Sample records for paneb tri ja

  1. ADHD: Tips to Try


    ... How Can I Help a Friend Who Cuts? ADHD: Tips to Try KidsHealth > For Teens > ADHD: Tips to Try Print A A A Text Size en español TDAH: Consejos que puedes probar ADHD , or attention deficit hyperactivity disorder, is a medical ...

  2. Trying to Conceive


    ... español ) Trying to conceive Related information Basal body temperature chart (PDF, 555 KB) Ovulation and due date ... of your fertile times. They are: Basal body temperature method – Basal body temperature is your temperature at ...


    EPA Science Inventory

    The Toxics Release Inventory (TRI) site is designed to provide information on toxic chemical releases including collected data, guidance documents, program planning, background, history, and, program contacts, among other things. The data included in this homepage have been submi...

  4. Try Another Way. Training Manual.

    ERIC Educational Resources Information Center

    Gold, Marc

    Intended for use in training conferences, the manual describes the philosophy and procedures of Try Another Way, an approach for teaching moderately, severely and profoundly mentally retarded persons and developmentally disabled persons difficult to train. An alternative definition of retardation is proposed which stresses level of functioning…

  5. Analysis of bubbles and crashes in the TRY/USD, TRY/EUR, TRY/JPY and TRY/CHF exchange rate within the scope of econophysics

    NASA Astrophysics Data System (ADS)

    Deviren, Bayram; Kocakaplan, Yusuf; Keskin, Mustafa; Balcılar, Mehmet; Özdemir, Zeynel Abidin; Ersoy, Ersan


    In this study, we analyze the Turkish Lira/US Dollar (TRY/USD), Turkish Lira/Euro (TRY/EUR), Turkish Lira/Japanese Yen (TRY/JPY) and Turkish Lira/Swiss Franc (TRY/CHF) exchange rates in the global financial crisis period to detect the bubbles and crashes in the TRY by using a mathematical methodology developed by Watanabe et al. (2007). The methodology defines the bubbles and crashes in financial market price fluctuations by considering an exponential fitting of the associated data. This methodology is applied to detect the bubbles and crashes in the TRY/USD, TRY/EUR, TRY/JPY and TRY/CHF exchange rates from January, 1, 2005 to December, 20, 2013. In this mathematical methodology, the whole period of bubbles and crashes can be determined purely from past data, and the start of bubbles and crashes can be identified even before its bursts. In this way, the periods of bubbles and crashes in the TRY/USD, TRY/EUR, TRY/JPY and TRY/CHF are determined, and the beginning and end points of these periods are detected. The results show that the crashes in the TRY/CHF exchange rate are commonly finished earlier than in the other exchange rates; hence it is probable that the crashes in the other exchange rates would be finished soon when the crashes in the TRY/CHF exchange rate ended. We also find that the periods of crashes in the TRY/EUR exchange rate take longer time than in the other exchange rates. This information can be used in risk management and/or speculative gain. The crashes' periods in the TRY/EUR and TRY/USD exchange rates are observed to be relatively longer than in the other exchange rates.

  6. Tri-soft shell technique.


    Arshinoff, Steve A; Norman, Richard


    Soft-shell techniques exist for lower viscosity dispersive with higher viscosity cohesive ophthalmic viscosurgical devices (OVDs) (soft-shell technique [SST]), viscoadaptive OVDs with balanced salt solution (ultimate soft-shell technique), intraoperative floppy-iris syndrome (soft-shell bridge), and many specific modifications for disinserted zonular fibers, frayed iris strands, Fuchs endothelial dystrophy, small holes in the posterior capsule with protruding vitreous, capsular dye use, and others. Soft-shell techniques exist because it is rheologically impossible to control the surgical environment with a single OVD as well as with an ordered combination of rheologically different OVDs. Surgeons frequently confuse these techniques because of their multitude. This paper unifies all SSTs into a single improved tri-soft shell technique (TSST), from which basic specific applications to unusual circumstances are simple and intuitive. As shown with previous SSTs, the TSST allows surgeons to perform complex tasks with greater surgical facility and to protect endothelial cells better than with single OVDs. PMID:23889867

  7. Can't sleep? Try these tips


    ... Can’t sleep? Try these tips To use the sharing features ... time. But if it happens often, lack of sleep can affect your health and make it hard ...

  8. Scientists Try to Stop Another Deadly Virus


    ... Try to Stop Another Deadly Virus Junin, an Ebola-like disease in Argentina, has a death rate ... companies that developed a similar treatment against the Ebola virus during the 2014-2015 outbreak. That drug, ...

  9. Looks-Conscious Teens Trying Risky Supplements


    ... gov/medlineplus/news/fullstory_159576.html Looks-Conscious Teens Trying Risky Supplements Unregulated products can harm health, ... be role models, but that comes with the power of success and celebrity, he said. "Professional sports ...

  10. TriKota v 1.0

    SciTech Connect



    The TriKota software is a library that allows the Dakota Optimization Toolkit to be easily accessed from a computer code that is already interfaced to the solution algorithms in the Trilinos framework. It is a class of code known as an adapter. TriKota also supplies examples so that new applications can quickly make use of it’s capabilities.The TriKota package is meant to enable more rapid development and a broader use of optimization and uncertainty quantification algorithms. As a general-purpose mathematical software, the uses will span many application areas that seek to perform computational design and analysis.

  11. TriKota v 1.0

    Energy Science and Technology Software Center (ESTSC)


    The TriKota software is a library that allows the Dakota Optimization Toolkit to be easily accessed from a computer code that is already interfaced to the solution algorithms in the Trilinos framework. It is a class of code known as an adapter. TriKota also supplies examples so that new applications can quickly make use of it’s capabilities.The TriKota package is meant to enable more rapid development and a broader use of optimization and uncertainty quantificationmore » algorithms. As a general-purpose mathematical software, the uses will span many application areas that seek to perform computational design and analysis.« less

  12. Global Gene Regulation by Fusarium Transcription Factors Tri6 and Tri10 Reveals Adaptations for Toxin Biosynthesis

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Trichothecenes are isoprenoid mycotoxins in wheat infected with the filamentous fungus Fusarium graminearum. Some fungal genes for trichothecene biosynthesis (Tri genes) are known to be under control of transcription factors encoded by Tri6 and Tri10. Tri6 and Tri10 deletion mutants were constructed...

