Shreesh; Arya, Dharamvir Singh

    2016-01-01

    Kaempferol (KMP), a dietary flavonoid, has antioxidant, anti-inflammatory, and antiapoptotic effects. Hence, we investigated the effect of KMP in ischemia-reperfusion (IR) model of myocardial injury in rats. We studied male albino Wistar rats that were divided into sham, IR-control, KMP-20 + IR, and KMP 20 per se groups. KMP (20 mg/kg; i.p.) was administered daily to rats for the period of 15 days, and, on the 15th day, ischemia was produced by one-stage ligation of left anterior descending coronary artery for 45 min followed by reperfusion for 60 min. After completion of surgery, rats were sacrificed; heart was removed and processed for biochemical, morphological, and molecular studies. KMP pretreatment significantly ameliorated IR injury by maintaining cardiac function, normalizing oxidative stress, and preserving morphological alterations. Furthermore, there was a decrease in the level of inflammatory markers (TNF-α, IL-6, and NFκB), inhibition of active JNK and p38 proteins, and activation of ERK1/ERK2, a prosurvival kinase. Additionally, it also attenuated apoptosis by reducing the expression of proapoptotic proteins (Bax and Caspase-3), TUNEL positive cells, and increased level of antiapoptotic proteins (Bcl-2). In conclusion, KMP protected against IR injury by attenuating inflammation and apoptosis through the modulation of MAPK pathway. PMID:27087891

  15. Synthesis and Protective Effects of Kaempferol-3'-sulfonate on Hydrogen Peroxide-induced injury in Vascular Smooth Muscle Cells.

    PubMed

    Yang, Xinbin; Wang, Qin; Wang, Chunmei; Qin, Xiaolin; Huang, Yu; Zeng, Renquan

    2016-06-01

    A novel water-soluble sulfated derivative, kaempferol-3'-sulfonate acid sodium (KS) with the composition of [C15 H9 O9 SNa]·2.5H2 O, was synthesized and characterized by elemental analysis, IR, (1) H NMR, (13) C NMR, and HRMS. Its protective effects on human vascular smooth muscle cells injured by hydrogen peroxide were evaluated by CCK-8 method, flow cytometry, and Western blotting. The experimental results indicated that the KS can significantly increase cell viability and reduce apoptosis on H2 O2 -injured VSMCs, as well as reverse the effects of H2 O2 on Bcl-2, Bad, and caspase-3 expressions. In addition, LDH leakage, MDA levels, and SOD and GSH activities were also measured with spectrophotometry. The results indicated that the KS acted as antioxidant preventing LDH leakage and MDA production, while increasing intracellular SOD and GSH activities. These findings revealed that KS might potentially serve as an effective antioxidant agent for prevention and treatment of vascular disease caused by H2 O2 -injured VSMCs. PMID:26706847

  16. A fragmentation study of kaempferol using electrospray quadrupole time-of-flight mass spectrometry at high mass resolution

    NASA Astrophysics Data System (ADS)

    March, Raymond E.; Miao, Xiu-Sheng

    2004-02-01

    A mass spectrometric method based on the combined use of electrospray ionization, collision-induced dissociation and tandem mass spectrometry at high mass resolution has been applied to an investigation of the structural characterization of protonated and deprotonated kaempferol (3,5,7,4'-tetrahydroxyflavone). Low-energy product ion mass spectra of [M+H]+ ions showed simple fragmentations of the C ring that permitted characterization of the substituents in the A and B rings. In addition, four rearrangement reactions accompanied by losses of C2H2O, CHO[radical sign], CO, and H2O were observed. Low-energy product ion mass spectra of [M-H]- ions showed only four rearrangement reactions accompanied by losses of OH[radical sign], CO, CH2O, and C2H2O. The use of elevated cone voltages permitted observation of product ion mass spectra of selected primary and secondary fragment ions so that each fragment ion reported was observed as a direct product of its immediate precursor ion. Product ion mass spectra examined at high mass resolution allowed unambiguous determination of the elemental composition of fragment ions and resolution of two pairs of isobars. Fragmentation mechanisms and ion structures have been proposed.

  17. The application of continuous wavelet transform and least squares support vector machine for the simultaneous quantitative spectrophotometric determination of Myricetin, Kaempferol and Quercetin as flavonoids in pharmaceutical plants.

    PubMed

    Sohrabi, Mahmoud Reza; Darabi, Golnaz

    2016-01-01

    Flavonoids are γ-benzopyrone derivatives, which are highly regarded in these researchers for their antioxidant property. In this study, two new signals processing methods been coupled with UV spectroscopy for spectral resolution and simultaneous quantitative determination of Myricetin, Kaempferol and Quercetin as flavonoids in Laurel, St. John's Wort and Green Tea without the need for any previous separation procedure. The developed methods are continuous wavelet transform (CWT) and least squares support vector machine (LS-SVM) methods integrated with UV spectroscopy individually. Different wavelet families were tested by CWT method and finally the Daubechies wavelet family (Db4) for Myricetin and the Gaussian wavelet families for Kaempferol (Gaus3) and Quercetin (Gaus7) were selected and applied for simultaneous analysis under the optimal conditions. The LS-SVM was applied to build the flavonoids prediction model based on absorption spectra. The root mean square errors for prediction (RMSEP) of Myricetin, Kaempferol and Quercetin were 0.0552, 0.0275 and 0.0374, respectively. The developed methods were validated by the analysis of the various synthetic mixtures associated with a well- known flavonoid contents. Mean recovery values of Myricetin, Kaempferol and Quercetin, in CWT method were 100.123, 100.253, 100.439 and in LS-SVM method were 99.94, 99.81 and 99.682, respectively. The results achieved by analyzing the real samples from the CWT and LS-SVM methods were compared to the HPLC reference method and the results were very close to the reference method. Meanwhile, the obtained results of the one-way ANOVA (analysis of variance) test revealed that there was no significant difference between the suggested methods. PMID:26241831

  18. The application of continuous wavelet transform and least squares support vector machine for the simultaneous quantitative spectrophotometric determination of Myricetin, Kaempferol and Quercetin as flavonoids in pharmaceutical plants

    NASA Astrophysics Data System (ADS)

    Sohrabi, Mahmoud Reza; Darabi, Golnaz

    2016-01-01

    Flavonoids are γ-benzopyrone derivatives, which are highly regarded in these researchers for their antioxidant property. In this study, two new signals processing methods been coupled with UV spectroscopy for spectral resolution and simultaneous quantitative determination of Myricetin, Kaempferol and Quercetin as flavonoids in Laurel, St. John's Wort and Green Tea without the need for any previous separation procedure. The developed methods are continuous wavelet transform (CWT) and least squares support vector machine (LS-SVM) methods integrated with UV spectroscopy individually. Different wavelet families were tested by CWT method and finally the Daubechies wavelet family (Db4) for Myricetin and the Gaussian wavelet families for Kaempferol (Gaus3) and Quercetin (Gaus7) were selected and applied for simultaneous analysis under the optimal conditions. The LS-SVM was applied to build the flavonoids prediction model based on absorption spectra. The root mean square errors for prediction (RMSEP) of Myricetin, Kaempferol and Quercetin were 0.0552, 0.0275 and 0.0374, respectively. The developed methods were validated by the analysis of the various synthetic mixtures associated with a well- known flavonoid contents. Mean recovery values of Myricetin, Kaempferol and Quercetin, in CWT method were 100.123, 100.253, 100.439 and in LS-SVM method were 99.94, 99.81 and 99.682, respectively. The results achieved by analyzing the real samples from the CWT and LS-SVM methods were compared to the HPLC reference method and the results were very close to the reference method. Meanwhile, the obtained results of the one-way ANOVA (analysis of variance) test revealed that there was no significant difference between the suggested methods.

  19. Soy Leaf Extract Containing Kaempferol Glycosides and Pheophorbides Improves Glucose Homeostasis by Enhancing Pancreatic β-Cell Function and Suppressing Hepatic Lipid Accumulation in db/db Mice.

    PubMed

    Li, Hua; Ji, Hyeon-Seon; Kang, Ji-Hyun; Shin, Dong-Ha; Park, Ho-Yong; Choi, Myung-Sook; Lee, Chul-Ho; Lee, In-Kyung; Yun, Bong-Sik; Jeong, Tae-Sook

    2015-08-19

    This study investigated the molecular mechanisms underlying the antidiabetic effect of an ethanol extract of soy leaves (ESL) in db/db mice. Control groups (db/+ and db/db) were fed a normal diet (ND), whereas the db/db-ESL group was fed ND with 1% ESL for 8 weeks. Dietary ESL improved glucose tolerance and lowered plasma glucose, glycated hemoglobin, HOMA-IR, and triglyceride levels. The pancreatic insulin content of the db/db-ESL group was significantly greater than that of the db/db group. ESL supplementation altered pancreatic IRS1, IRS2, Pdx1, Ngn3, Pax4, Ins1, Ins2, and FoxO1 expression. Furthermore, ESL suppressed lipid accumulation and increased glucokinase activity in the liver. ESL primarily contained kaempferol glycosides and pheophorbides. Kaempferol, an aglycone of kaempferol glycosides, improved β-cell proliferation through IRS2-related FoxO1 signaling, whereas pheophorbide a, a product of chlorophyll breakdown, improved insulin secretion and β-cell proliferation through IRS1-related signaling with protein kinase A in MIN6 cells. ESL effectively regulates glucose homeostasis by enhancing IRS-mediated β-cell insulin signaling and suppressing SREBP-1-mediated hepatic lipid accumulation in db/db mice. PMID:26211813

  20. Protective Effects of Kaempferol against Myocardial Ischemia/Reperfusion Injury in Isolated Rat Heart via Antioxidant Activity and Inhibition of Glycogen Synthase Kinase-3β

    PubMed Central

    Zhou, Mingjie; Ren, Huanhuan; Han, Jichun; Wang, Wenjuan; Zheng, Qiusheng; Wang, Dong

    2015-01-01

    Objective. This study aimed to evaluate the protective effect of kaempferol against myocardial ischemia/reperfusion (I/R) injury in rats. Method. Left ventricular developed pressure (LVDP) and its maximum up/down rate (±dp/dtmax) were recorded as myocardial function. Infarct size was detected with 2,3,5-triphenyltetrazolium chloride staining. Cardiomyocyte apoptosis was determined using terminal deoxynucleotidyl nick-end labeling (TUNEL). The levels of creatine kinase (CK), lactate dehydrogenase (LDH), malondialdehyde (MDA), superoxide dismutase (SOD), glutathione/glutathione disulfide (GSH/GSSG) ratio, and tumor necrosis factor-alpha (TNF-α) were determined using enzyme linked immunosorbent assay (ELISA). Moreover, total glycogen synthase kinase-3β (GSK-3β), phospho-GSK-3β (P-GSK-3β), precaspase-3, cleaved caspase-3, and cytoplasm cytochrome C were assayed using Western blot analysis. Results. Pretreatment with kaempferol significantly improved the recovery of LVDP and ±dp/dtmax, as well as increased the levels of SOD and P-GSK-3β and GSH/GSSG ratio. However, the pretreatment reduced myocardial infarct size and TUNEL-positive cell rate, as well as decreased the levels of cleaved caspase-3, cytoplasm cytochrome C, CK, LDH, MDA, and TNF-α. Conclusion. These results suggested that kaempferol provides cardioprotection via antioxidant activity and inhibition of GSK-3β activity in rats with I/R. PMID:26265983

  1. Effect of edible oils on quercetin, kaempferol and galangin transport and conjugation in the intestinal Caco-2/HT29-MTX co-culture model.

    PubMed

    Jailani, Fadhilah; Williamson, Gary

    2014-04-01

    Solubility and matrix play an important role in the gut lumen in delivering bioactive compounds to the absorptive surface of enterocytes. The purpose of this study was to determine the effect of certain commonly consumed lipids, soybean, olive and corn oil, on the transport and conjugation of flavonols (myricetin, quercetin, kaempferol and galangin) using the conjugation-competent co-cultured Caco-2/HT29-MTX intestinal cell monolayer model. To enable identification and quantification of conjugates, each flavonol was enzymatically glucuronidated or sulphated, then analysed by HPLC with triple quadrupole mass spectrometric detection. Quantification showed large differences in mass spectrometric peak area response factors between the aglycones and many of the conjugates, with galangin-sulphate for example ionising ∼15-fold better than galangin. Flavonol aglycones and conjugates were transported to the basolateral side of Caco-2/HT29-MTX co-cultures. The total amount of methyl, sulphate and glucuronide conjugates was in the order: galangin > quercetin > kaempferol > myricetin. All oils inhibited the transport and conjugation of galangin, the most hydrophobic flavonol, whereas they increased the sulphation, and to some extent glucuronidation, of quercetin and kaempferol. The results show that the lipid matrix has the potential to modify both transport and conjugation of dietary flavonols, but that the effect depends upon the structure and hydrophobicity. PMID:24525490

  2. Incorporation effect of nanosized perovskite LaFe₀.₇Co₀.₃O₃ on the electrochemical activity of Pt nanoparticles-multi walled carbon nanotube composite toward methanol oxidation

    SciTech Connect

    Noroozifar, Meissam; Khorasani-Motlagh, Mozhgan; Khaleghian-Moghadam, Roghayeh; Ekrami-Kakhki, Mehri-Saddat; Shahraki, Mohammad

    2013-05-01

    Nanosized perovskite LaFe₀.₇Co₀.₃O₃ (LFCO) is synthesized through conventional co-precipitation method and characterized by X-ray powder diffraction (XRD), scanning electron microscopy (SEM) and energy dispersive X-ray (EDX) techniques. The incorporation effect of the mentioned perovskite to catalytic activity of the PtNPs-MWCNTs-nafion (or -chitosan) catalyst toward methanol oxidation has been studied by cyclic voltammetry. Based on the electrochemical studies, all MWCNTs-PtNPs-nafion (or chitosan) and MWCNTs-PtNPs-LFCO-nafion (or chitosan) catalysts show a considerable activity for methanol oxidation. However, a synergistic effect is observed when LFCO is added to the catalyst by decreasing the poisoning rate of the Pt catalyst. - Graphical abstract: Nanosized perovskite LaFe₀.₇Co₀.₃O₃ is synthesized and characterized. The incorporation effect of the mentioned perovskite to catalytic activity of the PtNPS-MWCNTs-nafion (or -chitosan) catalyst toward methanol oxidation is studied. Highlights: • Nanocrystalline LaFe₀.₇Co₀.₃O₃ (LFCO) is prepared by a new simple co-precipitation method. • Effect of LFCO to catalytic activity of PtNPS for methanol oxidation is studied. • A synergistic effect is observed when LFCO is added to the Pt catalyst. • Oxygen of LFCO could be considered as active oxygen to remove CO intermediates.

  3. Kaempferol Suppresses Transforming Growth Factor-β1–Induced Epithelial-to-Mesenchymal Transition and Migration of A549 Lung Cancer Cells by Inhibiting Akt1-Mediated Phosphorylation of Smad3 at Threonine-1791

    PubMed Central

    Jo, Eunji; Park, Seong Ji; Choi, Yu Sun; Jeon, Woo-Kwang; Kim, Byung-Chul

    2015-01-01

    Kaempferol, a natural dietary flavonoid, is well known to possess chemopreventive and therapeutic anticancer efficacy; however, its antimetastatic effects have not been mechanistically studied so far in any cancer model. This study was aimed to investigate the inhibitory effect and accompanying mechanisms of kaempferol on epithelial-to-mesenchymal transition (EMT) and cell migration induced by transforming growth factor-β1 (TGF-β1). In human A549 non–small lung cancer cells, kaempferol strongly blocked the enhancement of cell migration by TGF-β1–induced EMT through recovering the loss of E-cadherin and suppressing the induction of mesenchymal markers as well as the upregulation of TGF-β1–mediated matrix metalloproteinase-2 activity. Interestingly, kaempferol reversed TGF-β1–mediated Snail induction and E-cadherin repression by weakening Smad3 binding to the Snail promoter without affecting its C-terminus phosphorylation, complex formation with Smad4, and nuclear translocation under TGF-β1 stimulation. Mechanism study revealed that the phosphorylation of Smad3 linker region induced by TGF-β1 was required for the induction of EMT and cell migration, and selective downregulation of the phosphorylation of Smad3 at Thr179 residue (not Ser204, Ser208, and Ser213) in the linker region was responsible for the inhibition by kaempferol of TGF-β1–induced EMT and cell migration. Furthermore, Akt1 was required for TGF-β1–mediated induction of EMT and cell migration and directly phosphorylated Smad3 at Thr179, and kaempferol completely abolished TGF-β1–induced Akt1 phosphorylation. In summary, kaempferol blocks TGF-β1–induced EMT and migration of lung cancer cells by inhibiting Akt1-mediated phosphorylation of Smad3 at Thr179 residue, providing the first evidence of a molecular mechanism for the anticancer effect of kaempferol. PMID:26297431

  4. Kaempferol Suppresses Transforming Growth Factor-β1-Induced Epithelial-to-Mesenchymal Transition and Migration of A549 Lung Cancer Cells by Inhibiting Akt1-Mediated Phosphorylation of Smad3 at Threonine-179.

    PubMed

    Jo, Eunji; Park, Seong Ji; Choi, Yu Sun; Jeon, Woo-Kwang; Kim, Byung-Chul

    2015-07-01

    Kaempferol, a natural dietary flavonoid, is well known to possess chemopreventive and therapeutic anticancer efficacy; however, its antimetastatic effects have not been mechanistically studied so far in any cancer model. This study was aimed to investigate the inhibitory effect and accompanying mechanisms of kaempferol on epithelial-to-mesenchymal transition (EMT) and cell migration induced by transforming growth factor-β1 (TGF-β1). In human A549 non-small lung cancer cells, kaempferol strongly blocked the enhancement of cell migration by TGF-β1-induced EMT through recovering the loss of E-cadherin and suppressing the induction of mesenchymal markers as well as the upregulation of TGF-β1-mediated matrix metalloproteinase-2 activity. Interestingly, kaempferol reversed TGF-β1-mediated Snail induction and E-cadherin repression by weakening Smad3 binding to the Snail promoter without affecting its C-terminus phosphorylation, complex formation with Smad4, and nuclear translocation under TGF-β1 stimulation. Mechanism study revealed that the phosphorylation of Smad3 linker region induced by TGF-β1 was required for the induction of EMT and cell migration, and selective downregulation of the phosphorylation of Smad3 at Thr179 residue (not Ser204, Ser208, and Ser213) in the linker region was responsible for the inhibition by kaempferol of TGF-β1-induced EMT and cell migration. Furthermore, Akt1 was required for TGF-β1-mediated induction of EMT and cell migration and directly phosphorylated Smad3 at Thr179, and kaempferol completely abolished TGF-β1-induced Akt1 phosphorylation. In summary, kaempferol blocks TGF-β1-induced EMT and migration of lung cancer cells by inhibiting Akt1-mediated phosphorylation of Smad3 at Thr179 residue, providing the first evidence of a molecular mechanism for the anticancer effect of kaempferol. PMID:26297431

  5. A facile one-pot self-assembly approach to incorporate SnOx nanoparticles in ordered mesoporous carbon with soft templating for fuel cells

    NASA Astrophysics Data System (ADS)

    Huang, Yingqiang; Zhai, Zhicheng; Luo, Zhigang; Liu, Yingju; Liang, Zhurong; Fang, Yueping

    2014-04-01

    Unique SnOx (x = 1,2)/ordered mesoporous carbon nanocomposites (denoted as SnOx/OMC) are firstly synthesized through a ‘one-pot’ synthesis together with the soft template self-assembly approach. The obtained SnOx/OMC nanocomposites with various SnOx contents exhibit uniform pore sizes between 3.9 and 4.2 nm, high specific surface areas between 497 and 595 m2 g-1, and high pore volumes between 0.39 and 0.48 cm3 g-1. With loading of Pt, Pt-SnOx/OMC with relatively low SnOx content exhibits superior electrocatalytic performance, long-term durability, and resistance to CO poisoning for methanol oxidation, as compared to Pt/OMC, PtRu/C and Pt-SnOx/C, which may be attributed not only to the synergetic effect of embedded SnOx, but also to the highly ordered mesostructure with high specific surface areas and large pore volumes affording plenty of surface area for support of Pt nanoparticles. This work supplies an efficient way to synthesize novel ordered mesoporous carbon self-supported metallic oxide as catalyst support and its further potential application to reduce the cost of catalysts in direct methanol fuel cells.

  6. Preparation of a novel positively charged nanofiltration composite membrane incorporated with silver nanoparticles for pharmaceuticals and personal care product rejection and antibacterial properties.

    PubMed

    Huang, Zhong-Hua; Yin, Yan-Na; Aikebaier, Gu-Li-Mi-la; Zhang, Yan

    2016-01-01

    A novel positively charged N-[(2-hydroxy-3-trimethylammonium)propyl] chloride chitosan (HTCC)-Ag/polyethersulfone (PES) composite nanofiltration membrane was easily prepared by coating the active layer, HTCC, onto PES as the support through epichlorohydrin as the cross-linking reagent and nano-Ag particles as the introduced inorganic components. Scanning election microscopy, X-ray photoelectron spectroscopy, atomic force microscopy, and X-ray diffraction were employed to characterize the morphology of the resultant membranes, of which the molecular weight cut-off was about 941 Da. At 25 °C, the pure water permeability is 16.27 L/h·m(2)·MPa. Our results showed that the rejection of pharmaceuticals and personal care products (PPCPs) followed the sequence: atenolol > carbamazepine > ibuprofen, confirming that the membranes were positively charged. The antibacterial properties of the membranes were compared to elucidate the existence of Ag nanoparticles which help to improve antibacterial activity against Gram-negative Escherichia coli (DH5α, Rosetta) and Gram-positive Bacillus subtilis. The inhibition zone diameters of HTCC-Ag/PES membranes towards E. coli DH5α, E. coli Rosetta and Bacillus subtilis were 17.77, 16.18, and 15.44 mm, respectively. It was found that HTCC-Ag/PES membrane has a better antibacterial activity against E. coli than against Bacillus subtilis, especially for E. coli DH5α. PMID:27120646

  7. Improved performance of CdS/CdSe quantum dots sensitized solar cell by incorporation of ZnO nanoparticles/reduced graphene oxide nanocomposite as photoelectrode

    NASA Astrophysics Data System (ADS)

    Ghoreishi, F. S.; Ahmadi, V.; Samadpour, M.

    2014-12-01

    Here we present novel quantum dot sensitized solar cells (QDSSC) based on ZnO nanoparticles (NPs)/reduced graphene oxide (RGO) nanocomposite photoanodes for better light harvesting and energy conversion. Photoelectrodes are prepared by doctor blading ZnO NPs/GO nanocomposite paste on a fluorine doped tin oxide substrate which are then sintered at 450 °C to obtain ZnO NPs/RGO nanocomposites. The partial reduction of GO after thermal reduction, is studied by Fourier transform infrared and Raman spectroscopies. Cadmium sulfide (CdS) and cadmium selenide (CdSe) quantum dots are deposited on the films through successive ionic layer adsorption and reaction and chemical bath deposition methods, respectively. The unique properties of ZnO NPs/RGO photoanodes, lead to a significant enhancement in the photovoltaic properties of solar cells in comparison with bare ZnO photoanodes. Current-voltage characteristics of cells are studied and the best results are obtained from ZnO NPs-RGO/CdS/CdSe with photoelectric conversion efficiency of 2.20% which is almost two times higher than cells which are made by pure ZnO NPs as photoanode (1.28%). Electrochemical impedance measurements show that the enhancement can be attributed to the increase of electron transfer rate in the ZnO NPs/RGO nanocomposite photoanode which arises from the ultrahigh electron mobility in graphene (RGO) sheets.

  8. Site-specific incorporation of three toll-like receptor 2 targeting adjuvants into semisynthetic, molecularly defined nanoparticles: application to group a streptococcal vaccines.

    PubMed

    Moyle, Peter M; Dai, Wei; Zhang, Yingkai; Batzloff, Michael R; Good, Michael F; Toth, Istvan

    2014-05-21

    Subunit vaccines offer a means to produce safer, more defined vaccines compared to traditional whole microorganism approaches. Subunit antigens, however, exhibit weak immunity, which is normally overcome through coadministration with adjuvants. Enhanced vaccine properties (e.g., improved potency) can be obtained by linking antigen and adjuvant, as observed for synthetic peptide antigens and Toll-like receptor 2 (TLR2) ligands. As few protective peptide antigens have been reported, compared to protein antigens, we sought to extend the utility of this approach to recombinant proteins, while ensuring that conjugation reactions yielded a single, molecularly defined product. Herein we describe the development and optimization of techniques that enable the efficient, site-specific attachment of three synthetic TLR2 ligands (lipid core peptide (LCP), Pam2Cys, and Pam3Cys) onto engineered protein antigens, permitting the selection of optimal TLR2 agonists during the vaccine development process. Using this approach, broadly protective (J14) and population targeted (seven M protein N-terminal antigens) multiantigenic vaccines against group A streptococcus (GAS; Streptococcus pyogenes) were produced and observed to self-assemble in PBS to yield nanoparticules (69, 101, and 123 nm, respectively). All nanoparticle formulations exhibited self-adjuvanting properties, with rapid, persistent, antigen-specific IgG antibody responses elicited toward each antigen in subcutaneously immunized C57BL/6J mice. These antibodies were demonstrated to strongly bind to the cell surface of five GAS serotypes that are not represented by vaccine M protein N-terminal antigens, are among the top 20 circulating strains in developed countries, and are associated with clinical disease, suggesting that these vaccines may elicit broadly protective immune responses. PMID:24712905

  9. Treatment with kaempferol suppresses breast cancer cell growth caused by estrogen and triclosan in cellular and xenograft breast cancer models.

    PubMed

    Kim, Seung-Hee; Hwang, Kyung-A; Choi, Kyung-Chul

    2016-02-01

    As a phytoestrogen, kaempferol (Kaem) is one of bioflavonoids, which are found in a variety of vegetables including broccoli, tea and tomato. In this study, the antiproliferative effects of Kaem in triclosn (TCS)-induced cell growth were examined in MCF-7 breast cancer cells. TCS promoted the cell viability of MCF-7 cells via estrogen receptor α (ERα) as did 17β-estradiol (E2), a positive control. On the other hand, Kaem significantly suppressed E2 or TCS-induced cell growth. To elucidate the molecular mechanisms of TCS and Kaem, alterations in the expressions of cell cycle, apoptosis and metastasis-related genes were identified using western blot assay. The treatment of the cells with TCS up-regulated the protein expressions of cyclin D1, cyclin E and cathepsin D, while down-regulated p21 and bax expressions. Kaem reversed TCS-induced gene expressions in an opposite manner. The phosphorylation of IRS-1, AKT, MEK1/2 and ERK was increased by TCS, indicating that TCS induced MCF-7 cell proliferation via nongenomic ER signaling pathway associated with IGF-1R. Kaem presented an antagonistic activity on this signaling by down-regulating the protein expression of pIRS-1, pAkt and pMEK1/2 promoted by E2 or TCS. In an in vivo xenografted mouse model, tumor growth was induced by treatment with E2 or TCS, which was identified in the measurement of tumor volume, hematoxylin and eosin staining, bromodeoxyuridine and immunohistochemistry assay. On the contrary, E2 or TCS-induced breast tumor growth was inhibited by co-treatment with Kaem, which is consistent with in vitro results. Taken together, these results revealed that Kaem has an anticancer effect against procancer activity of E2 or TCS, a xenoestrogen, in breast cancer and may be suggested as a prominent agent to neutralize breast cancer risk caused by TCS. PMID:26878784

  10. Effect of Ginkgo biloba extract on procarcinogen-bioactivating human CYP1 enzymes: Identification of isorhamnetin, kaempferol, and quercetin as potent inhibitors of CYP1B1

    SciTech Connect

    Chang, Thomas K.H. . E-mail: tchang@interchange.ubc.ca; Chen Jie; Yeung, Eugene Y.H.

    2006-05-15

    In the present study, we investigated the effect of Ginkgo biloba extracts and some of its individual constituents on the catalytic activity of human cytochrome P450 enzymes CYP1B1, CYP1A1, and CYP1A2. G. biloba extract of known abundance of terpene trilactones and flavonol glycosides inhibited 7-ethoxyresorufin O-dealkylation catalyzed by human recombinant CYP1B1, CYP1A1, and CYP1A2, and human liver microsomes, with apparent K {sub i} values of 2 {+-} 0.3, 5 {+-} 0.5, 16 {+-} 1.4, and 39 {+-} 1.2 {mu}g/ml (mean {+-} SE), respectively. In each case, the mode of inhibition was of the mixed type. Bilobalide, ginkgolides A, B, C, and J, quercetin 3-O-rutinoside, kaempferol 3-O-rutinoside, and isorhamentin 3-O-rutinoside were not responsible for the inhibition of CYP1 enzymes by G. biloba extract, as determined by experiments with these individual chemicals at the levels present in the extract. In contrast, the aglycones of quercetin, kaempferol, and isorhamentin inhibited CYP1B1, CYP1A1, and CYP1A2. Among the three flavonol aglycones, isorhamentin was the most potent in inhibiting CYP1B1 (apparent K {sub i} = 3 {+-} 0.1 nM), whereas quercetin was the least potent in inhibiting CYP1A2 (apparent K {sub i} 418 {+-} 50 nM). The mode of inhibition was competitive, noncompetitive, or mixed, depending on the enzyme and the flavonol. G. biloba extract also reduced benzo[a]pyrene hydroxylation, and the effect was greater with CYP1B1 than with CYP1A1 as the catalyst. Overall, our novel findings indicate that G. biloba extract and the flavonol aglycones isorhamnetin, kaempferol, and quercetin preferentially inhibit the in vitro catalytic activity of human CYP1B1.

  11. The anti-obesity and anti-diabetic effects of kaempferol glycosides from unripe soybean leaves in high-fat-diet mice.

    PubMed

    Zang, Yanqing; Zhang, Liping; Igarashi, Kiharu; Yu, Changqing

    2015-03-01

    The present study investigated the anti-obesity and anti-diabetic effects of kaempferol glycoside (KG) fractions which were composed of four kaempferol glycosides and purified from unripe Jindai-soybean (Edamame) leaves in C57BL/6J mice. High fat-fed mice treated with 0.15% dietary KG for 92 days had reduced body weight, adipose tissue and TG levels compared to the high fat-fed control group. KG-treatment also decreased fasting blood glucose, serum HbA1c (hemoglobin A(1c)) levels and improved insulin resistance. Gene expression analysis of the liver showed that KG decreased peroxisome proliferator-activated receptor (PPAR-γ) and sterol regulatory element-binding protein (SREBP-1c) expression. These results suggest that KG reduced the accumulation of adipose tissue, improving hyperlipidemia as well as diabetes in obese mice by increasing lipid metabolism through the downregulation of PPAR-γ and SREBP-1c. Thus, KG may have an anti-obesity and anti-diabetic potential. PMID:25599885

  12. Lilium compounds kaempferol and jatropham can modulate cytotoxic and genotoxic effects of radiomimetic zeocin in plants and human lymphocytes In vitro.

    PubMed

    Jovtchev, Gabriele; Gateva, Svetla; Stankov, Alexander

    2016-06-01

    Organisms are constantly exposed to the detrimental effect of environmental DNA-damaging agents. The harmful effects of environmental genotoxins could be decreased in a viable way by antimutagenesis. One of the modern approaches to reduce the mutagenic burden is based on exogenous natural and synthetic compounds that possess protective and antimutagenic potential against genotoxins. The natural compounds kaempferol and jatropham isolated from Lilium candidum were tested with respect to their potential to protect cells against the radiomimetic zeocin, as well as to their cytotoxic and genotoxic activities in two types of experimental eukaryotic test systems: Hordeum vulgare and human lymphocytes in vitro. Mitotic index (MI) was used as an endpoint for cytotoxicity; the frequency of chromosome aberrations (MwA) and the number of induced micronuclei (MN), as endpoints for genotoxicity/clastogenicity. Formation of aberration "hot spots" was also used as an indicator for genotoxicity in H. vulgare. Both kaempferol and jatropham were shown to possess a potential to modulate and decrease the cytotoxic and genotoxic/clastogenic effect of zeocin depending on the experimental design and the test system. Our data could be useful for health research programs, particularly in clarifying the pharmacological potential and activity of natural plant compounds. © 2014 Wiley Periodicals, Inc. Environ Toxicol 31: 751-764, 2016. PMID:25504804

  13. Silver Nanoparticles in Dental Biomaterials

    PubMed Central

    Corrêa, Juliana Mattos; Mori, Matsuyoshi; Sanches, Heloísa Lajas; da Cruz, Adriana Dibo; Poiate, Isis Andréa Venturini Pola

    2015-01-01

    Silver has been used in medicine for centuries because of its antimicrobial properties. More recently, silver nanoparticles have been synthesized and incorporated into several biomaterials, since their small size provides great antimicrobial effect, at low filler level. Hence, these nanoparticles have been applied in dentistry, in order to prevent or reduce biofilm formation over dental materials surfaces. This review aims to discuss the current progress in this field, highlighting aspects regarding silver nanoparticles incorporation, such as antimicrobial potential, mechanical properties, cytotoxicity, and long-term effectiveness. We also emphasize the need for more studies to determine the optimal concentration of silver nanoparticle and its release over time. PMID:25667594

  14. Characterization of a Glucosyltransferase Enzyme Involved in the Formation of Kaempferol and Quercetin Sophorosides in Crocus sativus1[C][W

    PubMed Central

    Trapero, Almudena; Ahrazem, Oussama; Rubio-Moraga, Angela; Jimeno, Maria Luisa; Gómez, Maria Dolores; Gómez-Gómez, Lourdes

    2012-01-01

    UGT707B1 is a new glucosyltransferase isolated from saffron (Crocus sativus) that localizes to the cytoplasm and the nucleus of stigma and tepal cells. UGT707B1 transcripts were detected in the stigma tissue of all the Crocus species analyzed, but expression analysis of UGT707B1 in tepals revealed its absence in certain species. The analysis of the glucosylated flavonoids present in Crocus tepals reveals the presence of two major flavonoid compounds in saffron: kaempferol-3-O-β-d-glucopyranosyl-(1-2)-β-d-glucopyranoside and quercetin-3-O-β-d-glucopyranosyl-(1-2)-β-d-glucopyranoside, both of which were absent from the tepals of those Crocus species that did not express UGT707B1. Transgenic Arabidopsis (Arabidopsis thaliana) plants constitutively expressing UGT707B1 under the control of the cauliflower mosaic virus 35S promoter have been constructed and their phenotype analyzed. The transgenic lines displayed a number of changes that resembled those described previously in lines where flavonoid levels had been altered. The plants showed hyponastic leaves, a reduced number of trichomes, thicker stems, and flowering delay. Levels of flavonoids measured in extracts of the transgenic plants showed changes in the composition of flavonols when compared with wild-type plants. The major differences were observed in the extracts from stems and flowers, with an increase in 3-sophoroside flavonol glucosides. Furthermore, a new compound not detected in ecotype Columbia wild-type plants was detected in all the tissues and identified as kaempferol-3-O-sophoroside-7-O-rhamnoside. These data reveal the involvement of UGT707B1 in the biosynthesis of flavonol-3-O-sophorosides and how significant changes in flavonoid homeostasis can be caused by the overproduction of a flavonoid-conjugating enzyme. PMID:22649274

  15. Neuroprotective Effect of Kaempferol Glycosides against Brain Injury and Neuroinflammation by Inhibiting the Activation of NF-?B and STAT3 in Transient Focal Stroke

    PubMed Central

    Wang, Liang-Fen; Kuang, Xi; Liu, Ke; Zhang, Hao; Du, Jun-Rong

    2013-01-01

    Background Ischemic brain injury is associated with neuroinflammatory response, which essentially involves glial activation and neutrophil infiltration. Transcription factors nuclear factor-?B (NF-?B) and signal transducer and activator of transcription 3 (STAT3) contribute to ischemic neuroinflammatory processes and secondary brain injury by releasing proinflammatory mediators. Kaempferol-3-O-rutinoside (KRS) and kaempferol-3-O- glucoside (KGS) are primary flavonoids found in Carthamus tinctorius L. Recent studies demonstrated that KRS protected against ischemic brain injury. However, little is known about the underlying mechanisms. Flavonoids have been reported to have antiinflammatory properties. Herein, we explored the effects of KRS and KGS in a transient focal stroke model. Methodology/Principal Findings Rats were subjected to middle cerebral artery occlusion for 2 hours followed by 22 h reperfusion. An equimolar dose of KRS or KGS was administered i.v. at the beginning of reperfusion. The results showed that KRS or KGS significantly attenuated the neurological deficits, brain infarct volume, and neuron and axon injury, reflected by the upregulation of neuronal nuclear antigen-positive neurons and downregulation of amyloid precursor protein immunoreactivity in the ipsilateral ischemic hemisphere. Moreover, KRS and KGS inhibited the expression of OX-42, glial fibrillary acidic protein, phosphorylated STAT3 and NF-?B p65, and the nuclear content of NF-?B p65. Subsequently, these flavonoids inhibited the expression of tumor necrosis factor ?, interleukin 1?, intercellular adhesion molecule 1, matrix metallopeptidase 9, inducible nitric oxide synthase, and myeloperoxidase. Conclusion/Significance Our findings suggest that postischemic treatment with KRS or KGS prevents ischemic brain injury and neuroinflammation by inhibition of STAT3 and NF-?B activation and has the therapeutic potential for the neuroinflammation-related diseases, such as ischemic stroke. PMID:23437066

  16. Kaempferol Activates G2-Checkpoint of the Cell Cycle Resulting in G2-Arrest and Mitochondria-Dependent Apoptosis in Human Acute Leukemia Jurkat T Cells.