  13. Tri-District Arts Consortium Summer Program.

    ERIC Educational Resources Information Center

    Kirby, Charlotte O.


    The Tri-District Arts Consortium in South Carolina was formed to serve artistically gifted students in grades six-nine. The consortium developed a summer program offering music, dance, theatre, and visual arts instruction through a curriculum of intense training, performing, and hands-on experiences with faculty members and guest artists. (JDD)

  14. A tri-serine tri-lactone scaffold for the quantification of citrate in urine.


    Akdeniz, Ali; Caglayan, Mehmet Gokhan; Anzenbacher, Pavel


    Tri-serine tri-lactone based C3 symmetry fluorescent sensors were synthesized. Citrate is shown to bind to sensors, while displaying an increase in fluorescence intensity for the sensor with thiourea and a quenching for the sensor with sulfonamide. Information-rich responses of the sensors enable us to discriminate structurally similar anions, including mono-, di- and tri-carboxylates with 100% correct classification. A simple two-sensor array enables the determination of the concentration of citrate in urine without any sample preparation with high accuracy (error < 2%). PMID:26669653

  15. Tri-axial tactile sensing element

    NASA Astrophysics Data System (ADS)

    Castellanos-Ramos, Julián.; Navas-González, Rafael; Vidal-Verdú, F.


    A 13 x 13 square millimetre tri-axial taxel is presented which is suitable for some medical applications, for instance in assistive robotics that involves contact with humans or in prosthetics. Finite Element Analysis is carried out to determine what structure is the best to obtain a uniform distribution of pressure on the sensing areas underneath the structure. This structure has been fabricated in plastic with a 3D printer and a commercial tactile sensor has been used to implement the sensing areas. A three axis linear motorized translation stage with a tri-axial precision force sensor is used to find the parameters of the linear regression model and characterize the proposed taxel. The results are analysed to see to what extent the goal has been reached in this specific implementation.

  16. Synthesis of di-, tri- and tetracyclopropylhydrazines.


    Shestakov, Aleksandr N; Kuznetsov, Mikhail A


    Previously unknown 1,1-dicyclopropylhydrazine was obtained in two steps starting from dicyclopropylamine. It serves as a convenient starting material to tri- and tetracyclopropylhydrazines, which have not been described in the literature either. Tricyclopropylhydrazine was prepared in an overall four-step sequence featuring the de Meijere-Chaplinski modification of the Kulinkovich reaction as a key step. Tetracyclopropylhydrazine was obtained by the reductive amination of the cyclopropanone ethyl trimethylsilyl acetal with 1,1-dicyclopropylhydrazine or with the parent hydrazine. Synthetic utility of these cyclopropylhydrazine building blocks is presented as well. PMID:26734692

  17. Tri-bimaximal Mixing from Cascades

    SciTech Connect

    Takahashi, Ryo


    We investigate fermion mass matrices of the cascade form which lead to the tri-bimaximal mixing in the lepton sector. The cascade neutrino matrix predicts a parameter-independent relation among the observables, which are the neutrino mixing angles and mass squared differences. The relation predicts that the atmospheric neutrino mixing angle is close to maximal. We also study phenomenological aspect of the cascade form in supersymmetric theory, which are lepton flavor violation and thermal leptogenesis. A dynamical realivation of the cascade mass matrix are also presented in U(1) flavor theory.

  18. Convertible, tri-mode solar conversion system

    NASA Astrophysics Data System (ADS)

    Kelly, D. A.

    A convertible, tri-mode solar collection system has been developed to provide year-round operation in the Northeastern U.S. Employing a plastic hot air duct-box in addition to conventional linear parabolic concentrators and thermal storage units, the system is able to provide wintertime hot air for residential heating and summertime steam for electrical power generation. Because of its superior utilization factor, it is expected that the device will pay back for an initial investment in a significantly shorter time than present alternatives

  19. A Transgenic Tri-Modality Reporter Mouse

    PubMed Central

    Yan, Xinrui; Ray, Pritha; Paulmurugan, Ramasamy; Tong, Ricky; Gong, Yongquan; Sathirachinda, Ataya; Wu, Joseph C.; Gambhir, Sanjiv S.


    Transgenic mouse with a stably integrated reporter gene(s) can be a valuable resource for obtaining uniformly labeled stem cells, tissues, and organs for various applications. We have generated a transgenic mouse model that ubiquitously expresses a tri-fusion reporter gene (fluc2-tdTomato-ttk) driven by a constitutive chicken β-actin promoter. This “Tri-Modality Reporter Mouse” system allows one to isolate most cells from this donor mouse and image them for bioluminescent (fluc2), fluorescent (tdTomato), and positron emission tomography (PET) (ttk) modalities. Transgenic colonies with different levels of tri-fusion reporter gene expression showed a linear correlation between all three-reporter proteins (R2=0.89 for TdTomato vs Fluc, R2=0.94 for Fluc vs TTK, R2=0.89 for TdTomato vs TTK) in vitro from tissue lysates and in vivo by optical and PET imaging. Mesenchymal stem cells (MSCs) isolated from this transgenics showed high level of reporter gene expression, which linearly correlated with the cell numbers (R2=0.99 for bioluminescence imaging (BLI)). Both BLI (R2=0.93) and micro-PET (R2=0.94) imaging of the subcutaneous implants of Tri-Modality Reporter Mouse derived MSCs in nude mice showed linear correlation with the cell numbers and across different imaging modalities (R2=0.97). Serial imaging of MSCs transplanted to mice with acute myocardial infarction (MI) by intramyocardial injection exhibited significantly higher signals in MI heart at days 2, 3, 4, and 7 (p<0.01). MSCs transplanted to the ischemic hindlimb of nude mice showed significantly higher BLI and PET signals in the first 2 weeks that dropped by 4th week due to poor cell survival. However, laser Doppler perfusion imaging revealed that blood circulation in the ischemic limb was significantly improved in the MSCs transplantation group compared with the control group. In summary, this mouse can be used as a source of donor cells and organs in various research areas such as stem cell research

  20. Toxic Release Inventory (TRI), 1989. Data file

    SciTech Connect

    Not Available


    Section 313 of the Emergency Planning and Community Right-to-Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act of 1986 (Public Law 99-499) requires EPA to establish a National Inventory of toxic chemical emissions from certain facilities. The final Toxic Chemical Release Form R and regulations for the 1987 reporting year were published in the Federal Register on February 16, 1988 (53 FR 4500-4554). The list of toxic chemicals subject to reporting consisted initially of chemicals listed for similar reporting purposes by the States of New Jersey and Maryland. There are over 300 chemicals and categories on these lists. The reporting requirement applies to owners and operators of facilities that have 10 or more full-time employees, that are in Standard Industrial Classification (SIC) codes 20 through 39 (i.e., manufacturing facilities) and that manufacture (including importing), process or otherwise use a listed toxic chemical in excess of specified threshold quantities. The law mandates that the data be made publicly available through a computer database. The online TRI file should appeal to a broad based user audience including industry, state and local environmental agencies, emergency planning committees, the Federal Government and other regulatory groups. Another important user group is likely to be concerned citizens who, on their own or through public interest groups and public libraries, can use TRI to ask questions about chemical releases in their communities.

  1. Try-in Pastes Versus Resin Cements: A Color Comparison.


    Vaz, Edenize Cristina; Vaz, Maysa Magalhães; Rodrigues Gonçalves de Oliveira, Maria Beatriz; Takano, Alfa Emília; de Carvalho Cardoso, Paula; de Torres, Érica Miranda; Gonzaga Lopes, Lawrence


    This study aimed to compare the color of ceramic veneer restorations using different shades of try-in pastes and resin cement. Researchers found no differences between try-in pastes and resin cements after cementation. PMID:27213935

  2. Characterization of Tri-lab Tantalum Plate.

    SciTech Connect

    Buchheit, Thomas E.; Cerreta, Ellen K.; Deibler, Lisa Anne; Chen, Shu-Rong; Michael, Joseph R.


    This report provides a detailed characterization Tri-lab Tantalum (Ta) plate jointly purchased from HCStark Inc. by Sandia, Los Alamos and Lawrence Livermore National Laboratories. Data in this report was compiled from series of material and properties characterization experiments carried out at Sandia (SNL) and Los Alamos (LANL) Laboratories through a leveraged effort funded by the C2 campaign. Results include microstructure characterization detailing the crystallographic texture of the material and an increase in grain size near the end of the rolled plate. Mechanical properties evaluations include, compression cylinder, sub-scale tension specimen, micohardness and instrumented indentation testing. The plate was found to have vastly superior uniformity when compare with previously characterized wrought Ta material. Small but measurable variations in microstructure and properties were noted at the end, and at the top and bottom edges of the plate.

  3. Development and evaluation of WillTry: An instrument for measuring children’s willingness to try fruits and vegetables

    Technology Transfer Automated Retrieval System (TEKTRAN)

    This paper describes the development and evaluation of the WillTry instrument, a psychometric tool, designed to measure children’s willingness to try fruits and vegetables. WillTry surveys were interviewer-administered to 284 children in an elementary school, and in summer day camps located in rura...

  4. Tri-Center Analysis: Determining Measures of Trichotomous Central Tendency for the Parametric Analysis of Tri-Squared Test Results

    ERIC Educational Resources Information Center

    Osler, James Edward


    This monograph provides an epistemological rational for the design of a novel post hoc statistical measure called "Tri-Center Analysis". This new statistic is designed to analyze the post hoc outcomes of the Tri-Squared Test. In Tri-Center Analysis trichotomous parametric inferential parametric statistical measures are calculated from…

  5. Still confusing, TRI reporting requires careful organization

    SciTech Connect

    Costa, R. )


    Since 1988, Sec. 313 of the Emergency Planning and Community Right-to-Know Act (EPCRA) has required manufacturing facilities to report annually on toxic chemical releases and offsite transfers of more than 300 toxic chemicals above certain threshold quantities. EPCRA, a stand-alone regulation that also is incorporated in SARA as Title III, mandates that only facilities whose primary business is manufacturing products for commercial use report under the Toxic Chemical Release Inventory (TRI) program. The list of regulated chemicals is dynamic. A petition process allows anyone to request additions or deletions from the chemical list, based on established toxicity criteria. The criteria involve health effects -- including evidence of reproductive dysfunction, neurological disorders, heritable genetic mutations, cancer, and teratogenic and other effects -- as well as significant adverse impacts to the environment. EPA must respond within 180 days to a petition, and any changes to the list must be promulgated under federal regulatory procedures. A petition submitted by a state governor becomes law if EPA fails to act within 180 days.

  6. Toxic release inventory, (TRI), 1991. Data file

    SciTech Connect


    Section 313 of the Emergency Planning and Community Right-to-Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act of 1986 (Public Law 99-499) requires EPA to establish a national inventory of toxic chemical emissions from certain facilities. The final Toxic Chemical Release Form R and regulations for the 1987 reporting year were published in the Federal Register on February 16, 1988 (53 FR 4500-4554). The reporting requirement applies to owners and operators of facilities that have 10 or more full-time employees, that are in Standard Industrial Classification (SIC) codes 20 through 39 (i.e., manufacturing facilities) and that manufacture (including importing), process or otherwise use a listed toxic chemical in excess of specified threshold quantities. The law mandates that the data be made publicly available through a computer database. The online TRI file should appeal to a broad-based user audience including industry, state and local environmental agencies, emergency planning committees, the Federal Government and other regulatory groups.

  7. Toxic Release Inventory (TRI), 1990. Data file

    SciTech Connect

    Not Available


    Section 313 of the Emergency Planning and Community Right-to-Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act of 1986 (Public Law 99-499) requires EPA to establish a National Inventory of toxic chemical emissions from certain facilities. The final Toxic Chemical Release Form R and regulations for the 1987 reporting year were published in the Federal Register on February 16, 1988 (53 FR 4500-4554). The list of toxic chemicals subject to reporting consisted initially of chemicals listed for similar reporting purposes by the States of New Jersey and Maryland. There are over 300 chemicals and categories on these lists. The reporting requirement applies to owners and operators of facilities that have 10 or more full-time employees, that are in Standard Industrial Classification (SIC) codes 20 through 39 (i.e., manufacturing facilities) and that manufacture (including importing), process or otherwise use a listed toxic chemical in excess of specified threshold quantities. The law mandates that the data be made publicly available through a computer database. The online TRI file should appeal to a broad based user audience including industry, state and local environmental agencies, emergency planning committees, the Federal Government and other regulatory groups.