    PubMed

    Kim, Ki Yun; Jang, Won Young; Lee, Ji Young; Jun, Do Youn; Ko, Jee Youn; Yun, Young Ho; Kim, Young Ho

    2016-02-28

    The effect of kaempferol (3,5,7,4-tetrahydroxyflavone), a flavonoid compound that was identified in barnyard millet (Echinochloa crus-galli var. frumentacea) grains, on G2-checkpoint and apoptotic pathways was investigated in human acute leukemia Jurkat T cell clones stably transfected with an empty vector (J/Neo) or a Bcl-xL expression vector (J/Bcl-xL). Exposure of J/Neo cells to kaempeferol caused cytotoxicity and activation of the ATM/ATR-Chk1/Chk2 pathway, activating the phosphorylation of p53 (Ser-15), inhibitory phosphorylation of Cdc25C (Ser-216), and inactivation of cyclin-dependent kinase 1 (Cdk1), with resultant G2- arrest of the cell cycle. Under these conditions, apoptotic events, including upregulation of Bak and PUMA levels, Bak activation, mitochondrial membrane potential (Δψm) loss, activation of caspase-9, -8, and -3, anti-poly (ADP-ribose) polymerase (PARP) cleavage, and accumulation of apoptotic sub-G1 cells, were induced without accompanying necrosis. However, these apoptotic events, except for upregulation of Bak and PUMA levels, were completely abrogated in J/Bcl-xL cells overexpressing Bcl-xL, suggesting that the G2-arrest and the Bcl-xL-sensitive mitochondrial apoptotic events were induced, in parallel, as downstream events of the DNA-damage-mediated G2-checkpoint activation. Together these results demonstrate that kaempferol-mediated antitumor activity toward Jurkat T cells was attributable to G2-checkpoint activation, which caused not only G2-arrest of the cell cycle but also activating phosphorylation of p53 (Ser-15) and subsequent induction of mitochondriadependent apoptotic events, including Bak and PUMA upregulation, Bak activation, Δpsim loss, and caspase cascade activation. PMID:26699757

  17. Antiplasmodial properties of kaempferol-3-O-rhamnoside isolated from the leaves of Schima wallichii against chloroquine-resistant Plasmodium falciparum

    PubMed Central

    BARLIANA, MELISA I.; SURADJI, EKA W.; ABDULAH, RIZKY; DIANTINI, AJENG; HATABU, TOSHIMITSU; NAKAJIMA-SHIMADA, JUNKO; SUBARNAS, ANAS; KOYAMA, HIROSHI

    2014-01-01

    Previous intervention studies have shown that the most effective agents used in the treatment of malaria were isolated from natural sources. Plants consumed by non-human primates serve as potential drug sources for human disease management due to the similarities in anatomy, physiology and disease characteristics. The present study investigated the antiplasmodial properties of the primate-consumed plant, Schima wallichii (S. wallichii) Korth. (family Theaceae), which has already been reported to have several biological activities. The ethanol extract of S. wallichii was fractionated based on polarity using n-hexane, ethyl acetate and water. The antiplasmodial activity was tested in vitro against chloroquine-resistant Plasmodium falciparum (P. falciparum) at 100 μg/ml for 72 h. The major compound of the most active ethyl acetate fraction was subsequently isolated using column chromatography and identified by nuclear magnetic resonance. The characterized compound was also tested against chloroquine-resistant P. falciparum in culture to evaluate its antiplasmodial activity. The ethanol extract of S. wallichii at 100 μg/ml exhibited a significant parasite shrinkage after 24 h of treatment. The ethyl acetate fraction at 100 μg/ml was the most active fraction against chloroquine-resistant P. falciparum. Based on the structural characterization, the major compound isolated from the ethyl acetate fraction was kaempferol-3-O-rhamnoside, which showed promising antiplasmodial activity against chloroquine-resistant P. falciparum with an IC50 of 106 μM after 24 h of treatment. The present study has provided a basis for the further investigation of kaempferol-3-O-rhamnoside as an active compound for potential antimalarial therapeutics. PMID:24944812

  18. A fraction containing kaempferol-3,4'-dimethylether from Larrea divaricata Cav. induces macrophage activation on mice infected with Candida albicans.

    PubMed

    Martino, Renzo; Canale, Fernando; Sülsen, Valeria; Alonso, Rosario; Davicino, Roberto; Mattar, Aida; Anesini, Claudia; Micalizzi, Blas

    2014-06-01

    Larrea divaricata Cav. is a plant growing in South America. Both the infusion and a derived fraction (F1) of L. divaricata have proved to have immunomodulatory properties. Moreover, F1 can activate macrophages obtained from mice infected with Candida albicans. In this work, F1 was administrated to infected animals, and the state and type of activation of resident macrophages were studied. Results showed that F1 was able to activate macrophages obtained from infected mice by both classical and alternative pathways, probably by inducing a translocation of nuclear factor kappa-B. F1 increases not only the lysosomal activity of macrophages but also the production of phagosomal superoxide anion as a consequence of the activation of the Nicotinamide adenine dinucleotide phosphate oxidase (NADPH oxidase) complex. F1 induced an increase in the macrophage capacity to kill the fungus, which was reflected in a decrease in the levels of colonization of organs. A main flavonoid, kaempferol-3,4'-dimethylether, was identified in F1 by HPLC. This compound increased in vitro production of nitric oxide in heat-killed C. albicans-stimulated macrophages. The flavonoid could thus be considered one of the responsible molecules mediating the overall effects of F1 on the immune system in infected animals. PMID:24281902

  19. Electronically cloaked nanoparticles

    NASA Astrophysics Data System (ADS)

    Shen, Wenqing

    The concept of electronic cloaking is to design objects invisible to conduction electrons. The approach of electronic cloaking has been recently suggested to design invisible nanoparticle dopants with electronic scattering cross section smaller than 1% of the physical cross section (pi a2), and therefore to enhance the carrier mobility of bulk materials. The proposed nanoparticles have core-shell structures. The dopants are incorporated inside the core, while the shell layer serves both as a spacer to separate the charge carriers from their parent atoms and as a cloaking shell to minimize the scattering cross section of the electrons from the ionized nanoparticles. Thermoelectric materials are usually highly doped to have enough carrier density. Using invisible dopants could achieve larger thermoelectric power factors by enhancing the electronic mobility. Core-shell nanoparticles show an advantage over one-layer nanoparticles, which are proposed in three-dimensional modulation doping. However designing such nanoparticles is not easy as there are too many parameters to be considered. This thesis first shows an approach to design hollow nanoparticles by applying constrains on variables. In the second part, a simple mapping approach is introduced where one can identify possible core-shell particles by comparing the dimensionless parameters of chosen materials with provided maps. In both parts of this work, several designs with realistic materials were made and proven to achieve electronic cloaking. Improvement in the thermoelectric power factor compared to the traditional impurity doping method was demonstrated in several cases.

  20. Simultaneous Quantification of Syringic Acid and Kaempferol in Extracts of Bergenia Species Using Validated High-Performance Thin-Layer Chromatographic-Densitometric Method.

    PubMed

    Srivastava, Nishi; Srivastava, Amit; Srivastava, Sharad; Rawat, Ajay Kumar Singh; Khan, Abdul Rahman

    2016-03-01

    A rapid, sensitive, selective and robust quantitative densitometric high-performance thin-layer chromatographic method was developed and validated for separation and quantification of syringic acid (SYA) and kaempferol (KML) in the hydrolyzed extracts of Bergenia ciliata and Bergenia stracheyi. The separation was performed on silica gel 60F254 high-performance thin-layer chromatography plates using toluene : ethyl acetate : formic acid (5 : 4: 1, v/v/v) as the mobile phase. The quantification of SYA and KML was carried out using a densitometric reflection/absorption mode at 290 nm. A dense spot of SYA and KML appeared on the developed plate at a retention factor value of 0.61 ± 0.02 and 0.70 ± 0.01. A precise and accurate quantification was performed using linear regression analysis by plotting the peak area vs concentration 100-600 ng/band (correlation coefficient: r = 0.997, regression coefficient: R(2) = 0.996) for SYA and 100-600 ng/band (correlation coefficient: r = 0.995, regression coefficient: R(2) = 0.991) for KML. The developed method was validated in terms of accuracy, recovery and inter- and intraday study as per International Conference on Harmonisation guidelines. The limit of detection and limit of quantification of SYA and KML were determined, respectively, as 91.63, 142.26 and 277.67, 431.09 ng. The statistical data analysis showed that the method is reproducible and selective for the estimation of SYA and KML in extracts of B. ciliata and B. stracheyi. PMID:26543088

  1. Carbon Materials Metal/Metal Oxide Nanoparticle Composite and Battery Anode Composed of the Same

    NASA Technical Reports Server (NTRS)

    Hung, Ching-Cheh (Inventor)

    2006-01-01

    A method of forming a composite material for use as an anode for a lithium-ion battery is disclosed. The steps include selecting a carbon material as a constituent part of the composite, chemically treating the selected carbon material to receive nanoparticles, incorporating nanoparticles into the chemically treated carbon material and removing surface nanoparticles from an outside surface of the carbon material with incorporated nanoparticles. A material making up the nanoparticles alloys with lithium.

  2. Nanoparticles for Imaging: Top or Flop?

    PubMed Central

    Mertens, Marianne E.; Grimm, Jan; Lammers, Twan

    2014-01-01

    Nanoparticles are frequently suggested as diagnostic agents. However, except for iron oxide nanoparticles, diagnostic nanoparticles have been barely incorporated into clinical use so far. This is predominantly due to difficulties in achieving acceptable pharmacokinetic properties and reproducible particle uniformity as well as to concerns about toxicity, biodegradation, and elimination. Reasonable indications for the clinical utilization of nanoparticles should consider their biologic behavior. For example, many nanoparticles are taken up by macrophages and accumulate in macrophage-rich tissues. Thus, they can be used to provide contrast in liver, spleen, lymph nodes, and inflammatory lesions (eg, atherosclerotic plaques). Furthermore, cells can be efficiently labeled with nanoparticles, enabling the localization of implanted (stem) cells and tissue-engineered grafts as well as in vivo migration studies of cells. The potential of using nanoparticles for molecular imaging is compromised because their pharmacokinetic properties are difficult to control. Ideal targets for nanoparticles are localized on the endothelial luminal surface, whereas targeted nanoparticle delivery to extravascular structures is often limited and difficult to separate from an underlying enhanced permeability and retention (EPR) effect. The majority of clinically used nanoparticle-based drug delivery systems are based on the EPR effect, and, for their more personalized use, imaging markers can be incorporated to monitor biodistribution, target site accumulation, drug release, and treatment efficacy. In conclusion, although nanoparticles are not always the right choice for molecular imaging (because smaller or larger molecules might provide more specific information), there are other diagnostic and theranostic applications for which nanoparticles hold substantial clinical potential. PMID:25247562

  3. Fabrication of latex rubber reinforced with micellar nanoparticle as an interface modifier

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Reinforced latex rubbers were fabricated by incorporating small amount of nanoparticles as interface modifier. The rubbers were fabricated in a compression mold at 130°C. The incorporated nanoparticles were prepared from wheat protein (gliadin) and ethyl cyanoacrylate (ECA). These nanoparticles were...

  4. Metal-doped semiconductor nanoparticles and methods of synthesis thereof

    NASA Technical Reports Server (NTRS)

    Ren, Zhifeng (Inventor); Chen, Gang (Inventor); Poudel, Bed (Inventor); Kumar, Shankar (Inventor); Wang, Wenzhong (Inventor); Dresselhaus, Mildred (Inventor)

    2009-01-01

    The present invention generally relates to binary or higher order semiconductor nanoparticles doped with a metallic element, and thermoelectric compositions incorporating such nanoparticles. In one aspect, the present invention provides a thermoelectric composition comprising a plurality of nanoparticles each of which includes an alloy matrix formed of a Group IV element and Group VI element and a metallic dopant distributed within the matrix.

  5. Metal-doped semiconductor nanoparticles and methods of synthesis thereof

    DOEpatents

    Ren, Zhifeng; Chen, Gang; Poudel, Bed; Kumar, Shankar; Wang, Wenzhong; Dresselhaus, Mildred

    2009-09-08

    The present invention generally relates to binary or higher order semiconductor nanoparticles doped with a metallic element, and thermoelectric compositions incorporating such nanoparticles. In one aspect, the present invention provides a thermoelectric composition comprising a plurality of nanoparticles each of which includes an alloy matrix formed of a Group IV element and Group VI element and a metallic dopant distributed within the matrix.

  6. Volume-labeled nanoparticles and methods of preparation

    DOEpatents

    Wang, Wei; Gu, Baohua; Retterer, Scott T; Doktycz, Mitchel J

    2015-04-21

    Compositions comprising nanosized objects (i.e., nanoparticles) in which at least one observable marker, such as a radioisotope or fluorophore, is incorporated within the nanosized object. The nanosized objects include, for example, metal or semi-metal oxide (e.g., silica), quantum dot, noble metal, magnetic metal oxide, organic polymer, metal salt, and core-shell nanoparticles, wherein the label is incorporated within the nanoparticle or selectively in a metal oxide shell of a core-shell nanoparticle. Methods of preparing the volume-labeled nanoparticles are also described.

  7. Hydrogel nanoparticle based immunoassay

    DOEpatents

    Liotta, Lance A; Luchini, Alessandra; Petricoin, Emanuel F; Espina, Virginia

    2015-04-21

    An immunoassay device incorporating porous polymeric capture nanoparticles within either the sample collection vessel or pre-impregnated into a porous substratum within fluid flow path of the analytical device is presented. This incorporation of capture particles within the immunoassay device improves sensitivity while removing the requirement for pre-processing of samples prior to loading the immunoassay device. A preferred embodiment is coreshell bait containing capture nanoparticles which perform three functions in one step, in solution: a) molecular size sieving, b) target analyte sequestration and concentration, and c) protection from degradation. The polymeric matrix of the capture particles may be made of co-polymeric materials having a structural monomer and an affinity monomer, the affinity monomer having properties that attract the analyte to the capture particle. This device is useful for point of care diagnostic assays for biomedical applications and as field deployable assays for environmental, pathogen and chemical or biological threat identification.

  8. A focal adhesion kinase inhibitor 16-hydroxy-cleroda-3,13-dien-16,15-olide incorporated into enteric-coated nanoparticles for controlled anti-glioma drug delivery.

    PubMed

    Thiyagarajan, Varadharajan; Lin, Shi-Xiang; Lee, Chia-Hung; Weng, Ching-Feng

    2016-05-01

    16-Hydroxy-cleroda-3,13-dien-16,15-olide (HCD) which is extracted from a medicinal plant, Polyalthia longifolia, was shown to exhibit anticancer activity through apoptosis and FAK inhibition in our previous study. To improve its solubility and efficacy, a novel HCD delivery system using copper-substituted mesoporous silica nanoparticles (MSNs) was designed as a delivery vehicle, and the outer surfaces of MSNs were further coated with enteric polymers to prevent the drug from leaching in the stomach acid. All the data regarding synthesis and physical characterization, including Zeta potential, FT-IR spectra, N2 adsorption-desorption isotherms (BET), drug loading, powder X-ray diffraction, Thermo gravimetric analysis (TGA), Transmission electron microscopy (TEM), and Scanning electron microscopy (SEM) were well characterized. The non-coated MSN-HCD exposed to acidic pH (1.2) showed a rapid degradation of the drug, whereas the enteric-coated samples presented a sustained release profile in the gastrointestinal pHs. Cell cytotoxicity was further confirmed by the MTT-C6 Glioma cell line, in vitro. When compared with the control and pure HCD, the MSN-HCD revealed a potential anti-proliferation effect via the synergistic effect of the drug and the MSN vehicle. Additionally, this MSN-HCD had the effect of increasing the reactive oxygen species (ROS) levels and altered the Mitochondria membrane potential (MMP) in C6 cell line. The in vivo anti-tumor efficacy of enteric-coated MSN-HCD was evaluated by C6 Glioma bearing xenograft nude mice, and enteric-coated MSN-HCD clearly exhibited the greatest anti-glioma activity, as compared to the pure HCD and the untreated control. In terms of the effective treatment of brain glioma, this study provides conclusive evidence of the successful development of the anti-cancer agent HCD conjugated with enteric-coated MSN as a delivery control mechanism with enhanced dissolution characteristics. PMID:26851441

  9. Boronate affinity nanoparticles for RNA isolation.

    PubMed

    Toprak, Aykut; Görgün, Cansu; Kuru, Cansu İlke; Türkcan, Ceren; Uygun, Murat; Akgöl, Sinan

    2015-05-01

    In this presented paper, boronic acid incorporated poly(HEMA) based nanoparticles were synthesized for RNA adsorption. For this purpose, poly(HEMA) nanoparticles were synthesized by using the surfactant free emulsion polymerization technique. Then, nanoparticles were modified with 3-(2-imidazoline-1-yl)propyl(triethoxysilane) (IMEO) and functionalized with phenylboronic acid (PBA). Prepared nanoparticles were characterized with SEM, FTIR and zeta-size. Optimum RNA adsorption conditions were investigated with different pHs, temperatures and initial RNA concentrations in order to determine the maximum RNA adsorption onto poly(HEMA)-IMEO-PBA nanoparticles. It was also studied that, synthesized nanoparticles could be used for 5 successive reuses and adsorption capacity of the nanoparticles decreased only about 5% at the end of the 5 cycles. PMID:25746268

  10. Modulation of flavonoid metabolites in Arabidopsis thaliana through overexpression of the MYB75 transcription factor: role of kaempferol-3,7-dirhamnoside in resistance to the specialist insect herbivore Pieris brassicae

    PubMed Central

    Dicke, Marcel

    2014-01-01

    Anthocyanins and flavonols are secondary metabolites that can function in plant defence against herbivores. In Arabidopsis thaliana, anthocyanin and flavonol biosynthesis are regulated by MYB transcription factors. Overexpression of MYB75 (oxMYB75) in Arabidopsis results in increasing anthocyanin and flavonol levels which enhances plant resistance to generalist caterpillars. However, how these metabolites affect specialist herbivores has remained unknown. Performance of a specialist aphid (Brevicoryne brassicae) was unaffected after feeding on oxMYB75 plants, whereas a specialist caterpillar (Pieris brassicae) gained significantly higher body mass when feeding on this plant. An increase in anthocyanin and total flavonol glycoside levels correlated negatively with the body mass of caterpillars fed on oxMYB75 plants. However, a significant reduction of kaempferol-3,7-dirhamnoside (KRR) corresponded to an increased susceptibility of oxMYB75 plants to caterpillar feeding. Pieris brassicae caterpillars also grew less on an artificial diet containing KRR or on oxMYB75 plants that were exogenously treated with KRR, supporting KRR’s function in direct defence against this specialist caterpillar. The results show that enhancing the activity of the anthocyanin pathway in oxMYB75 plants results in re-channelling of quercetin/kaempferol metabolites which has a negative effect on the accumulation of KRR, a novel defensive metabolite against a specialist caterpillar. PMID:24619996

  11. Improved barrier and mechanical properties of novel hydroxypropyl methylcellulose edible films with chitosan/tripolyphosphate nanoparticles

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Chitosan/tripolyphosphate nanoparticles were prepared and incorporated in hydroxypropyl methylcellulose (HPMC) films. FT-IR and transmission electron microscopy (TEM) analyses of the nanoparticles, mechanical properties, water vapor permeability, thermal stability, scanning electron microscopy (SEM...

  12. Development of molecular indicators to track the effects of nanoparticle toxicity in Arabidopsis thaliana

    EPA Science Inventory

    The emergence of nanotechnology and incorporation of nanoparticles in consumer products necessitates risk assessment from an environmental and health safety standpoint. To date, very few studies have examined nanoparticle effects on terrestrial species, especially plants. Pre...

  13. Design and characterization of protein-quercetin bioactive nanoparticles

    PubMed Central

    2011-01-01

    Background The synthesis of bioactive nanoparticles with precise molecular level control is a major challenge in bionanotechnology. Understanding the nature of the interactions between the active components and transport biomaterials is thus essential for the rational formulation of bio-nanocarriers. The current study presents a single molecule of bovine serum albumin (BSA), lysozyme (Lys), or myoglobin (Mb) used to load hydrophobic drugs such as quercetin (Q) and other flavonoids. Results Induced by dimethyl sulfoxide (DMSO), BSA, Lys, and Mb formed spherical nanocarriers with sizes less than 70 nm. After loading Q, the size was further reduced by 30%. The adsorption of Q on protein is mainly hydrophobic, and is related to the synergy of Trp residues with the molecular environment of the proteins. Seven Q molecules could be entrapped by one Lys molecule, 9 by one Mb, and 11 by one BSA. The controlled releasing measurements indicate that these bioactive nanoparticles have long-term antioxidant protection effects on the activity of Q in both acidic and neutral conditions. The antioxidant activity evaluation indicates that the activity of Q is not hindered by the formation of protein nanoparticles. Other flavonoids, such as kaempferol and rutin, were also investigated. Conclusions BSA exhibits the most remarkable abilities of loading, controlled release, and antioxidant protection of active drugs, indicating that such type of bionanoparticles is very promising in the field of bionanotechnology. PMID:21586116

  14. Zinc Incorporation Into Hydroxylapatite

    SciTech Connect

    Tang, Y.; Chappell, H; Dove, M; Reeder, R; Lee, Y

    2009-01-01

    By theoretical modeling and X-ray absorption spectroscopy, the local coordination structure of Zn incorporated into hydroxylapatite was examined. Density function theory (DFT) calculations show that Zn favors the Ca2 site over the Ca1 site, and favors tetrahedral coordination. X-ray absorption near edge structure (XANES) spectroscopy results suggest one dominant coordination environment for the incorporated Zn, and no evidence was observed for other Zn-containing phases. Extended X-ray absorption fine structure (EXAFS) fitting of the synthetic samples confirms that Zn occurs in tetrahedral coordination, with two P shells at 2.85-3.07 {angstrom}, and two higher Ca shells at 3.71-4.02 {angstrom}. These fit results are consistent with the most favored DFT model for Zn substitution in the Ca2 site.

  15. Engineering nanoparticle-protein associations for protein crystal nucleation and nanoparticle arrangement

    NASA Astrophysics Data System (ADS)

    Benoit, Denise N.

    Engineering the nanoparticle - protein association offers a new way to form protein crystals as well as new approaches for arrangement of nanoparticles. Central to this control is the nanoparticle surface. By conjugating polymers on the surface with controlled molecular weights many properties of the nanoparticle can be changed including its size, stability in buffers and the association of proteins with its surface. Large molecular weight poly(ethylene glycol) (PEG) coatings allow for weak associations between proteins and nanoparticles. These interactions can lead to changes in how proteins crystallize. In particular, they decrease the time to nucleation and expand the range of conditions over which protein crystals form. Interestingly, when PEG chain lengths are too short then protein association is minimized and these effects are not observed. One important feature of protein crystals nucleated with nanoparticles is that the nanoparticles are incorporated into the crystals. What results are nanoparticles placed at well-defined distances in composite protein-nanoparticle crystals. Crystals on the size scale of 10 - 100 micrometers exhibit optical absorbance, fluorescence and super paramagnetic behavior derivative from the incorporated nanomaterials. The arrangement of nanoparticles into three dimensional arrays also gives rise to new and interesting physical and chemical properties, such as fluorescence enhancement and varied magnetic response. In addition, anisotropic nanomaterials aligned throughout the composite crystal have polarization dependent optical properties.

  16. Antibacterial behavior of polypyrrole: The influence of morphology and additives incorporation.

    PubMed

    da Silva, Fernando A G; Queiroz, Jefferson C; Macedo, Ericleiton R; Fernandes, Antonio W C; Freire, Naiana B; da Costa, Mateus M; de Oliveira, Helinando P

    2016-05-01

    The antibacterial behavior of polypyrrole (PPy) depends on a diversity of structural parameters such as surface area, aggregation level and additives (metal nanoparticles) incorporation. This paper summarizes the influence of different preparation procedures of PPy on action of resulting antibacterial composite against Escherichia coli, Staphylococcus aureus and Klebsiella pneumoniae. The bactericidal action has been assigned to morphology (size of polypyrrole nanoparticles). The electrostatic interaction established between polymer nanoparticles and bacteria provokes the bacterial cell death and returns advantages in comparison with conventional composites of polypyrrole decorated with metal nanoparticles. PMID:26952429

  17. Application of Magnetic Nanoparticles to Gene Delivery

    PubMed Central

    Kami, Daisuke; Takeda, Shogo; Itakura, Yoko; Gojo, Satoshi; Watanabe, Masatoshi; Toyoda, Masashi

    2011-01-01

    Nanoparticle technology is being incorporated into many areas of molecular science and biomedicine. Because nanoparticles are small enough to enter almost all areas of the body, including the circulatory system and cells, they have been and continue to be exploited for basic biomedical research as well as clinical diagnostic and therapeutic applications. For example, nanoparticles hold great promise for enabling gene therapy to reach its full potential by facilitating targeted delivery of DNA into tissues and cells. Substantial progress has been made in binding DNA to nanoparticles and controlling the behavior of these complexes. In this article, we review research on binding DNAs to nanoparticles as well as our latest study on non-viral gene delivery using polyethylenimine-coated magnetic nanoparticles. PMID:21747701

  18. Silver Nanoparticles

    NASA Astrophysics Data System (ADS)

    Khaydarov, R. R.; Khaydarov, R. A.; Estrin, Y.; Evgrafova, S.; Scheper, T.; Endres, C.; Cho, S. Y.

    The bactericidal effect of silver nanoparticles obtained by a novel electrochemical method on Escherichia coli, Staphylococcus aureus, Aspergillus niger and Penicillium phoeniceum cultures has been studied. The tests conducted have demonstrated that synthesized silver nanoparticles — when added to water paints or cotton fabrics — show a pronounced antibacterial/antifungal effect. It was shown that smaller silver nanoparticles have a greater antibacterial/antifungal efficacy. The paper also provides a review of scientific literature with regard to recent developments in the field of toxicity of silver nanoparticles and its effect on environment and human health.

  19. DISTRIBUTED AMPLIFIER INCORPORATING FEEDBACK

    DOEpatents

    Bell, P.R. Jr.

    1958-10-21

    An improved distributed amplifier system employing feedback for stabilization is presented. In accordance with the disclosed invention, a signal to be amplified is applled to one end of a suitable terminated grid transmission line. At intervals along the transmission line, the signal is fed to stable, resistance-capacitance coupled amplifiers incorporating feedback loops therein. The output current from each amplifier is passed through an additional tube to minimize the electrostatic capacitance between the tube elements of the last stage of the amplifier, and fed to appropriate points on an output transmission line, similar to the grid line, but terminated at the opposite (input) end. The output taken from the unterminated end of the plate transmission line is proportional to the input voltage impressed upon the grid line.

  20. Investigations of nano-particle toxicity and uptake of Cerium oxide and Titanium dioxide in Arabidopsis thaliana (L.)

    EPA Science Inventory

    The emergence of nanotechnology and incorporation of nanoparticles in consumer products necessitates risk assessment from an environmental and health safety standpoint. To date, very few studies have examined nanoparticle effects on terrestrial species, especially plants. In ...

  1. Intermetallic nanoparticles

    DOEpatents

    Singh, Dileep; Yusufoglu, Yusuf; Timofeeva, Elena; Routbort, Jules

    2015-07-14

    A process for preparing intermetallic nanoparticles of two or more metals is provided. In particular, the process includes the steps: a) dispersing nanoparticles of a first metal in a solvent to prepare a first metal solution, b) forming a reaction mixture with the first metal solution and a reducing agent, c) heating the reaction mixture to a reaction temperature; and d) adding a second metal solution containing a salt of a second metal to the reaction mixture. During this process, intermetallic nanoparticles, which contain a compound with the first and second metals are formed. The intermetallic nanoparticles with uniform size and a narrow size distribution is also provided. An electrochemical device such as a battery with the intermetallic nanoparticles is also provided.

  2. Intermetallic nanoparticles

    DOEpatents

    Singh, Dileep; Yusufoglu, Yusuf; Timofeeva, Elena; Routbort, Jules L.

    2015-11-20

    A process for preparing intermetallic nanoparticles of two or more metals is provided. In particular, the process includes the steps: a) dispersing nanoparticles of a first metal in a solvent to prepare a first metal solution, b) forming a reaction mixture with the first metal solution and a reducing agent, c) heating the reaction mixture to a reaction temperature; and d) adding a second metal solution containing a salt of a second metal to the reaction mixture. During this process, intermetallic nanoparticles, which contain a compound with the first and second metals are formed. The intermetallic nanoparticles with uniform size and a narrow size distribution is also provided. An electrochemical device such as a battery with the intermetallic nanoparticles is also provided.

  3. DNA templated magnetic nanoparticles

    NASA Astrophysics Data System (ADS)

    Kinsella, Joseph M.

    Recent discoveries in nanoscience are predicted to potentially revolutionize future technologies in an extensive number of fields. These developments are contingent upon discovering new and often unconventional methods to synthesize and control nanoscale components. Nature provides several examples of working nanotechnology such as the use of programmed self assembly to build and deconstruct complex molecular systems. We have adopted a method to control the one dimensional assembly of magnetic nanoparticles using DNA as a scaffold molecule. With this method we have demonstrated the ability to organize 5 nm particles into chains that stretch up to ˜20 mum in length. One advantage of using DNA compared is the ability of the molecule to interact with other biomolecules. After assembling particles onto DNA we have been able to cleave the molecule into smaller fragments using restriction enzymes. Using ligase enzymes we have re-connected these fragments, coated with either gold or iron oxide, to form long one-dimensional arrangements of the two different types of nanoparticles on a single molecular guide. We have also created a sensitive magnetic field sensor by incorporating magnetic nanoparticle coated DNA strands with microfabricated electrodes. The IV characteristics of the aligned nanoparticles are dependant on the magnitude of an externally applied magnetic field. This transport phenomenon known as tunneling magnetoresistance (TMR) shows room temperature resistance of our devices over 80% for cobalt ferrite coated DNA when a field of 20 kOe is applied. In comparison, studies using two dimensional nanoparticle films of irox oxides xii only exhibit a 35% MR effect. Confinement into one dimension using the DNA guide produces a TMR mechanism which produces significant increases in magnetoresistance. This property can be utilized for applications in magnetic field sensing, data storage, and logic elements.

  4. Antimicrobial Air Filters Using Natural Euscaphis japonica Nanoparticles.

    PubMed

    Hwang, Gi Byoung; Heo, Ki Joon; Yun, Ji Ho; Lee, Jung Eun; Lee, Hee Ju; Nho, Chu Won; Bae, Gwi-Nam; Jung, Jae Hee

    2015-01-01

    Controlling bioaerosols has become more important with increasing participation in indoor activities. Treatments using natural-product nanomaterials are a promising technique because of their relatively low toxicity compared to inorganic nanomaterials such as silver nanoparticles or carbon nanotubes. In this study, antimicrobial filters were fabricated from natural Euscaphis japonica nanoparticles, which were produced by nebulizing E. japonica extract. The coated filters were assessed in terms of pressure drop, antimicrobial activity, filtration efficiency, major chemical components, and cytotoxicity. Pressure drop and antimicrobial activity increased as a function of nanoparticle deposition time (590, 855, and 1150 g/cm2(filter) at 3-, 6-, and 9-min depositions, respectively). In filter tests, the antimicrobial efficacy was greater against Staphylococcus epidermidis than Micrococcus luteus; ~61, ~73, and ~82% of M. luteus cells were inactivated on filters that had been coated for 3, 6, and 9 min, respectively, while the corresponding values were ~78, ~88, and ~94% with S. epidermidis. Although statistically significant differences in filtration performance were not observed between samples as a function of deposition time, the average filtration efficacy was slightly higher for S. epidermidis aerosols (~97%) than for M. luteus aerosols (~95%). High-performance liquid chromatography (HPLC) and electrospray ionization-tandem mass spectrometry (ESI/MS) analyses confirmed that the major chemical compounds in the E. japonica extract were 1()-O-galloyl pedunculagin, quercetin-3-O-glucuronide, and kaempferol-3-O-glucoside. In vitro cytotoxicity and disk diffusion tests showed that E. japonica nanoparticles were less toxic and exhibited stronger antimicrobial activity toward some bacterial strains than a reference soluble nickel compound, which is classified as a human carcinogen. This study provides valuable information for the development of a bioaerosol control system that is environmental friendly and suitable for use in indoor environments. PMID:25974109

  5. Antimicrobial Air Filters Using Natural Euscaphis japonica Nanoparticles

    PubMed Central

    Yun, Ji Ho; Lee, Jung Eun; Lee, Hee Ju; Nho, Chu Won; Bae, Gwi- Nam; Jung, Jae Hee

    2015-01-01

    Controlling bioaerosols has become more important with increasing participation in indoor activities. Treatments using natural-product nanomaterials are a promising technique because of their relatively low toxicity compared to inorganic nanomaterials such as silver nanoparticles or carbon nanotubes. In this study, antimicrobial filters were fabricated from natural Euscaphis japonica nanoparticles, which were produced by nebulizing E. japonica extract. The coated filters were assessed in terms of pressure drop, antimicrobial activity, filtration efficiency, major chemical components, and cytotoxicity. Pressure drop and antimicrobial activity increased as a function of nanoparticle deposition time (590, 855, and 1150 µg/cm2filter at 3-, 6-, and 9-min depositions, respectively). In filter tests, the antimicrobial efficacy was greater against Staphylococcus epidermidis than Micrococcus luteus; ~61, ~73, and ~82% of M. luteus cells were inactivated on filters that had been coated for 3, 6, and 9 min, respectively, while the corresponding values were ~78, ~88, and ~94% with S. epidermidis. Although statistically significant differences in filtration performance were not observed between samples as a function of deposition time, the average filtration efficacy was slightly higher for S. epidermidis aerosols (~97%) than for M. luteus aerosols (~95%). High-performance liquid chromatography (HPLC) and electrospray ionization-tandem mass spectrometry (ESI/MS) analyses confirmed that the major chemical compounds in the E. japonica extract were 1(ß)-O-galloyl pedunculagin, quercetin-3-O-glucuronide, and kaempferol-3-O-glucoside. In vitro cytotoxicity and disk diffusion tests showed that E. japonica nanoparticles were less toxic and exhibited stronger antimicrobial activity toward some bacterial strains than a reference soluble nickel compound, which is classified as a human carcinogen. This study provides valuable information for the development of a bioaerosol control system that is environmental friendly and suitable for use in indoor environments. PMID:25974109

  6. Properties of Novel Hydroxypropyl Methylcellulose Films Containing Chitosan Nanoparticles

    Technology Transfer Automated Retrieval System (TEKTRAN)

    In this work, chitosan nanoparticles were prepared and incorporated in hydroxypropyl methylcellulose (HPMC) films under different conditions. Mechanical properties, water vapor and oxygen permeability, water solubility and scanning and transmission electron microscopy (SEM and TEM) results were ana...

  7. Polymeric nanoparticles

    PubMed Central

    Bolhassani, Azam; Javanzad, Shabnam; Saleh, Tayebeh; Hashemi, Mehrdad; Aghasadeghi, Mohammad Reza; Sadat, Seyed Mehdi

    2014-01-01

    Nanocarriers with various compositions and biological properties have been extensively applied for in vitro/in vivo drug and gene delivery. The family of nanocarriers includes polymeric nanoparticles, lipid-based carriers (liposomes/micelles), dendrimers, carbon nanotubes, and gold nanoparticles (nanoshells/nanocages). Among different delivery systems, polymeric carriers have several properties such as: easy to synthesize, inexpensive, biocompatible, biodegradable, non-immunogenic, non-toxic, and water soluble. In addition, cationic polymers seem to produce more stable complexes led to a more protection during cellular trafficking than cationic lipids. Nanoparticles often show significant adjuvant effects in vaccine delivery since they may be easily taken up by antigen presenting cells (APCs). Natural polymers such as polysaccharides and synthetic polymers have demonstrated great potential to form vaccine nanoparticles. The development of new adjuvants or delivery systems for DNA and protein immunization is an expanding research field. This review describes polymeric carriers especially PLGA, chitosan, and PEI as vaccine delivery systems. PMID:24128651

  8. Precision Nanoparticles

    SciTech Connect

    John Hemminger

    2009-07-21

    A revolutionary technology that efficiently produces nanoparticles in uniform and prescribed sizes (1-100 nanometers) using supercritical fluids. INL researcher Robert Fox was joined by Idaho State University researchers Rene Rodriquez and Joshua Pak in d

  9. Precision Nanoparticles

    ScienceCinema

    John Hemminger

    2010-01-08

    A revolutionary technology that efficiently produces nanoparticles in uniform and prescribed sizes (1-100 nanometers) using supercritical fluids. INL researcher Robert Fox was joined by Idaho State University researchers Rene Rodriquez and Joshua Pak in d

  10. Characterizing nanoparticles

    NASA Astrophysics Data System (ADS)

    Perrey, Christopher Robert

    The properties of nanoscale materials have been shown to deviate from those expected of bulk materials. In order to better understand the causes of these observations, a fundamental understanding of the structure of nanoparticles and nanostructured materials is necessary. This work focuses on the characterization of such materials using techniques of electron microscopy. Structures composed of nanoparticles and mechanically deformed, lithographically created silicon towers were analyzed using a combination of focused ion beam milling, scanning electron microscopy, and transmission electron microscopy. The nanostructured films were found to be not fully dense and composed of chemically heterogeneous areas; such specimens could not be produced using traditional methods of sample preparation. The mechanically indented towers exhibited an increased defect structure that was consistent with the increase in applied load. Additional studies focusing on individual nanoparticles produced by different plasma processes have been analyzed in terms of morphology, chemistry, and defect structure. It was found that nanoparticle morphology can be a direct indicator of the particle formation processes occurring in the plasma. Spherical particles can be formed by rapidly solidifying a liquid sphere, with a convex solid-liquid interface. Highly-oriented cubic particles are the result of a slower vapor condensation process on energetically favorable crystallographic planes. Intermediate nanoparticle shapes were encountered and indicate a transition in solidification mechanisms is possible. Using aberration-corrected high-resolution transmission electron microscopy, silicon nanoparticles as small as 1.25 nm in diameter were discovered in hydrogenated nanocrystalline silicon (a/nc-Si:H) films. Some of these nanoparticles contained twin defects and stacking faults; the structure of these planar defects indicate that the nanoparticles were formed in the plasma and not by solid-state nucleation in the film.