  8. PyTRiP - a toolbox and GUI for the proton/ion therapy planning system TRiP

    NASA Astrophysics Data System (ADS)

    Toftegaard, J.; Petersen, J. B.; Bassler, N.


    Purpose: Only very few treatment planning systems (TPS) are capable of handling heavy ions. Commercial heavy ion TPS are costly and normally restrict the possibility to implement new functionalities. PyTRiP provides Python bindings and a platform-independent graphical user interface (GUI) for the heavy ion treatment program TRiP, and adds seamless support of DICOM files. We aim to provide a front-end for TRiP which does not require any special computer skills. Methods: PyTRiP is written in Python combined with C for fast computing. Routines for DICOM file import/export to TRiPs native file format are implemented. The GUI comes as an executable with all its dependencies including PyTRiP making it easy to install on Windows, Mac and Linux. Results: PyTRiP is a comprehensive toolbox for handling TRiP. Treatment plans are handled using an object oriented structure. Bindings to TRiP (which only runs on Linux, either locally or on a remote server) are performed through a single function call. GUI users can intuitively create treatment plans without much knowledge about the TRiP user interface. Advanced users still have full access to all TRiP functionality. The user interface comes with a comprehensive plotting tool, which can visualize 2D contours, volume histograms, as well as dose- and linear energy transfer (LET) distributions. Conclusion: We developed a powerful toolbox for ion therapy research using TRiP as backend. The corresponding GUI allows to easily and intuitively create, calculate and visualize treatment plans. TRiP is thereby more accessible and simpler to use.

  9. See Behind the Numbers at WSU Tri-Cities

    SciTech Connect

    Fisher, Brad; Kluse, Michael; Novich, Carolynn M.


    The enrollment numbers for WSU were released this week. The enrollment at the Tri-Cities campus remained flat, but these numbers do not tell the full story of WSU Tri-Cities and the many things we have to celebrate about our local campus. WSU Tri-Cities has gone through significant growth and change over the past several years and has fostered closer ties to its alumni, the community, region and state.

  10. Tri-Cities Index of Innovation and Technology

    SciTech Connect

    Fowler, Richard A.; Scott, Michael J.; Butner, Ryan S.


    In 2001 and 2004, the Economic Development Office of Pacific Northwest National Laboratory published companion reports to the Washington Technology Center Index studies that provided additional information on the Tri-Cities (Kennewick-Richland-Pasco) area of the state, its technology businesses, and important advantages that the Tri-Cities have as places to live and do business. These reports also compared the Tri-Cities area to other technology-based metropolitan areas in the Pacific Northwest and nation along critical dimensions known to be important to technology firms. This report updates the material in these earlier reports, and highlights a growing Tri-Cities metropolitan area.

  11. Bismuth tri-iodide radiation detector development

    NASA Astrophysics Data System (ADS)

    Gokhale, Sasmit S.

    Bismuth tri-iodide is an attractive material for room temperature radiation detection. BiI3 demonstrates a number of properties that are apt for semiconductor radiation detection, especially gamma ray spectroscopy. The high atomic number (ZBi = 83 and ZI = 53) and the relatively high density (5.78 g/cm3) cause the material to have good photon stopping power, while the large band-gap (1.67 eV ) allows it to function as a room temperature radiation detector without any cooling mechanism. This work presents the fabrication and characterization of BiI3 radiation detectors. For the purpose of this research detectors were fabricated by cutting BiI3 crystal boules, followed by mechanical and chemical surface treatments. Detectors with various electrode geometries enabling single polarity charge sensing were fabricated. The electrical characteristics and the radiation response of the detectors were measured. The radiation response measurement was performed at room temperature using a 241Am alpha particle source and a 241Am sealed gamma-ray source. The spectral resolutions of the detectors varied from 2.09% - 6.1% for 59.5 keV gamma-rays and between 26% - 40% for 5.48 MeV alpha particles. Charge carrier properties such as the electron and hole mobility and lifetime were also estimated. The electron mobility for an ultrapure BiI 3 detector was estimated to be approximately 433 cm 2/Vs while that for antimony doped BiI3 was estimated to be around 956 cm2/Vs and the mobility-lifetime product for electrons was estimated to be around 5.44 x 10-4 cm 2/V. Detector simulation was performed using the Monte Carlo simulation code MCNP5. A Matlab script which incorporates charge carrier trapping and statistical variation was written to generate a gamma-ray spectrum from the simulated energy deposition spectra. Measured and simulated spectra were compared to extract the charge carrier mobility-lifetime products, which for electrons and holes were estimated to be 5 x 10-3 cm2/V and 1.3 x

  12. Financial Statement Audit Report of Tri-County Community College.

    ERIC Educational Resources Information Center

    Campbell, Ralph

    This report presents the results of the Tri-County Community College financial statement audit for the fiscal year ending on June 30, 1998. Tri-County Community College is a component of the State of North Carolina, thus the authority to audit is granted by Article 5A of G.S. 147. The accounts and operations of the institution were subject to…

  13. TriBITS (Tribal Build, Integrate, and Test System)

    Energy Science and Technology Software Center (ESTSC)


    TriBITS is a configuration, build, test, and reporting system that uses the Kitware open-source CMake/CTest/CDash system. TriBITS contains a number of custom CMake/CTest scripts and python scripts that extend the functionality of the out-of-the-box CMake/CTest/CDash system.

  14. Global Gene Regulation by Fusarium Transcription Factors Tri6 and Tri10 Reveals Adaptations for Toxin Biosynthesis

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Trichothecenes are isoprenoid mycotoxins and harmful contaminants of wheat infected with the filamentous fungus Fusarium graminearum. The expression of some fungal genes for trichothecene biosynthesis (Tri genes) are known to be under control of transcription factors encoded by the genes Tri6 and Tr...