  11. Biocompatibility of crystalline opal nanoparticles

    PubMed Central

    2012-01-01

    Background Silica nanoparticles are being developed as a host of biomedical and biotechnological applications. For this reason, there are more studies about biocompatibility of silica with amorphous and crystalline structure. Except hydrated silica (opal), despite is presents directly and indirectly in humans. Two sizes of crystalline opal nanoparticles were investigated in this work under criteria of toxicology. Methods In particular, cytotoxic and genotoxic effects caused by opal nanoparticles (80 and 120 nm) were evaluated in cultured mouse cells via a set of bioassays, methylthiazolyldiphenyl-tetrazolium-bromide (MTT) and 5-bromo-2?-deoxyuridine (BrdU). Results 3T3-NIH cells were incubated for 24 and 72 h in contact with nanocrystalline opal particles, not presented significant statistically difference in the results of cytotoxicity. Genotoxicity tests of crystalline opal nanoparticles were performed by the BrdU assay on the same cultured cells for 24 h incubation. The reduction of BrdU-incorporated cells indicates that nanocrystalline opal exposure did not caused unrepairable damage DNA. Conclusions There is no relationship between that particles size and MTT reduction, as well as BrdU incorporation, such that the opal particles did not induce cytotoxic effect and genotoxicity in cultured mouse cells. PMID:23088559

  12. Preparation and Characterisation of Highly Loaded Fluorescent Chitosan Nanoparticles

    PubMed Central

    Katas, Haliza; Mui Wen, Chan

    2011-01-01

    Chitosan (CS) nanoparticles have been developed as a versatile drug delivery system to transport drugs, genes, proteins, and peptides into target sites. Demands on fluorescent nanoparticles have increased recently due to various applications in medical and stem-cell-based researches. In this study, fluorescent CS nanoparticles were prepared by a mild method, namely, complex coacervation. Entrapment efficiency of sulforhodamine (SR101) loaded into CS nanoparticles was investigated to evaluate their capacity in incorporating fluorescent molecule. Particle size of produced fluorescent nanoparticles was in the range of 600–700 nm, and their particle size was highly dependent on the CS molecular weight as well as concentration. A high entrapment efficiency of SR101 into CS nanoparticles could also be obtained when it was dissolved in methanol. In conclusion, highly loaded fluorescent CS nanoparticles could be easily prepared using complex coacervation method and therefore can be applied in various medical researches. PMID:22389847

  13. Incorporation of pyrene in polypyrrole/polystyrene magnetic beads

    NASA Astrophysics Data System (ADS)

    Głowala, Paulina; Budniak, Adam; Krug, Pamela; Wysocka, Barbara; Berbeć, Sylwia; Dec, Robert; Dołęga, Izabela; Kacprzak, Kamil; Wojciechowski, Jarosław; Kawałko, Jakub; Kępka, Paweł; Kępińska, Daria; Kijewska, Krystyna; Mazur, Maciej

    2014-10-01

    Pyrene, a fluorescent dye, was incorporated into polystyrene particles coated with polypyrrole. The incorporation was achieved by treating the polypyrrole/polystyrene (PPy/PS) beads in a tetrahydrofuran (THF) solution of the pyrene fluorophore followed by rinsing with methanol. The polystyrene cores of the beads swell in THF, allowing penetration of pyrene molecules into the polystyrene structure. The addition of methanol causes contraction of the swollen polystyrene, which encapsulates the dye molecules inside the beads. It is shown that the polypyrrole coating is permeable with respect to both the dye and the solvent, allowing the transport of molecules between the polystyrene cores and the contacting solution. The polypyrrole adlayer can be used as a matrix for the incorporation of magnetic nanoparticles. Embedded particles provide magnetic functionality to the PPy/PS beads. It is demonstrated that the pyrene-loaded beads can be manipulated with an external magnetic field.

  14. Using Models that Incorporate Uncertainty

    ERIC Educational Resources Information Center

    Caulkins, Jonathan P.

    2002-01-01

    In this article, the author discusses the use in policy analysis of models that incorporate uncertainty. He believes that all models should consider incorporating uncertainty, but that at the same time it is important to understand that sampling variability is not usually the dominant driver of uncertainty in policy analyses. He also argues that…

  15. Trimetallic Ag@AuPt Neapolitan nanoparticles

    NASA Astrophysics Data System (ADS)

    Song, Yang; Chen, Shaowei

    2013-07-01

    Trimetallic Ag@AuPt Neapolitan nanoparticles were prepared by two sequential galvanic exchange reactions of 1-hexanethiolate-capped silver nanoparticles (AgC6, 5.70 +/- 0.82 nm in diameter) with gold(i)-thiomalic acid (AuITMA) and platinum(ii)-hexanethiolate (PtIIC6) complexes. The first reaction was carried out at the air-water interface by the Langmuir method where the AgC6 nanoparticles formed a compact monolayer and water-soluble AuITMA was injected into the water subphase; the nanoparticles were then deposited onto a substrate surface in the up-stroke fashion and immersed into an acetone solution of PtIIC6. As both reactions were confined to an interface, the Au and Pt elements were situated on two opposite poles of the original Ag nanoparticles. The tripatchy structure was clearly manifested in elemental mapping of the nanoparticles, and consistent with the damping and red-shift of the nanoparticle surface plasmon resonance. Further characterizations by X-ray photoelectron spectroscopy showed that the reactions were mostly confined to the top layers of the Ag metal cores, and contact angle and infrared spectroscopic measurements confirmed the incorporation and segregated distribution of the organic capping ligands on the nanoparticle surface.

  16. Gold Nanoparticle Labels Amplify Ellipsometric Signals

    NASA Technical Reports Server (NTRS)

    Venkatasubbarao, Srivatsa

    2008-01-01

    The ellipsometric method reported in the immediately preceding article was developed in conjunction with a method of using gold nanoparticles as labels on biomolecules that one seeks to detect. The purpose of the labeling is to exploit the optical properties of the gold nanoparticles in order to amplify the measurable ellipsometric effects and thereby to enable ultrasensitive detection of the labeled biomolecules without need to develop more-complex ellipsometric instrumentation. The colorimetric, polarization, light-scattering, and other optical properties of nanoparticles depend on their sizes and shapes. In the present method, these size-and-shape-dependent properties are used to magnify the polarization of scattered light and the diattenuation and retardance of signals derived from ellipsometry. The size-and-shape-dependent optical properties of the nanoparticles make it possible to interrogate the nanoparticles by use of light of various wavelengths, as appropriate, to optimally detect particles of a specific type at high sensitivity. Hence, by incorporating gold nanoparticles bound to biomolecules as primary or secondary labels, the performance of ellipsometry as a means of detecting the biomolecules can be improved. The use of gold nanoparticles as labels in ellipsometry has been found to afford sensitivity that equals or exceeds the sensitivity achieved by use of fluorescence-based methods. Potential applications for ellipsometric detection of gold nanoparticle-labeled biomolecules include monitoring molecules of interest in biological samples, in-vitro diagnostics, process monitoring, general environmental monitoring, and detection of biohazards.

  17. Single-cell imaging detection of nanobarcoded nanoparticle biodistributions in tissues for nanomedicine

    NASA Astrophysics Data System (ADS)

    Eustaquio, Trisha; Cooper, Christy L.; Leary, James F.

    2011-03-01

    In nanomedicine, biodistribution studies are critical to evaluate the safety and efficacy of nanoparticles. Currently, extensive biodistribution studies are hampered by the limitations of bulk tissue and single-cell imaging techniques. To ameliorate these limitations, we have developed a novel method for single nanoparticle detection that incorporates a conjugated oligonucleotide as a "nanobarcode" for detection via in situ PCR. This strategy magnifies the detection signal from single nanoparticles, facilitating rapid evaluation of nanoparticle uptake by cell type over larger areas. The nanobarcoding method can enable precise analysis of nanoparticle biodistributions and expedite translation of these nanoparticles to the clinic.

  18. Preparation of drug nanoparticles by emulsion evaporation method

    NASA Astrophysics Data System (ADS)

    Hoa, Le Thi Mai; Chi, Nguyen Tai; Triet, Nguyen Minh; Thanh Nhan, Le Ngoc; Mau Chien, Dang

    2009-09-01

    Polymeric drug nanoparticles were prepared by emulsion solvent evaporation method. In this study, prepared the polymeric drug nanoparticles consist of ketoprofen and Eudragit E 100. The morphology structure was investigated by scanning electron microscopy (SEM). The interactions between the drug and polymer were investigated by Fourier transform infrared spectroscopy (FTIR). The size distribution was measured by means of Dynamic Light Scattering. The nanoparticles have an average size of about 150 nm. The incorporation ability of drugs in the polymeric nanoparticles depended on the integration between polymer and drug as well as the glass transition temperature of the polymer.

  19. Magnetic Nanoparticles for Biomedical Applications

    NASA Astrophysics Data System (ADS)

    Jing, Ying

    Nanotechnology is revolutionizing human's life. Synthesis and application of magnetic nanoparticles is a fast burgeoning field which has potential to bring significant advance in many fields, for example diagnosis and treatment in biomedical area. Novel nanoparticles to function efficiently and intelligently are in desire to improve the current technology. We used a magnetron-sputtering-based nanocluster deposition technique to synthesize magnetic nanoparticles in gas phase, and specifically engineered nanoparticles for different applications. Alternating magnetic field heating is emerging as a technique to assist cancer treatment or drug delivery. We proposed high-magnetic-moment Fe3Si particles with relatively large magnetic anisotropy energy should in principle provide superior performance. Such nanoparticles were experimentally synthesized and characterized. Their promising magnetic properties can contribute to heating performance under suitable alternating magnetic field conditions. When thermal energy is used for medical treatment, it is ideal to work in a designed temperature range. Biocompatible and "smart" magnetic nanoparticles with temperature self-regulation were designed from both materials science and biomedicine aspects. We chose Fe-Si material system to demonstrate the concept. Temperature dependent physical property was adjusted by tuning of exchange coupling between Fe atoms through incorporation of various amount of Si. The magnetic moment can still be kept in a promising range. The two elements are both biocompatible, which is favored by in-vivo medical applications. A combination of "smart" magnetic particles and thermo-sensitive polymer were demonstrated to potentially function as a platform for drug delivery. Highly sensitive diagnosis for point-of-care is in desire nowadays. We developed composition- and phase-controlled Fe-Co nanoparticles for bio-molecule detection. It has been demonstrated that Fe70Co30 nanoparticles and giant magnetoresistance sensor make a successful integrated system for bio-molecule detection. In addition, we proposed the concept of "magnetic coloring": magnetic nanoparticles with different M-H loop form an archive of labels for detection of multiple molecules in the same sample. The composition- and phase- controlled Fe-Co particles are candidate to serve this application. Magnetic nanoparticles can also play a role in "green" catalysis. We synthesized core-shell structured nanoparticle with core rich in Fe, and shell rich in FeSiO, which have capability for phtocatalysis and magnetic recycling. The magnetic core enables recycling of catalysts by applying an external magnetic field. The shell shows good optical absorption which indicates the possibility of phtocatalysis. A big challenge for nanoparticles synthesized in gas phase is to transfer them into aqueous environment, especially in biomedical field. We experimented different approaches to modify the surface of magnetic nanoparticles. A direct way was developed to introduce functional molecule onto the surface of nanoparticles in vacuum. A new design of nanoparticle collection was implemented to assist surface modification in vacuum and to enable large quantity of manufacturing.

  20. Hybrid Nanoparticles for Detection and Treatment of Cancer

    PubMed Central

    Sailor, Michael J.; Park, Ji-Ho

    2012-01-01

    There is currently considerable effort to incorporate both diagnostic and therapeutic functions into a single nanoscale system for the more effective treatment of cancer. Nanoparticles have great potential to achieve such dual functions, particularly if more than one type of nanostructure can be incorporated in a nanoassembly—referred to in this review as a hybrid nanoparticle. Here we review recent developments in the synthesis and evaluation of such hybrid nanoparticles based on two design strategies (barge vs. tanker), in which liposomal, micellar, porous silica, polymeric, viral, noble metal, and nanotube systems are incorporated either within (barge) or at the surface of (tanker) a nanoparticle. We highlight the design factors that should be considered to obtain effective nanodevices for cancer detection and treatment. PMID:22610698

  1. Biological evaluation of nanosilver incorporated cellulose pulp for hygiene products.

    PubMed

    Kavitha Sankar, P C; Ramakrishnan, Reshmi; Rosemary, M J

    2016-04-01

    Cellulose pulp has a visible market share in personal hygiene products such as sanitary napkins and baby diapers. However it offers good surface for growth of microorganisms. Huge amount of research is going on in developing hygiene products that do not initiate microbial growth. The objective of the present work is to produce antibacterial cellulose pulp by depositing silver nanopowder on the cellulose fiber. The silver nanoparticles used were of less than 100nm in size and were characterised using transmission electron microscopy and X-ray powder diffraction studies. Antibacterial activity of the functionalized cellulose pulp was proved by JIS L 1902 method. The in-vitro cytotoxicity, in-vivo vaginal irritation and intracutaneous reactivity studies were done with silver nanopowder incorporated cellulose pulp for introducing a new value added product to the market. Cytotoxicity evaluation suggested that the silver nanoparticle incorporated cellulose pulp is non-cytotoxic. No irritation and skin sensitization were identified in animals tested with specific extracts prepared from the test material in the in-vivo experiments. The results indicated that the silver nanopowder incorporated cellulose pulp meets the requirements of the standard practices recommended for evaluating the biological reactivity and has good biocompatibility, hence can be classified as a safe hygiene product. PMID:26838891

  2. Co-administration of non-carrier nanoparticles boosts antigen immune response without requiring protein conjugation.

    PubMed

    Wibowo, Nani; Chuan, Yap P; Seth, Arjun; Cordoba, Yoann; Lua, Linda H L; Middelberg, Anton P J

    2014-06-17

    Nanotechnology promises a revolution in medicine including through new vaccine approaches. The use of nanoparticles in vaccination has, to date, focused on attaching antigen directly to or within nanoparticle structures to enhance antigen uptake by immune cells. Here we question whether antigen incorporation with the nanoparticle is actually necessary to boost vaccine effectiveness. We show that the immunogenicity of a sub-unit protein antigen was significantly boosted by formulation with silica nanoparticles even without specific conjugation of antigen to the nanoparticle. We further show that this effect was observed only for virus-sized nanoparticles (50 nm) but not for larger (1,000 nm) particles, demonstrating a pronounced effect of nanoparticle size. This non-attachment approach has potential to radically simplify the development and application of nanoparticle-based formulations, leading to safer and simpler nanoparticle applications in vaccine development. PMID:24793947

  3. Poly(amidoamine)-Cholesterol Conjugate Nanoparticles Obtained by Electrospraying as Novel Tamoxifen Delivery System

    PubMed Central

    Cavalli, R.; Bisazza, A.; Bussano, R.; Trotta, M.; Civra, A.; Lembo, D.; Ranucci, E.; Ferruti, P.

    2011-01-01

    A new poly(amidoamine)-cholesterol (PAA-cholesterol) conjugate was synthesized, characterized and used to produce nanoparticles by the electrospraying technique. The electrospraying is a method of liquid atomization that consists in the dispersion of a solution into small charged droplets by an electric field. Tuning the electrospraying process parameters spherical PAA-chol nanoparticles formed. The PAA-cholesterol nanoparticles showed sizes lower than 500 nm and spherical shape. The drug incorporation capacity was investigated using tamoxifen, a lipophilic anticancer drug, as model drug. The incorporation of the tamoxifen did not affect the shape and sizes of nanoparticles showing a drug loading of 40%. Tamoxifen-loaded nanoparticles exhibited a higher dose-dependent cytotoxicity than free tamoxifen, while blank nanoparticles did not show any cytotoxic effect at the same concentrations. The electrospray technique might be proposed to produce tamoxifen-loaded PAA-chol nanoparticle in powder form without any excipient in a single step. PMID:21785731

  4. Functionalized mesoporous silica nanoparticles for oral delivery of budesonide

    NASA Astrophysics Data System (ADS)

    Yoncheva, K.; Popova, M.; Szegedi, A.; Mihaly, J.; Tzankov, B.; Lambov, N.; Konstantinov, S.; Tzankova, V.; Pessina, F.; Valoti, M.

    2014-03-01

    Non-functionalized and amino-functionalized mesoporous silica nanoparticle were loaded with anti-inflammatory drug budesonide and additionally post-coated with bioadhesive polymer (carbopol). TEM images showed spherical shape of the nanoparticles and slightly higher polydispersity after coating with carbopol. Nitrogen physisorption and thermogravimetic analysis revealed that more efficient loading and incorporation into the pores of nanoparticles was achieved with the amino-functionalized silica carrier. Infrared spectra indicated that the post-coating of these nanoparticles with carbopol led to the formation of bond between amino groups of the functionalized carrier and carboxyl groups of carbopol. The combination of amino-functionalization of the carrier with the post-coating of the nanoparticles sustained budesonide release. Further, an in vitro model of inflammatory bowel disease showed that the cytoprotective effect of budesonide loaded in the post-coated silica nanoparticles on damaged HT-29 cells was more pronounced compared to the cytoprotection obtained with pure budesonide.

  5. Core-shell biopolymer nanoparticle delivery systems: synthesis and characterization of curcumin fortified zein-pectin nanoparticles.

    PubMed

    Hu, Kun; Huang, Xiaoxia; Gao, Yongqing; Huang, Xulin; Xiao, Hang; McClements, David Julian

    2015-09-01

    Biopolymer core-shell nanoparticles were fabricated using a hydrophobic protein (zein) as the core and a hydrophilic polysaccharide (pectin) as the shell. Particles were prepared by coating cationic zein nanoparticles with anionic pectin molecules using electrostatic deposition (pH 4). The core-shell nanoparticles were fortified with curcumin (a hydrophobic bioactive molecule) at a high loading efficiency (>86%). The resulting nanoparticles were spherical, relatively small (diameter ≈ 250 nm), and had a narrow size distribution (polydispersity index ≈ 0.24). The encapsulated curcumin was in an amorphous (rather than crystalline form) as detected by differential scanning calorimetry (DSC). Fourier transform infrared (FTIR) and Raman spectra indicated that the encapsulated curcumin interacted with zein mainly through hydrophobic interactions. The nanoparticles were converted into a powdered form that had good water-dispersibility. These core-shell biopolymer nanoparticles could be useful for incorporating curcumin into functional foods and beverages, as well as dietary supplements and pharmaceutical products. PMID:25842338

  6. Multifunctional mesoporous silica nanocomposite nanoparticles for theranostic applications.

    PubMed

    Lee, Ji Eun; Lee, Nohyun; Kim, Taeho; Kim, Jaeyun; Hyeon, Taeghwan

    2011-10-18

    Clever combinations of different types of functional nanostructured materials will enable the development of multifunctional nanomedical platforms for multimodal imaging or simultaneous diagnosis and therapy. Mesoporous silica nanoparticles (MSNs) possess unique structural features such as their large surface areas, tunable nanometer-scale pore sizes, and well-defined surface properties. Therefore, they are ideal platforms for constructing multifunctional materials that incorporate a variety of functional nanostructured materials. In this Account, we discuss recent progress by our group and other researchers in the design and fabrication of multifunctional nanocomposite nanoparticles based on mesoporous silica nanostructures for applications to simultaneous diagnosis and therapy. Versatile mesoporous silica-based nanocomposite nanoparticles were fabricated using various methods. Here, we highlight two synthetic approaches: the encapsulation of functional nanoparticles within a mesoporous silica shell and the assembly of nanoparticles on the surface of silica nanostructures. Various nanoparticles were encapsulated in MSNs using surfactants as both phase transfer agents and pore-generating templates. Using MSNs as a scaffold, functional components such as magnetic nanoparticles and fluorescent dyes have been integrated within these systems to generate multifunctional nanocomposite systems that maintain their individual functional characteristics. For example, uniform mesoporous dye-doped silica nanoparticles immobilized with multiple magnetite nanocrystals on their surfaces have been fabricated for their use as a vehicle capable of simultaneous magnetic resonance (MR) and fluorescence imaging and drug delivery. The resulting nanoparticle-incorporated MSNs were then tested in mice with tumors. These in vivo experiments revealed that these multifunctional nanocomposite nanoparticles were delivered to the tumor sites via passive targeting. These nanocomposite nanoparticles served as successful multimodal imaging probes and also delivered anticancer drugs to the tumor site. With innumerable combinations of imaging modalities and drug delivery available within these vehicles, multifunctional nanocomposite nanoparticles provide new opportunities for clinical diagnostics and therapeutics. PMID:21848274

  7. Towards the Rational Design of Nanoparticle Catalysts

    NASA Astrophysics Data System (ADS)

    Dash, Priyabrat

    This research is focused on development of routes towards the rational design of nanoparticle catalysts. Primarily, it is focused on two main projects; (1) the use of imidazolium-based ionic liquids (ILs) as greener media for the design of quasi-homogeneous nanoparticle catalysts and (2) the rational design of heterogeneous-supported nanoparticle catalysts from structured nanoparticle precursors. Each project has different studies associated with the main objective of the design of nanoparticle catalysts. In the first project, imidazolium-based ionic liquids have been used for the synthesis of nanoparticle catalysts. In particular, studies on recyclability, reuse, mode-of-stability, and long-term stability of these ionic-liquid supported nanoparticle catalysts have been done; all of which are important factors in determining the overall "greenness" of such synthetic routes. Three papers have been published/submitted for this project. In the first publication, highly stable polymer-stabilized Au, Pd and bimetallic Au-Pd nanoparticle catalysts have been synthesized in imidazolium-based 1-butyl-3-methylimidazolium hexafluorophosphate ([BMIM]PF6) ionic liquid (Journal of Molecular Catalysis A: Chemical, 2008, 286, 114). The resulting nanoparticles were found to be effective and selective quasi-homogeneous catalysts towards a wide-range of hydrogenation reactions and the catalyst solution was reused for further catalytic reactions with minimal loss in activity. The synthesis of very pure and clean ILs has allowed a platform to study the effects of impurities in the imidazolium ILs on nanoparticle stability. In a later study, a new mode of stabilization was postulated where the presence of low amounts of 1-methylimidazole has substantial effects on the resulting stability of Au and Pd-Au nanoparticles in these ILs (Chemical Communications, 2009, 812). In further continuation of this study, a comparative study involving four stabilization protocols for nanoparticle stabilization in BMIMPF6 IL is described, and have shown that nanoparticle stability and catalytic activity of nanoparticles is dependent on the overall stability of the nanoparticles towards aggregation (manuscript submitted). The second major project is focused on synthesizing structurally well-defined supported catalysts by incorporating the nanoparticle precursors (both alloy and core shell) into oxide frameworks (TiO2 and Al2O 3), and examining their structure-property relationships and catalytic activity. a full article has been published on this project (Journal of Physical Chemistry C, 2009, 113, 12719) in which a route to rationally design supported catalysts from structured nanoparticle precursors with precise control over size, composition, and internal structure of the nanoparticles has been shown. In a continuation of this methodology for the synthesis of heterogeneous catalysts, efforts were carried out to apply the same methodology in imidazolium-based ILs as a one-pot media for the synthesis of supported-nanoparticle heterogeneous catalysts via the trapping of pre-synthesized nanoparticles into porous inorganic oxide materials. Nanoparticle catalysts in highly porous titania supports were synthesized using this methodology (manuscript to be submitted).

  8. Selenium incorporation using recombinant techniques

    SciTech Connect

    Walden, Helen

    2010-04-01

    An overview of techniques for recombinant incorporation of selenium and subsequent purification and crystallization of the resulting labelled protein. Using selenomethionine to phase macromolecular structures is common practice in structure determination, along with the use of selenocysteine. Selenium is consequently the most commonly used heavy atom for MAD. In addition to the well established recombinant techniques for the incorporation of selenium in prokaryal expression systems, there have been recent advances in selenium labelling in eukaryal expression, which will be discussed. Tips and things to consider for the purification and crystallization of seleno-labelled proteins are also included.

  9. Apoferritin-Templated Synthesis of Encoded Metallic Phosphate Nanoparticle Tags

    SciTech Connect

    Liu, Guodong; Wu, Hong; Dohnalkova, Alice; Lin, Yuehe

    2007-07-31

    Encoded metallic-phosphate nanoparticle tags, with distinct encoding patterns, have been prepared using an apoferritin template. A center-cavity structure as well as the disassociation and reconstructive characteristics of apoferritin at different pH environments provide a facile route for preparing such encoded nanoparticle tags. Encapsulation and diffusion approaches have been investigated during the preparation. The encapsulation approach, which is based on the dissociation and reconstruction of apoferritin at different pHs, exhibits an effective route to prepare such encoded metallic-phosphate nanoparticle tags. The compositionally encoded nanoparticle tag leads to a high coding capacity with a large number of distinguishable voltammetric signals, reflecting the predetermined composition of the metal mixture solution (and hence the nanoparticle composition). Releasing the metal components from the nanoparticle tags at pH 4.6 acetate buffer avoids harsh dissolution conditions, such as strong acids. Such a synthesis of encoded nanoparticle tags, including single-component and compositionally encoded nanoparticle tags, is substantially simple, fast, and convenient compared to that of encoded metal nanowires and semiconductor nanoparticle (CdS, PbS, and ZnS) incorporated polystyrene beads. The encoded metallic-phosphate nanoparticle tags thus show great promise for bioanalytical or product-tracking/identification/protection applications.

  10. Physicochemical signatures of nanoparticle-dependent complement activation

    SciTech Connect

    Thomas, Dennis G.; Chikkagoudar, Satish; Heredia-Langner, Alejandro; Tardiff, Mark F.; Xu, Zhixiang; Hourcade, Dennis; Pham, Christine; Lanza, Gregory M.; Weinberger, Kilian Q.; Baker, Nathan A.

    2014-03-21

    Nanoparticles are potentially powerful therapeutic tools that have the capacity to target drug payloads and imaging agents. However, some nanoparticles can activate complement, a branch of the innate immune system, and cause adverse side-effects. Recently, we developed an in vitro hemolytic assay protocol for measuring the nanoparticle-dependent complement activity of serum samples and applied this protocol to several nanoparticle formulations that differed in size, surface charge, and surface chemistry; quantifying the nanoparticle-dependent complement activity using a metric called Residual Hemolytic Activity (RHA). In the present work, we have used a decision tree learning algorithm to derive the rules for estimating nanoparticle-dependent complement response based on the data generated from the hemolytic assay studies. Our results indicate that physicochemical properties of nanoparticles, namely, size, polydispersity index, zeta potential, and mole percentage of the active surface ligand of a nanoparticle, can serve as good descriptors for prediction of nanoparticle-dependent complement activation in the decision tree modeling framework. The robustness and predictability of the model can be improved by training the model with additional data points that are uniformly distributed in the RHA/physicochemical descriptor space and by incorporating instability effects on nanoparticle physicochemical properties into the model.

  11. Earth abundant bimetallic nanoparticles for heterogeneous catalysis

    NASA Astrophysics Data System (ADS)

    Senn, Jonathan F., Jr.

    Polymer exchange membrane fuel cells have the potential to replace current fossil fuel-based technologies in terms of emissions and efficiency, but CO contamination of H2 fuel, which is derived from steam methane reforming, leads to system inefficiency or failure. Solutions currently under development are bimetallic nanoparticles comprised of earth-abundant metals in different architectures to reduce the concentration of CO by PROX during fuel cell operation. Chapter One introduces the Pt-Sn and Co-Ni bimetallic nanoparticle systems, and the intermetallic and core-shell architectures of interest for catalytic evaluation. Application, theory, and studies associated with the efficacy of these nanoparticles are briefly reviewed. Chapter Two describes the concepts of the synthetic and characterization methods used in this work. Chapter Three presents the synthetic, characterization, and catalytic findings of this research. Pt, PtSn, PtSn2, and Pt 3Sn nanoparticles have been synthesized and supported on gamma-Al2O3. Pt3Sn was shown to be an effective PROX catalyst in various gas feed conditions, such as the gas mixture incorporating 0.1% CO, which displayed a light-off temperatures of ˜95°C. Co and Ni monometallic and CoNi bimetallic nanoparticles have been synthesized and characterized, ultimately leading to the development of target Co Ni core-shell nanoparticles. Proposed studies of catalytic properties of these nanoparticles in preferential oxidation of CO (PROX) reactions will further elucidate the effects of different crystallographic phases, nanoparticle-support interactions, and architecture on catalysis, and provide fundamental understanding of catalysis with nanoparticles composed of earth abundant metals in different architectures.

  12. Incorporating Argumentation through Forensic Science

    ERIC Educational Resources Information Center

    Wheeler, Lindsay B.; Maeng, Jennifer L.; Smetana, Lara K.

    2014-01-01

    This article outlines how to incorporate argumentation into a forensic science unit using a mock trial. Practical details of the mock trial include: (1) a method of scaffolding students' development of their argument for the trial, (2) a clearly outlined set of expectations for students during the planning and implementation of the mock

  13. Incorporating Argumentation through Forensic Science

    ERIC Educational Resources Information Center

    Wheeler, Lindsay B.; Maeng, Jennifer L.; Smetana, Lara K.

    2014-01-01

    This article outlines how to incorporate argumentation into a forensic science unit using a mock trial. Practical details of the mock trial include: (1) a method of scaffolding students' development of their argument for the trial, (2) a clearly outlined set of expectations for students during the planning and implementation of the mock…

  14. Influence of nanoparticle-ion and nanoparticle-polymer interactions on ion transport and viscoelastic properties of polymer electrolytes

    NASA Astrophysics Data System (ADS)

    Mogurampelly, Santosh; Sethuraman, Vaidyanathan; Pryamitsyn, Victor; Ganesan, Venkat

    2016-04-01

    We use atomistic simulations to probe the ion conductivities and mechanical properties of polyethylene oxide electrolytes containing Al2O3 nanoparticles. We specifically study the influence of repulsive polymer-nanoparticle and ion-nanoparticle interactions and compare the results with those reported for electrolytes containing the polymorph β-Al2O3 nanoparticles. We observe that incorporating repulsive nanoparticle interactions generally results in increased ionic mobilities and decreased elastic moduli for the electrolyte. Our results indicate that both ion transport and mechanical properties are influenced by the polymer segmental dynamics in the interfacial zones of the nanoparticle in the ion-doped systems. Such effects were seen to be determined by an interplay between the nanoparticle-polymer, nanoparticle-ion, and ion-polymer interactions. In addition, such interactions were also observed to influence the number of dissociated ions and the resulting conductivities. Within the perspective of the influence of nanoparticles on the polymer relaxation times in ion-doped systems, our results in the context of viscoelastic properties were consistent with the ionic mobilities. Overall, our results serve to highlight some issues that confront the efforts to use nanoparticle dispersions to simultaneously enhance the conductivity and the mechanical strength of polymer electrolyte.

  15. Controlling particle size in the Stöber process and incorporation of calcium.

    PubMed

    Greasley, Sarah L; Page, Samuel J; Sirovica, Slobodan; Chen, Shu; Martin, Richard A; Riveiro, Antonio; Hanna, John V; Porter, Alexandra E; Jones, Julian R

    2016-05-01

    The Stӧber process is commonly used for synthesising spherical silica particles. This article reports the first comprehensive study of how the process variables can be used to obtain monodispersed particles of specific size. The modal particle size could be selected within in the range 20-500nm. There is great therapeutic potential for bioactive glass nanoparticles, as they can be internalised within cells and perform sustained delivery of active ions. Biodegradable bioactive glass nanoparticles are also used in nanocomposites. Modification of the Stӧber process so that the particles can contain cations such as calcium, whilst maintaining monodispersity, is desirable. Here, whilst calcium incorporation is achieved, with a homogenous distribution, careful characterisation shows that much of the calcium is not incorporated. A maximum of 10mol% CaO can be achieved and previous reports are likely to have overestimated the amount of calcium incorporated. PMID:26890387

  16. Modeling the heterogeneous catalytic activity of a single nanoparticle using a first passage time distribution formalism

    NASA Astrophysics Data System (ADS)

    Das, Anusheela; Chaudhury, Srabanti

    2015-11-01

    Metal nanoparticles are heterogeneous catalysts and have a multitude of non-equivalent, catalytic sites on the nanoparticle surface. The product dissociation step in such reaction schemes can follow multiple pathways. Proposed here for the first time is a completely analytical theoretical framework, based on the first passage time distribution, that incorporates the effect of heterogeneity in nanoparticle catalysis explicitly by considering multiple, non-equivalent catalytic sites on the nanoparticle surface. Our results show that in nanoparticle catalysis, the effect of dynamic disorder is manifested even at limiting substrate concentrations in contrast to an enzyme that has only one well-defined active site.

  17. Electrosprayed nanoparticle delivery system for controlled release.

    PubMed

    Eltayeb, Megdi; Stride, Eleanor; Edirisinghe, Mohan; Harker, Anthony

    2016-09-01

    This study utilises an electrohydrodynamic technique to prepare core-shell lipid nanoparticles with a tunable size and high active ingredient loading capacity, encapsulation efficiency and controlled release. Using stearic acid and ethylvanillin as model shell and active ingredients respectively, we identify the processing conditions and ratios of lipid:ethylvanillin required to form nanoparticles. Nanoparticles with a mean size ranging from 60 to 70nm at the rate of 1.37×10(9) nanoparticles per minute were prepared with different lipid:ethylvanillin ratios. The polydispersity index was ≈21% and the encapsulation efficiency ≈70%. It was found that the rate of ethylvanillin release was a function of the nanoparticle size, and lipid:ethylvanillin ratio. The internal structure of the lipid nanoparticles was studied by transmission electron microscopy which confirmed that the ethylvanillin was encapsulated within a stearic acid shell. Fourier transform infrared spectroscopy analysis indicated that the ethylvanillin had not been affected. Extensive analysis of the release of ethylvanillin was performed using several existing models and a new diffusive release model incorporating a tanh function. The results were consistent with a core-shell structure. PMID:27207047

  18. Incorporation of dopant impurities into a silicon oxynitride matrix containing silicon nanocrystals

    NASA Astrophysics Data System (ADS)

    Ehrhardt, Fabien; Ulhaq-Bouillet, Corinne; Muller, Dominique; Slaoui, Abdelilah; Ferblantier, Gérald

    2016-05-01

    Dopant impurities, such as gallium (Ga), indium (In), and phosphorus (P), were incorporated into silicon-rich silicon oxynitride (SRSON) thin films by the ion implantation technique. To form silicon nanoparticles, the implanted layers were thermally annealed at temperatures up to 1100 °C for 60 min. This thermal treatment generates a phase separation of the silicon nanoparticles from the SRSON matrix in the presence of the dopant atoms. We report on the position of the dopant species within the host matrix and relative to the silicon nanoparticles, as well as on the effect of the dopants on the crystalline structure and the size of the Si nanoparticles. The energy-filtered transmission electron microscopy technique is thoroughly used to identify the chemical species. The distribution of the dopant elements within the SRSON compound is determined using Rutherford backscattering spectroscopy. Energy dispersive X-ray mapping coupled with spectral imaging of silicon plasmons was performed to spatially localize at the nanoscale the dopant impurities and the silicon nanoparticles in the SRSON films. Three different behaviors were observed according to the implanted dopant type (Ga, In, or P). The In-doped SRSON layers clearly showed separated nanoparticles based on indium, InOx, or silicon. In contrast, in the P-doped SRSON layers, Si and P are completely miscible. A high concentration of P atoms was found within the Si nanoparticles. Lastly, in Ga-doped SRSON the Ga atoms formed large nanoparticles close to the SRSON surface, while the Si nanoparticles were localized in the bulk of the SRSON layer. In this work, we shed light on the mechanisms responsible for these three different behaviors.

  19. Eugenol-loaded chitosan nanoparticles: II. Application in bio-based plastics for active packaging.

    PubMed

    Woranuch, Sarekha; Yoksan, Rangrong

    2013-07-25

    The aim of the present research was to study the possibility of using eugenol-loaded chitosan nanoparticles as antioxidants for active bio-based packaging material. Eugenol-loaded chitosan nanoparticles were incorporated into thermoplastic flour (TPF) - a model bio-based plastic - through an extrusion process at temperatures above 150°C. The influences of eugenol-loaded chitosan nanoparticles on crystallinity, morphology, thermal properties, radical scavenging activity, reducing power, tensile properties and barrier properties of TPF were investigated. Although the incorporation of 3% (w/w) of eugenol-loaded chitosan nanoparticles significantly reduced the extensibility and the oxygen barrier property of TPF, it provided antioxidant activity and improved the water vapor barrier property. In addition, TPF containing eugenol-loaded chitosan nanoparticles exhibited superior radical scavenging activity and stronger reducing power compared with TPF containing naked eugenol. The results suggest the applicability of TPF containing eugenol-loaded chitosan nanoparticles as an antioxidant active packaging material. PMID:23768604

  20. Formation and characterization of nanoparticles via laser ablation in solution

    NASA Astrophysics Data System (ADS)

    Golightly, Justin Samuel

    The work presented in this thesis encompassed laser ablation of various transition metals within a liquid environment. Through an improved understanding of the ablation process, control over the properties of the resultant nanoparticles can be obtained, and thusly nanoparticles can be tailored with specific properties. Creation of nanoparticles via laser ablation in solution is a relatively youngtechnique for nanoparticle synthesis, and the work presented should prove useful in guiding further exploration in ablation processes in liquids for nanomaterial production. When a laser is focused onto a target under a liquid environment, the target material and its surrounding liquid are vaporized. The concoction of vapor is ejected normal to the surface as a bubble. The bubble has a temperature reaching the boiling point of the metal, and has a gradient to the boiling point of the solvent. The bubble expands until it reaches a critical volume, and then subsequently collapses. It is within this bubble that nanoparticle formation occurs. As the bubble expands, the vapor cools and nanoparticle growth transpires. During the bubble collapse, pressures reaching GigaPascals have been reported, and a secondary nanoparticle formation occurs as a result of these high pressures. Chapter 1 delves a little more into the nanoparticle formation mechanisms, as well as an introduction to the analytical techniques used for characterization. Ablation of titanium took place in isopropanol, ethanol, water, and n-hexane, under various fluences, with a 532 nm Nd:YAG operating at 10 Hz. It was found that a myriad of nanoparticles could be made with vastly different compositions that were both solvent and fluence dependent. Nanoparticles were made that incorporated carbon and oxygen from the solvent, showing how solvent choice is an important factor in nanoparticle creation. Chapter 3 discusses the results of the titanium work in great detail and demonstrates carbide production with ablation in isopropyl alcohol. Ablation in n-hexane also showed diffraction patterns correlating with carbides, and water showed oxygen incorporation. These results showed the ability to utilize the solvent in tailoring nanoparticles to achieve desired properties. Zirconium and nickel were ablated with the Nd:YAG at 532 nm. These studies utilized a stainless steel chamber designed and built to improve control over the experimental variables. The nickel study showcased the new chamber's ability for reproducibility in a size dependence study based upon laser fluence. The results of ablation with the Nd:YAG were compared to femtosecond ablation experiments performed with a titanium:sapphire femtosecond laser system. The Ti:sapphire femtosecond laser operated at 10 Hz, produced femtosecond pulses centered at ˜795 nm. The pulse duration was varied from 100 fs to 390 fs, the nanoparticles created from each condition were characterized, and the results are presented in chapters 5 and 6. Aluminum nanoparticles were made using both nanosecond and femtosecond laser ablation techniques. Aluminum nanoparticles have a great deal of potential for use as fuel additives as well as in paints and coatings. The nanosecond ablation process rendered large nanoparticles (over 200 nm) and the results are briefly shown in Appendix A. The femtosecond system produced a much smaller distribution of nanoparticles, with nanoparticles remaining in suspension for over a month's time, as evidenced by their unique UV-Vis absorbance. These nanoparticles were produced in isopropyl alcohol, and were stabilized by the solvent, as TEM analysis showed nanoparticles with very little oxygen incorporation. The solvent is bound to the nanoparticles as a result of the formation process and as a result forms a protective coating, which prevents further oxidation over time. The remarkable stability of these aluminum nanoparticles is a testament of employing the high energy scheme of the laser ablation process in a manner to tailor the production of novel nanomaterials. (Abstract shortened by UMI.)

  1. Investigation of antibacterial activity of cotton fabric incorporating nano silver colloid

    NASA Astrophysics Data System (ADS)

    Thanh, Ngo Vo Ke; Thi Phuong Phong, Nguyen

    2009-09-01

    In this work, silver nanoparticles were prepared by polyol process with microwave heating and incorporated on cotton fabric surfaces. The antibacterial performance of the antibacterial cotton fabric was tested for different concentration of nano-sized silver colloid, contact time germs, and washing times. It was found that antibacterial activity increased with the increasing concentration of nano-sized silver colloid. The antibacterial fabric with 758 mg/kg of silver nanoparticles on surface cotton was highly effective in killing test bacteria and had excellent water resisting property.

  2. Hybrid collagen-based hydrogels with embedded montmorillonite nanoparticles.

    PubMed

    Nistor, Manuela Tatiana; Vasile, Cornelia; Chiriac, Aurica P

    2015-08-01

    Montmorillonite nanoparticles have been physically incorporated within a crosslinked collagen/poly(N-isopropyl acrylamide) network in order to adjust the properties of the stimuli-responsive hybrid systems. The research underlines both the influence of hydrogel composition and nanoparticle type on hybrid hydrogel properties. The dispersion of the montmorillonite nanoparticles in polymeric matrix have been visualized by SEM, TEM and AFM techniques and quantitatively and qualitatively estimated using near infrared chemical imaging. The electrical charge of the nanoparticles influenced the polymeric chain arrangement and the pore size. The morphologies of the nanoparticulated layers are partially exfoliated or intercalated and uniformly dispersed through the polymeric semi-interpenetrated network based on collagen and poly(N-isopropyl acrylamide). The hybrid hydrogels exhibit pseudoplastic behavior and the addition of nanoparticles has resulted in the increase of the complex viscosity. The adhesion capacity was affected mainly by the presence of organically modified montmorillonites. PMID:26042709

  3. Formation and material analysis of plasma polymerized carbon nitride nanoparticles

    NASA Astrophysics Data System (ADS)

    Kovačević, E.; Berndt, J.; Stefanović, I.; Becker, H.-W.; Godde, C.; Strunskus, Th.; Winter, J.; Boufendi, L.

    2009-05-01

    This paper deals with the analysis of nanoparticles polymerized in nitrogen/acetylene and argon/acetylene gas mixtures in low temperature rf discharges. The polymerization process was monitored by means of mass spectroscopy. The chemical characteristics of the material were obtained in situ by infrared absorption spectroscopy and ex situ by means of near edge x-ray absorption fine structure spectroscopy. These data were supported by complimentary elemental analyses such as deuteron induced gamma emission, Rutherford backscattering, and nuclear reaction analysis. Although morphology showed no differences, further material analysis shows clearly nitrogen incorporation in the nanoparticles, mostly by multiple bonds. In comparison with the nanoparticles from argon/acetylene plasma, the amount of carbon in carbon-nitride nanoparticles remains unchanged, whereas hydrogen content strongly decreases. The results of mass spectroscopy on neutrals and ions lead to the assumption that carbon-nitride nanoparticles are formed by copolymerization of two kinds of precursors: hydrocarbon and nitrogen containing hydrocarbon species.

  4. Molecular imaging and therapy of cancer with radiolabeled nanoparticles

    PubMed Central

    Hong, Hao; Zhang, Yin; Sun, Jiangtao; Cai, Weibo

    2009-01-01

    Summary This review summarizes the current state-of-the-art of radiolabeled nanoparticles for molecular imaging and internal radiotherapy applications targeting cancer. With the capacity to provide enormous flexibility, radiolabeled nanoparticles have the potential to profoundly impact disease diagnosis and patient management in the near future. Currently, the major challenges facing the research on radiolabeled nanoparticles are desirable (tumor) targeting efficacy, robust chemistry for both radionuclide encapsulation/incorporation and targeting ligand conjugation, favorable safety profile, as well as certain commercial and regulatory hurdles. PMID:20161038

  5. Uranium incorporation into amorphous silica.

    PubMed

    Massey, Michael S; Lezama-Pacheco, Juan S; Nelson, Joey M; Fendorf, Scott; Maher, Kate

    2014-01-01

    High concentrations of uranium are commonly observed in naturally occurring amorphous silica (including opal) deposits, suggesting that incorporation of U into amorphous silica may represent a natural attenuation mechanism and promising strategy for U remediation. However, the stability of uranium in opaline silicates, determined in part by the binding mechanism for U, is an important factor in its long-term fate. U may bind directly to the opaline silicate matrix, or to materials such as iron (hydr)oxides that are subsequently occluded within the opal. Here, we examine the coordination environment of U within opaline silica to elucidate incorporation mechanisms. Precipitates (with and without ferrihydrite inclusions) were synthesized from U-bearing sodium metasilicate solutions, buffered at pH ? 5.6. Natural and synthetic solids were analyzed with X-ray absorption spectroscopy and a suite of other techniques. In synthetic amorphous silica, U was coordinated by silicate in a double corner-sharing coordination geometry (Si at ? 3.8-3.9 ) and a small amount of uranyl and silicate in a bidentate, mononuclear (edge-sharing) coordination (Si at ? 3.1-3.2 , U at ? 3.8-3.9 ). In iron-bearing synthetic solids, U was adsorbed to iron (hydr)oxide, but the coordination environment also contained silicate in both edge-sharing and corner-sharing coordination. Uranium local coordination in synthetic solids is similar to that of natural U-bearing opals that retain U for millions of years. The stability and extent of U incorporation into opaline and amorphous silica represents a long-term repository for U that may provide an alternative strategy for remediation of U contamination. PMID:24984107

  6. Incorporating Spirituality in Primary Care.

    PubMed

    Isaac, Kathleen S; Hay, Jennifer L; Lubetkin, Erica I

    2016-06-01

    Addressing cultural competency in health care involves recognizing the diverse characteristics of the patient population and understanding how they impact patient care. Spirituality is an aspect of cultural identity that has become increasingly recognized for its potential to impact health behaviors and healthcare decision-making. We consider the complex relationship between spirituality and health, exploring the role of spirituality in primary care, and consider the inclusion of spirituality in existing models of health promotion. We discuss the feasibility of incorporating spirituality into clinical practice, offering suggestions for physicians. PMID:26832335

  7. Incorporation of additives into polymers

    DOEpatents

    McCleskey, T. Mark; Yates, Matthew Z.

    2003-07-29

    There has been invented a method for incorporating additives into polymers comprising: (a) forming an aqueous or alcohol-based colloidal system of the polymer; (b) emulsifying the colloidal system with a compressed fluid; and (c) contacting the colloidal polymer with the additive in the presence of the compressed fluid. The colloidal polymer can be contacted with the additive by having the additive in the compressed fluid used for emulsification or by adding the additive to the colloidal system before or after emulsification with the compressed fluid. The invention process can be carried out either as a batch process or as a continuous on-line process.

  8. Design of biodegradable nanoparticles: a novel approach to encapsulating poorly soluble phytochemical ellagic acid

    NASA Astrophysics Data System (ADS)

    Bala, I.; Bhardwaj, V.; Hariharan, S.; Sitterberg, J.; Bakowsky, U.; Kumar, M. N. V. Ravi

    2005-12-01

    Nanosizing of poorly water soluble drugs or incorporating them into nanoparticles to increase their solubility and thereby the bioavailability has become a favoured approach today. This work describes a novel method for encapsulating poorly water soluble phytochemical ellagic acid that is also sparingly soluble/insoluble in routine solvents used to prepare nanoparticles.

  9. Controlled cobalt doping in biogenic magnetite nanoparticles.

    PubMed

    Byrne, J M; Coker, V S; Moise, S; Wincott, P L; Vaughan, D J; Tuna, F; Arenholz, E; van der Laan, G; Pattrick, R A D; Lloyd, J R; Telling, N D

    2013-06-01

    Cobalt-doped magnetite (CoxFe3 -xO4) nanoparticles have been produced through the microbial reduction of cobalt-iron oxyhydroxide by the bacterium Geobacter sulfurreducens. The materials produced, as measured by superconducting quantum interference device magnetometry, X-ray magnetic circular dichroism, Mössbauer spectroscopy, etc., show dramatic increases in coercivity with increasing cobalt content without a major decrease in overall saturation magnetization. Structural and magnetization analyses reveal a reduction in particle size to less than 4 nm at the highest Co content, combined with an increase in the effective anisotropy of the magnetic nanoparticles. The potential use of these biogenic nanoparticles in aqueous suspensions for magnetic hyperthermia applications is demonstrated. Further analysis of the distribution of cations within the ferrite spinel indicates that the cobalt is predominantly incorporated in octahedral coordination, achieved by the substitution of Fe(2+) site with Co(2+), with up to 17 per cent Co substituted into tetrahedral sites. PMID:23594814

  10. Controlled cobalt doping in biogenic magnetite nanoparticles

    PubMed Central

    Byrne, J. M.; Coker, V. S.; Moise, S.; Wincott, P. L.; Vaughan, D. J.; Tuna, F.; Arenholz, E.; van der Laan, G.; Pattrick, R. A. D.; Lloyd, J. R.; Telling, N. D.

    2013-01-01

    Cobalt-doped magnetite (CoxFe3 −xO4) nanoparticles have been produced through the microbial reduction of cobalt–iron oxyhydroxide by the bacterium Geobacter sulfurreducens. The materials produced, as measured by superconducting quantum interference device magnetometry, X-ray magnetic circular dichroism, Mössbauer spectroscopy, etc., show dramatic increases in coercivity with increasing cobalt content without a major decrease in overall saturation magnetization. Structural and magnetization analyses reveal a reduction in particle size to less than 4 nm at the highest Co content, combined with an increase in the effective anisotropy of the magnetic nanoparticles. The potential use of these biogenic nanoparticles in aqueous suspensions for magnetic hyperthermia applications is demonstrated. Further analysis of the distribution of cations within the ferrite spinel indicates that the cobalt is predominantly incorporated in octahedral coordination, achieved by the substitution of Fe2+ site with Co2+, with up to 17 per cent Co substituted into tetrahedral sites. PMID:23594814

  11. Fabrication and characterization of magnetic nanoparticle composite membranes

    NASA Astrophysics Data System (ADS)

    Cruickshank, Akeem Armand

    To effectively and accurately deliver drugs within the human body, both new designs and components for implantable micropumps are being studied. Designs must ensure high biocompatibility, drug compatibility, accuracy and small power consumption. The focus of this thesis was to fabricate a prototype magnetic nanoparticle membrane for eventual incorporation into a biomedical pump and then determine the relationship between this membrane deflection and applied pneumatic or magnetic force. The magnetic nanoparticle polymer composite (MNPC) membranes in this study were composed of crosslinked polydimethylsiloxane (PDMS) and iron oxide nanoparticles (IONPs). An optimal iron oxide fabrication route was identified and particle size in each batch was approximately 24.6 nm. Once these nanoparticles were incorporated into a membrane (5 wt. %), the nanoparticle formed agglomerates with an average diameter of 2.26 +/-1.23 microm. Comparisons between the 0 and 5 wt. % loading of particles into the membranes indicated that the elastic modulus of the composite decreased with increasing particle concentration. The pressure- central deflection of the membranes could not be predicated by prior models and variation between magnetic and pneumatic pressure-deflection curves was quantified. Attempts to fabricate membranes with above 5 wt. % nanoparticles were not successful (no gelation). Fourier Transform Infrared (FTIR) spectroscopy results suggest that excess oleic acid on the nanoparticles prior to mixing might have prevented crosslinking.

  12. Antibacterial releasing titanium surface using albumin nanoparticle carriers.

    PubMed

    Kim, Da Hye; Kim, Kyo-Han; Kwon, Tae-Yub; Choi, Seok Hwa; Kang, Seong Soo; Kwon, Soon-Taek; Cho, Dae-Hyun; Kim, Hee Dong; Son, Jun Sik

    2014-11-01

    We developed a simple and highly efficient method for delivery from titanium (Ti) surfaces using albumin nanoparticle carriers. A Ti disc with a resorbable blasting media surface was used as a metal implant with a localized drug delivery structure. Human serum albumin (HSA) nanoparticles loaded with chlorhexidine (CHX) diacetate salt hydrate as the model drug were fabricated using a desolvation technique. The CHX-loaded HSA nanoparticles produced were cross linked with glutaraldehyde (GA). The nanoparticles were pre-coated with positively-charged polyethylenimine (PEI) molecules and then immobilized via electrical interactions on the negatively charged Ti disc surface. Our results suggested that the PEI-coated HSA nanoparticles loaded with CHX (PEI-CHX-HSA) were incorporated successfully and well-dispersed on the Ti disc surfaces. The agar diffusion test on the Ti surface treated with PEI-CHX-HSA nanoparticles showed a larger growth inhibition zone of Streptococcus mutans versus the control Ti surface, suggesting that this innovative delivery platform imparts potent antibacterial activity to the Ti surface. Thus, CHX, which inhibits the growth of oral bacteria, can be efficiently incorporated onto Ti surfaces by using HSA nanoparticles. PMID:25958539

  13. Nanoparticle-polymer composite membranes: Synthesis, characterization, and environmental applications

    NASA Astrophysics Data System (ADS)

    Taurozzi, Julian S.

    Advances in nanotechnology and materials science offer new possibilities for the development of novel water treatment technologies A salient example is the emergence of a new generation of nanostructured membranes with improved separation properties and, in some cases, multifunctional capabilities. The present work explores different aspects of the formation of nanoparticle-enabled membranes, focusing on the dependence between synthetic methods, nanoparticle properties, and the performance of the obtained membranes. The effects of nanoparticle loading, size and morphology, and methods of nanoparticle incorporation on the functional properties of the resulting nanocomposite membranes are studied. Additionally, empirical predictors of membrane performance for the rational design of nanocomposite membranes and novel strategies for the manufacture of membrane-based sensors and biofouling resistant membrane spacers are presented. The first chapter of the dissertation provides an overview of the theory of phase inversion in polymer blends -- one of the main methods for the fabrication of ultrafiltration membranes. The second chapter describes the study of the effect of shape and loading of carbon nanoparticle fillers on the hydraulic properties of nanocomposite membranes. In the third chapter, the effects of casting mixture composition and nanoparticle incorporation route on the morphological structure and separation performance of nanocomposite membranes are described and the potential use of these nanocomposites for the mitigation of membrane biofouling is discussed. Finally, in the last chapter, a method for the synthesis of a nanoparticle-enabled, membrane-based sensor for water quality control is presented.

  14. Antimicrobial polymers with metal nanoparticles.

    PubMed

    Palza, Humberto

    2015-01-01

    Metals, such as copper and silver, can be extremely toxic to bacteria at exceptionally low concentrations. Because of this biocidal activity, metals have been widely used as antimicrobial agents in a multitude of applications related with agriculture, healthcare, and the industry in general. Unlike other antimicrobial agents, metals are stable under conditions currently found in the industry allowing their use as additives. Today these metal based additives are found as: particles, ions absorbed/exchanged in different carriers, salts, hybrid structures, etc. One recent route to further extend the antimicrobial applications of these metals is by their incorporation as nanoparticles into polymer matrices. These polymer/metal nanocomposites can be prepared by several routes such as in situ synthesis of the nanoparticle within a hydrogel or direct addition of the metal nanofiller into a thermoplastic matrix. The objective of the present review is to show examples of polymer/metal composites designed to have antimicrobial activities, with a special focus on copper and silver metal nanoparticles and their mechanisms. PMID:25607734

  15. YAG:Ce nanoparticle lightsources

    NASA Astrophysics Data System (ADS)

    Masenelli, B.; Mollet, O.; Boisron, O.; Canut, B.; Ledoux, G.; Bluet, J.-M.; Mélinon, P.; Dujardin, Ch; Huant, S.

    2013-04-01

    We investigate the luminescence properties of 10 nm yttrium aluminum garnet (YAG) nanoparticles doped with Ce ions at 0.2%, 4% and 13% that are designed as active probes for scanning near-field optical microscopy. They are produced by a physical method without any subsequent treatment, which is imposed by the desired application. The structural analysis reveals the amorphous nature of the particles, which we relate to some compositional defects as indicated by the elemental analysis. The optimum emission is obtained with a doping level of 4%. The emission of the YAG nanoparticles doped at 0.2% is strongly perturbed by the crystalline disorder whereas the 13% doped particles hardly exhibit any luminescence. In the latter case, the presence of Ce4+ ions is confirmed, indicating that the Ce concentration is too high to be incorporated efficiently in YAG nanoparticles in the trivalent state. By a unique procedure combining cathodoluminescence and Rutherford backscattering spectrometry, we demonstrate that the enhancement of the particle luminescence yield is not proportional to the doping concentration, the emission enhancement being larger than the Ce concentration increase. Time-resolved photoluminescence reveals the presence of quenching centres likely related to the crystalline disorder as well as the presence of two distinct Ce ion populations. Eventually, nano-cathodoluminescence indicates that the emission and therefore the distribution of the doping Ce ions and of the defects are homogeneous.

  16. Antimicrobial Polymers with Metal Nanoparticles

    PubMed Central

    Palza, Humberto

    2015-01-01

    Metals, such as copper and silver, can be extremely toxic to bacteria at exceptionally low concentrations. Because of this biocidal activity, metals have been widely used as antimicrobial agents in a multitude of applications related with agriculture, healthcare, and the industry in general. Unlike other antimicrobial agents, metals are stable under conditions currently found in the industry allowing their use as additives. Today these metal based additives are found as: particles, ions absorbed/exchanged in different carriers, salts, hybrid structures, etc. One recent route to further extend the antimicrobial applications of these metals is by their incorporation as nanoparticles into polymer matrices. These polymer/metal nanocomposites can be prepared by several routes such as in situ synthesis of the nanoparticle within a hydrogel or direct addition of the metal nanofiller into a thermoplastic matrix. The objective of the present review is to show examples of polymer/metal composites designed to have antimicrobial activities, with a special focus on copper and silver metal nanoparticles and their mechanisms. PMID:25607734

  17. Reducing the cytotoxicity of inhalable engineered nanoparticles via in situ passivation with biocompatible materials.

    PubMed

    Byeon, Jeong Hoon; Park, Jae Hong; Peters, Thomas M; Roberts, Jeffrey T

    2015-07-15

    The cytotoxicity of model welding nanoparticles was modulated through in situ passivation with soluble biocompatible materials. A passivation process consisting of a spark discharge particle generator coupled to a collison atomizer as a co-flow or counter-flow configuration was used to incorporate the model nanoparticles with chitosan. The tested model welding nanoparticles are inhaled and that A549 cells are a human lung epithelial cell line. Measurements of in vitro cytotoxicity in A549 cells revealed that the passivated nanoparticles had a lower cytotoxicity (>65% in average cell viability, counter-flow) than the untreated model nanoparticles. Moreover, the co-flow incorporation between the nanoparticles and chitosan induced passivation of the nanoparticles, and the average cell viability increased by >80% compared to the model welding nanoparticles. As a more convenient way (additional chitosan generation and incorporation devices may not be required), other passivation strategies through a modification of the welding rod with chitosan adhesive and graphite paste did also enhance average cell viability (>58%). The approach outlined in this work is potentially generalizable as a new platform, using only biocompatible materials in situ, to treat nanoparticles before they are inhaled. PMID:25797930

  18. Piezoelectric Nanoparticle-Polymer Composite Materials

    NASA Astrophysics Data System (ADS)

    McCall, William Ray

    Herein we demonstrate that efficient piezoelectric nanoparticle-polymer composite materials can be synthesized and fabricated into complex microstructures using sugar-templating methods or optical printing techniques. Stretchable foams with excellent tunable piezoelectric properties are created by incorporating sugar grains directly into polydimethylsiloxane (PDMS) mixtures containing barium titanate (BaTiO3 -- BTO) nanoparticles and carbon nanotubes (CNTs), followed by removal of the sugar after polymer curing. Porosities and elasticity are tuned by simply adjusting the sugar/polymer mass ratio and the electrical performance of the foams showed a direct relationship between porosity and the piezoelectric outputs. User defined 2D and 3D optically printed piezoelectric microstructures are also fabricated by incorporating BTO nanoparticles into photoliable polymer solutions such as polyethylene glycol diacrylate (PEGDA) and exposing to digital optical masks that can be dynamically altered. Mechanical-to-electrical conversion efficiency of the optically printed composite is enhanced by chemically altering the surface of the BTO nanoparticles with acrylate groups which form direct covalent linkages with the polymer matrix under light exposure. Both of these novel materials should find exciting uses in a variety of applications including energy scavenging platforms, nano- and microelectromechanical systems (NEMS/MEMS), sensors, and acoustic actuators.

  19. Iron Nanoparticles in Reactive Environmental Barriers

    SciTech Connect

    Nuxoll, Eric E.; Shimotori, Tsutomu; Arnold, William A.; Cussler, Edward L.

    2003-09-23

    Zero-valent iron is cheap, environmentally innocuous, and effective at reducing chlorinated organics. It has, as a result, become a popular candidate for remediating aquifers contaminated with trichloroethylene and other halogenated pollutants. In this paper, we discuss one such system, where iron nanoparticles are synthesized and incorporated into polyvinyl alcohol membranes, forming water-permeable barriers to these pollutants. These barriers are tested against a variety of contaminants, including carbon tetrachloride, copper, and chromate.

  20. Crystallization of hollow mesoporous silica nanoparticles.

    PubMed

    Drisko, Glenna L; Carretero-Genevrier, Adrian; Perrot, Alexandre; Gich, Martí; Gàzquez, Jaume; Rodriguez-Carvajal, Juan; Favre, Luc; Grosso, David; Boissière, Cédric; Sanchez, Clément

    2015-03-11

    Complex 3D macrostructured nanoparticles are transformed from amorphous silica into pure polycrystalline α-quartz using catalytic quantities of alkaline earth metals as devitrifying agent. Walls as thin as 10 nm could be crystallized without losing the architecture of the particles. The roles of cation size and the mol% of the incorporated devitrifying agent in crystallization behavior are studied, with Mg(2+), Ca(2+), Sr(2+) and Ba(2+) all producing pure α-quartz under certain conditions. PMID:25503642

  1. 17 CFR 260.7a-30 - Identification of material incorporated; form of incorporation.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 17 Commodity and Securities Exchanges 3 2012-04-01 2012-04-01 false Identification of material... Incorporation by Reference § 260.7a-30 Identification of material incorporated; form of incorporation. In each case of incorporation by reference, the matter incorporated shall be clearly identified in...

  2. 17 CFR 260.7a-30 - Identification of material incorporated; form of incorporation.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 17 Commodity and Securities Exchanges 4 2014-04-01 2014-04-01 false Identification of material... Incorporation by Reference § 260.7a-30 Identification of material incorporated; form of incorporation. In each case of incorporation by reference, the matter incorporated shall be clearly identified in...

  3. 17 CFR 260.7a-30 - Identification of material incorporated; form of incorporation.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 17 Commodity and Securities Exchanges 3 2011-04-01 2011-04-01 false Identification of material... Incorporation by Reference § 260.7a-30 Identification of material incorporated; form of incorporation. In each case of incorporation by reference, the matter incorporated shall be clearly identified in...

  4. 17 CFR 260.7a-30 - Identification of material incorporated; form of incorporation.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 17 Commodity and Securities Exchanges 3 2013-04-01 2013-04-01 false Identification of material... Incorporation by Reference § 260.7a-30 Identification of material incorporated; form of incorporation. In each case of incorporation by reference, the matter incorporated shall be clearly identified in...

  5. Photocurrent enhancements of organic solar cells by altering dewetting of plasmonic Ag nanoparticles

    PubMed Central

    Fleetham, Tyler; Choi, Jea-Young; Choi, Hyung Woo; Alford, Terry; Jeong, Doo Seok; Lee, Taek Sung; Lee, Wook Seong; Lee, Kyeong-Seok; Li, Jian; Kim, Inho

    2015-01-01

    Incorporation of metal nanoparticles into active layers of organic solar cells is one of the promising light trapping approaches. The size of metal nanoparticles is one of key factors to strong light trapping, and the size of thermally evaporated metal nanoparticles can be tuned by either post heat treatment or surface modification of substrates. We deposited Ag nanoparticles on ITO by varying nominal thicknesses, and post annealing was carried out to increase their size in radius. PEDOT:PSS was employed onto the ITO substrates as a buffer layer to alter the dewetting behavior of Ag nanoparticles. The size of Ag nanoparticles on PEDOT:PSS were dramatically increased by more than three times compared to those on the ITO substrates. Organic solar cells were fabricated on the ITO and PEDOT:PSS coated ITO substrates with incorporation of those Ag nanoparticles, and their performances were compared. The photocurrents of the cells with the active layers on PEDOT:PSS with an optimal choice of the Ag nanoparticles were greatly enhanced whereas the Ag nanoparticles on the ITO substrates did not lead to the photocurrent enhancements. The origin of the photocurrent enhancements with introducing the Ag nanoparticles on PEDOT:PSS are discussed. PMID:26388104

  6. Delineating the pathways for the site-directed synthesis of individual nanoparticles on surfaces

    PubMed Central

    Liu, Guoliang; Eichelsdoerfer, Daniel J.; Rasin, Boris; Zhou, Yu; Brown, Keith A.; Liao, Xing; Mirkin, Chad A.

    2013-01-01

    Although nanoparticles with exquisite properties have been synthesized for a variety of applications, their incorporation into functional devices is challenging owing to the difficulty in positioning them at specified sites on surfaces. In contrast with the conventional synthesis-then-assembly paradigm, scanning probe block copolymer lithography can pattern precursor materials embedded in a polymer matrix and synthesize desired nanoparticles on site, offering great promise for incorporating nanoparticles into devices. This technique, however, is extremely limited from a materials standpoint. To develop a materials-general method for synthesizing nanoparticles on surfaces for broader applications, a mechanistic understanding of polymer-mediated nanoparticle formation is crucial. Here, we design a four-step synthetic process that enables independent study of the two most critical steps for synthesizing single nanoparticles on surfaces: phase separation of precursors and particle formation. Using this process, we elucidate the importance of the polymer matrix in the diffusion of metal precursors to form a single nanoparticle and the three pathways that the precursors undergo to form nanoparticles. Based on this mechanistic understanding, the synthetic process is generalized to create metal (Au, Ag, Pt, and Pd), metal oxide (Fe2O3, Co2O3, NiO, and CuO), and alloy (AuAg) nanoparticles. This mechanistic understanding and resulting process represent a major advance in scanning probe lithography as a tool to generate patterns of tailored nanoparticles for integration with solid-state devices. PMID:23277538

  7. Toxicity of food-relevant nanoparticles in intestinal epithelial models

    NASA Astrophysics Data System (ADS)

    McCracken, Christie

    Nanoparticles are increasingly being incorporated into common consumer products, including in foods and food packaging, for their unique properties at the nanoscale. Food-grade silica and titania are used as anti-caking and whitening agents, respectively, and these particle size distributions are composed of approximately one-third nanoparticles. Zinc oxide and silver nanoparticles can be used for their antimicrobial properties. However, little is known about the interactions of nanoparticles in the body upon ingestion. This study was performed to investigate the role of nanoparticle characteristics including surface chemistry, dissolution, and material type on toxicity to the intestinal epithelium. Only mild acute toxicity of zinc oxide nanoparticles was observed after 24-hour treatment of intestinal epithelial C2BBe1 cells based on the results of toxicity assays measuring necrosis, apoptosis, membrane damage, and mitochondrial activity. Silica and titanium dioxide nanoparticles were not observed to be toxic although all nanoparticles were internalized by cells. In vitro digestion of nanoparticles in solutions representing the stomach and intestines prior to treatment of cells did not alter nanoparticle toxicity. Long-term repeated treatment of cells weekly for 24 hours with nanoparticles did not change nanoparticle cytotoxicity or the growth rate of the treated cell populations. Thus, silica, titanium dioxide, and zinc oxide nanoparticles were found to induce little toxicity in intestinal epithelial cells. Fluorescent silica nanoparticles were synthesized as a model for silica used in foods that could be tracked in vitro and in vivo. To maintain an exterior of pure silica, a silica shell was hydrolyzed around a core particle of quantum dots or a fluorescent dye electrostatically associated with a commercial silica particle. The quantum dots used were optimized from a previously reported microwave quantum dot synthesis to a quantum yield of 40%. Characterization of the silica particles showed that the surface properties resembled pure silica. These particles were able to be detected in vitro as well as in vivo after oral administration of nanoparticles to mice by gavage. After four daily administrations, nanoparticles were detected by fluorescence confocal microscopy in intestines as well as liver, kidney, spleen, lung, and brain. Thus, silica nanoparticles were able to traverse the intestinal epithelium. Further investigation is needed to determine nanoparticle accumulation and potential functional consequences throughout the body. Silver nanoparticles were particularly toxic to proliferating (subconfluent) C2BBe1 cells plated at low density, inducing 15% necrosis and a 76% decrease in mitochondrial activity. Silver nanoparticle treatment induced oxidative stress in cells based on increased GSH/GSSG ratios. In addition, silver nanoparticles induced G2/M phase cell cycle arrest and inhibited cell proliferation at doses forty times lower than those at which silica, titanium dioxide, and zinc oxide nanoparticles had inhibitory effects. Silver nanoparticles subjected to in vitro digestion before cell exposure required higher doses to induce toxicity, likely due to slower dissolution because of greater surface species adsorption. Silver nanoparticles did not cause toxicity or oxidative stress in confluent (stationary) cells. Thus, upon ingestion, silver nanoparticles may be especially toxic to proliferating stem cells in intestinal crypts, particularly in disease states with a compromised epithelium.

  8. Photothermal guidance for selective photothermolysis with nanoparticles

    NASA Astrophysics Data System (ADS)

    Zharov, Vladimir P.; Galitovskaya, Elena; Viegas, Mark

    2004-07-01

    Photothermal (PT) technique was applied to optimizing selective photothermolysis of cancer cells and bacteria into which nanoparticles have been incorporated (selective "nanophotothermolysis"). This technique involved first irradiating nanoparticles-penetrated cells with nanosecond pump-laser pulses in the visible spectral ranges. Laser-induced local thermal effects around the nanoparticles in the cancer cells or bacteria were then detected via time-resolved monitoring of temperature-dependent variations of the refractive index. This procedure was accomplished with imaging of a second probe-laser pulse. Analysis of the distinctive temporal shape of the PT response revealed linear and nonlinear phenomena around nanoparticles, such as alteration of local temperature, and bubble-formation-caused cell death accompanied by laser-induced melting and disintegration of particles. The damage threshold was obtained for live cancer cells in vitro depended on the size (range: 2-250 nm) and number of particles, laser energy, and number of pulses. Local heat-based induction of apoptosis and necrosis was controlled in parallel with conventional kits (e.g. trypan blue, Annexin V-propidium iodide) and optical and electron microscopy. The PT technique potentially allowed for the detection of nanoparticles that had been delivered into live cells by direct microinjection, natural diffusion, and selective targeting with antibodies.

  9. Modified natural nanoparticles as contrast agents for medical imaging

    PubMed Central

    Cormode, David P.; Jarzyna, Peter A.; Mulder, Willem J. M.; Fayad, Zahi A.

    2009-01-01

    The development of novel and effective contrast agents is one of the drivers of the ongoing improvement in medical imaging. Many of the new agents reported are nanoparticle-based. There are a variety of natural nanoparticles known, e.g. lipoproteins, viruses or ferritin. Natural nanoparticles have advantages as delivery platforms such as biodegradability. In addition, our understanding of natural nanoparticles is quite advanced, allowing their adaptation as contrast agents. They can be labeled with small molecules or ions such as Gd3+ to act as contrast agents for magnetic resonance imaging, 18F to act as positron emission tomography contrast agents or fluorophores to act as contrast agents for fluorescence techniques. Additionally, inorganic nanoparticles such as iron oxide, gold nanoparticles or quantum dots can be incorporated to add further contrast functionality. Furthermore, these natural nanoparticle contrast agents can be rerouted from their natural targets via the attachment of targeting molecules. In this review, we discuss the various modified natural nanoparticles that have been exploited as contrast agents. PMID:19900496

  10. Electrostatic assembly of binary nanoparticle superlattices using protein cages

    NASA Astrophysics Data System (ADS)

    Kostiainen, Mauri A.; Hiekkataipale, Panu; Laiho, Ari; Lemieux, Vincent; Seitsonen, Jani; Ruokolainen, Janne; Ceci, Pierpaolo

    2013-01-01

    Binary nanoparticle superlattices are periodic nanostructures with lattice constants much shorter than the wavelength of light and could be used to prepare multifunctional metamaterials. Such superlattices are typically made from synthetic nanoparticles, and although biohybrid structures have been developed, incorporating biological building blocks into binary nanoparticle superlattices remains challenging. Protein-based nanocages provide a complex yet monodisperse and geometrically well-defined hollow cage that can be used to encapsulate different materials. Such protein cages have been used to program the self-assembly of encapsulated materials to form free-standing crystals and superlattices at interfaces or in solution. Here, we show that electrostatically patchy protein cages--cowpea chlorotic mottle virus and ferritin cages--can be used to direct the self-assembly of three-dimensional binary superlattices. The negatively charged cages can encapsulate RNA or superparamagnetic iron oxide nanoparticles, and the superlattices are formed through tunable electrostatic interactions with positively charged gold nanoparticles. Gold nanoparticles and viruses form an AB8fcc crystal structure that is not isostructural with any known atomic or molecular crystal structure and has previously been observed only with large colloidal polymer particles. Gold nanoparticles and empty or nanoparticle-loaded ferritin cages form an interpenetrating simple cubic AB structure (isostructural with CsCl). We also show that these magnetic assemblies provide contrast enhancement in magnetic resonance imaging.