    PubMed Central

    Wolfson, Mark; Pockey, Jessica R.; Reboussin, Beth A.; Sutfin, Erin L.; Egan, Kathleen L.; Wagoner, Kimberly G.; Spangler, John G.


    Background Dissolvable tobacco products (DTPs) have been introduced into test markets in the U.S. We sought to gauge level of interest in trying these products and correlates of interest among potential consumers. Methods A web-based survey of freshman at 11 universities in North Carolina (NC) and Virginia (VA) was conducted in fall 2010. Multivariable logistic regression analyses were used to identify correlates of students’ likelihood to try DTPs. Results Weighted prevalence of likelihood to try DTPs was 3.7%. Significant correlates of likelihood to try included male gender, current cigarette smoking, current snus use, sensation seeking, lifetime illicit drug use, and perceived health risk of using DTPs. Among current smokers, current snus use, current use of chewing tobacco, and considering quitting smoking were associated with likelihood to try DTPs. Conclusions While overall interest in trying these products was low, current users of cigarettes and snus were much more likely than others in trying a free sample. Some current smokers may consider DTPs to be an aid to smoking cessation, although the population-level impact of introducing these products is unknown. PMID:24309296

  16. Many Breast Cancer Patients Try Alternative Medicine First


    ... fullstory_158806.html Many Breast Cancer Patients Try Alternative Medicine First: Study But delay in getting chemotherapy may ... with early stage breast cancer who turn to alternative medicine may delay recommended chemotherapy, a new study suggests. ...

  17. Many Breast Cancer Patients Try Alternative Medicine First


    ... Many Breast Cancer Patients Try Alternative Medicine First: Study But delay ... 12, 2016 (HealthDay News) -- Women with early stage breast cancer who turn to alternative medicine may delay recommended ...

  18. 77 FR 52309 - Tri County Resource Advisory Committee

    Federal Register 2010, 2011, 2012, 2013, 2014


    .... ACTION: Notice of meeting. SUMMARY: The Tri County Resource Advisory Committee will meet in Deer Lodge... meeting will be held at 1002 Hollenback Road, Deer Lodge, Montana at the USDA Service Center...

  19. Learner Performance Accounting: A Tri-Cycle Process

    ERIC Educational Resources Information Center

    Brown, Thomas C.; McCleary, Lloyd E.


    The Tri-Cycle Process described in the model permits for the first time an integrated system for designing an individualized instructional system that would permit a rational, diagnosis-prescription-evaluation system keyed to an accounting system. (Author)

  20. TriG: Next Generation Scalable Spaceborne GNSS Receiver

    NASA Technical Reports Server (NTRS)

    Tien, Jeffrey Y.; Okihiro, Brian Bachman; Esterhuizen, Stephan X.; Franklin, Garth W.; Meehan, Thomas K.; Munson, Timothy N.; Robison, David E.; Turbiner, Dmitry; Young, Lawrence E.


    TriG is the next generation NASA scalable space GNSS Science Receiver. It will track all GNSS and additional signals (i.e. GPS, GLONASS, Galileo, Compass and Doris). Scalable 3U architecture and fully software and firmware recofigurable, enabling optimization to meet specific mission requirements. TriG GNSS EM is currently undergoing testing and is expected to complete full performance testing later this year.

  1. Tri-Cities research may help biofuels take flight

    SciTech Connect

    Madison, Alison L.


    Monthly economic diversity column for the Tri-City Herald. Excerpt: If you stop and think about it, some pretty interesting stuff has roots in the Tri-Cities, but reaches far beyond. Many Tri-Citians have gone on to be professional athletes, entertainers, scientists and engineers, doctors, lawyers, and humanitarians to name just a few. And a lot of groundbreaking discoveries - many born of strategic collaborations resulting from purposeful economic development efforts - have emerged from work at our local national laboratory. Just recently, Pacific Northwest National Laboratory entered into a $2M collaboration with Seattle biofuel producer Imperium Renewables and other partners to develop a new method to make renewable jet fuels. Successful development of the catalytic process, which converts biomass-based alcohols into renewable drop-in jet fuels, could lead to additional renewable jet fuel production facilities being built and operated in the Pacific Northwest.

  2. Mooney Institute Tries to Blend Unionism, School Reform

    ERIC Educational Resources Information Center

    Honawar, Vaishali


    Teachers' unions are rarely seen as hands-on school reformers, but the Tom Mooney Institute for Teacher & Union Leadership thinks they should be, and is trying to get a new generation of local union leaders ready for such roles. The institute is an offshoot of the 13-year-old Teachers Union Reform Network of NEA and AFT Locals, or TURN, which…

  3. Cutting Back on Wine? Try a Smaller Glass


    ... FAQs Contact Us Health Topics Drugs & Supplements Videos & Tools Español You Are Here: Home → Latest Health News → Article URL of this page: Cutting Back on Wine? Try a Smaller Glass Even ...

  4. The Food Friends: Encouraging Preschoolers to Try New Foods

    ERIC Educational Resources Information Center

    Bellows, Laura; Anderson, Jennifer


    In response to concerns about children's eating behaviors, the Colorado Nutrition Network developed and tested Food Friends--Making New Foods Fun for Kids. The program was designed as a 12-week social marketing campaign aimed at encouraging preschool-age children to try new foods, such as Ugli Fruit, couscous, and daikon radish. Tasting novel…

  5. Queens Tri-School Confederation, 1991-92 Evaluation Report.

    ERIC Educational Resources Information Center

    Hannah, Susan; Dworkowitz, Barbara

    An evaluation was done of the Queens Tri-School Confederation, three high schools in the New York City Public Schools funded by a federal grant from the Magnet Schools Assistance Program. The grant provided Hillcrest, Jamaica, and Thomas A. Edison High Schools with funds to develop or expand emergency technician programs at Hillcrest; a law…

  6. As Students Scatter Online, Colleges Try to Keep Up

    ERIC Educational Resources Information Center

    Mangan, Katherine


    While e-mail remains the official method of communication on most campuses, colleges are expanding their presence in the virtual world, trying to reach students where they hang out. But without careful planning, that can lead to a scattershot approach as new platforms keep popping up and students' attention becomes increasingly dispersed. The…