  11. Synthesis and Characterization of Gold-Titanium Dioxide Nanoparticles

    NASA Astrophysics Data System (ADS)

    Cramer, Hailey; Shah, Ismat

    2013-03-01

    Nanoparticles are of recent scientific interest due to their unique size-dependent optical, electrical, and catalytic properties. Gold nanoparticles specifically, have many potential applications, especially in optoelectronic devices due to their optical properties and plasmon resonance. The specific goals of this research are to synthesize Au/TiO2 core-shell nanoparticles for their use in improving the overall efficiency of P3HT/PCBM polymer solar cells previously prepared in our lab. The standard sodium citrate reduction method was used to synthesize gold nanoparticles with an average diameter of 15 nm. Through changing the concentration of sodium citrate in solution we were able to tune the size of the nanoparticles, and therefore change their light-absorbing properties. The goals of this research are to cap the gold nanoparticles with TiO2 through a sol-gel method. Characterization of the Au/TiO2 particles will be performed using high resolution tunneling electron microscopy to determine the size of the nanoparticles and the thickness of the TiO2 shell. In addition, ultraviolet-visual spectroscopy was used to determine the absorption of the particles, and dynamic light scattering was used to confirm the size distribution of the particles. The incorporation of Au/TiO2 nanoparticles in P3HT/PCBM devices will be discussed.

  12. Functionalized mesoporous silica nanoparticles for oral delivery of budesonide

    SciTech Connect

    Yoncheva, K.; Popova, M.; Szegedi, A.; Mihaly, J.; Tzankov, B.; Lambov, N.; Konstantinov, S.; Tzankova, V.; Pessina, F.; Valoti, M.

    2014-03-15

    Non-functionalized and amino-functionalized mesoporous silica nanoparticle were loaded with anti-inflammatory drug budesonide and additionally post-coated with bioadhesive polymer (carbopol). TEM images showed spherical shape of the nanoparticles and slightly higher polydispersity after coating with carbopol. Nitrogen physisorption and thermogravimetic analysis revealed that more efficient loading and incorporation into the pores of nanoparticles was achieved with the amino-functionalized silica carrier. Infrared spectra indicated that the post-coating of these nanoparticles with carbopol led to the formation of bond between amino groups of the functionalized carrier and carboxyl groups of carbopol. The combination of amino-functionalization of the carrier with the post-coating of the nanoparticles sustained budesonide release. Further, an in vitro model of inflammatory bowel disease showed that the cytoprotective effect of budesonide loaded in the post-coated silica nanoparticles on damaged HT-29 cells was more pronounced compared to the cytoprotection obtained with pure budesonide. -- Graphical abstract: Silica mesoporous MCM-41 particles were amino-functionalized, loaded with budesonide and post-coated with bioadhesive polymer (carbopol) in order to achieve prolonged residence of anti-inflammatory drug in GIT. Highlights: • Higher drug loading in amino-functionalized mesoporous silica. • Amino-functionalization and post-coating of the nanoparticles sustained drug release. • Achievement of higher cytoprotective effect with drug loaded into the nanoparticles.

  13. Antioxidative and antiinflammatory activities of quercetin-loaded silica nanoparticles.

    PubMed

    Lee, Ga Hyun; Lee, Sung June; Jeong, Sang Won; Kim, Hyun-Chul; Park, Ga Young; Lee, Se Geun; Choi, Jin Hyun

    2016-07-01

    Utilizing the biological activities of compounds by encapsulating natural components in stable nanoparticles is an important strategy for a variety of biomedical and healthcare applications. In this study, quercetin-loaded silica nanoparticles were synthesized using an oil-in-water microemulsion method, which is a suitable system for producing functional nanoparticles of controlled size and shape. The resulting quercetin-loaded silica nanoparticles were spherical, highly monodispersed, and stable in an aqueous system. Superoxide radical scavenging effects were found for the quercetin-loaded silica nanoparticles as well as free quercetin. The quercetin-loaded silica nanoparticles showed cell viability comparable to that of the controls. The amounts of proinflammatory cytokines produced by macrophages, such as interleukin 1 beta, interleukin 6, and tumor necrosis factor alpha, were reduced significantly for the quercetin-loaded silica nanoparticles. These results suggest that the antioxidative and antiinflammatory activities of quercetin are maintained after encapsulation in silica. Silica nanoparticles can be used for the effective and stable incorporation of biologically active natural components into composite biomaterials. PMID:27038916

  14. Two-Phase Electrospinning to Incorporate Polyelectrolyte Complexes and Growth Factors into Electrospun Chitosan Nanofibers.

    PubMed

    Place, Laura W; Sekyi, Maria; Taussig, Julia; Kipper, Matt J

    2016-03-01

    Growth factors are potent signaling proteins for tissue engineering, but they are susceptible to loss of activity when exposed to solvents used for polymer processing. This work explores preservation of fibroblast growth factor-2 (FGF-2) activity in chitosan nanofibers using two-phase electrospinning via a compound coaxial needle and from a water-in-oil emulsion FGF-2 in aqueous poly(vinyl alcohol) is added on either the inside (A/O) or the outside (O/A) of an organic chitosan phase, using the compound needle. FGF-2 is further stabilized by complexation to heparin-based nanoparticles. The emulsion method does not result in detectable incorporation of FGF-2. The A/O fibers incorporate the highest amount of FGF-2. Nanoparticle-stabilized FGF-2 in A/O nanofibers is most active toward bone-marrow stromal cells. PMID:26611767

  15. Nanoparticles for transcutaneous vaccination

    PubMed Central

    Hansen, Steffi; Lehr, Claus‐Michael

    2012-01-01

    Summary The living epidermis and dermis are rich in antigen presenting cells (APCs). Their activation can elicit a strong humoral and cellular immune response as well as mucosal immunity. Therefore, the skin is a very attractive site for vaccination, and an intradermal application of antigen may be much more effective than a subcutaneous or intramuscular injection. However, the stratum corneum (SC) is a most effective barrier against the invasion of topically applied vaccines. Products which have reached the stage of clinical testing, avoid this problem by injecting the nano‐vaccine intradermally or by employing a barrier disrupting method and applying the vaccine to a relatively large skin area. Needle‐free vaccination is desirable from a number of aspects: ease of application, improved patient acceptance and less risk of infection among them. Nanocarriers can be designed in a way that they can overcome the SC. Also incorporation into nanocarriers protects instable antigen from degradation, improves uptake and processing by APCs, and facilitates endosomal escape and nuclear delivery of DNA vaccines. In addition, sustained release systems may build a depot in the tissue gradually releasing antigen which may avoid booster doses. Therefore, nanoformulations of vaccines for transcutaneous immunization are currently a very dynamic field of research. Among the huge variety of nanocarrier systems that are investigated hopes lie on ultra‐flexible liposomes, superfine rigid nanoparticles and nanocarriers, which are taken up by hair follicles. The potential and pitfalls associated with these three classes of carriers will be discussed. PMID:21854553

  16. Synthesis and applications of novel silver nanoparticle structures

    NASA Astrophysics Data System (ADS)

    Dukes, Kyle

    The field of nanotechnology is rapidly expanding across disciplines as each new development is realized. New exciting technologies are being driven by advances in the application of nanotechnology; including biochemical, optical, and semiconductors research. This thesis will focus on the use of silver nanoparticles as optical labels on cells, methods of forming different small structures of silver nanoparticles, as well as the use of silver nanoparticles in the development of a photovoltaic cell. Silver nanoparticles have been modified with self-assembled monolayers of hydroxyl-terminated long chain thiols and encapsulated with a silica shell. The resulting core-shell nanoparticles were used as optical labels for cell analysis using flow cytometry and microscopy. The excitation of plasmon resonances in nanoparticles results in strong depolarized scattering of visible light permitting detection at the single nanoparticle level. The nanoparticles were modified with neutravidin via epoxide-azide coupling chemistry and biotinylated antibodies targeting cell surface receptors were bound to the nanoparticle surface. The nanoparticle labels exhibited long-term stability under physiological conditions without aggregation or silver ion leaching. Labeled cells exhibited two orders of magnitude enhancement of the scattering intensity compared to unlabeled cells. Dimers of silver nanoparticles have been fabricated by first immobilizing a monolayer of single silver nanoparticles onto poly(4-vinylpyridine) covered glass slides. The monolayer was then exposed to adenine, which has two amines which will bind to silver. The nanoparticle monolayer, now modified with adenine, is exposed to a second suspension of nanoparticles which will bind with the amine modified monolayer. Finally, a thin silica shell is formed about the structure via solgel chemistry to prevent dissolution or aggregation upon sonication/striping. Circular arrays of silver nanoparticels are developed using a template base self assembly. A 1.5 micron silica sphere is bound to poly(4-vinylpyridine) coated glass and used as a template. a mask of silica monoxide is vacuum deposited atop the spheres/glass leaving a ring just below the sphere untouched and able to bind silver nanoparticles. Optical microscopy reveal interesting results under depolarized light conditions, but ultimate structural analysis has proven elusive. Semiconducting p-type cuprous oxide was electrochemically deposited on both silver and indium tin oxide electrodes. Silver nanoparticles were incorporated into the architecture either atop the cuprous oxide or sandwiched between cuprous oxide and n-type material. Increases in photocurrent were observed in both cases and further work must be conducted to optimize a solid state device for photovoltaic applications.

  17. Finite Size Effects on the Real-Space Pair Distribution Function of Nanoparticles

    SciTech Connect

    Gilbert, Benjamin

    2008-10-01

    The pair distribution function (PDF) method is a powerful approach for the analysis of the structure of nanoparticles. An important approximation used in nanoparticle PDF simulations is the incorporation of a form factor describing nanoparticle size and shape. The precise effect of the form factor on the PDF is determined by both particle shape and structure if these characteristics are both anisotropic and correlated. The correct incorporation of finite size effects is important for distinguishing and quantifying the structural consequences of small particle size in nanomaterials.

  18. On the thermal stability of volume holograms recorded in nanoparticle-polymer composite films

    NASA Astrophysics Data System (ADS)

    Tomita, Yasuo; Nakamura, Toshihiro; Tago, Atsushi

    2008-04-01

    We report on measurements of thermal expansion coefficients and temperature-dependent refractive indices of nanoparticle-polymer composite films in which plane-wave volume holograms are recorded. These physical constants are evaluated for photopolymer films with the incorporation of inorganic nanoparticles or binder polymer. We show that the incorporation of inorganic nanoparticles in photopolymer is a very effective method to suppress temperature-dependent film-thickness and refractive-index changes as well as to increase the refractive index modulation and reduce polymerization shrinkage.

  19. Cationic additives in nanosystems activate cytotoxicity and inflammatory response of human neutrophils: lipid nanoparticles versus polymeric nanoparticles

    PubMed Central

    Hwang, Tsong-Long; Aljuffali, Ibrahim A; Lin, Chwan-Fwu; Chang, Yuan-Ting; Fang, Jia-You

    2015-01-01

    This report compares the effect of lipid and polymeric nanoparticles upon human neutrophils in the presence of cationic surfactants. Nanostructured lipid carriers and poly(lactic-co-glycolic) acid nanoparticles were manufactured as lipid and polymeric systems, respectively. Some cytotoxic and proinflammatory mediators such as lactate dehydrogenase (LDH), elastase, O2•−, and intracellular Ca2+ were examined. The nanoparticles showed a size of 170–225 nm. Incorporation of cetyltrimethylammonium bromide or soyaethyl morpholinium ethosulfate, the cationic surfactant, converted zeta potential from a negative to a positive charge. Nanoparticles without cationic surfactants revealed a negligible change on immune and inflammatory responses. Cationic surfactants in both nanoparticulate and free forms induced cell death and the release of mediators. Lipid nanoparticles generally demonstrated a greater response compared to polymeric nanoparticles. The neutrophil morphology observed by electron microscopy confirmed this trend. Cetyltrimethylammonium bromide as the coating material showed more significant activation of neutrophils than soyaethyl morpholinium ethosulfate. Confocal microscope imaging displayed a limited internalization of nanoparticles into neutrophils. It is proposed that cationic nanoparticles interact with the cell membrane, triggering membrane disruption and the following Ca2+ influx. The elevation of intracellular Ca2+ induces degranulation and oxidative stress. The consequence of these effects is cytotoxicity and cell death. Caution should be taken when selecting feasible nanoparticulate formulations and cationic additives for consideration of applicability and toxicity. PMID:25609950

  20. 49 CFR 572.30 - Incorporated materials.

    Code of Federal Regulations, 2014 CFR

    2014-10-01

    ... 49 Transportation 7 2014-10-01 2014-10-01 false Incorporated materials. 572.30 Section 572.30....30 Incorporated materials. (a) The drawings and specifications referred to in this regulation that... Federal Register has approved the materials incorporated by reference. For materials subject to...

  1. 49 CFR 572.190 - Incorporated materials.

    Code of Federal Regulations, 2013 CFR

    2013-10-01

    ... Register approved the materials incorporated by reference in accordance with 5 U.S.C. 552(a) and 1 CFR part... 49 Transportation 7 2013-10-01 2013-10-01 false Incorporated materials. 572.190 Section 572.190... Test Dummy, Small Adult Female § 572.190 Incorporated materials. (a) The following materials are...

  2. 49 CFR 587.5 - Incorporated materials.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ... 49 Transportation 7 2011-10-01 2011-10-01 false Incorporated materials. 587.5 Section 587.5... Barrier § 587.5 Incorporated materials. (a) The drawings and specifications referred to in this regulation that are not set forth in full are hereby incorporated in this part by reference. These materials...

  3. 49 CFR 572.190 - Incorporated materials.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ... Register approved the materials incorporated by reference in accordance with 5 U.S.C. 552(a) and 1 CFR part... 49 Transportation 7 2011-10-01 2011-10-01 false Incorporated materials. 572.190 Section 572.190... Dummy, Small Adult Female § 572.190 Incorporated materials. (a) The following materials are...

  4. 49 CFR 572.30 - Incorporated materials.

    Code of Federal Regulations, 2012 CFR

    2012-10-01

    ... 49 Transportation 7 2012-10-01 2012-10-01 false Incorporated materials. 572.30 Section 572.30....30 Incorporated materials. (a) The drawings and specifications referred to in this regulation that... Federal Register has approved the materials incorporated by reference. For materials subject to...

  5. 49 CFR 587.5 - Incorporated materials.

    Code of Federal Regulations, 2013 CFR

    2013-10-01

    ... 49 Transportation 7 2013-10-01 2013-10-01 false Incorporated materials. 587.5 Section 587.5... Barrier § 587.5 Incorporated materials. (a) The drawings and specifications referred to in this regulation that are not set forth in full are hereby incorporated in this part by reference. These materials...

  6. 49 CFR 572.190 - Incorporated materials.

    Code of Federal Regulations, 2014 CFR

    2014-10-01

    ... Register approved the materials incorporated by reference in accordance with 5 U.S.C. 552(a) and 1 CFR part... 49 Transportation 7 2014-10-01 2014-10-01 false Incorporated materials. 572.190 Section 572.190... Test Dummy, Small Adult Female § 572.190 Incorporated materials. (a) The following materials are...

  7. 49 CFR 572.30 - Incorporated materials.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ... 49 Transportation 7 2011-10-01 2011-10-01 false Incorporated materials. 572.30 Section 572.30....30 Incorporated materials. (a) The drawings and specifications referred to in this regulation that... Federal Register has approved the materials incorporated by reference. For materials subject to...

  8. 49 CFR 572.190 - Incorporated materials.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ... Register approved the materials incorporated by reference in accordance with 5 U.S.C. 552(a) and 1 CFR part... 49 Transportation 7 2010-10-01 2010-10-01 false Incorporated materials. 572.190 Section 572.190... Dummy, Small Adult Female § 572.190 Incorporated materials. (a) The following materials are...

  9. 49 CFR 572.30 - Incorporated materials.

    Code of Federal Regulations, 2013 CFR

    2013-10-01

    ... 49 Transportation 7 2013-10-01 2013-10-01 false Incorporated materials. 572.30 Section 572.30....30 Incorporated materials. (a) The drawings and specifications referred to in this regulation that... Federal Register has approved the materials incorporated by reference. For materials subject to...

  10. 49 CFR 587.5 - Incorporated materials.

    Code of Federal Regulations, 2014 CFR

    2014-10-01

    ... 49 Transportation 7 2014-10-01 2014-10-01 false Incorporated materials. 587.5 Section 587.5... Barrier § 587.5 Incorporated materials. (a) The drawings and specifications referred to in this regulation that are not set forth in full are hereby incorporated in this part by reference. These materials...

  11. 49 CFR 572.180 - Incorporated materials.

    Code of Federal Regulations, 2013 CFR

    2013-10-01

    ... approved the materials incorporated by reference in accordance with 5 U.S.C. 552(a) and 1 CFR part 51... 49 Transportation 7 2013-10-01 2013-10-01 false Incorporated materials. 572.180 Section 572.180... Test Dummy, 50th Percentile Adult Male § 572.180 Incorporated materials. (a) The following...

  12. 49 CFR 572.180 - Incorporated materials.

    Code of Federal Regulations, 2014 CFR

    2014-10-01

    ... approved the materials incorporated by reference in accordance with 5 U.S.C. 552(a) and 1 CFR part 51... 49 Transportation 7 2014-10-01 2014-10-01 false Incorporated materials. 572.180 Section 572.180... Test Dummy, 50th Percentile Adult Male § 572.180 Incorporated materials. (a) The following...

  13. 49 CFR 572.180 - Incorporated materials.

    Code of Federal Regulations, 2012 CFR

    2012-10-01

    ... approved the materials incorporated by reference in accordance with 5 U.S.C. 552(a) and 1 CFR part 51... 49 Transportation 7 2012-10-01 2012-10-01 false Incorporated materials. 572.180 Section 572.180... Dummy, 50th Percentile Adult Male § 572.180 Incorporated materials. (a) The following materials...

  14. 49 CFR 587.5 - Incorporated materials.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ... 49 Transportation 7 2010-10-01 2010-10-01 false Incorporated materials. 587.5 Section 587.5... Barrier § 587.5 Incorporated materials. (a) The drawings and specifications referred to in this regulation that are not set forth in full are hereby incorporated in this part by reference. These materials...

  15. 49 CFR 587.5 - Incorporated materials.

    Code of Federal Regulations, 2012 CFR

    2012-10-01

    ... 49 Transportation 7 2012-10-01 2012-10-01 false Incorporated materials. 587.5 Section 587.5... Barrier § 587.5 Incorporated materials. (a) The drawings and specifications referred to in this regulation that are not set forth in full are hereby incorporated in this part by reference. These materials...

  16. 49 CFR 572.30 - Incorporated materials.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ... 49 Transportation 7 2010-10-01 2010-10-01 false Incorporated materials. 572.30 Section 572.30....30 Incorporated materials. (a) The drawings and specifications referred to in this regulation that... Federal Register has approved the materials incorporated by reference. For materials subject to...

  17. 49 CFR 572.190 - Incorporated materials.

    Code of Federal Regulations, 2012 CFR

    2012-10-01

    ... Register approved the materials incorporated by reference in accordance with 5 U.S.C. 552(a) and 1 CFR part... 49 Transportation 7 2012-10-01 2012-10-01 false Incorporated materials. 572.190 Section 572.190... Dummy, Small Adult Female § 572.190 Incorporated materials. (a) The following materials are...

  18. Numeral Incorporation in Japanese Sign Language

    ERIC Educational Resources Information Center

    Ktejik, Mish

    2013-01-01

    This article explores the morphological process of numeral incorporation in Japanese Sign Language. Numeral incorporation is defined and the available research on numeral incorporation in signed language is discussed. The numeral signs in Japanese Sign Language are then introduced and followed by an explanation of the numeral morphemes which are

  19. Numeral Incorporation in Japanese Sign Language

    ERIC Educational Resources Information Center

    Ktejik, Mish

    2013-01-01

    This article explores the morphological process of numeral incorporation in Japanese Sign Language. Numeral incorporation is defined and the available research on numeral incorporation in signed language is discussed. The numeral signs in Japanese Sign Language are then introduced and followed by an explanation of the numeral morphemes which are…

  20. Incorporation of Heparin into Biomaterials

    PubMed Central

    Sakiyama-Elbert, Shelly E

    2013-01-01

    This review provides an overview on the incorporation of heparin into biomaterials with a focus on drug delivery and the use of heparin-based biomaterials for self-assembly of polymer networks. Heparin conjugation to biomaterials was originally explored to reduce the thrombogenicity of materials in contact with blood. Many of the conjugation strategies that were developed for these applications are still popular today for other applications. More recently heparin has been conjugated to biomaterials for drug delivery applications. Many of the delivery approaches have taken advantage of the ability of heparin to bind to a wide variety of growth factors, protect them from degradation and to potentiate their interactions with cell surface receptors. More recently, the use of heparin as a base polymer for scaffold fabrication has also been explored, often utilizing non-covalent binding of heparin with peptides or proteins to promote self-assembly of hydrogel networks. This review will highlight recent advances in each of these areas. PMID:24021232

  1. Cell tracking using nanoparticles.

    PubMed

    Vaccaro, Dennis E; Yang, Meiheng; Weinberg, James S; Reinhardt, Christopher P; Groman, Ernest V

    2008-09-01

    Tracking cells in regenerative medicine is becoming increasingly important for basic cell therapy science, for cell delivery optimization and for accurate biodistribution studies. This report describes nanoparticles that utilize stable-isotope metal labels for multiple detection technologies in preclinical studies. Cells labeled with nanoparticles can be imaged by electron microscopy, fluorescence, and magnetic resonance. The nanoparticle-labeled cells can be quantified by neutron activation, thereby allowing, with the use of standard curves, the determination of the number of labeled cells in tissue samples from in vivo sources. This report describes the characteristics of these nanoparticles and methods for using these nanoparticles to label and track cells. PMID:20559922

  2. Assessing Nanoparticle Toxicity

    NASA Astrophysics Data System (ADS)

    Love, Sara A.; Maurer-Jones, Melissa A.; Thompson, John W.; Lin, Yu-Shen; Haynes, Christy L.

    2012-07-01

    Nanoparticle toxicology, an emergent field, works toward establishing the hazard of nanoparticles, and therefore their potential risk, in light of the increased use and likelihood of exposure. Analytical chemists can provide an essential tool kit for the advancement of this field by exploiting expertise in sample complexity and preparation as well as method and technology development. Herein, we discuss experimental considerations for performing in vitro nanoparticle toxicity studies, with a focus on nanoparticle characterization, relevant model cell systems, and toxicity assay choices. Additionally, we present three case studies (of silver, titanium dioxide, and carbon nanotube toxicity) to highlight the important toxicological considerations of these commonly used nanoparticles.

  3. SERRS coded nanoparticles for biomolecular labelling with wavelength-tunable discrimination.

    PubMed

    McKenzie, Fiona; Ingram, Andrew; Stokes, Robert; Graham, Duncan

    2009-03-01

    The preparation and use of tri-functional linkers for surface complexation to both gold and silver nanoparticles is reported. These molecules confer excellent stability towards nanoparticles ensuring particle monodispersity in biological buffers, and also incorporate dyes to allow use of the functionalised nanoparticles as SERRS reporters. Biomolecule conjugation and quantitation has been illustrated using Alexafluor 680 labelled streptavidin. Variation of the chromophore has been introduced, which allows for exquisite control of the SERRS by manipulation of laser wavelength. This demonstrates the potential of SERRS functionalised nanoparticles for multiple, simultaneous monitoring of excitation events, an area of research where the capability of molecular fluorophores and quantum dots is limited. PMID:19238293

  4. Peptide-directed self-assembly of functionalized polymeric nanoparticles part I: design and self-assembly of peptide-copolymer conjugates into nanoparticle fibers and 3D scaffolds.

    PubMed

    Ding, Xiaochu; Janjanam, Jagadeesh; Tiwari, Ashutosh; Thompson, Martin; Heiden, Patricia A

    2014-06-01

    A robust self-assembly of nanoparticles into fibers and 3D scaffolds is designed and fabricated by functionalizing a RAFT-polymerized amphiphilic triblock copolymer with designer ionic complementary peptides so that the assembled core-shell polymeric nanoparticles are directed by peptide assembly into continuous "nanoparticle fibers," ultimately leading to 3D fiber scaffolds. The assembled nanostructure is confirmed by FESEM and optical microscopy. The assembly is not hindered when a protein (insulin) is incorporated within the nanoparticles as an active ingredient. MTS cytotoxicity tests on SW-620 cell lines show that the peptides, copolymers, and peptide-copolymer conjugates are biocompatible. The methodology of self-assembled nanoparticle fibers and 3D scaffolds is intended to combine the advantages of a flexible hydrogel scaffold with the versatility of controlled release nanoparticles to offer unprecedented ability to incorporate desired drug(s) within a self-assembled scaffold system with individual control over the release of each drug. PMID:24610743

  5. Nanoparticle Supracrystals and Layered Supracrystals as Chemical Amplifiers

    SciTech Connect

    Kowalczyk, Bartlomiej; Walker, David A; Siowling, Soh; Grzybowski, Bartosz A.

    2010-07-13

    Nanoparticle crystals and core–shell crystals detect and amplify the presence of chemical and enzymatic analytes. These crystals are made insoluble in water by cross-linking their surface with dithiols incorporating analyte-specific groups. Upon addition of an analyte, these groups are cut, and the “punctured” crystals liberate millions of individual, brightly colored NPs.

  6. Terminal Supraparticle Assemblies from Similarly Charged Protein Molecules and Nanoparticles

    PubMed Central

    Park, Jai Il; Nguyen, Trung Dac; de Queirós Silveira, Gleiciani; Bahng, Joong Hwan; Srivastava, Sudhanshu; Sun, Kai; Zhao, Gongpu; Zhang, Peijun; Glotzer, Sharon C.; Kotov, Nicholas A.

    2015-01-01

    Self-assembly of proteins and inorganic nanoparticles into terminal assemblies makes possible a large family of uniformly sized hybrid colloids. These particles can be compared in terms of utility, versatility and multifunctionality to other known types of terminal assemblies. They are simple to make and offer theoretical tools for designing their structure and function. To demonstrate such assemblies, we combine cadmium telluride nanoparticles with cytochrome C protein and observe spontaneous formation of spherical supraparticles with a narrow size distribution. Such self-limiting behaviour originates from the competition between electrostatic repulsion and non-covalent attractive interactions. Experimental variation of supraparticle diameters for several assembly conditions matches predictions obtained in simulations. Similar to micelles, supraparticles can incorporate other biological components as exemplified by incorporation of nitrate reductase. Tight packing of nanoscale components enables effective charge and exciton transport in supraparticles as demonstrated by enzymatic nitrate reduction initiated by light absorption in the nanoparticle. PMID:24845400

  7. Terminal supraparticle assemblies from similarly charged protein molecules and nanoparticles

    NASA Astrophysics Data System (ADS)

    Park, Jai Il; Nguyen, Trung Dac; de Queirós Silveira, Gleiciani; Bahng, Joong Hwan; Srivastava, Sudhanshu; Zhao, Gongpu; Sun, Kai; Zhang, Peijun; Glotzer, Sharon C.; Kotov, Nicholas A.

    2014-05-01

    Self-assembly of proteins and inorganic nanoparticles into terminal assemblies makes possible a large family of uniformly sized hybrid colloids. These particles can be compared in terms of utility, versatility and multifunctionality to other known types of terminal assemblies. They are simple to make and offer theoretical tools for designing their structure and function. To demonstrate such assemblies, we combine cadmium telluride nanoparticles with cytochrome C protein and observe spontaneous formation of spherical supraparticles with a narrow size distribution. Such self-limiting behaviour originates from the competition between electrostatic repulsion and non-covalent attractive interactions. Experimental variation of supraparticle diameters for several assembly conditions matches predictions obtained in simulations. Similar to micelles, supraparticles can incorporate other biological components as exemplified by incorporation of nitrate reductase. Tight packing of nanoscale components enables effective charge and exciton transport in supraparticles and bionic combination of properties as demonstrated by enzymatic nitrate reduction initiated by light absorption in the nanoparticle.

  8. De-alloyed platinum nanoparticles

    DOEpatents

    Strasser, Peter; Koh, Shirlaine; Mani, Prasanna; Ratndeep, Srivastava

    2011-08-09

    A method of producing de-alloyed nanoparticles. In an embodiment, the method comprises admixing metal precursors, freeze-drying, annealing, and de-alloying the nanoparticles in situ. Further, in an embodiment de-alloyed nanoparticle formed by the method, wherein the nanoparticle further comprises a core-shell arrangement. The nanoparticle is suitable for electrocatalytic processes and devices.

  9. Preparation and Characterization of Chitosan Nanoparticles for Zidovudine Nasal Delivery.

    PubMed

    Barbi, Mariana Da Silva; Carvalho, Flávia Chiva; Kiill, Charlene Priscila; Barud, Hernane Da Silva; Santagneli, Sílvia Helena; Ribeiro, Sidney José Lima; Gremião, Maria Palmira Daflon

    2015-01-01

    Zidovudine (AZT) is the antiretroviral drug most frequently used for the treatment of Acquired Immunodeficiency Syndrome. Its low oral bioavailability demands the development of innovative strategies to overcome the first pass metabolism. The nasal route is an option for enhanced therapeutic efficacy and to reduce the extent of the first-pass effect. In this article, AZT loaded chitosan nanoparticles were prepared by a modified ionotropic gelation method with sodium tripolyphosphate. The increase proportion of CS (NP1 10:01 (w/w)) promoted the formation of smaller nanoparticles (260 nm), while raising the proportion of TPP (NP2 5:1 w/w) increased the nanoparticles size (330 nm). The incorporation of AZT increased the nanoparticles size for both AZT-loaded nanoparticles AZT-loaded NP1 (406 nm) and AZT-loaded NP2 (425 nm). The incorporation of AZT into NP1 did not change the electrophoretic mobility, however, in AZT-loaded NP2 there was a significant increase. The positive surface of the nanoparticles is very important for the mucoadhesive properties due interaction with the sialic groups of the mucin. Nuclear resonance magnetic data showed that the higher concentration of chitosan in the nanoparticles favored the interaction of few phosphate units (pyrophosphate) by ionic interaction Scanning electron microscopy, revealed that the nanoparticles are nearly spherical shape with porous surface. The entrapment efficiency of AZT, was 17.58% ± 1.48 and 11.02% ± 2.05 for NP1 and NP2, respectively. The measurement of the mucoadhesion force using mucin discs and nasal tissue obtained values of NP1 = 2.12 and NP2 = 4.62. In vitro permeation study showed that the nanoparticles promoted an increase in the flux of the drug through the nasal mucosa. In view of these results, chitosan nanoparticles were found to be a promising approach for the incorporation of hydrophilic drugs and these results suggest that the CS-containing nanoparticles have great potential for nasal AZT administration. PMID:26328451

  10. Solid Lipid Nanoparticles: A Modern Formulation Approach in Drug Delivery System

    PubMed Central

    Mukherjee, S.; Ray, S.; Thakur, R. S.

    2009-01-01

    Solid lipid nanoparticles are at the forefront of the rapidly developing field of nanotechnology with several potential applications in drug delivery, clinical medicine and research, as well as in other varied sciences. Due to their unique size-dependent properties, lipid nanoparticles offer the possibility to develop new therapeutics. The ability to incorporate drugs into nanocarriers offers a new prototype in drug delivery that could be used for secondary and tertiary levels of drug targeting. Hence, solid lipid nanoparticles hold great promise for reaching the goal of controlled and site specific drug delivery and hence have attracted wide attention of researchers. This review presents a broad treatment of solid lipid nanoparticles discussing their advantages, limitations and their possible remedies. The different types of nanocarriers which were based on solid lipid like solid lipid nanoparticles, nanostructured lipid carriers, lipid drug conjugates are discussed with their structural differences. Different production methods which are suitable for large scale production and applications of solid lipid nanoparticles are described. Appropriate analytical techniques for characterization of solid lipid nanoparticles like photon correlation spectroscopy, scanning electron microscopy, differential scanning calorimetry are highlighted. Aspects of solid lipid nanoparticles route of administration and their biodistribution are also incorporated. If appropriately investigated, solid lipid nanoparticles may open new vistas in therapy of complex diseases. PMID:20502539

  11. Amphotericin B aggregation inhibition with novel nanoparticles prepared with poly(epsilon-caprolactone)/poly(n,n-dimethylamino-2-ethyl methacrylate) diblock copolymer.

    PubMed

    Shim, Yong-Ho; Kim, You-Chan; Lee, Hong-Joo; Bougard, Francois; Dubois, Philippe; Choi, Ki-Choon; Chung, Chung-Wook; Kang, Dae Hwan; Jeong, Young-Il

    2011-01-01

    Diblock copolymers composed of poly(epsilon-caprolactone) (PCL) and poly(N,N-dimethylamino-2-ethyl methacrylate) (PDMAEMA), or methoxy polyethylene glycol(PEG), were synthesized via a combination of ring-opening polymerization and atom-transfer radical polymerization in order to prepare polymeric nanoparticles as an antifungal drug carrier. Amphotericin B (AmB), a natural antibiotic, was incorporated into the polymeric nanoparticles. The physical properties of AmB-incorporated polymeric nanoparticles with PCL-b-PDMAEMA and PCL-b-PEG were studied in relation to morphology and particle size. In the aggregation state study, AmB-incorporated PCL-b- PDMAEMA nanoparticles exhibited a monomeric state pattern of free AmB, whereas AmB-incorporated PCL-b- PEG nanoparticles displayed an aggregated pattern. In in vitro hemolysis tests with human red blood cells, AmBincorporated PCL-b-PDMAEMA nanoparticles were seen to be 10 times less cytotoxic than free AmB (5 microgram/ml). In addition, an improved antifungal activity of AmBincorporated polymeric nanoparticles was observed through antifungal activity tests using Candida albicans, whereas polymeric nanoparticles themselves were seen not to affect activity. Finally, in vitro AmB release studies were conducted, proving the potential of AmB-incorporated PCL-b-PDMAEMA nanoparticles as a new formulation candidate for AmB. PMID:21301189

  12. Targeted nanoparticle enhanced proapoptotic peptide as potential therapy for glioblastoma

    PubMed Central

    Agemy, Lilach; Friedmann-Morvinski, Dinorah; Kotamraju, Venkata Ramana; Roth, Lise; Sugahara, Kazuki N.; Girard, Olivier M.; Mattrey, Robert F.; Verma, Inder M.; Ruoslahti, Erkki

    2011-01-01

    Antiangiogenic therapy can produce transient tumor regression in glioblastoma (GBM), but no prolongation in patient survival has been achieved. We have constructed a nanosystem targeted to tumor vasculature that incorporates three elements: (i) a tumor-homing peptide that specifically delivers its payload to the mitochondria of tumor endothelial cells and tumor cells, (ii) conjugation of this homing peptide with a proapoptotic peptide that acts on mitochondria, and (iii) multivalent presentation on iron oxide nanoparticles, which enhances the proapoptotic activity. The iron oxide component of the nanoparticles enabled imaging of GBM tumors in mice. Systemic treatment of GBM-bearing mice with the nanoparticles eradicated most tumors in one GBM mouse model and significantly delayed tumor development in another. Coinjecting the nanoparticles with a tumor-penetrating peptide further enhanced the therapeutic effect. Both models used have proven completely resistant to other therapies, suggesting clinical potential of our nanosystem. PMID:21969599

  13. A simple method to ordered mesoporous carbons containing nickel nanoparticles

    SciTech Connect

    Dai, Sheng; Wang, Xiqing

    2009-01-01

    A series of ordered mesoporous carbons containing magnetic Ni nanoparticles (Ni-OMCs) with a variety of Ni loadings was made by a simple one-pot synthetic procedure through carbonization of phenolic resin-Pluronic block copolymer composites containing various amount of nickel nitrate. Such composite materials were characterized by N{sub 2} sorption, XRD, and STEM. Ni-OMCs exhibited high BET surface area, uniform pore size, and large pore volume without obvious pore blockage with a Ni loading as high as 15 wt%. Ni nanoparticles were crystalline with a face-center-cubic phase and observed mainly in the carbon matrix and on the outer surface as well. The average particle size of Ni nanoparticles was dependent on the preparation (carbonization) temperature and Ni loading; the higher the temperature was used and the more the Ni was incorporated, the larger the Ni nanoparticles were observed. One of the applications of Ni-OMCs was demonstrated as magnetically separable adsorbents.

  14. Magnetic Nanoparticles in Non-magnetic CNTs and Graphene

    NASA Astrophysics Data System (ADS)

    Kayondo, Moses; Seifu, Dereje

    Magnetic nanoparticles were embedded in non-magnetic CNTs and graphene matrix to incorporate all the advantages and the unique properties of CNTs and graphene. Composites of CNTs and graphene with magnetic nanoparticles may offer new opportunities for a wide variety of potential applications such as magnetic data storage, magnetic force microscopy tip, electromagnetic interference shields, thermally conductive films, reinforced polymer composites, transparent electrodes for displays, solar cells, gas sensors, magnetic nanofluids, and magnetically guided drug delivery systems. Magnetic nanoparticles coated CNTs can also be used as an electrode in lithium ion battery to replace graphite because of the higher theoretical capacity. Graphene nanocomposites, coated with magnetic sensitive nanoparticles, have demonstrated enhanced magnetic property. We would like to acknowledge support by NSF-MRI-DMR-1337339.

  15. Contact Mechanics of Nanoparticles

    NASA Astrophysics Data System (ADS)

    Carrillo, J.-M. Y.; Dobrynin, A. V.