  7. A Theoretical Analysis of the English "Try and V" Construction

    ERIC Educational Resources Information Center

    Tsuchida, Takehiro


    Examining grammatically idiosyncratic English expressions often helps reveal not only to ESL (English as a second language) teachers and learners but also to experts on English how intricately language is composed. This paper aims to expound one such idiomatic expression of the "try and V" construction by exploring the phenomenon from diverse…

  8. Genetic-algorithm-based tri-state neural networks

    NASA Astrophysics Data System (ADS)

    Uang, Chii-Maw; Chen, Wen-Gong; Horng, Ji-Bin


    A new method, using genetic algorithms, for constructing a tri-state neural network is presented. The global searching features of the genetic algorithms are adopted to help us easily find the interconnection weight matrix of a bipolar neural network. The construction method is based on the biological nervous systems, which evolve the parameters encoded in genes. Taking the advantages of conventional (binary) genetic algorithms, a two-level chromosome structure is proposed for training the tri-state neural network. A Matlab program is developed for simulating the network performances. The results show that the proposed genetic algorithms method not only has the features of accurate of constructing the interconnection weight matrix, but also has better network performance.

  9. Development of the Tri-ATHLETE Lunar Vehicle Prototype

    NASA Technical Reports Server (NTRS)

    Heverly, Matt; Matthews, Jaret; Frost, Matt; Quin, Chris


    The Tri-ATHLETE (All Terrain Hex Limed Extra Terrestrial Explorer) vehicle is the second generation of a wheel-on-limb vehicle being developed to support the return of humans to the lunar surface. This paper describes the design, assembly, and test of the Tri-ATHLETE robotic system with a specific emphasis on the limb joint actuators. The design and implementation of the structural components is discussed, and a novel and low cost approach to approximating flight-like cabling is also presented. The paper concludes with a discussion of the "second system effect" and other lessons learned as well as results from a three week long field trial of the vehicle in the Arizona desert.

  10. Tri-band microstrip antenna design for wireless communication applications

    NASA Astrophysics Data System (ADS)

    Sami, Gehan; Mohanna, Mahmoud; Rabeh, Mohamed L.


    This paper introduces a novel rectangular tri-band patch antenna that is fabricated and measured for wireless communication systems. The introduced antenna is designed for WLAN and WiMAX applications. The desired tri-band operation was obtained by proper loading for a rectangular patch antenna using slots and shorting pins. The optimal location and dimension for the loaded elements were obtained with the aid of interfacing a Genetic Algorithm (GA) model with an Ansoft High Frequency Structural Simulator (HFSS). The results obtained from our simulated antenna show 5.8% impedance matching band width at 2.4 GHz, 3.7% at 3.5 GHz and 1.57% at 5.7 GHz. In addition, an equivalent circuit of the proposed antenna is introduced using the least square curve fitting optimization technique.

  11. 108. Doughton Park Recreation Area Comfort Station. Instead of trying ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    108. Doughton Park Recreation Area Comfort Station. Instead of trying to hide this building, it was decided to let it be seen. A salt box design reflecting a mountain building was chosen, it had a sloping split shingle roof matching the hill side with a front porch placed on the lower side. - Blue Ridge Parkway, Between Shenandoah National Park & Great Smoky Mountains, Asheville, Buncombe County, NC

  12. The tri-spade drill for endosseous dental implant installation.


    Kay, J F; Gilman, L; May, T C


    Many aspects of endosseous dental implant practice have been addressed over the past several decades. While most of this attention has centered on the dental implant body itself and, most recently, on various aspects of prosthetic restoration, the installation armamentarium for site preparation and implant placement has been neglected. Drills, in particular, have received minimal attention, with most drills currently used for implant placement being identical, or nearly identical, to century-old wood or metal cutting instruments. The tri-spade drill design represents an innovation that has evolved from analysis of currently used implant drills, drill mechanics, and the mechanical and physical properties of bone, in consideration of the clinical realities of contemporary endosseous implant placement. The tri-spade drill design, which features three cutting edges, is much more stable in the hands of the practicing clinician. It reduces crestal chatter upon entry into the bone site (a stable drilling situation), resulting in a more perfectly prepared final hole for placement of a cylindrical root-form dental implant. The drill tip angle is designed specifically for use with bone; the reaming action associated with the sharpened cutting edges adjacent to the large side flutes also allows for efficient debris removal. The tri-spade drill design represents an incremental increase in the dental implant armamentarium and efficacy for the installation of endosseous cylindrical dental implants. PMID:1813652

  13. Tri-layered elastomeric scaffolds for engineering heart valve leaflets

    PubMed Central

    Masoumi, Nafiseh; Annabi, Nasim; Assmann, Alexander; Larson, Benjamin L.; Hjortnaes, Jesper; Alemdar, Neslihan; Kharaziha, Mahshid; Manning, Keefe B.; Mayer, John E.; Khademhosseini, Ali


    Tissue engineered heart valves (TEHVs) that can grow and remodel have the potential to serve as permanent replacements of the current non-viable prosthetic valves particularly for pediatric patients. A major challenge in designing functional TEHVs is to mimic both structural and anisotropic mechanical characteristics of the native valve leaflets. To establish a more biomimetic model of TEHV, we fabricated tri-layered scaffolds by combining electrospinning and microfabrication techniques. These constructs were fabricated by assembling microfabricated poly(glycerol sebacate) (PGS) and fibrous PGS/poly(-caprolactone) (PCL) electrospun sheets to develop elastic scaffolds with tunable anisotropic mechanical properties similar to the mechanical characteristics of the native heart valves. The engineered scaffolds supported valvular interstitial cells (VICs) and mesenchymal stem cells (MSCs) growth within the 3D structure and promoted the deposition of heart valve extracellular matrix (ECM). MSCs were also organized and aligned along the anisotropic axes of the engineered tri-layered scaffolds. In addition, the fabricated constructs opened and closed properly in an ex vivo model of porcine heart valve leaflet tissue replacement. The engineered tri-layered scaffolds have the potential for successful translation towards TEHV replacements. PMID:24947233

  14. Tri-layered elastomeric scaffolds for engineering heart valve leaflets.


    Masoumi, Nafiseh; Annabi, Nasim; Assmann, Alexander; Larson, Benjamin L; Hjortnaes, Jesper; Alemdar, Neslihan; Kharaziha, Mahshid; Manning, Keefe B; Mayer, John E; Khademhosseini, Ali


    Tissue engineered heart valves (TEHVs) that can grow and remodel have the potential to serve as permanent replacements of the current non-viable prosthetic valves particularly for pediatric patients. A major challenge in designing functional TEHVs is to mimic both structural and anisotropic mechanical characteristics of the native valve leaflets. To establish a more biomimetic model of TEHV, we fabricated tri-layered scaffolds by combining electrospinning and microfabrication techniques. These constructs were fabricated by assembling microfabricated poly(glycerol sebacate) (PGS) and fibrous PGS/poly(caprolactone) (PCL) electrospun sheets to develop elastic scaffolds with tunable anisotropic mechanical properties similar to the mechanical characteristics of the native heart valves. The engineered scaffolds supported the growth of valvular interstitial cells (VICs) and mesenchymal stem cells (MSCs) within the 3D structure and promoted the deposition of heart valve extracellular matrix (ECM). MSCs were also organized and aligned along the anisotropic axes of the engineered tri-layered scaffolds. In addition, the fabricated constructs opened and closed properly in an ex vivo model of porcine heart valve leaflet tissue replacement. The engineered tri-layered scaffolds have the potential for successful translation towards TEHV replacements. PMID:24947233

  15. Dental hygienists' work environment: motivating, facilitating, but also trying.


    Candell, A; Engström, M


    The aim of the present study was to describe dental hygienists' experiences of their physical and psychosocial work environment. The study was descriptive in design and used a qualitative approach. Eleven dental hygienists participated in the study and data were collected during spring 2008 using semi-structured interviews. The material was analysed using qualitative content analysis. The results showed that the dental hygienists experienced their work environment as motivating and facilitating, but at the same time as trying. The three categories revealed a theme: Being controlled in a modern environment characterized by good relationships. Motivating factors were the good relationship with co-workers, managers and patients, seeing the results of your work, having your own responsibility and making your own decisions. The new, pleasant and modern clinics, good cooperation between co-workers and varying duties were described as facilitating factors. The trying factors, as described by the dental hygienists, were above all being controlled by time limits or by some elements of the work, such as teamwork. The dental hygienists also felt stress because appointments were too-short. To conclude, the participants described their work environment as trying in several ways, despite the modern clinics and good relationships. PMID:20624190

  16. Bayer bilateral denoising on TriMedia3270

    NASA Astrophysics Data System (ADS)

    Phelippeau, H.; Akil, M.; Dias Rodrigues, B.; Talbot, H.; Bara, S.


    Digital cameras are now commonly included in several digital devices such as mobile phones. They are present everywhere and have become the principal image capturing tool. Inherent to light and semiconductors properties, sensor noise [10] continues to be an important factor of image quality [12], especially in low light conditions. Removing the noise with mathematical solutions appears thus unavoidable to obtain an acceptable image quality. However, embedded devices are limited by processing capabilities and power consumption and thus cannot make use of the full range of complex mathematical noise removing solutions. The bilateral filter [6] appears to be an interesting compromise between implementation complexity and noise removing performances. Especially, the Bayer [5] bilateral filter proposed in [11] is well adapted for single sensor devices. In this paper, we simulate and optimize the Bayer bilateral filter execution on a common media-processor: the TM3270 [4] from the NXP Semiconductors TriMedia family. To do so we use the TriMedia Compilation System (TCS). We applied common optimization techniques (such as LUT, loop unrolling, convenient data type representation) as well as custom TriMedia operations. We finally propose a new Bayer bilateral filter formulation dedicated to the TM3270 architecture that yields an execution improvement of 99.6% compared to the naÃve version. This improvement results in real-time video processing at VGA resolution at the 350MHz clock rate.

  17. Parametric design of tri-axial nested Helmholtz coils

    SciTech Connect

    Abbott, Jake J.


    This paper provides an optimal parametric design for tri-axial nested Helmholtz coils, which are used to generate a uniform magnetic field with controllable magnitude and direction. Circular and square coils, both with square cross section, are considered. Practical considerations such as wire selection, wire-wrapping efficiency, wire bending radius, choice of power supply, and inductance and time response are included. Using the equations provided, a designer can quickly create an optimal set of custom coils to generate a specified field magnitude in the uniform-field region while maintaining specified accessibility to the central workspace. An example case study is included.

  18. Government action on diabetes prevention: time to try something new.


    Kaldor, Jenny C; Magnusson, Roger S; Colagiuri, Stephen


    Type 2 diabetes mellitus, driven by overweight and obesity linked to unhealthy diets, is the fastest-growing non-communicable disease in Australia. Halting the rise of diabetes will require a paradigm shift from personal to shared responsibility, with greater accountability from Australian governments and the food industry. It will also require governments to try something different to the prevailing approaches emphasising education and the provision of information. We propose four priority areas where government regulation could strengthen Australia's response. Those areas relate to mandatory front-of-pack food labelling, regulating junk food advertising, better oversight of food reformulation and taxing sugar-sweetened beverages. PMID:26068689

  19. An innovative tri-directional broadband piezoelectric energy harvester

    SciTech Connect

    Su, Wei-Jiun Zu, Jean


    This paper presents a tri-directional piezoelectric energy harvester that is able to harvest vibration energy over a wide bandwidth from three orthogonal directions. The harvester consists of a main beam, an auxiliary beam, and a spring-mass system, with magnets integrated to introduce nonlinear force and couple the three sub-systems. Theoretical analysis and experiments were performed at constant acceleration under frequency sweeps to acquire frequency responses. The experimental results show that the voltage can achieve more than 2 V over more than 5 Hz of bandwidth with 1 MΩ load in the three orthogonal directions.

  20. Tri-functional cannula for retinal endovascular surgery


    Weiss, Jonathan D.