    2013-03-01

    We perform molecular dynamics simulations of the detachment of nanoparticles from a substrate. The critical detachment force, f*, is obtained as a function of the nanoparticle radius, Rp, shear modulus, G, surface energy, γp, and work of adhesion, W. The magnitude of the detachment force is shown to increase from πWRp to 2.2 πWRp with increasing nanoparticle shear modulus and nanoparticle size. This variation of the detachment force is a manifestation of a neck formation upon nanoparticle detachment. Using scaling analysis, we show that the magnitude of the detachment force is controlled by the balance of the nanoparticle elastic energy, surface energy of the neck, and nanoparticle adhesion energy to a substrate. It is a function of the dimensionless parameter δ ~γp(GRp) - 1 / 3W - 2 / 3 which is proportional to the ratio of the surface energy of a neck and the elastic energy of deformed nanoparticle. In the case of small values of the parameter δ <<1, the critical detachment force approaches a critical Johnson, Kendall and Roberts force, f * ~ 1 . 5 πWRp , as is usually the case for strongly crosslinked large nanoparticles. However, in the opposite limit, corresponding to soft small nanoparticles, for which δ>>1, the critical detachment force, f*, scales as f * ~γp3 / 2 Rp1 / 2 G - 1 / 2 . Simulation data are described by a scaling function f * ~γp3 / 2 Rp1 / 2 G - 1 / 2δ - 1 . 89 . NSF DMR-1004576

  16. Nanoparticles for Biomedical Imaging

    SciTech Connect

    Nune, Satish K.; Gunda, Padmaja; Thallapally, Praveen K.; Lin, Ying-Ying; Forrest, Laird M.; Berkland, Cory J.

    2009-11-01

    Background: Synthetic nanoparticles are emerging as versatile tools in biomedical applications, particularly in the area of biomedical imaging. Nanoparticles 1 to 100 nm in diameter possess dimensions comparable to biological functional units. Diverse surface chemistries, unique magnetic properties, tunable absorption and emission properties, and recent advances in the synthesis and engineering of various nanoparticles suggest their potential as probes for early detection of diseases such as cancer. Surface functionalization has further expanded the potential of nanoparticles as probes for molecular imaging. Objective: To summarize emerging research of nanoparticles for biomedical imaging with increased selectivity and reduced non-specific uptake with increased spatial resolution containing stabilizers conjugated with targeting ligands. Methods: This review summarizes recent technological advances in the synthesis of various nanoparticle probes, and surveys methods to improve the targeting of nanoparticles for their applications in biomedical imaging. Conclusion: Structural design of nanomaterials for biomedical imaging continues to expand and diversify. Synthetic methods have aimed to control the size and surface characteristics of nanoparticles to control distribution, half-life and elimination. Although molecular imaging applications using nanoparticles are advancing into clinical applications, challenges such as storage stability and long-term toxicology should continue to be addressed. Keywords: nanoparticle synthesis, surface modification, targeting, molecular imaging, and biomedical imaging.

  17. Lipoprotein-inspired nanoparticles for cancer theranostics.

    PubMed

    Ng, Kenneth K; Lovell, Jonathan F; Zheng, Gang

    2011-10-18

    Over hundreds of millions of years, animals have evolved endogenous lipoprotein nanoparticles for shuttling hydrophobic molecules to different parts of the body. In the last 70 years, scientists have developed an understanding of lipoprotein function, often in relationship to lipid transport and heart disease. Such biocompatible, lipid-protein complexes are also ideal for loading and delivering cancer therapeutic and diagnostic agents, which means that lipoprotein and lipoprotein-inspired nanoparticles also offer opportunities for cancer theranostics. By mimicking the endogenous shape and structure of lipoproteins, the nanocarrier can remain in circulation for an extended period of time, while largely evading the reticuloendothelial cells in the body's defenses. The small size (less than 30 nm) of the low-density (LDL) and high-density (HDL) classes of lipoproteins allows them to maneuver deeply into tumors. Furthermore, lipoproteins can be targeted to their endogenous receptors, when those are implicated in cancer, or to other cancer receptors. In this Account, we review the field of lipoprotein-inspired nanoparticles related to the delivery of cancer imaging and therapy agents. LDL has innate cancer targeting potential and has been used to incorporate diverse hydrophobic molecules and deliver them to tumors. Nature's method of rerouting LDL in atherosclerosis provides a strategy to extend the cancer targeting potential of lipoproteins beyond its narrow purview. Although LDL has shown promise as a drug nanocarrier for cancer imaging and therapy, increasing evidence indicates that HDL, the smallest lipoprotein, may also be of use for drug targeting and uptake into cancer cells. We also discuss how synthetic HDL-like nanoparticles, which do not include human or recombinant proteins, can deliver molecules directly to the cytoplasm of certain cancer cells, effectively bypassing the endosomal compartment. This strategy could allow HDL-like nanoparticles to be used to deliver drugs that have increased activity in the cytoplasm. Lipoprotein nanoparticles have evolved to be ideal delivery vehicles, and because of that specialized function, they have the potential to improve cancer theranostics. PMID:21557543

  18. Vascular Targeting of a Gold Nanoparticle to Breast Cancer Metastasis.

    PubMed

    Peiris, Pubudu M; Deb, Partha; Doolittle, Elizabeth; Doron, Gilad; Goldberg, Amy; Govender, Priya; Shah, Shruti; Rao, Swetha; Carbone, Sarah; Cotey, Thomas; Sylvestre, Meilyn; Singh, Sohaj; Schiemann, William P; Lee, Zhenghong; Karathanasis, Efstathios

    2015-08-01

    The vast majority of breast cancer deaths are due to metastatic disease. Although deep tissue targeting of nanoparticles is suitable for some primary tumors, vascular targeting may be a more attractive strategy for micrometastasis. This study combined a vascular targeting strategy with the enhanced targeting capabilities of a nanoparticle to evaluate the ability of a gold nanoparticle (AuNP) to specifically target the early spread of metastatic disease. As a ligand for the vascular targeting strategy, we utilized a peptide targeting alpha(v) beta(3) integrin, which is functionally linked to the development of micrometastases at a distal site. By employing a straightforward radiolabeling method to incorporate Technetium-99m into the AuNPs, we used the high sensitivity of radionuclide imaging to monitor the longitudinal accumulation of the nanoparticles in metastatic sites. Animal and histological studies showed that vascular targeting of the nanoparticle facilitated highly accurate targeting of micrometastasis in the 4T1 mouse model of breast cancer metastasis using radionuclide imaging and a low dose of the nanoparticle. Because of the efficient targeting scheme, 14% of the injected AuNP deposited at metastatic sites in the lungs within 60 min after injection, indicating that the vascular bed of metastasis is a viable target site for nanoparticles. PMID:26036431

  19. Colloidal polymers via dipolar assembly of magnetic nanoparticle monomers.

    PubMed

    Hill, Lawrence J; Pyun, Jeffrey

    2014-05-14

    In this Spotlight on Applications, we describe our recent progress in the preparation of hierarchical one-dimensional (1-D) materials constructed from polymer-coated ferromagnetic cobalt nanoparticles. We begin with a general discussion of nanoparticles capable of 1-D self-organization to form 1-D assemblies, which we term colloidal polymers. The need for efficient, highly directional interactions prompted our investigation with polymer-coated ferromagnetic nanoparticles, which spontaneously form linear assemblies through coupling of north and south magnetic poles present in these single-domain ferromagnetic nanoparticles. These highly directional N-S interactions and the resulting formation of 1-D assemblies can be understood in the context of traditional polymer-forming reactions. The dipolar assembly of these ferromagnetic nanoparticles into chains and binary assemblies while dispersed in organic media has been investigated as a key foundation to form novel magnetic materials and heterostructured nanocomposites. These studies enabled the fabrication of magnetic nanoactuating systems resembling "artificial cilia and flagella". We then discuss our recent efforts to prepare cobalt oxide nanowires using various nanoparticle conversion reactions through a process termed colloidal polymerization. A series of novel functional "colloidal monomers" based on dipolar cobalt nanoparticles were also prepared, incorporating noble metal or semiconductor nanoinclusions to form heterostructured cobalt oxide nanocomposites. PMID:24467583

  20. Multifunctional gold nanoparticles for diagnosis and therapy of disease

    PubMed Central

    Mieszawska, Aneta J.; Mulder, Willem J. M.; Fayad, Zahi A.

    2013-01-01

    Gold nanoparticles (AuNPs) have a number of physical properties that make them appealing for medical applications. For example, the attenuation of X-rays by gold nanoparticles has led to their use in computed tomography imaging and as adjuvants for radiotherapy. AuNPs have numerous other applications in imaging, therapy and diagnostic systems. The advanced state of synthetic chemistry of gold nanoparticles offers precise control over physicochemical and optical properties. Furthermore gold cores are inert and are considered to be biocompatible and non-toxic. The surface of gold nanoparticles can easily be modified for a specific application and ligands for targeting, drugs or biocompatible coatings can be introduced. AuNPs can be incorporated into larger structures such as polymeric nanoparticles or liposomes that deliver large payloads for enhanced diagnostic applications, efficiently encapsulate drugs for concurrent therapy or add additional imaging labels. This array of features has led to the afore-mentioned applications in biomedical fields, but more recently in approaches where multifunctional gold nanoparticles are used for multiple methods, such as concurrent diagnosis and therapy, so called theranostics. The following review covers basic principles and recent findings in gold nanoparticle applications for imaging, therapy and diagnostics, with a focus on reports of multifunctional AuNPs. PMID:23360440

  1. Photodynamic characterization and optimization using multifunctional nanoparticles for brain cancer treatment

    NASA Astrophysics Data System (ADS)

    Herrmann, Kristen; Lee Koo, Yong-Eun; Orringer, Daniel A.; Sagher, Oren; Philbert, Martin; Kopelman, Raoul

    2013-03-01

    Photosensitizer-conjugated polyacrylamide nanoparticles were prepared for in vivo characterization of the minimally invasive and localized treatment of photodynamic therapy (PDT) on brain tumors. By incorporating a variety of nanoparticle matrixes, choosing methylene blue as a photosensitizer, and targeting the nanoparticle by the use of F3 peptide we have made nanoparticle-based PDT improvements to current PDT efficiency. Quantitative growth patterns were determined through visual observation of the tumorigenic response to various treatments by the use of an animal cranial window model. PDT treatments with methylene blue-polyacrylamide (MB-PAA) nanoparticles produced significant adjournment of tumor growth over control groups, clearly demonstrating the advantages of nanoparticle-based PDT agents for the eradication of local tumors, leading to the potential palliation of the advancing disease.

  2. Molecular dynamics study of nanoparticle stability at liquid interfaces: Effect of nanoparticle-solvent interaction and capillary waves

    NASA Astrophysics Data System (ADS)

    Cheung, David L.

    2011-08-01

    While the interaction of colloidal particles (sizes in excess of 100 nm) with liquid interfaces may be understood in terms of continuum models, which are grounded in macroscopic properties such as surface and line tensions, the behaviour of nanoparticles at liquid interfaces may be more complex. Recent simulations [D. L. Cheung and S. A. F. Bon, Phys. Rev. Lett. 102, 066103 (2009)], 10.1103/PhysRevLett.102.066103 of nanoparticles at an idealised liquid-liquid interface showed that the nanoparticle-interface interaction range was larger than expected due, in part, to the action of thermal capillary waves. In this paper, molecular dynamics simulations of a Lennard-Jones nanoparticle in a binary Lennard-Jones mixture are used to confirm that these previous results hold for more realistic models. Furthermore by including attractive interactions between the nanoparticle and the solvent, it is found that the detachment energy decreases as the nanoparticle-solvent attraction increases. Comparison between the simulation results and recent theoretical predictions [H. Lehle and M. Oettel, J. Phys. Condens. Matter 20, 404224 (2008)], 10.1088/0953-8984/20/40/404224 shows that for small particles the incorporation of capillary waves into the predicted effective nanoparticle-interface interaction improves agreement between simulation and theory.

  3. Aptamer conjugated magnetic nanoparticles as nanosurgeons

    NASA Astrophysics Data System (ADS)

    Nair, Baiju G.; Nagaoka, Yutaka; Morimoto, Hisao; Yoshida, Yasuhiko; Maekawa, Toru; Sakthi Kumar, D.

    2010-11-01

    Magnetic nanoparticles have shown promise in the fields of targeted drug delivery, hyperthermia and magnetic resonance imaging (MRI) in cancer therapy. The ability of magnetic nanoparticles to undergo surface modification and the effect of external magnetic field in the dynamics of their movement make them an excellent nanoplatform for cancer destruction. Surgical removal of cancerous or unwanted cells selectively from the interior of an organ or tissue without any collateral damage is a serious problem due to the highly infiltrative nature of cancer. To address this problem in surgery, we have developed a nanosurgeon for the selective removal of target cells using aptamer conjugated magnetic nanoparticles controlled by an externally applied three-dimensional rotational magnetic field. With the help of the nanosurgeon, we were able to perform surgical actions on target cells in in vitro studies. LDH and intracellular calcium release assay confirmed the death of cancer cells due to the action of the nanosurgeon which in turn nullifies the possibility of proliferation by the removed cells. The nanosurgeon will be a useful tool in the medical field for selective surgery and cell manipulation studies. Additionally, this system could be upgraded for the selective removal of complex cancers from diverse tissues by incorporating various target specific ligands on magnetic nanoparticles.

  4. Radiotherapy Improvements by Using Au Nanoparticles.

    PubMed

    Torrisi, Lorenzo

    2015-01-01

    Au nanoparticles can be prepared inside biological solutions and incorporated in special molecules for their transport through blood, drugs and proteins up to the tumour sites or directly injected in their volume when it is possible. The Au nanoparticles are biocompatible and can be accepted locally in the organism also at relatively high concentrations. The use of Au nanoparticles injected in the tumour site enhances significantly the effective atomic number of the medium, depending on the used concentration, and consequently the proton and electron energy loss and the X-ray absorption coefficient determining an increment of the local absorbed dose during radiotherapy. Traditional radiotherapy using electrons, X-rays and gamma rays, and innovative protontherapy can benefit the increment of the effective atomic number of the tissue in the presence of Au-nanoparticles embedded in the tumour volume with an adaptive up-take procedure. This method decreases the dose released to the healthy tissues permitting a better cantering of the irradiated targets and shielding the healthy tissue placed behind the tumour. The presented theoretical study approach permits to evaluate an enhancement of the radiotherapy dose of the order of 1 % using 60 MeV protons, of the order of 10% using 6 MeV electrons and of the order of 100 % using 100 keV X-ray photons. Here, we also disccused for patents relaed to the topic. PMID:27009126

  5. Stimulus responsive nanoparticles

    NASA Technical Reports Server (NTRS)

    Cairns, Darren Robert (Inventor); Huebsch, Wade W. (Inventor); Sierros, Konstantinos A. (Inventor); Shafran, Matthew S. (Inventor)

    2013-01-01

    Disclosed are various embodiments of methods and systems related to stimulus responsive nanoparticles. In one embodiment includes a stimulus responsive nanoparticle system, the system includes a first electrode, a second electrode, and a plurality of elongated electro-responsive nanoparticles dispersed between the first and second electrodes, the plurality of electro-responsive nanorods configured to respond to an electric field established between the first and second electrodes.

  6. Stimulus Responsive Nanoparticles

    NASA Technical Reports Server (NTRS)

    Cairns, Darran Robert (Inventor); Huebsch, Wade W. (Inventor); Sierros, Konstantinos A. (Inventor); Shafran, Matthew S. (Inventor)

    2015-01-01

    Disclosed are various embodiments of methods and systems related to stimulus responsive nanoparticles. In one embodiment includes a stimulus responsive nanoparticle system, the system includes a first electrode, a second electrode, and a plurality of elongated electro-responsive nanoparticles dispersed between the first and second electrodes, the plurality of electro-responsive nanorods configured to respond to an electric field established between the first and second electrodes.

  7. Cytotoxicity of gold nanoparticles.

    PubMed

    Pan, Yu; Bartneck, Matthias; Jahnen-Dechent, Willi

    2012-01-01

    Nanomaterials are now routinely used in technical as well as medical applications. The very physicochemical properties that favor nanomaterial application are the prime cause that these materials cannot be considered "generally safe." We are still far from predicting the toxicological profile of new nanoparticles, despite continuous attempts to establish a structure-function relation between the physical and chemical properties of nanoparticles and their interactions with biological systems. Herein, we summarize some basic concept to assess nanoparticle toxicity, death pathways, cell cycle, and oxidative stress in response to nanoparticle exposure of cells. PMID:22568908

  8. Nanoparticles for biomedical imaging

    PubMed Central

    Nune, Satish K; Gunda, Padmaja; Thallapally, Praveen K; Lin, Ying-Ying; Forrest, M Laird; Berkland, Cory J

    2011-01-01

    Background Synthetic nanoparticles are emerging as versatile tools in biomedical applications, particularly in the area of biomedical imaging. Nanoparticles 1 – 100 nm in diameter have dimensions comparable to biological functional units. Diverse surface chemistries, unique magnetic properties, tunable absorption and emission properties, and recent advances in the synthesis and engineering of various nanoparticles suggest their potential as probes for early detection of diseases such as cancer. Surface functionalization has expanded further the potential of nanoparticles as probes for molecular imaging. Objective To summarize emerging research of nanoparticles for biomedical imaging with increased selectivity and reduced nonspecific uptake with increased spatial resolution containing stabilizers conjugated with targeting ligands. Methods This review summarizes recent technological advances in the synthesis of various nanoparticle probes, and surveys methods to improve the targeting of nanoparticles for their application in biomedical imaging. Conclusion Structural design of nanomaterials for biomedical imaging continues to expand and diversify. Synthetic methods have aimed to control the size and surface characteristics of nanoparticles to control distribution, half-life and elimination. Although molecular imaging applications using nanoparticles are advancing into clinical applications, challenges such as storage stability and long-term toxicology should continue to be addressed. PMID:19743894

  9. 49 CFR 572.40 - Incorporated materials.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ... 49 Transportation 7 2010-10-01 2010-10-01 false Incorporated materials. 572.40 Section 572.40... Percentile Male § 572.40 Incorporated materials. (a) The drawings, specifications, manual, and computer... by reference. These materials are thereby made part of this regulation. The Director of the...

  10. 49 CFR 572.40 - Incorporated materials.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ... 49 Transportation 7 2011-10-01 2011-10-01 false Incorporated materials. 572.40 Section 572.40... Percentile Male § 572.40 Incorporated materials. (a) The drawings, specifications, manual, and computer... by reference. These materials are thereby made part of this regulation. The Director of the...

  11. 49 CFR 572.180 - Incorporated materials.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ... CFR part 51. Copies of the materials may be inspected at the Department of Transportation, Docket... 49 Transportation 7 2010-10-01 2010-10-01 false Incorporated materials. 572.180 Section 572.180... Dummy, 50th Percentile Adult Male § 572.180 Incorporated materials. (a) The following materials...

  12. 49 CFR 572.40 - Incorporated materials.

    Code of Federal Regulations, 2012 CFR

    2012-10-01

    ... 49 Transportation 7 2012-10-01 2012-10-01 false Incorporated materials. 572.40 Section 572.40... Percentile Male § 572.40 Incorporated materials. (a) The drawings, specifications, manual, and computer... by reference. These materials are thereby made part of this regulation. The Director of the...

  13. 49 CFR 572.40 - Incorporated materials.

    Code of Federal Regulations, 2013 CFR

    2013-10-01

    ... 49 Transportation 7 2013-10-01 2013-10-01 false Incorporated materials. 572.40 Section 572.40... Percentile Male § 572.40 Incorporated materials. (a) The drawings, specifications, manual, and computer... by reference. These materials are thereby made part of this regulation. The Director of the...

  14. 49 CFR 572.40 - Incorporated materials.

    Code of Federal Regulations, 2014 CFR

    2014-10-01

    ... 49 Transportation 7 2014-10-01 2014-10-01 false Incorporated materials. 572.40 Section 572.40... Percentile Male § 572.40 Incorporated materials. (a) The drawings, specifications, manual, and computer... by reference. These materials are thereby made part of this regulation. The Director of the...

  15. 49 CFR 572.180 - Incorporated materials.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ... CFR part 51. Copies of the materials may be inspected at the Department of Transportation, Docket... 49 Transportation 7 2011-10-01 2011-10-01 false Incorporated materials. 572.180 Section 572.180... Dummy, 50th Percentile Adult Male § 572.180 Incorporated materials. (a) The following materials...

  16. Incorporating User Search Behavior into Relevance Feedback.

    ERIC Educational Resources Information Center

    Ruthven, Ian; Lalmas, Mounia; van Rijsbergen, Keith

    2003-01-01

    Presents five user experiments on incorporating behavioral information into the relevance feedback process in information retrieval, concentrating on ranking terms for query expansion and selecting new terms to add to the user's query. Topics include term ranking and user behavior; incorporating user behavior into term ranking; and user behavior…

  17. Incorporating Sociology into Community Service Classes

    ERIC Educational Resources Information Center

    Hochschild, Thomas R., Jr.; Farley, Matthew; Chee, Vanessa

    2014-01-01

    Sociologists and instructors who teach about community service share an affinity for understanding and addressing social problems. While many studies have demonstrated the benefits of incorporating community service into sociology courses, we examine the benefits of incorporating sociological content into community service classes. The authors

  18. 10 CFR 218.31 - Incorporated procedures.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... 10 Energy 3 2010-01-01 2010-01-01 false Incorporated procedures. 218.31 Section 218.31 Energy DEPARTMENT OF ENERGY OIL STANDBY MANDATORY INTERNATIONAL OIL ALLOCATION Procedures § 218.31 Incorporated procedures. The following subparts of part 205 of this chapter are, as appropriate, hereby made applicable...

  19. Constraints on Noun Incorporation in Korean.

    ERIC Educational Resources Information Center

    Khym, Hangyoo

    1997-01-01

    A study of the noun incorporation phenomenon in Korean suggests that noun incorporation occurs at D-structure and obeys the Head Movement Constraint syntactically, and the Theme-Only Constraint semantically. First, the structure of "sunrise"-type words is identified, showing that before derivation through nominalization of the affix "-i,"…

  20. Incorporating Sociology into Community Service Classes

    ERIC Educational Resources Information Center

    Hochschild, Thomas R., Jr.; Farley, Matthew; Chee, Vanessa

    2014-01-01

    Sociologists and instructors who teach about community service share an affinity for understanding and addressing social problems. While many studies have demonstrated the benefits of incorporating community service into sociology courses, we examine the benefits of incorporating sociological content into community service classes. The authors…

  1. Multifunctional Magnetic Nanoparticles for Medical Imaging Applications

    PubMed Central

    Fang, Chen; Zhang, Miqin

    2010-01-01

    Magnetic nanoparticles (MNPs) have attracted enormous research attention due to their unique magnetic properties that enable the detection by the non-invasive medical imaging modality—magnetic resonance imaging (MRI). By incorporating advanced features, such as specific targeting, multimodality, therapeutic delivery, the detectability and applicability of MNPs have been dramatically expanded. A delicate design on structure, composition and surface chemistry is essential to achieving desired properties in MNP systems, such as high imaging contrast and chemical stability, non-fouling surface, target specificity and/or multimodality. This article presents the design fundamentals on the development of MNP systems, from discussion of material selection for nanoparticle cores and coatings, strategies for chemical synthesis and surface modification and their merits and limitations, to conjugation of special biomolecules for intended functions, and reviews the recent advances in the field. PMID:20593005

  2. Field emission scanning electron microscopy (FE-SEM) as an approach for nanoparticle detection inside cells.

    PubMed

    Havrdova, M; Polakova, K; Skopalik, J; Vujtek, M; Mokdad, A; Homolkova, M; Tucek, J; Nebesarova, J; Zboril, R

    2014-12-01

    When developing new nanoparticles for bio-applications, it is important to fully characterize the nanoparticle's behavior in biological systems. The most common techniques employed for mapping nanoparticles inside cells include transmission electron microscopy (TEM) and scanning transmission electron microscopy (STEM). These techniques entail passing an electron beam through a thin specimen. STEM or TEM imaging is often used for the detection of nanoparticles inside cellular organelles. However, lengthy sample preparation is required (i.e., fixation, dehydration, drying, resin embedding, and cutting). In the present work, a new matrix (FTO glass) for biological samples was used and characterized by field emission scanning electron microscopy (FE-SEM) to generate images comparable to those obtained by TEM. Using FE-SEM, nanoparticle images were acquired inside endo/lysosomes without disruption of the cellular shape. Furthermore, the initial steps of nanoparticle incorporation into the cells were captured. In addition, the conductive FTO glass endowed the sample with high stability under the required accelerating voltage. Owing to these features of the sample, further analyses could be performed (material contrast and energy-dispersive X-ray spectroscopy (EDS)), which confirmed the presence of nanoparticles inside the cells. The results showed that FE-SEM can enable detailed characterization of nanoparticles in endosomes without the need for contrast staining or metal coating of the sample. Images showing the intracellular distribution of nanoparticles together with cellular morphology can give important information on the biocompatibility and demonstrate the potential of nanoparticle utilization in medicine. PMID:25173605

  3. Fabrication of three-dimensionally interconnected nanoparticle superlattices and their lithium-ion storage properties

    PubMed Central

    Jiao, Yucong; Han, Dandan; Ding, Yi; Zhang, Xianfeng; Guo, Guannan; Hu, Jianhua; Yang, Dong; Dong, Angang

    2015-01-01

    Three-dimensional superlattices consisting of nanoparticles represent a new class of condensed materials with collective properties arising from coupling interactions between close-packed nanoparticles. Despite recent advances in self-assembly of nanoparticle superlattices, the constituent materials have been limited to those that are attainable as monodisperse nanoparticles. In addition, self-assembled nanoparticle superlattices are generally weakly coupled due to the surface-coating ligands. Here we report the fabrication of three-dimensionally interconnected nanoparticle superlattices with face-centered cubic symmetry without the presynthesis of the constituent nanoparticles. We show that mesoporous carbon frameworks derived from self-assembled supercrystals can be used as a robust matrix for the growth of nanoparticle superlattices with diverse compositions. The resulting interconnected nanoparticle superlattices embedded in a carbon matrix are particularly suitable for energy storage applications. We demonstrate this by incorporating tin oxide nanoparticle superlattices as anode materials for lithium-ion batteries, and the resulting electrochemical performance is attributable to their unique architectures. PMID:25739732

  4. Latex nanoparticles for multimodal imaging and detection in vivo

    NASA Astrophysics Data System (ADS)

    Cartier, R.; Kaufner, L.; Paulke, B. R.; Wüstneck, R.; Pietschmann, S.; Michel, R.; Bruhn, H.; Pison, U.

    2007-05-01

    The aim of the present work was to develop a multimodal imaging and detection approach to study the behaviour of nanoparticles in animal studies. Highly carboxylated 144 nm-sized latex nanoparticles were labelled with 68Ga for positron emission tomography, 111In for quantitative gamma scintigraphy or Gd3+ for magnetic resonance imaging. Following intravenous injection into rats, precise localization was achieved revealing the tracer in the blood compartment with a time-dependent accumulation in the liver. In addition, rhodamine B was also incorporated to examine specific interactions with blood cells. Flow cytometry and fluorescent microscopy show uptake of nanoparticles by leucocytes and, unexpectedly, thrombocytes, but not erythrocytes. Cellular internalization was an active and selective process. Further incorporation of polyethylene glycol into the nanoparticle corona could prevent uptake by thrombocytes but not macrophages or monocytes. Our data demonstrate the feasibility of a multimodal approach and its usefulness to analyse the fate of nanoparticles at the macroscopic and cellular level. It will facilitate the development of functionalized nanocarrier systems and extend their biomedical applications.

  5. Fluorescent conjugated polymer nanoparticles by polymerization in miniemulsion.

    PubMed

    Baier, Moritz C; Huber, Johannes; Mecking, Stefan

    2009-10-14

    Highly fluorescent conjugated polymer nanoparticles were prepared directly by polymerization in aqueous miniemulsion, employing Glaser coupling polymerization as a suitable step-growth reaction. A 4,4'-dinonyl-2,2'-bipyridine-modified catalyst was found to be suited for the polymerization in the aqueous heterophase system. Nanoparticles of poly(arylene diethynylenes) (arylene = 2,5-dialkyoxy phenylenes and 9,9'-dihexyl fluorene) with molecular weights in the range of M(n) 10(4) to 10(5) g mol(-1) and with sizes of < or = 30 nm, as observed by TEM, result. N,N'-di(4-ethynylphenyl)-1,7-di[4-(1,1,3,3-tetramethylbutyl)phenoxy]perylene-3,4:9,10-tetracarboxdiimide or 2,7-diethynylfluorenone was converted completely during the heterophase polymerization to afford colloidally stable nanoparticles of poly(arylene diethynylenes) with 0.1-2 mol % covalently incorporated perylene dye and 2-9 mol % of covalently incorporated fluorenone dye, respectively. Fluorescence spectroscopy of the aqueous dispersions reveals an efficient energy transfer to the dye in the nanoparticles, which enables a variation of the luminescence emission color between red (lambda(em) (max.) ca. 650 nm) and the green emission of the nanoparticles without dye. PMID:19764722

  6. Epidermal growth factor receptor-targeted lipid nanoparticles retain self-assembled nanostructures and provide high specificity

    NASA Astrophysics Data System (ADS)

    Zhai, Jiali; Scoble, Judith A.; Li, Nan; Lovrecz, George; Waddington, Lynne J.; Tran, Nhiem; Muir, Benjamin W.; Coia, Gregory; Kirby, Nigel; Drummond, Calum J.; Mulet, Xavier

    2015-02-01

    Next generation drug delivery utilising nanoparticles incorporates active targeting to specific sites. In this work, we combined targeting with the inherent advantages of self-assembled lipid nanoparticles containing internal nano-structures. Epidermal growth factor receptor (EGFR)-targeting, PEGylated lipid nanoparticles using phytantriol and 1,2-distearoyl-sn-glycero-3-phosphoethanolamine-PEG-maleimide amphiphiles were created. The self-assembled lipid nanoparticles presented here have internal lyotropic liquid crystalline nano-structures, verified by synchrotron small angle X-ray scattering and cryo-transmission electron microscopy, that offer the potential of high drug loading and enhanced cell penetration. Anti-EGFR Fab' fragments were conjugated to the surface of nanoparticles via a maleimide-thiol reaction at a high conjugation efficiency and retained specificity following conjugation to the nanoparticles. The conjugated nanoparticles were demonstrated to have high affinity for an EGFR target in a ligand binding assay.Next generation drug delivery utilising nanoparticles incorporates active targeting to specific sites. In this work, we combined targeting with the inherent advantages of self-assembled lipid nanoparticles containing internal nano-structures. Epidermal growth factor receptor (EGFR)-targeting, PEGylated lipid nanoparticles using phytantriol and 1,2-distearoyl-sn-glycero-3-phosphoethanolamine-PEG-maleimide amphiphiles were created. The self-assembled lipid nanoparticles presented here have internal lyotropic liquid crystalline nano-structures, verified by synchrotron small angle X-ray scattering and cryo-transmission electron microscopy, that offer the potential of high drug loading and enhanced cell penetration. Anti-EGFR Fab' fragments were conjugated to the surface of nanoparticles via a maleimide-thiol reaction at a high conjugation efficiency and retained specificity following conjugation to the nanoparticles. The conjugated nanoparticles were demonstrated to have high affinity for an EGFR target in a ligand binding assay. Electronic supplementary information (ESI) available: Fig. S1-S4. See DOI: 10.1039/c4nr05200e

  7. Membrane interactions of mesoporous silica nanoparticles as carriers of antimicrobial peptides.

    PubMed

    Braun, Katharina; Pochert, Alexander; Lindén, Mika; Davoudi, Mina; Schmidtchen, Artur; Nordström, Randi; Malmsten, Martin

    2016-08-01

    Membrane interactions are critical for the successful use of mesoporous silica nanoparticles as delivery systems for antimicrobial peptides (AMPs). In order to elucidate these, we here investigate effects of nanoparticle charge and porosity on AMP loading and release, as well as consequences of this for membrane interactions and antimicrobial effects. Anionic mesoporous silica particles were found to incorporate considerable amounts of the cationic AMP [LL-37, 37 aa] (LL-37), whereas loading is much lower for non-porous or positively charged silica nanoparticles. Due to preferential pore localization, anionic mesoporous particles, but not the other particles, protect LL-37 from degradation by infection-related proteases. For anionic mesoporous nanoparticles, membrane disruption is mediated almost exclusively by peptide release. In contrast, non-porous silica particles build up a resilient LL-37 surface coating due to their higher negative surface charge, and display largely particle-mediated membrane interactions and antimicrobial effects. For positively charged mesoporous silica nanoparticles, LL-37 incorporation promotes the membrane binding and disruption displayed by the particles in the absence of peptide, but also causes toxicity against human erythrocytes. Thus, the use of mesoporous silica nanoparticles as AMP delivery systems requires consideration of membrane interactions and selectivity of both free peptide and the peptide-loaded nanoparticles, the latter critically dependent on nanoparticle properties. PMID:27174622

  8. Biocompatible nanoparticles and biopolyelectrolytes

    NASA Astrophysics Data System (ADS)

    Zribi, Olena

    The research presented in this manuscript encompasses a merger of two research directions: a study of aqueous nanoparticle colloids and a study of biological polyelectrolytes. The majority of biomedical applications of nanoparticles require stable aqueous colloids of nanoparticles as a starting point. A new one-step method of preparation of aqueous solutions of ultra-fine ferroelectric barium titanate nanoparticles was developed and generalized to the preparation of stable aqueous colloids of semiconductor nanoparticles. This high-energy ball milling technique is low cost, environmentally friendly, and allows for control of nanoparticle size by changing milling time. Aqueous colloids of BaTiO3 nanoparticles are stable over time, maintain ferroelectricity and can be used as second harmonic generating nanoprobes for biomedical imaging. Biopolyelectrolytes exhibit a variety of novel liquid-crystalline phases in aqueous solutions where their electrolytic nature is a driving force behind phase formation. We study medically relevant mixtures of F-actin, DNA and oppositely charged ions (such as multivalent salts and antibiotic drugs) and map out phase diagrams and laws that govern phase transitions. We combine these research directions in studies of the condensation behavior in aqueous solutions of biocompatible nanoparticles and biopolyelectrolytes.

  9. Nanoparticle Deposition onto Biofilms

    PubMed Central

    Miller, J.K.; Neubig, R.; Clemons, C.B.; Kreider, K.L.; Wilber, J.P.; Young, G.W.; Ditto, A.J.; Yun, Y.H.; Milsted, A.; Badawy, H.T.; Panzner, M.J.; Youngs, W.J.; Cannon, C.L.

    2012-01-01

    We develop a mathematical model of nanoparticles depositing onto and penetrating into a biofilm grown in a parallel-plate flow cell. We carry out deposition experiments in a flow cell to support the modeling. The modeling and the experiments are motivated by the potential use of polymer nanoparticles as part of a treatment strategy for killing biofilms infecting the deep passages in the lungs. In the experiments and model, a fluid carrying polymer nanoparticles is injected into a parallel-plate flow cell in which a biofilm has grown over the bottom plate. The model consists of a system of transport equations describing the deposition and diffusion of nanoparticles. Standard asymptotic techniques that exploit the aspect ratio of the flow cell are applied to reduce the model to two coupled partial differential equations. We perform numerical simulations using the reduced model. We compare the experimental observations with the simulation results to estimate the nanoparticle sticking coefficient and the diffusion coefficient of the nanoparticles in the biofilm. The distributions of nanoparticles through the thickness of the biofilm are consistent with diffusive transport, and uniform distributions through the thickness are achieved in about four hours. Nanoparticle deposition does not appear to be strongly influenced by the flow rate in the cell for the low flow rates considered. PMID:22878680

  10. Nanoparticle Oscillations and Fronts

    SciTech Connect

    Lagzi, Istvan; Kowalczyk, Bartlomiej; Wang, Dawei; Grzybowski, Bartosz A.

    2010-09-30

    Chemical oscillations can be coupled to the dynamic self-assembly of nanoparticles. Periodic pH changes translate into protonation and deprotonation of the ligands that stabilize the nanoparticles, thus altering repulsive and attractive interparticle forces. In a continuous stirred-tank reactor, rhythmic aggregation and dispersion is observed; in spatially distributed media, propagation of particle aggregation fronts is seen.

  11. Preparation and characterizations of silver incorporated polyurethane composite nanofibers via electrospinning for biomedical applications.

    PubMed

    Nirmala, R; Kalpana, Duraisamy; Navamathavan, R; Lee, Yang Soo; Kim, Hak Yong

    2013-07-01

    We report on the preparation and characterization of polyurethane (PU) nanofibers containing silver (Ag) nanoparticles were synthesized by using electrospinning. Two different approaches were adopted to incorporate the Ag nanoparticles in to PU nanofibers. In the first approach, a homogeneous solution of 10 wt% PU containing silver nitrate was electrospun to obtain PU-Ag composite nanofibers. And in the second approach, the pristine PU nanofibers were initially electrospun and then Ag nanoparticles were coated via wet casting method. The surface morphology, structure, bonding configuration, optical and thermal properties of the resultant products were characterized by scanning electron microscopy (SEM), X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FT-IR), Raman spectroscopy, UV-vis spectroscopy and thermogravimetric analysis. The antibacterial activity was tested against four common food borne pathogenic bacteria, namely, Staphylococcus aureus, Escherichia coli, Salmonella typhimurium and Klebsiella pneumoniae by minimum inhibitory concentration (MIC) method. Our results demonstrated that no bactericidal activity was detected for the pristine PU nanofibers. Further on, antibacterial activity was observed to be more pronounced for the composite nanofibers which were attributed to the presence of Ag nanoparticles in the composite nanofibers. Overall, this study demonstrates the fabrication of cheap, stable and effective nanofiber mats with excellent antimicrobial activity that can be utilized to inhibit the microbial growth associated with food stuff. PMID:23901491

  12. 17 CFR 260.7a-30 - Identification of material incorporated; form of incorporation.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Identification of material incorporated; form of incorporation. 260.7a-30 Section 260.7a-30 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION (CONTINUED) GENERAL RULES AND REGULATIONS, TRUST INDENTURE ACT OF 1939 Incorporation by Reference §...

  13. Size Dependent Phase Diagrams of Nickel-Carbon Nanoparticles

    NASA Astrophysics Data System (ADS)

    Magnin, Y.; Zappelli, A.; Amara, H.; Ducastelle, F.; Bichara, C.

    2015-11-01

    The carbon rich phase diagrams of nickel-carbon nanoparticles, relevant to catalysis and catalytic chemical vapor deposition synthesis of carbon nanotubes, are calculated for system sizes up to about 3 nm (807 Ni atoms). A tight binding model for interatomic interactions drives the grand canonical Monte Carlo simulations used to locate solid, core shell and liquid stability domains, as a function of size, temperature, and carbon chemical potential or concentration. Melting is favored by carbon incorporation from the nanoparticle surface, resulting in a strong relative lowering of the eutectic temperature and a phase diagram topology different from the bulk one. This should lead to a better understanding of the nanotube growth mechanisms.

  14. Magnetic Nanoparticle Degradation in vivo Studied by Mssbauer Spectroscopy

    NASA Astrophysics Data System (ADS)

    Nikitin, Maxim; Gabbasov, Raul; Cherepanov, Valery; Chuev, Mikhail; Polikarpov, Mikhail; Panchenko, Vladislav; Deyev, Sergey

    2010-12-01

    Magnetic nanoparticles belong to the most promising nanosized objects for biomedical applications. However, little is known about clearance of magnetic nanoparticles from the organism. In this work superparamagnetic iron oxide particles fluidMAG-ARA were injected into tail vein of mice at a dose of 17 mg per 20 g body weight. At various time intervals after the injection the mice were sacrificed and their organs collected. A Mssbauer study allowed to detect magnetic particles in the liver and spleen and showed the degradation of the particles with incorporation of exogenous iron into paramagnetic ferritin-like iron species.

  15. Single Nanoparticle Plasmonic Sensors

    PubMed Central

    Sriram, Manish; Zong, Kelly; Vivekchand, S. R. C.; Gooding, J. Justin

    2015-01-01

    The adoption of plasmonic nanomaterials in optical sensors, coupled with the advances in detection techniques, has opened the way for biosensing with single plasmonic particles. Single nanoparticle sensors offer the potential to analyse biochemical interactions at a single-molecule level, thereby allowing us to capture even more information than ensemble measurements. We introduce the concepts behind single nanoparticle sensing and how the localised surface plasmon resonances of these nanoparticles are dependent upon their materials, shape and size. Then we outline the different synthetic approaches, like citrate reduction, seed-mediated and seedless growth, that enable the synthesis of gold and silver nanospheres, nanorods, nanostars, nanoprisms and other nanostructures with tunable sizes. Further, we go into the aspects related to purification and functionalisation of nanoparticles, prior to the fabrication of sensing surfaces. Finally, the recent developments in single nanoparticle detection, spectroscopy and sensing applications are discussed. PMID:26473866

  16. Covalently functionalized gold nanoparticles: Synthesis, characterization, and integration into capillary electrophoresis

    NASA Astrophysics Data System (ADS)

    Ivanov, Michael Robert

    Nanomaterials are widely used as pseudostationary and stationary phases in electrically driven separations. The advantages of using nanomaterials are numerous including tunable sizes, multiple core compositions, flexible injection schemes, and diverse surface chemistries. Nanomaterials, however, exhibit large surface energies which induce aggregation and may yield unpredictable function in separations. Because nanomaterials can modify buffer conductivity, viscosity, and pH; successful and systematic incorporation of nanomaterials into separations requires rigorous synthetic control and characterization of both the nanoparticle core and surface chemistry. This dissertation investigates the impact of gold nanoparticle surface chemistry and morphology to capillary electrophoresis separations. Gold nanoparticle core composition, shape, size, self assembled monolayer (SAM) formation, and SAM packing density are quantified for gold nanoparticles functionalized with thioctic acid, 6-mercaptohexanoic acid, or 11-mercaptoundecanoic acid SAMs. TEM, 1H NMR, extinction spectroscopy, zeta potential, X-ray photoelectron spectroscopy, and flocculation assess the morphology, surface chemistry, optical properties, surface charge, SAM packing density, and stability of the nanoparticles, respectively. Using well-characterized nanostructures, pseudostationary phases of gold nanoparticles in capillary electrophoresis are studied. Gold nanoparticles functionalized with thioctic acid and either 6-mercaptohexanoic acid or 6-aminohexanethiol impact the mobility of analytes in a concentration and surface chemistry-dependent manner. From these data, a novel parameter termed the critical nanoparticle concentration is developed and is used to estimate nanoparticle stability during capillary electrophoresis separations. To understand the function of carboxylated gold nanoparticles in capillary electrophoresis, extended DLVO theory is used to model interparticle interactions. Nanoparticle aggregation leads to electron tunneling between nanoparticles thereby taking on bulk electrical properties which cause measured currents to increase for nanoparticles functionalized with poorly ordered SAMs. Nanoparticles functionalized with well-ordered SAMs main their nanoscale properties and reduce measured currents during electrically driven flow. Finally, carboxylic acid functionalized gold nanoparticles effect the separation of target biomarkers in both a SAM composition and surface coverage dependent manner. These effects are most systematic with well ordered SAMs. To understand the separation mechanism functionalized gold nanoparticles exhibit, their ζ potential with and without dopamine are evaluated. Large dopamine concentrations neutralize the three functionalized gold nanoparticles according to a dose response curve. The positively charged dopamine molecules saturate the negatively charged nanoparticle surfaces thereby providing a plausible explanation to the observed biomarker concentration trends. These data and future work provide a rigorous experimental and theoretical evaluation of nanoparticle structure impacts their function as pseudostationary phases in separations and other applications.

  17. Nanoparticle Approaches against Bacterial Infections

    PubMed Central

    Gao, Weiwei; Thamphiwatana, Soracha; Angsantikul, Pavimol; Zhang, Liangfang

    2014-01-01

    Despite the wide success of antibiotics, the treatment of bacterial infection still faces significant challenges, particularly the emergence of antibiotic resistance. As a result, nanoparticle drug delivery platforms including liposomes, polymeric nanoparticles, dendrimers, and various inorganic nanoparticles have been increasingly exploited to enhance the therapeutic effectiveness of existing antibiotics. This review focuses on areas where nanoparticle approaches hold significant potential to advance the treatment of bacterial infection. These areas include targeted antibiotic delivery, environmentally responsive antibiotic delivery, combinatorial antibiotic delivery, nanoparticle-enabled antibacterial vaccination, and nanoparticle-based bacterial detection. In each area we highlight the innovative antimicrobial nanoparticle platforms and review their progress made against bacterial infections. PMID:25044325

  18. Curcumin-loaded into PLGA nanoparticles: preparation and in vitro schistosomicidal activity.

    PubMed

    Luz, Priscilla P; Magalhães, Lizandra G; Pereira, Ana Carolina; Cunha, Wilson R; Rodrigues, Vanderlei; Andrade E Silva, Marcio L

    2012-02-01

    The incorporation of the curcumin into poly(lactic-co-glycolic)acid (PLGA) nanospheres by the nanoprecipitation technique, the characterization of the nanoparticles and the schistosomicidal activity of the curcumin-loaded into PLGA nanospheres were reported. The incorporation process occurred with high efficiency and the images of field-emission scanning electron microscopy (FESEM) revealed the production of spherically shaped particles. According to the dynamic light scattering measurements, the particles are nanometric and monodisperse. The curcumin-loaded PLGA nanoparticles (50 and 100 μM) caused the death of all worms and a separation between 50% and 100% of Schistosoma mansoni couples at concentrations from 30 μM. Moreover, the curcumin-loaded PLGA nanoparticles also decreased the motor activity and caused partial alterations in the tegument of adult worms. This study marks the first time that schistosomicidal activity has been reported for curcumin-loaded PLGA nanoparticles. PMID:21739309

  19. A comprehensive review of the application of chalcogenide nanoparticles in polymer solar cells.

    PubMed

    Freitas, Jilian N; Gonçalves, Agnaldo S; Nogueira, Ana F

    2014-06-21

    In this review the use of solution-processed chalcogenide quantum dots (CdS, CdSe, PbS, etc.) in hybrid organic-inorganic solar cells is explored. Such devices are known as potential candidates for low-cost and efficient solar energy conversion, and compose the so-called third generation solar cells. The incorporation of oxides and metal nanoparticles has also been successfully achieved in this new class of photovoltaic devices; however, we choose to explore here chalcogenide quantum dots in light of their particularly attractive optical and electronic properties. We address herein a comprehensive review of the historical background and state-of-the-art comprising the incorporation of such nanoparticles in polymer matrices. Later strategies for surface chemistry manipulation, in situ synthesis of nanoparticles, use of continuous 3D nanoparticles network (aerogels) and ternary systems are also reviewed. PMID:24839190

  20. Understanding the physics of magnetic nanoparticles and their applications in the biomedical field

    NASA Astrophysics Data System (ADS)

    Laha, Suvra Santa

    The study of magnetic nanoparticles is of great interest because of their potential uses in magnetic-recording, medical diagnostic and therapeutic applications. Additionally, they also offer an opportunity to understand the physics underlying the complex behavior exhibited by these materials. Two of the most important relaxation phenomena occurring in magnetic nanoparticles are superparamagnetic blocking and spin-glass-like freezing. In addition to features attributed to superparamagnetism, these nanoparticles can also exhibit magnetic relaxation effects at very low temperatures (≤ 50 K). Our studies suggest that all structural defects, and not just surface spins, are responsible for the low-temperature glass-like relaxation observed in many magnetic nanoparticles. The characteristic dipolar interaction energy existing in an ensemble of magnetic nanoparticles does not apparently depend on the average spacing between the nanoparticles but is likely to be strongly influenced by the fluctuations in the nanoparticle distribution. Our findings revealed that incorporating a small percentage of boron can stabilize the spinel structure in Mn 3O4 nanoparticles. We have also demonstrated that the dipolar interactions between the magnetic cores can be tuned by introducing non-magnetic nanoparticles. In particular, we studied the magnetic properties of Gd-doped Fe3O4 nanoparticles, a potential applicant for T1--T2 dual-modal MRI contrast agent. We have explored the interactions of BiFeO3 nanoparticles on live cells and the binding of FITC-conjugated Fe3O 4 nanoparticles with artificial lipid membranes to investigate these materials as candidates in medical imaging. Taken together, these studies have advanced our understanding of the fundamental physical principles that governs magnetism in magnetic materials with a focus on developing these nanoparticles for advanced biomedical applications. The materials developed and studied expand the repertoire of tools available for multimodal imaging, using both x-ray and magnetic resonance.

  1. Active curcumin nanoparticles formed from a volatile microemulsion template.

    PubMed

    Margulis, K; Srinivasan, S; Ware, M J; Summers, H D; Godin, B; Magdassi, S

    2014-01-01

    We report on biological performance of organic nanoparticles formed by a simple method based on rapid solvent removal from a volatile microemulsion. The particular focus of the study was on testing the suitability of the method for substances soluble in partially water-miscible organic solvents as well as on evaluating the therapeutic activity of the resultant nanoparticles. Curcumin was employed as a model for hydrophobic drug, and, as it is soluble in water-miscible organic solvents, it was successfully incorporated into a new cyclopentanone-water microemulsion system. During rapid solvent removal by spray-drying, the nanometric droplets of the microemulsion were converted into nanoparticles containing amorphous curcumin with the average size of 20.2±3.4 nm, having ζ potential of -36.2 ±1.8 mV. These nanoparticles were dispersible in water and retained the high loading of the active substance. The therapeutic activity of the resulting nanoparticles was demonstrated in a pancreatic cancer cell line Panc-1. The effective concentration for reducing the metabolic activity was found to be 11.5 μM for nanoparticles compared with 19.5 μM for free curcumin. PMID:25485110

  2. Active curcumin nanoparticles formed from a volatile microemulsion template

    PubMed Central

    Margulis, K.; Srinivasan, S.; Ware, M. J.; Summers, H. D.; Godin, B.

    2014-01-01

    We report on biological performance of organic nanoparticles formed by a simple method based on rapid solvent removal from a volatile microemulsion. The particular focus of the study was on testing the suitability of the method for substances soluble in partially water-miscible organic solvents as well as on evaluating the therapeutic activity of the resultant nanoparticles. Curcumin was employed as a model for hydrophobic drug, and, as it is soluble in water-miscible organic solvents, it was successfully incorporated into a new cyclopentanone-water microemulsion system. During rapid solvent removal by spray-drying, the nanometric droplets of the microemulsion were converted into nanoparticles containing amorphous curcumin with the average size of 20.2±3.4 nm, having ζ potential of −36.2 ±1.8 mV. These nanoparticles were dispersible in water and retained the high loading of the active substance. The therapeutic activity of the resulting nanoparticles was demonstrated in a pancreatic cancer cell line Panc-1. The effective concentration for reducing the metabolic activity was found to be 11.5 μM for nanoparticles compared with 19.5 μM for free curcumin. PMID:25485110

  3. Nanoparticle Nanosensors for Intracellular Measurements of Metabolites and Metabolic Indicators

    NASA Astrophysics Data System (ADS)

    Talley, Chad

    2004-03-01

    Surface-enhanced Raman scattering (SERS) using metal nanoparticles provides a powerful tool for investigating the chemical micro-environments in biological systems. We are currently developing chemical sensors using functionalized metal nanoparticles combined with SERS. The sensors consist of gold or silver nanoparticles (50-100 nm in diameter) which are coated with a functional group that will react with the target analyte. Changes in the observed SERS spectrum upon analyte binding are then used to identify and quantify the analyte molecule. This approach improves the specificity of the technique and reduces the background resulting from non-specific adsorption to the metal surface. The region of enhancement is confined to within a few nanometers of the particle surface providing a highly localized signal. Additionally, the sensors are extremely robust allowing measurements to extend over long time periods without signal degradation. Here we present steps toward utilizing functionalized metal nanoparticles combined with SERS as chemical sensors. The results from pH measurements using the functionalized nanoparticle sensors will be presented as well as progress toward the development of sensors for other analytes of interest. Finally, progress toward incorporating these nanoparticle sensors into living cells for localized measurement will be presented. This work was performed under the auspices of the U. S. Department of Energy by the University of California, Lawrence Livermore National Laboratory under Contract No. W-7405-Eng-48.

  4. HDL-mimetic PLGA nanoparticle to target atherosclerosis plaque macrophages.

    PubMed

    Sanchez-Gaytan, Brenda L; Fay, Francois; Lobatto, Mark E; Tang, Jun; Ouimet, Mireille; Kim, YongTae; van der Staay, Susanne E M; van Rijs, Sarian M; Priem, Bram; Zhang, Liangfang; Fisher, Edward A; Moore, Kathryn J; Langer, Robert; Fayad, Zahi A; Mulder, Willem J M

    2015-03-18

    High-density lipoprotein (HDL) is a natural nanoparticle that exhibits an intrinsic affinity for atherosclerotic plaque macrophages. Its natural targeting capability as well as the option to incorporate lipophilic payloads, e.g., imaging or therapeutic components, in both the hydrophobic core and the phospholipid corona make the HDL platform an attractive nanocarrier. To realize controlled release properties, we developed a hybrid polymer/HDL nanoparticle composed of a lipid/apolipoprotein coating that encapsulates a poly(lactic-co-glycolic acid) (PLGA) core. This novel HDL-like nanoparticle (PLGA-HDL) displayed natural HDL characteristics, including preferential uptake by macrophages and a good cholesterol efflux capacity, combined with a typical PLGA nanoparticle slow release profile. In vivo studies carried out with an ApoE knockout mouse model of atherosclerosis showed clear accumulation of PLGA-HDL nanoparticles in atherosclerotic plaques, which colocalized with plaque macrophages. This biomimetic platform integrates the targeting capacity of HDL biomimetic nanoparticles with the characteristic versatility of PLGA-based nanocarriers. PMID:25650634

  5. HDL-Mimetic PLGA Nanoparticle To Target Atherosclerosis Plaque Macrophages

    PubMed Central

    Sanchez-Gaytan, Brenda L.; Fay, Francois; Lobatto, Mark E.; Tang, Jun; Ouimet, Mireille; Kim, YongTae; van der Staay, Susanne E. M.; van Rijs, Sarian M.; Priem, Bram; Zhang, Liangfang; Fisher, Edward A; Moore, Kathryn J.; Langer, Robert; Fayad, Zahi A.; Mulder, Willem J M

    2015-01-01

    High-density lipoprotein (HDL) is a natural nanoparticle that exhibits an intrinsic affinity for atherosclerotic plaque macrophages. Its natural targeting capability as well as the option to incorporate lipophilic payloads, e.g., imaging or therapeutic components, in both the hydrophobic core and the phospholipid corona make the HDL platform an attractive nanocarrier. To realize controlled release properties, we developed a hybrid polymer/HDL nanoparticle composed of a lipid/apolipoprotein coating that encapsulates a poly(lactic-co-glycolic acid) (PLGA) core. This novel HDL-like nanoparticle (PLGA–HDL) displayed natural HDL characteristics, including preferential uptake by macrophages and a good cholesterol efflux capacity, combined with a typical PLGA nanoparticle slow release profile. In vivo studies carried out with an ApoE knockout mouse model of atherosclerosis showed clear accumulation of PLGA–HDL nanoparticles in atherosclerotic plaques, which colocalized with plaque macrophages. This biomimetic platform integrates the targeting capacity of HDL biomimetic nanoparticles with the characteristic versatility of PLGA-based nanocarriers. PMID:25650634

  6. Characterisation of copper oxide nanoparticles for antimicrobial applications.

    PubMed

    Ren, Guogang; Hu, Dawei; Cheng, Eileen W C; Vargas-Reus, Miguel A; Reip, Paul; Allaker, Robert P

    2009-06-01

    Copper oxide (CuO) nanoparticles were characterised and investigated with respect to potential antimicrobial applications. It was found that nanoscaled CuO, generated by thermal plasma technology, contains traces of pure Cu and Cu2O nanoparticles. Transmission electron microscopy (TEM) demonstrated particle sizes in the range 20-95 nm. TEM energy dispersive spectroscopy gave the ratio of copper to oxygen elements as 54.18% to 45.26%. The mean surface area was determined as 15.69 m(2)/g by Brunau-Emmet-Teller (BET) analysis. CuO nanoparticles in suspension showed activity against a range of bacterial pathogens, including meticillin-resistant Staphylococcus aureus (MRSA) and Escherichia coli, with minimum bactericidal concentrations (MBCs) ranging from 100 microg/mL to 5000 microg/mL. The ability of CuO nanoparticles to reduce bacterial populations to zero was enhanced in the presence of sub-MBC concentrations of silver nanoparticles. Studies of CuO nanoparticles incorporated into polymers suggest release of ions may be required for optimum killing. PMID:19195845

  7. Molecular imaging with nanoparticles: giant roles for dwarf actors.

    PubMed

    Debbage, Paul; Jaschke, Werner

    2008-11-01

    Molecular imaging, first developed to localise antigens in light microscopy, now encompasses all imaging modalities including those used in clinical care: optical imaging, nuclear medical imaging, ultrasound imaging, CT, MRI, and photoacoustic imaging. Molecular imaging always requires accumulation of contrast agent in the target site, often achieved most efficiently by steering nanoparticles containing contrast agent into the target. This entails accessing target molecules hidden behind tissue barriers, necessitating the use of targeting groups. For imaging modalities with low sensitivity, nanoparticles bearing multiple contrast groups provide signal amplification. The same nanoparticles can in principle deliver both contrast medium and drug, allowing monitoring of biodistribution and therapeutic activity simultaneously (theranostics). Nanoparticles with multiple bioadhesive sites for target recognition and binding will be larger than 20 nm diameter. They share functionalities with many subcellular organelles (ribosomes, proteasomes, ion channels, and transport vesicles) and are of similar sizes. The materials used to synthesise nanoparticles include natural proteins and polymers, artificial polymers, dendrimers, fullerenes and other carbon-based structures, lipid-water micelles, viral capsids, metals, metal oxides, and ceramics. Signal generators incorporated into nanoparticles include iron oxide, gadolinium, fluorine, iodine, bismuth, radionuclides, quantum dots, and metal nanoclusters. Diagnostic imaging applications, now appearing, include sentinal node localisation and stem cell tracking. PMID:18825403

  8. [Roentgen findings following incorporation of metallic mercury].

    PubMed

    Lange, H; Schadeberg, A; Hiller, U

    1987-05-01

    In the light of own cases and the present literature the different possibilities of the incorporation of metallic mercury are indicated, the radiological findings explained and the possible consequences of the proof discussed. PMID:3630295

  9. Incorporating Reading Skills into Art Lessons.

    ERIC Educational Resources Information Center

    Peragallo, Anne M.

    1981-01-01

    Using a ceramics unit, the author illustrates ways of incorporating the following reading skills into an art lesson: following directions; pronunciation, spelling, and vocabulary development; interpreting illustrations; using reference books and materials; notetaking; and skimming. (SJL)

  10. 49 CFR 572.80 - Incorporated materials.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ... accordance with 5 U.S.C. 552(a) and 1 CFR part 51. Copies of the materials may be obtained from Rowley-Scher... 49 Transportation 7 2011-10-01 2011-10-01 false Incorporated materials. 572.80 Section 572.80... Incorporated materials. The drawings and specifications referred to in § 572.81(a) that are not set forth...

  11. 49 CFR 572.80 - Incorporated materials.

    Code of Federal Regulations, 2014 CFR

    2014-10-01

    ... accordance with 5 U.S.C. 552(a) and 1 CFR part 51. Copies of the materials may be obtained from Rowley-Scher... 49 Transportation 7 2014-10-01 2014-10-01 false Incorporated materials. 572.80 Section 572.80... Incorporated materials. The drawings and specifications referred to in § 572.81(a) that are not set forth...

  12. 49 CFR 572.80 - Incorporated materials.

    Code of Federal Regulations, 2012 CFR

    2012-10-01

    ... accordance with 5 U.S.C. 552(a) and 1 CFR part 51. Copies of the materials may be obtained from Rowley-Scher... 49 Transportation 7 2012-10-01 2012-10-01 false Incorporated materials. 572.80 Section 572.80... Incorporated materials. The drawings and specifications referred to in § 572.81(a) that are not set forth...

  13. 49 CFR 572.80 - Incorporated materials.

    Code of Federal Regulations, 2013 CFR

    2013-10-01

    ... accordance with 5 U.S.C. 552(a) and 1 CFR part 51. Copies of the materials may be obtained from Rowley-Scher... 49 Transportation 7 2013-10-01 2013-10-01 false Incorporated materials. 572.80 Section 572.80... Incorporated materials. The drawings and specifications referred to in § 572.81(a) that are not set forth...

  14. 49 CFR 572.80 - Incorporated materials.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ... accordance with 5 U.S.C. 552(a) and 1 CFR part 51. Copies of the materials may be obtained from Rowley-Scher... 49 Transportation 7 2010-10-01 2010-10-01 false Incorporated materials. 572.80 Section 572.80... Incorporated materials. The drawings and specifications referred to in § 572.81(a) that are not set forth...

  15. Incorporation of thrombospondin into fibrin clots

    SciTech Connect

    Bale, M.D.; Westrick, L.G.; Mosher, D.F.

    1985-06-25

    Thrombospondin is a major platelet glycoprotein which is released from platelets during blood coagulation. The authors examined the interaction of thrombospondin with polymerizing fibrin. Thrombospondin, purified from human platelets and labeled with /sup 125/I, became incorporated into clots formed from both plasma and purified fibrinogen. Plasma clots contained somewhat less thrombospondin than clots formed from equivalent concentrations of fibrinogen. In plasma clots and fibrin clots formed in the presence of factor XIII, thrombospondin was cross-linked in the clot; thrombospondin in the supernatant remained largely monomeric. Cross-linking of thrombospondin by factor XIII, however, only slightly increased the amount of thrombospondin which was incorporated into the clot. In contrast, incorporation of /sup 125/I-fibronectin into clots was dependent upon cross-linking. Most of the incorporation of /sup 125/I-thrombospondin occurred during fibrin polymerization as judged by parallel studies of the incorporation of /sup 125/I-fibrinogen. The amount of thrombospondin incorporated into a clot was directly related to thrombospondin concentration and was only weakly dependent on fibrinogen concentration. Incorporation was not saturated at thrombospondin:fibrin (mol/mol) ratios as high as 2/1. Thrombospondin, however, modified the final structure of fibrin clots in a concentration-dependent manner as monitored by opacity. When tryptic digests of /sup 125/I-thrombospondin were studied, the 270-kilodalton core became incorporated into fibrin whereas the 30-kilodalton heparin binding fragment was excluded. These results indicate that thrombospondin specifically co-polymerizes with fibrin during blood coagulation and may be an important modulator of clot structure.

  16. Encapsulation of gold nanoparticles into self-assembling protein nanoparticles

    PubMed Central

    2012-01-01

    Background Gold nanoparticles are useful tools for biological applications due to their attractive physical and chemical properties. Their applications can be further expanded when they are functionalized with biological molecules. The biological molecules not only provide the interfaces for interactions between nanoparticles and biological environment, but also contribute their biological functions to the nanoparticles. Therefore, we used self-assembling protein nanoparticles (SAPNs) to encapsulate gold nanoparticles. The protein nanoparticles are formed upon self-assembly of a protein chain that is composed of a pentameric coiled-coil domain at the N-terminus and trimeric coiled-coil domain at the C-terminus. The self-assembling protein nanoparticles form a central cavity of about 10 nm in size, which is ideal for the encapsulation of gold nanoparticles with similar sizes. Results We have used SAPNs to encapsulate several commercially available gold nanoparticles. The hydrodynamic size and the surface coating of gold nanoparticles are two important factors influencing successful encapsulation by the SAPNs. Gold nanoparticles with a hydrodynamic size of less than 15 nm can successfully be encapsulated. Gold nanoparticles with citrate coating appear to have stronger interactions with the proteins, which can interfere with the formation of regular protein nanoparticles. Upon encapsulation gold nanoparticles with polymer coating interfere less strongly with the ability of the SAPNs to assemble into nanoparticles. Although the central cavity of the SAPNs carries an overall charge, the electrostatic interaction appears to be less critical for the efficient encapsulation of gold nanoparticles into the protein nanoparticles. Conclusions The SAPNs can be used to encapsulate gold nanoparticles. The SAPNs can be further functionalized by engineering functional peptides or proteins to either their N- or C-termini. Therefore encapsulation of gold nanoparticles into SAPNs can provide a useful platform to generate a multifunctional biodevices. PMID:23114058

  17. Direct Electrochemistry of Cytochrome bo Oxidase at a series of Gold Nanoparticles-Modified Electrodes.

    PubMed

    Melin, Frederic; Meyer, Thomas; Lankiang, Styven; Choi, Sylvia K; Gennis, Robert B; Blanck, Christian; Schmutz, Marc; Hellwig, Petra

    2013-01-01

    New membrane-protein based electrodes were prepared incorporating cytochrome bo(3) from E. coli and gold nanoparticles. Direct electron transfer between the electrode and the immobilized enzymes was achieved, resulting in an electrocatalytic activity in presence of O(2). The size of the gold nanoparticles was shown to be important and smaller particles were shown to reduce the overpotential of the process. PMID:23335854

  18. Engineered Hybrid Nanoparticles for On-Demand Diagnostics and Therapeutics.

    PubMed

    Nguyen, Kim Truc; Zhao, Yanli

    2015-12-15

    Together with the simultaneous development of nanomaterials and molecular biology, the bionano interface brings about various applications of hybrid nanoparticles in nanomedicine. The hybrid nanoparticles not only present properties of the individual components but also show synergistic effects for specialized applications. Thus, the development of advanced hybrid nanoparticles for targeted and on-demand diagnostics and therapeutics of diseases has rapidly become a hot research topic in nanomedicine. The research focus is to fabricate novel classes of programmable hybrid nanoparticles that are precisely engineered to maximize drug concentrations in diseased cells, leading to enhanced efficacy and reduced side effects of chemotherapy for the disease treatment. In particular, the hybrid nanoparticle platforms can simultaneously target diseased cells, enable the location to be imaged by optical methods, and release therapeutic drugs to the diseased cells by command. This Account specially discusses the rational fabrication of integrated hybrid nanoparticles and their applications in diagnostics and therapeutics. For diagnostics applications, hybrid nanoparticles can be utilized as imaging agents that enable detailed visualization at the molecular level. By the use of suitable targeting ligands incorporated on the nanoparticles, targeted optical imaging may be feasible with improved performance. Novel imaging techniques such as multiphoton excitation and photoacoustic imaging using near-infrared light have been developed using the intrinsic properties of particular nanoparticles. The use of longer-wavelength excitation sources allows deeper penetration into the human body for disease diagnostics and at the same time reduces the adverse effects on normal tissues. Furthermore, multimodal imaging techniques have been achieved by combining several types of components in nanoparticles, offering higher accuracy and better spatial views, with the aim of detecting life-threatening diseases before symptoms appear. For therapeutics applications, various nanoparticle-based treatment methods such as photodynamic therapy, drug delivery, and gene delivery have been developed. The intrinsic ability of organic nanoparticles to generate reactive oxygen species has been utilized for photodynamic therapy, and mesoporous silica nanoparticles have been widely used for drug loading and controlled delivery. Herein, the development of controlled-release systems that can specifically deliver drug molecules to target cells and release then upon triggering is highlighted. By control of the release of loaded drug molecules at precise sites (e.g., cancer cells or malignant tumors), side effects of the drugs are minimized. This approach provides better control and higher efficacy of drugs in the human body. Future personalized medicine is also feasible through gene delivery methods. Specific DNA/RNA-carrying nanoparticles are able to deliver them to target cells to obtain desired properties. This development may create an evolution in current medicine, leading to more personalized healthcare systems that can reduce the population screening process and also the duration of drug evaluation. Furthermore, nanoparticles can be incorporated with various components that can be used for simultaneous diagnostics and therapeutics. These multifunctional theranostic nanoparticles enable real-time monitoring of treatment process for more efficient therapy. PMID:26605438

  19. Nanoparticle flotation collectors II: the role of nanoparticle hydrophobicity.

    PubMed

    Yang, Songtao; Pelton, Robert

    2011-09-20

    The ability of polystyrene nanoparticles to facilitate the froth flotation of glass beads was correlated to the hydrophobicity of the nanoparticles. Contact angle measurements were used to probe the hydrophobicity of hydrophilic glass surfaces decorated with hydrophobic nanoparticles. Both sessile water drop advancing angles, θ(a), and attached air bubble receding angle measurements, θ(r), were performed. For glass surfaces saturated with adsorbed nanoparticles, flotation recovery, a measure of flotation efficiency, increased with increasing values of each type of contact angle. As expected, the advancing water contact angle on nanoparticle-decorated, dry glass surfaces increased with surface coverage, the area fraction of glass covered with nanoparticles. However, the nanoparticles were far more effective at raising the contact angle than the Cassie-Baxter prediction, suggesting that with higher nanoparticle coverages the water did not completely wet the glass surfaces between the nanoparticles. A series of polystyrene nanoparticles was prepared to cover a range of surface energies. Water contact angle measurements, θ(np), on smooth polymer films formed from organic solutions of dissolved nanoparticles were used to rank the nanoparticles in terms of hydrophobicity. Glass spheres were saturated with adsorbed nanoparticles and were isolated by flotation. The minimum nanoparticle water contact angle to give high flotation recovery was in the range of 51° < θ(np(min)) ≤ 85°. PMID:21830818

  20. Gas Phase Nanoparticle Synthesis

    NASA Astrophysics Data System (ADS)

    Granqvist, Claes; Kish, Laszlo; Marlow, William

    This book deals with gas-phase nanoparticle synthesis and is intended for researchers and research students in nanomaterials science and engineering, condensed matter physics and chemistry, and aerosol science. Gas-phase nanoparticle synthesis is instrumental to nanotechnology - a field in current focus that raises hopes for environmentally benign, resource-lean manufacturing. Nanoparticles can be produced by many physical, chemical, and even biological routes. Gas-phase synthesis is particularly interesting since one can achieve accurate manufacturing control and hence industrial viability.

  1. NIR fluorescent silica nanoparticles as reporting labels in bioanalytical applications

    NASA Astrophysics Data System (ADS)

    Patonay, Gabor; Henary, Maged; Chapman, Gala; Emer, Kyle; Crow, Sydney

    2015-03-01

    The use of the NIR spectral region (650-900 nm) for bioanalytical and biomedical analyses is advantageous due to the inherently lower background interference in biological matrices and the high molar absorptivities of NIR chromophores. There are several different groups of NIR fluorescing dye are available for bioanalytical applications. One of these groups, NIR carbocyanines are increasingly used in analytical, bioanalytical and medical applications. These dyes can be used as reporter labels for sensitive bioanalytical use, such as immunochemistry. Due to the spectroscopic sensitivity of NIR carbocyanines for polarity changes in the microenvironment fluorescence quantum yield can vary significantly dependent on the microenvironment. NIR dyes can have relatively low fluorescent quantum yields as compared to visible fluorophores, especially in aqueous buffers but the lower quantum yield is compensated for by a much higher molar absorptivity. The fluorescence intensity of NIR reporting labels can significantly be increased by enclosing several dye molecules in silica nanoparticles. Incorporation of NIR dyes in silica nanoparticles creates a unique challenge as these dyes can be unstable under certain chemical conditions present during silica nanoparticles syntheses. In addition, self quenching may also become a problem for carbocyanines at higher a concentrations that typically found inside of NIR dye loaded silica nanoparticles. Dyes possessing high Stokes' shift can significantly reduce this problem. NIR carbocyanines are uniquely positioned for achieving this goal using a synthetic route that substitutes meso position halogens in NIR fluorescent carbocyanines with a linker containing amino moiety, which can also serve as a linker for covalently attaching the dye molecule to the nanoparticle backbone. The resulting silica nanoparticles can contain a large number of NIR dyes dependent on their size. For example some NIR fluorescent silica nanoparticle labels prepared that has an average radius around 15 nm, contains 16-20 covalently attached dye molecules inside of the nanoparticle. The primary applications of these particles are for bright fluorescent labels that can be used in applications such as immunochemistry, flow cytometry, and many other applications.

  2. Improvement of thermal stability of polypropylene using DOPO-immobilized silica nanoparticles

    PubMed Central

    Dong, Quanxiao; Ding, Yanfen; Wen, Bin; Wang, Feng; Dong, Huicong; Zhang, Shimin

    2014-01-01

    After the surface silylation with 3-methacryloxypropyltrimethoxysilane, silica nanoparticles were further modified by 9,10-dihydro-9-oxa-10-phosphaphenanthrene-10-oxide (DOPO). The immobilization of DOPO on silica nanoparticles was confirmed by Fourier transform infrared spectroscopy, UV–visible spectroscopy, magic angle spinning nuclear magnetic resonance, and thermogravimetric analysis. By incorporating the DOPO-immobilized silica nanoparticles (5 wt%) into polypropylene matrix, the thermal oxidative stability exhibited an improvement of 62 °C for the half weight loss temperature, while that was only 26 °C increment with incorporation of virgin silica nanoparticles (5 wt%). Apparent activation energies of the polymer nanocomposites were estimated via Flynn–Wall–Ozawa method. It was found that the incorporation of DOPO-immobilized silica nanoparticles improved activation energies of the degradation reaction. Based on the results, it was speculated that DOPO-immobilized silica nanoparticles could inhibit the degradation of polypropylene and catalyze the formation of carbonaceous char on the surface. Thus, thermal stability was significantly improved. PMID:24729654

  3. Thermoelectric Properties of Carbon nanohybrids Incorporated Polymer Nanocomposites

    NASA Astrophysics Data System (ADS)

    Zhang, Kun; Wang, Shiren

    2015-03-01

    In this work, non-covalently functionalized graphene with fluorinated fullerene (F-C60) by π- π stacking was integrated into poly(3,4-ethylenedioxythiophene):poly(styrenesulfonate) (PEDOT:PSS). F-C60 as a p-type organic semiconductor with deep highest occupied molecular orbital (HOMO) level modulates the band structure of reduced graphene oxide (rGO). Altering HOMO levels of rGO has been achieved by changing the ratio between rGO and F-C60. Incorporating of rGO/F-C60 nanohybrids into highly conductivity metallic PEDOT:PSS formed Schottky barrier to selectively scatter low-energy carriers. Enhanced thermoelectric power factor of rGO/F-C60/PEDOT:PSS nanocomposites were observed with the optimized power factor of 83.2 μW/m.K2, which is 19 times of that of the highly conductive PEDOT:PSS. Additionally, the F-C60 nanoparticles on rGO surfaces hinder thermal transport by phonon scattering, resulting in the synergistic effect on enhancing thermoelectric properties. As a result, a figure of merit (ZT) of 0.10 was achieved. NSF

  4. Effect of Gold Nanoparticle on Structure and Fluidity of Lipid Membrane

    PubMed Central

    Mhashal, Anil R.; Roy, Sudip

    2014-01-01

    This paper deals with the effect of different size gold nanoparticles on the fluidity of lipid membrane at different regions of the bilayer. To investigate this, we have considered significantly large bilayer leaflets and incorporated only one nanoparticle each time, which was subjected to all atomistic molecular dynamics simulations. We have observed that, lipid molecules located near to the gold nanoparticle interact directly with it, which results in deformation of lipid structure and slower dynamics of lipid molecules. However, lipid molecules far away from the interaction site of the nanoparticle get perturbed, which gives rise to increase in local ordering of the lipid domains and decrease in fluidity. The bilayer thickness and area per head group in this region also get altered. Similar trend, but with different magnitude is also observed when different size nanoparticle interact with the bilayer. PMID:25469786

  5. Current scenario of biomedical aspect of metal-based nanoparticles on gel dosimetry.

    PubMed

    Titus, Deena; Samuel, E James Jebaseelan; Mohana Roopan, Selvaraj

    2016-06-01

    In past decades, the possibility of using high atomic number nanoparticle has gained interest in gel dosimetry to enhance the dose deposited in the tumor while using low radiation as well as for better imaging purposes. Sparing of healthy tissues and targeting the tumor part have become much more captivating with the help of these systems. The gel dosimetry is a the three-dimensional dosimeter for extracting the dose, which can be used along with the nanoparticles like gold, platinum, and silver, for better therapeutic efficiency for modern radiotherapy techniques. These nanoparticles of different size prepared either by chemical route or green synthesis and incorporated into the gel system respond in a different manner. Having wide applications in therapeutic field, this study reviews the use of gel dosimeters in the therapeutic procedures and also with the aid of nanoparticles so as to achieve dose enhancement. The biological activity of the various nanoparticles has been discussed. PMID:27100529

  6. Cobalt driven enhancement of nanomagnetism in iron-oxide nanoparticles encapsulated in a synthetic ferritin shell

    NASA Astrophysics Data System (ADS)

    Skoropata, E.; Ceci, P.; Kasyutich, O.; van Lierop, J.

    2012-04-01

    We have examined the effects of Co doping (0-12% relative to total metal) on the magnetic properties of iron-oxide nanoparticles incorporated in a synthetic ferritin shell. Mössbauer spectroscopy revealed that the nanoparticles consisted of a mixture of Fe3 O4 and γ-Fe2 O3, and that Co was integrated exclusively into the B-sites of the Fe3 O4 phase. Cobalt doping resulted in the formation of Cox Fe3-x O4/γ-Fe2 O3 nanoparticles with x = 0, 0.25, 0.51, 0.56, and 0.63. Magnetometry and susceptometry experiments showed that substantial enhancements in the coercivities, blocking temperatures and anisotropy constants of the magnetoferritin nanoparticles occurred for all Co doping levels. Our results show that the Co altered significantly the local atomic Fe magnetism and enhanced the magnetic nanoparticle anisotropy considerably.

  7. Radiolabelled nanoparticles: novel classification of radiopharmaceuticals for molecular imaging of cancer.

    PubMed

    Mirshojaei, Seyedeh Fatemeh; Ahmadi, Amirhossein; Morales-Avila, Enrique; Ortiz-Reynoso, Mariana; Reyes-Perez, Horacio

    2016-02-01

    Nanotechnology has been used for every single modality in the molecular imaging arena for imaging purposes. Synergic advantages can be explored when multiple molecular imaging modalities are combined with respect to single imaging modalities. Multifunctional nanoparticles have large surface areas, where multiple functional moieties can be incorporated, including ligands for site-specific targeting and radionuclides, which can be detected to create 3D images. Recently, radiolabeled nanoparticles with individual properties have attracted great interest regarding their use in multimodality tumor imaging. Multifunctional nanoparticles can combine diagnostic and therapeutic capabilities for both target-specific diagnosis and the treatment of a given disease. The future of nanomedicine lies in multifunctional nanoplatforms that combine the diagnostic ability and therapeutic effects using appropriate ligands, drugs, responses and technological devices, which together are collectively called theranostic drugs. Co-delivery of radiolabeled nanoparticles is useful in multifunctional molecular imaging areas because it comprises several advantages based on nanoparticles architecture, pharmacokinetics and pharmacodynamic properties. PMID:26061297

  8. Acidic pH-induced charge-reversal nanoparticles for accelerated endosomal escape and enhanced microRNA modulation in cancer cells.

    PubMed

    Deng, Xiongwei; Wang, Yihui; Zhang, Fang; Yin, Zhaoxia; Hu, Qin; Xiao, Xiangqian; Zhou, Zhixiang; Wu, Yan; Sheng, Wang; Zeng, Yi

    2016-02-11

    pH-Induced charge-reversal nanoparticles incorporating microRNA (miRNA) were engineered through a single-step self-assembly of polyelectrolyte complexes. We found that the endosomal/lysosomal acidic environment could trigger the charge reversal of the nanoparticles from negative charge to positive charge and induce the structure alteration of the nanoparticles, which in turn led to accelerated endosomal escape and enhanced miRNA modulation in esophageal cancer cells. PMID:26811998

  9. Photoluminescence spectroscopy and lifetime measurements from self-assembled semiconductor-metal nanoparticle hybrid arrays.

    SciTech Connect

    Haridas, M.; Basue, J. K.; Gosztola, D. J.; Wiederrecht, G. P.

    2010-08-23

    We present results of photoluminescence spectroscopy and lifetime measurements on thin film hybrid arrays of semiconductor quantum dots and metal nanoparticles embedded in a block copolymer template. The intensity of emission as well as the measured lifetime would be controlled by varying the volume fraction and location of gold nanoparticles in the matrix. We demonstrate the ability to both enhance and quench the luminescence in the hybrids as compared to the quantum dot array films while simultaneously engineering large reduction in luminescence lifetime with incorporation of gold nanoparticles.

  10. Spray-coated nanoscale conductive patterns based on in situ sintered silver nanoparticle inks

    NASA Astrophysics Data System (ADS)

    Zheng, Yifan; Li, Shuguang; Shi, Wei; Yu, Junsheng

    2014-03-01

    Nanoscale patterns with high conductivity based on silver nanoparticle inks were fabricated using spray coating method. Through optimizing the solution content and spray operation, accurate nanoscale patterns consisting of silver nanoparticles with a square resistance lower than 1 Ω /cm2 were obtained. By incorporating in situ sintering to substitute the general post sintering process, the time consumption could be significantly reduced to one sixth, qualifying it for large-scale and cost-effective fabrication of printed electronics. To testify the application of spray-coated silver nanoparticle inks, an inverted polymer solar cell was also fabricated, which exhibited a power conversion efficiency of 2.76%.

  11. Crystallization of DNA-capped gold nanoparticles in high-concentration, divalent salt environments.

    PubMed

    Tan, Shawn J; Kahn, Jason S; Derrien, Thomas L; Campolongo, Michael J; Zhao, Mervin; Smilgies, Detlef-M; Luo, Dan

    2014-01-27

    The multiparametric nature of nanoparticle self-assembly makes it challenging to circumvent the instabilities that lead to aggregation and achieve crystallization under extreme conditions. By using non-base-pairing DNA as a model ligand instead of the typical base-pairing design for programmability, long-range 2D DNA-gold nanoparticle crystals can be obtained at extremely high salt concentrations and in a divalent salt environment. The interparticle spacings in these 2D nanoparticle crystals can be engineered and further tuned based on an empirical model incorporating the parameters of ligand length and ionic strength. PMID:24459055

  12. Spray-coated nanoscale conductive patterns based on in situ sintered silver nanoparticle inks.

    PubMed

    Zheng, Yifan; Li, Shuguang; Shi, Wei; Yu, Junsheng

    2014-01-01

    Nanoscale patterns with high conductivity based on silver nanoparticle inks were fabricated using spray coating method. Through optimizing the solution content and spray operation, accurate nanoscale patterns consisting of silver nanoparticles with a square resistance lower than 1 ? /cm2 were obtained. By incorporating in situ sintering to substitute the general post sintering process, the time consumption could be significantly reduced to one sixth, qualifying it for large-scale and cost-effective fabrication of printed electronics. To testify the application of spray-coated silver nanoparticle inks, an inverted polymer solar cell was also fabricated, which exhibited a power conversion efficiency of 2.76%. PMID:24666992

  13. Preparation and luminescent properties of GdOF:Ce, Tb nanoparticles and their transparent PMMA nanocomposites

    NASA Astrophysics Data System (ADS)

    Cai, Wen; Wang, Aiwu; Fu, Li; Hu, Jie; Rao, Tingke; Wang, Junqing; Zhong, Jiasong; Xiang, Weidong

    2015-05-01

    GdOF:Ce, Tb nanoparticles and their poly (methyl methacrylate) (PMMA) nanocomposites have been successfully prepared by a thermolysis route and thermal polymerization of methyl methacrylate (MMA) monomer, respectively. The obtained nanoparticles and nanocomposites are characterized by XRD, EDS, TEM, FTIR, TGA, UV-Vis and PL spectrum. The as-synthesized transparent GdOF:Ce, Tb/PMMA nanocomposites exhibit green photoluminescence under the irradiation of 254 nm UV lamp due to the incorporation of luminescent GdOF:Ce, Tb nanoparticles into the PMMA matrix. The present route would provide a general strategy to prepare other functional nanocomposites.

  14. Surface modification strategies on mesoporous silica nanoparticles for anti-biofouling zwitterionic film grafting.

    PubMed

    Khung, Yit Lung; Narducci, Dario

    2015-12-01

    In the past decade, zwitterionic-based anti-biofouling layers had gained much focus as a serious alternative to traditional polyhydrophilic films such as PEG. In the area of assembling silica nanoparticles with stealth properties, the incorporation of zwitterionic surface film remains fairly new but considering that silica nanoparticles had been widely demonstrated as useful biointerfacing nanodevice, zwitterionic film grafting on silica nanoparticle holds much potential in the future. This review will discuss on the conceivable functional chemistry approaches, some of which are potentially suitable for the assembly of such stealth systems. PMID:26589704

  15. Spray-coated nanoscale conductive patterns based on in situ sintered silver nanoparticle inks

    PubMed Central

    2014-01-01

    Nanoscale patterns with high conductivity based on silver nanoparticle inks were fabricated using spray coating method. Through optimizing the solution content and spray operation, accurate nanoscale patterns consisting of silver nanoparticles with a square resistance lower than 1 Ω /cm2 were obtained. By incorporating in situ sintering to substitute the general post sintering process, the time consumption could be significantly reduced to one sixth, qualifying it for large-scale and cost-effective fabrication of printed electronics. To testify the application of spray-coated silver nanoparticle inks, an inverted polymer solar cell was also fabricated, which exhibited a power conversion efficiency of 2.76%. PMID:24666992

  16. Hyperspectral imaging of plasmon resonances in metallic nanoparticles.

    PubMed

    Zopf, David; Jatschka, Jacqueline; Dathe, André; Jahr, Norbert; Fritzsche, Wolfgang; Stranik, Ondrej

    2016-07-15

    The spectroscopy of metal nanoparticles shows great potential for label-free sensing. In this article we present a hyper-spectral imaging system combined with a microfluidic system, which allows full spectroscopic characterization of many individual nanoparticles simultaneously (>50 particles). With such a system we were able overcome several limitations that are present in LSPR sensing with nanoparticle ensemble. We experimentally quantified (incorporating atomic force microscopy as well) the correlation between geometry, position of plasmon resonance (λPeak) and sensitivity of the particles (Sb=1.63λPeak-812.47[nm/RIU]). We were able to follow the adsorption of protein layers and determined their spatial inhomogeneity with the help of the hyperspectral imaging. PMID:26974477

  17. Electrosprayed nanoparticles for drug delivery and pharmaceutical applications

    PubMed Central

    Sridhar, Radhakrishnan; Ramakrishna, Seeram

    2013-01-01

    Nanotechnology based Pharma has emerged significantly and has influenced the Pharma industry up to a considerable extent. Nanoparticles technology holds a good share of the nanotech Pharma and is significant in comparison with the other domains. Electrospraying technology answers the potential needs of nanoparticle production such as scalability, reproducibility, effective encapsulation etc. Many drugs have been electrosprayed with and without polymer carriers. Drug release characteristics are improved with the incorporation of biodegradable polymer carriers which sustain the release of encapsulated drug. Electrospraying is acknowledged as an important technique for the preparation of nanoparticles with respect to pharmaceutical applications. Herein we attempted to consolidate the reports pertaining to electrospraying and their corresponding therapeutic application area. PMID:23512013

  18. Poly(amino acid) functionalized maghemite and gold nanoparticles

    NASA Astrophysics Data System (ADS)

    Perego, Davide; Masciocchi, Norberto; Guagliardi, Antonietta; Domínguez-Vera, José Manuel; Gálvez, Natividad

    2013-02-01

    Bimodal MRI/OI imaging probes are of great interest in nanomedicine. Although many organic polymers have been studied thoroughly for in vivo applications, reports on the use of poly(amino acid)s as coating polymers are scarce. In this paper, poly-(d-glutamic acid, d-lysine) (PGL) has been used for coating maghemite and gold nanoparticles. An advantage of this flexible and biocompatible polymer is that, once anchored to the nanoparticle surface, dangling lysine amino groups are available for the incorporation of new functionalities. As an example, Alexa Fluor derivatives have been attached to PGL-coated maghemite nanoparticles to obtain magnetic/fluorescent materials. These dual-property materials could be used as bimodal MRI/OI probes for in vivo imaging.

  19. Effects of Gold Nanoparticles on the Response of Phenol Biosensor Containing Photocurable Membrane with Tyrosinase

    PubMed Central

    Hanifah, Sharina Abu; Heng, Lee Yook; Ahmad, Musa

    2008-01-01

    The role of incorporation of gold nanoparticles (50-130 nm in diameter) into a series of photocurable methacrylic-acrylic based biosensor membranes containing tyrosinase on the response for phenol detection was investigated. Membranes with different hydrophilicities were prepared from 2-hydroxyethyl methacrylate and n-butyl acrylate via direct photocuring. A range of gold nanoparticles concentrations from 0.01 to 0.5 % (w/w) was incorporated into these membranes during the photocuring process. The addition of gold nanoparticles to the biosensor membrane led to improvement in the response time by a reduction of approximately 5 folds to give response times of 5-10 s. The linear response range of the phenol biosensor was also extended from 24 to 90 μM of phenol. The hydrophilicities of the membrane matrices demonstrated strong influence on the biosensor response and appeared to control the effect of the gold nanoparticles. For less hydrophilic methacrylic-acrylic membranes, the addition of gold nanoparticles led to a poorer sensitivity and detection limit of the biosensor towards phenol. Therefore, for the application of gold nanoparticles in the enhancement of a phenol biosensor response, the nanoparticles should be immobilized in a hydrophilic matrix rather than a hydrophobic material.

  20. Fabrication, Modeling and Characterization of Multi-Crosslinked Methacrylate Copolymeric Nanoparticles for Oral Drug Delivery

    PubMed Central

    Ngwuluka, Ndidi C.; Pillay, Viness; Choonara, Yahya E.; Modi, Girish; Naidoo, Dinesh; du Toit, Lisa C.; Kumar, Pradeep; Ndesendo, Valence M.K.; Khan, Riaz A.

    2011-01-01

    Nanotechnology remains the field to explore in the quest to enhance therapeutic efficacies of existing drugs. Fabrication of a methacrylate copolymer-lipid nanoparticulate (MCN) system was explored in this study for oral drug delivery of levodopa. The nanoparticles were fabricated employing multicrosslinking technology and characterized for particle size, zeta potential, morphology, structural modification, drug entrapment efficiency and in vitro drug release. Chemometric Computational (CC) modeling was conducted to deduce the mechanism of nanoparticle synthesis as well as to corroborate the experimental findings. The CC modeling deduced that the nanoparticles synthesis may have followed the mixed triangular formations or the mixed patterns. They were found to be hollow nanocapsules with a size ranging from 152 nm (methacrylate copolymer) to 321 nm (methacrylate copolymer blend) and a zeta potential range of 15.8–43.3 mV. The nanoparticles were directly compressible and it was found that the desired rate of drug release could be achieved by formulating the nanoparticles as a nanosuspension, and then directly compressing them into tablet matrices or incorporating the nanoparticles directly into polymer tablet matrices. However, sustained release of MCNs was achieved only when it was incorporated into a polymer matrix. The experimental results were well corroborated by the CC modeling. The developed technology may be potentially useful for the fabrication of multi-crosslinked polymer blend nanoparticles for oral drug delivery. PMID:22016653

  1. Highly quasi-monodisperse ag nanoparticles on titania nanotubes by impregnative aqueous ion exchange.

    PubMed

    Toledo-Antonio, J A; Cortes-Jácome, M A; Angeles-Chavez, C; López-Salinas, E; Quintana, P

    2009-09-01

    Silver nanoparticles were homogenously dispersed on titania nanotubes (NT), which were prepared by alkali hydrothermal methodology and dried at 373 K. Ag(+) incorporation was done by impregnative ion exchange of aqueous silver nitrate onto NT. First, Ag(+) ions incorporate into the layers of nanotube walls, and then, upon heat treatment under N(2) at 573 and 673 K, they migrate and change into Ag(2)O and Ag(0) nanoparticles, respectively. In both cases, Ag nanoparticles are highly dispersed, decorating the nanotubes in a polka-dot pattern. The Ag particle size distribution is very narrow, being ca. 4 +/- 2 nm without any observable agglomeration. The reduction of Ag(2)O into Ag(0) octahedral nanoparticles occurs spontaneously and topotactically when annealing, without the aid of any reducing agent. The population of Ag(0) nanoparticles can be controlled by adjusting the annealing temperature. An electron charge transfer from NT support to Ag(0) nanoparticles, because of a strong interaction, is responsible for considerable visible light absorption in Ag(0) nanoparticles supported on NT. PMID:19485374

  2. Drug Delivery Nanoparticles in Skin Cancers

    PubMed Central

    Dianzani, Chiara; Zara, Gian Paolo; Maina, Giovanni; Pettazzoni, Piergiorgio; Pizzimenti, Stefania; Rossi, Federica; Gigliotti, Casimiro Luca; Ciamporcero, Eric Stefano; Daga, Martina; Barrera, Giuseppina

    2014-01-01

    Nanotechnology involves the engineering of functional systems at nanoscale, thus being attractive for disciplines ranging from materials science to biomedicine. One of the most active research areas of the nanotechnology is nanomedicine, which applies nanotechnology to highly specific medical interventions for prevention, diagnosis, and treatment of diseases, including cancer disease. Over the past two decades, the rapid developments in nanotechnology have allowed the incorporation of multiple therapeutic, sensing, and targeting agents into nanoparticles, for detection, prevention, and treatment of cancer diseases. Nanoparticles offer many advantages as drug carrier systems since they can improve the solubility of poorly water-soluble drugs, modify pharmacokinetics, increase drug half-life by reducing immunogenicity, improve bioavailability, and diminish drug metabolism. They can also enable a tunable release of therapeutic compounds and the simultaneous delivery of two or more drugs for combination therapy. In this review, we discuss the recent advances in the use of different types of nanoparticles for systemic and topical drug delivery in the treatment of skin cancer. In particular, the progress in the treatment with nanocarriers of basal cell carcinoma, squamous cell carcinoma, and melanoma has been reported. PMID:25101298

  3. Theranostic Upconversion Nanoparticles (I)

    PubMed Central

    Chen, Guanying; Han, Gang

    2013-01-01

    This theme issue provides a comprehensive collection of original research articles on the creation of diverse types of theranostic upconversion nanoparticles, their fundamental interactions in biology, as well as their biophotonic applications in noninvasive diagnostics and therapy. PMID:23606916

  4. Renal Clearance of Nanoparticles

    PubMed Central

    Choi, Hak Soo; Liu, Wenhao; Misra, Preeti; Tanaka, Eiichi; Zimmer, John P.; Ipe, Binil Itty; Bawendi, Moungi G.; Frangioni, John V.

    2008-01-01

    SUMMARY The field of nanotechnology holds great promise for the diagnosis and treatment of human disease. However, the size and charge of most nanoparticles preclude their efficient clearance from the body as intact nanoparticles. Without such clearance or their biodegradation into biologically benign components, toxicity is potentially amplified and radiological imaging is hindered. Using quantum dots (QDs) as a model system, we have precisely defined the requirements for renal filtration and urinary excretion of inorganic, metal-containing nanoparticles. Zwitterionic or neutral organic coatings prevented adsorption of serum proteins, which otherwise increased hydrodynamic diameter (HD) by over 15 nm and prevented renal excretion. A final HD smaller than 5.5 nm resulted in rapid and efficient urinary excretion, and elimination of QDs from the body. This study provides a foundation for the design and development of biologically targeted nanoparticles for biomedical applications. PMID:17891134

  5. The impact of retinol loading and surface charge on the hepatic delivery of lipid nanoparticles.

    PubMed

    Pan, Tai-Long; Wang, Pei-Wen; Hung, Chi-Feng; Aljuffali, Ibrahim A; Dai, You-Shan; Fang, Jia-You

    2016-05-01

    The present work developed lipid nanoparticles to determine whether retinol loading and surface charge influenced liver targeting and biodistribution. Silibinin for treating liver fibrosis was used as the active model. The capability of nanoparticles to suppress hepatic stellate cells (HSCs) was investigated by examining cell viability and α-smooth muscle actin (α-SMA). The biodistribution of the nanocarriers in rats was monitored by real-time and organ bioimaging after an intravenous injection. Silibinin concentration in the organs was detected as well. Anionic nanoparticles showed a mean size of around 260nm, which was greater than that of cationic nanoparticles (about 170nm). The encapsulation percentage of silibinin was >98% for both anionic and cationic nanoparticles. All nanoparticles tested were able to be ingested into HSCs, with no difference between the formulations. The positive nanoparticles produced activated HSC apoptosis much more strongly than negative nanoparticles. The α-SMA suppression exhibited a contrary trend. The nanoparticles rapidly accumulated in the liver and spleen. Retinol incorporation in nanoparticles offers an active targeting approach to the liver via retinol binding protein (RBP). The negatively charged formulation containing retinol achieved higher uptake and longer retention in the liver than the other formulations. Silibinin inclusion in nanoparticles significantly decreased lung deposition and increased liver uptake. The lipid nanosystems promoted silibinin distribution to the liver by 2-3-fold compared to the free control. A better liver-specific selectivity was obtained by retinol-loaded anionic nanocarriers. It is important to optimize the formulations of the lipid nanoparticles for maximizing hepatic targeting. PMID:26901379

  6. Effect of iron oxide and gold nanoparticles on bacterial growth leading towards biological application

    PubMed Central

    2011-01-01

    Background Nanoparticle-metal oxide and gold represents a new class of important materials that are increasingly being developed for use in research and health related activities. The biological system being extremely critical requires the fundamental understanding on the influence of inorganic nanoparticles on cellular growth and functions. Our study was aimed to find out the effect of iron oxide (Fe3O4), gold (Au) nanoparticles on cellular growth of Escherichia coli (E. coli) and also try to channelize the obtained result by functionalizing the Au nanoparticle for further biological applications. Result Fe3O4 and Au nanoparticles were prepared and characterized using Transmission electron microscopy (TEM) and Dynamic Light Scattering (DLS). Preliminary growth analysis data suggest that the nanoparticles of iron oxide have an inhibitory effect on E. coli in a concentration dependant manner, whereas the gold nanoparticle directly showed no such activity. However the phase contrast microscopic study clearly demonstrated that the effect of both Fe3O4 and Au nanoparticle extended up to the level of cell division which was evident as the abrupt increase in bacterial cell length. The incorporation of gold nanoparticle by bacterial cell was also observed during microscopic analysis based on which glutathione functionalized gold nanoparticle was prepared and used as a vector for plasmid DNA transport within bacterial cell. Conclusion Altogether the study suggests that there is metal nanoparticle-bacteria interaction at the cellular level that can be utilized for beneficial biological application but significantly it also posses potential to produce ecotoxicity, challenging the ecofriendly nature of nanoparticles. PMID:21859494

  7. An overview of nanoparticles utilization in magnetorheological materials

    NASA Astrophysics Data System (ADS)

    Leong, S. A. N.; Mazlan, S. A.; Mohamad, N.; Aziz, S. A. A.; Ubaidillah

    2016-02-01

    Magnetorheological (MR) materials belong to smart materials family where the rheological properties can be altered continuously, rapidly and reversibly through the external magnetic field. The tuneable properties depend on the magnitude of the external magnetic field. The micron-sized magnetizable particles having high saturation magnetization within matrix carrier react to the magnetic field resulting in alteration of MR effect. The classic problem of smart materials is particles sedimentation and aggregation issues due to the high concentration and large size of magnetic particles. Many researchers have attempted to solve this issues by introducing nano-sized particles into these materials. Based on the previous researches, the nanoparticles incorporation in MR materials is reported to improve the stability of the MR materials and at the same time enhance the MR performance. This paper presents an overview of nanoparticles incorporation in different types of MR materials which are MR fluids, MR grease, and MR elastomer including the stability and performance achievement regarding rheological properties.

  8. Theoretical Approaches to Nanoparticles

    NASA Astrophysics Data System (ADS)

    Kempa, Krzysztof

    Nanoparticles can be viewed as wave resonators. Involved waves are, for example, carrier waves, plasmon waves, polariton waves, etc. A few examples of successful theoretical treatments that follow this approach are given. In one, an effective medium theory of a nanoparticle composite is presented. In another, plasmon polaritonic solutions allow to extend concepts of radio technology, such as an antenna and a coaxial transmission line, to the visible frequency range.

  9. Genetic incorporation of recycled unnatural amino acids.

    PubMed

    Ko, Wooseok; Kim, Sanggil; Jo, Kyubong; Lee, Hyun Soo

    2016-02-01

    The genetic incorporation of unnatural amino acids (UAAs) into proteins has been a useful tool for protein engineering. However, most UAAs are expensive, and the method requires a high concentration of UAAs, which has been a drawback of the technology, especially for large-scale applications. To address this problem, a method to recycle cultured UAAs was developed. The method is based on recycling a culture medium containing the UAA, in which some of essential nutrients were resupplemented after each culture cycle, and induction of protein expression was controlled with glucose. Under optimal conditions, five UAAs were recycled for up to seven rounds of expression without a decrease in expression level, cell density, or incorporation fidelity. This method can generally be applied to other UAAs; therefore, it is useful for reducing the cost of UAAs for genetic incorporation and helpful for expanding the use of the technology to industrial applications. PMID:26358464

  10. Incorporation of polyethers into molybdenum disulfide galleries

    SciTech Connect

    Lemmon, J.P.; Sloop, S.; Lerner, M.M.

    1993-12-31

    The lithiation and subsequent hydration of MoS{sub 2} provides an exfoliated, collodial suspension which may incorporate molecular clusters or organics upon restacking. The paper reports here the preparation of polyether - disulfide nanocomposites by the interaction of colloidal MoS{sub 2} with an aqueous or organic solution containing the appropriate polymer. MoS{sub 2} was exfoliated by the method indicated above. The interaction of the resulting colloidal suspension with solutions containing either poly(ethylene oxide) or methoxy-linked polyethylene glycol results in the formation of nanocomposites with polymer incorporated within the disulfide galleries. X-ray diffraction indicates an expansion of up to 8.3 {angstrom} between MoS{sub 2} sheets (c = 14.5 {angstrom}) consistent with the incorporation of polymer bilayers within the galleries. Structural data are presented for a range of polymer - disulfide stoichiometries.

  11. Introduction to metallic nanoparticles

    PubMed Central

    Mody, Vicky V.; Siwale, Rodney; Singh, Ajay; Mody, Hardik R.

    2010-01-01

    Metallic nanoparticles have fascinated scientist for over a century and are now heavily utilized in biomedical sciences and engineering. They are a focus of interest because of their huge potential in nanotechnology. Today these materials can be synthesized and modified with various chemical functional groups which allow them to be conjugated with antibodies, ligands, and drugs of interest and thus opening a wide range of potential applications in biotechnology, magnetic separation, and preconcentration of target analytes, targeted drug delivery, and vehicles for gene and drug delivery and more importantly diagnostic imaging. Moreover, various imaging modalities have been developed over the period of time such as MRI, CT, PET, ultrasound, SERS, and optical imaging as an aid to image various disease states. These imaging modalities differ in both techniques and instrumentation and more importantly require a contrast agent with unique physiochemical properties. This led to the invention of various nanoparticulated contrast agent such as magnetic nanoparticles (Fe3O4), gold, and silver nanoparticles for their application in these imaging modalities. In addition, to use various imaging techniques in tandem newer multifunctional nanoshells and nanocages have been developed. Thus in this review article, we aim to provide an introduction to magnetic nanoparticles (Fe3O4), gold nanoparticles, nanoshells and nanocages, and silver nanoparticles followed by their synthesis, physiochemical properties, and citing some recent applications in the diagnostic imaging and therapy of cancer. PMID:21180459

  12. Imaging through plasmonic nanoparticles.

    PubMed

    Tanzid, Mehbuba; Sobhani, Ali; DeSantis, Christopher J; Cui, Yao; Hogan, Nathaniel J; Samaniego, Adam; Veeraraghavan, Ashok; Halas, Naomi J

    2016-05-17

    The optical properties of metallic nanoparticles with plasmon resonances have been studied extensively, typically by measuring the transmission of light, as a function of wavelength, through a nanoparticle suspension. One question that has not yet been addressed, however, is how an image is transmitted through such a suspension of absorber-scatterers, in other words, how the various spatial frequencies are attenuated as they pass through the nanoparticle host medium. Here, we examine how the optical properties of a suspension of plasmonic nanoparticles affect the transmitted image. We use two distinct ways to assess transmitted image quality: the structural similarity index (SSIM), a perceptual distortion metric based on the human visual system, and the modulation transfer function (MTF), which assesses the resolvable spatial frequencies. We show that perceived image quality, as well as spatial resolution, are both dependent on the scattering and absorption cross-sections of the constituent nanoparticles. Surprisingly, we observe a nonlinear dependence of image quality on optical density by varying optical path length and nanoparticle concentration. This work is a first step toward understanding the requirements for visualizing and resolving objects through media consisting of subwavelength absorber-scatterer structures, an approach that should also prove useful in the assessment of metamaterial or metasurface-based optical imaging systems. PMID:27140618

  13. Externally modulated theranostic nanoparticles

    PubMed Central

    Urban, Cordula; Urban, Alexander S.; Charron, Heather; Joshi, Amit

    2013-01-01

    Externally modulated nanoparticles comprise a rapidly advancing class of cancer nanotherapeutics, which combine the favorable tumor accumulation of nanoparticles, with external spatio-temporal control on therapy delivery via optical, magnetic, or ultrasound modalities. The local control on therapy enables higher tumor treatment efficacy, while simultaneously reducing off-target effects. The nanoparticle interactions with external fields have an additional advantage of frequently generating an imaging signal, and thus such agents provide theranostic (both diagnostic and therapeutic) capabilities. In this review, we classify the emerging externally modulated theranostic nanoparticles according to the mode of external control and describe the physiochemical mechanisms underlying the external control of therapy, and illustrate the major embodiments of nanoparticles in each class with proven biological efficacy: (I) electromagnetic radiation in visible and near-infrared range is being exploited for gold based and carbon nanostructures with tunable surface plasmon resonance (SPR) for imaging and photothermal therapy (PTT) of cancer, photochemistry based manipulations are employed for light sensitive liposomes and porphyrin based nanoparticles; (II) Magnetic field based manipulations are being developed for iron-oxide based nanostructures for magnetic resonance imaging (MRI) and magnetothermal therapy; (III) ultrasound based methods are primarily being employed to increase delivery of conventional drugs and nanotherapeutics to tumor sites. PMID:24834381

  14. Gold Incorporated Mesoporous Silica Thin Film Model Surface as a Robust SERS and Catalytically Active Substrate.

    PubMed

    Sunil Sekhar, Anandakumari Chandrasekharan; Vinod, Chathakudath Prabhakaran

    2016-01-01

    Ultra-small gold nanoparticles incorporated in mesoporous silica thin films with accessible pore channels perpendicular to the substrate are prepared by a modified sol-gel method. The simple and easy spin coating technique is applied here to make homogeneous thin films. The surface characterization using FESEM shows crack-free films with a perpendicular pore arrangement. The applicability of these thin films as catalysts as well as a robust SERS active substrate for model catalysis study is tested. Compared to bare silica film our gold incorporated silica, GSM-23F gave an enhancement factor of 10³ for RhB with a laser source 633 nm. The reduction reaction of p-nitrophenol with sodium borohydride from our thin films shows a decrease in peak intensity corresponding to -NO₂ group as time proceeds, confirming the catalytic activity. Such model surfaces can potentially bridge the material gap between a real catalytic system and surface science studies. PMID:27213321

  15. Incorporating Duration Information in Activity Recognition

    NASA Astrophysics Data System (ADS)

    Chaurasia, Priyanka; Scotney, Bryan; McClean, Sally; Zhang, Shuai; Nugent, Chris

    Activity recognition has become a key issue in smart home environments. The problem involves learning high level activities from low level sensor data. Activity recognition can depend on several variables; one such variable is duration of engagement with sensorised items or duration of intervals between sensor activations that can provide useful information about personal behaviour. In this paper a probabilistic learning algorithm is proposed that incorporates episode, time and duration information to determine inhabitant identity and the activity being undertaken from low level sensor data. Our results verify that incorporating duration information consistently improves the accuracy.

  16. Therapy for incorporated radionuclides: scope and need

    SciTech Connect

    Smith, V.H.

    1981-03-01

    In the United States the recent termination of funding for research on therapy for incorporated radionuclides has virtually halted progress on improved or new agents and procedures for removing radioactivity from the body. Research was eliminated, but is still needed on new removal agents, improved delivery system, in vitro test systems, and the toxicology of treatments. For many radionuclides, no adequate therapy exists. The relationship between radionuclide removal and reduction in cancer risk is still unanswered. Without proper research support, needed improvements in the treatment for incorporated radionuclides in the US are uncertain.

  17. Activators generated by electron transfer for atom transfer radical polymerization of styrene in the presence of mesoporous silica nanoparticles

    SciTech Connect

    Khezri, Khezrollah; Roghani-Mamaqani, Hossein

    2014-11-15

    Graphical abstract: Effect of mesoporous silica nanoparticles (MCM-41) on the activator generated by electron transfer for atom transfer radical polymerization (AGET ATRP) is investigated. Decrement of conversion and number average molecular weight and also increment of polydispersity index (PDI) values are three main results of addition of MCM-41 nanoparticles. Incorporation of MCM-41 nanoparticles in the polystyrene matrix can clearly increase thermal stability and decrease glass transition temperature of the nanocomposites. - Highlights: • Spherical morphology, hexagonal structure, and high surface area with regular pore diameters of the synthesized MCM-41 nanoparticles are examined. • AGET ATRP of styrene in the presence of MCM-41 nanoparticles is performed. • Effect of MCM-41 nanoparticles addition on the polymerization rate, conversion and molecular weights of the products are discussed. • Improvement in thermal stability of the nanocomposites and decreasing T{sub g} values was also observed by incorporation of MCM-41 nanoparticles. - Abstract: Activator generated by electron transfer for atom transfer radical polymerization was employed to synthesize well-defined mesoporous silica nanoparticles/polystyrene composites. Inherent features of spherical mesoporous silica nanoparticles were evaluated by nitrogen adsorption/desorption isotherm, X-ray diffraction and scanning electron microscopy analysis techniques. Conversion and molecular weight evaluations were carried out using gas and size exclusion chromatography respectively. By the addition of only 3 wt% mesoporous silica nanoparticles, conversion decreases from 81 to 58%. Similarly, number average molecular weight decreases from 17,116 to 12,798 g mol{sup −1}. However, polydispersity index (PDI) values increases from 1.24 to 1.58. A peak around 4.1–4.2 ppm at proton nuclear magnetic resonance spectroscopy results clearly confirms the living nature of the polymerization. Thermogravimetric analysis shows that thermal stability of the nanocomposites increases by adding nanoparticles content. Decrease of glass transition temperature is also demonstrated by the addition of 3 wt% of silica nanoparticles according to the differential scanning calorimetry results.

  18. Heteroaggregation of cerium oxide nanoparticles and nanoparticles of pyrolyzed biomass

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Heteroaggregation with indigenous particles is an important process controlling the mobility of engineered nanomaterials in the environment. We studied heteroaggregation of cerium oxide nanoparticles (n-CeO2), which are widely used commercially, with nanoparticles of pyrogenic carbonaceous material ...

  19. Nanoparticle flotation collectors III: the role of nanoparticle diameter.

    PubMed

    Yang, Songtao; Pelton, Robert; Montgomery, Miles; Cui, Yuguo

    2012-09-26

    The ability of polystyrene nanoparticles to promote glass bead flotation was measured as a function of nanoparticle diameter. In all cases, smaller nanoparticles were more effective flotation collectors, even when compared at constant nanoparticle number concentration. The superior performance of smaller particles was explained by two mechanisms, acting in parallel. First, smaller particles deposit more quickly giving more effective flotation in those cases where nanoparticle deposition kinetics is rate determining; the sensitivity of nanoparticle deposition rates to particle size was illustrated by kinetic measurements on a quartz crystal microbalance silica surface. Second, for a given coverage of nanoparticles on the glass beads, the mean distance between neighboring nanoparticle surfaces decreases with particle diameter. We propose that the expansion of the three phase contact line, after initial bead/bubble attachment, is favored with decreasing the distance between neighboring hydrophobic particles. PMID:22871900

  20. Semiconducting compounds and devices incorporating same

    DOEpatents

    Marks, Tobin J.; Facchetti, Antonio; Boudreault, Pierre-Luc; Miyauchi, Hiroyuki

    2016-01-19

    Disclosed are molecular and polymeric compounds having desirable properties as semiconducting materials. Such compounds can exhibit desirable electronic properties and possess processing advantages including solution-processability and/or good stability. Organic transistor and photovoltaic devices incorporating the present compounds as the active layer exhibit good device performance.