    A tri-functional cannula combines the functions of tissue Plasminogen Activator (tPA) solution delivery, illumination and venous pressure measurement. The cannula utilizes a tapered hollow-core optical fiber having an inlet for tPA solution, an attached fiber optic splitter configured to receive illumination light from an optical source such and a LED. A window in the cannula transmits the light to and from a central retinal vein. The return light is coupled to an optical detector to measure the pressure within the vein and determine whether an occlusion has been removed.

  1. Diplomats try to establish greenhouse gas emissions-reduction rules

    NASA Astrophysics Data System (ADS)

    Showstack, Randy

    Ministers and other senior officials will participate in the next follow-up to the Kyoto Protocol to the United Nations Framework Convention on Climate Change when they deliberate on how to reduce greenhouse gas emissions at a November 2-13 meeting in Buenos Aires, Argentina."The Kyoto conference on the Climate Change Convention was a high-profile event because for the first time industrialized countries adopted emission-reduction targets that are legally binding," said Michael Zammit Cutajar, executive secretary of the convention. "In Buenos Aires, governments will try to establish the rules of the game for reaching these targets.""

  2. Diplomats try to establish greenhouse gas emissions-reduction rules

    NASA Astrophysics Data System (ADS)

    Showstack, Randy

    Ministers and other senior officials will participate in the next follow-up to the Kyoto Protocol to the United Nations Framework Convention on Climate Change when they deliberate on how to reduce greenhouse gas emissions at a November 2-13 meeting in Buenos Aires, Argentina.“The Kyoto conference on the Climate Change Convention was a high-profile event because for the first time industrialized countries adopted emission-reduction targets that are legally binding,” said Michael Zammit Cutajar, executive secretary of the convention. “In Buenos Aires, governments will try to establish the rules of the game for reaching these targets."”

  3. An innovative tri-directional broadband piezoelectric energy harvester

    NASA Astrophysics Data System (ADS)

    Su, Wei-Jiun; Zu, Jean


    This paper presents a tri-directional piezoelectric energy harvester that is able to harvest vibration energy over a wide bandwidth from three orthogonal directions. The harvester consists of a main beam, an auxiliary beam, and a spring-mass system, with magnets integrated to introduce nonlinear force and couple the three sub-systems. Theoretical analysis and experiments were performed at constant acceleration under frequency sweeps to acquire frequency responses. The experimental results show that the voltage can achieve more than 2 V over more than 5 Hz of bandwidth with 1 MΩ load in the three orthogonal directions.

  4. Multimatrix models and tri-Sasaki Einstein spaces

    SciTech Connect

    Herzog, Christopher P.; Pufu, Silviu S.; Tesileanu, Tiberiu; Klebanov, Igor R.


    Localization methods reduce the path integrals in N{>=}2 supersymmetric Chern-Simons gauge theories on S{sup 3} to multimatrix integrals. A recent evaluation of such a two-matrix integral for the N=6 superconformal U(N)xU(N) Aharony-Bergman-Jafferis-Maldacena theory produced detailed agreement with the AdS/CFT correspondence, explaining, in particular, the N{sup 3/2} scaling of the free energy. We study a class of p-matrix integrals describing N=3 superconformal U(N){sup p} Chern-Simons gauge theories. We present a simple method that allows us to evaluate the eigenvalue densities and the free energies in the large N limit keeping the Chern-Simons levels k{sub i} fixed. The dual M-theory backgrounds are AdS{sub 4}xY, where Y are seven-dimensional tri-Sasaki Einstein spaces specified by the k{sub i}. The gravitational free energy scales inversely with the square root of the volume of Y. We find a general formula for the p-matrix free energies that agrees with the available results for volumes of the tri-Sasaki Einstein spaces Y, thus providing a thorough test of the corresponding AdS{sub 4}/CFT{sub 3} dualities. This formula is consistent with the Seiberg duality conjectured for Chern-Simons gauge theories.

  5. A magnetic tri-enzyme nanobiocatalyst for fruit juice clarification.


    Sojitra, Uttam V; Nadar, Shamraja S; Rathod, Virendra K


    The major complications in fruit juice quality improvement are the presence of polysaccharides components in the form of disrupted fruit cell wall and cell materials. Hence, breakdown of cellulose along with pectin and starch is important for the juice processing. In this context, magnetic tri-enzyme nanobiocatalyst was prepared by simultaneously co-immobilizing three enzymes; α-amylase, pectinase and cellulase onto amino-functionalized magnetic nanoparticle by 60mM glutaraldehyde concentration with 10h cross-linking time for one pot juice clarification. The prepared nanobiocatalyst was characterized by FT-IR, SEM and XRD. The thermal (50-70°C) and pH (3-6) stability studies indicated more than two folds increment in half-life and enhanced tolerance to lower pH. The immobilized enzymes retained up to 75% of residual activity even after eight consecutive cycles of reuse. Finally, the clarification of apple, grapes and pineapple juices using magnetic tri-enzyme showed 41%, 46% and 53% respective reduction in turbidity till 150min treatment. PMID:27451184

  6. Hanford and the Tri-Cities economy 1997

    SciTech Connect

    Scott, M.J.


    The missions of the US Department of Energy`s Richland Operations Office (DOE/RL) are to safely manage the Hanford Site, to manage and clean up its legacy wastes, and to develop and deploy new science and technology in the environmental and energy fields. Collectively, DOE/RL and its contractors are the most important single entity in the Tri-Cities local economy (Pasco, Kennewick, and Richland, Washington, and the surrounding area). While the relevant economic region affected by DOE/RL and its contractors actually embraces a geographic area reaching from Yakima in the west to Walla Walla in the east and from Moses Lake in the north to Pendleton, Oregon, in the south, over 90% of economic impacts likely occur in Benton and Franklin Counties. These two counties are defined as the local Tri-Cities economy for purposes of this study. In the Federal fiscal year (FY) 1997 (October 1, 1996 through September 30, 1997), the total impact of DOE`s local $1.7 billion budget was felt through payrolls and local purchases of goods and services that totaled about $774 million. Directly or indirectly, the DOE/RL budget sustained an estimated 36% of all local employment (30,300 out of 84,800 jobs) and up to 67% of local wage income.

  7. Experimental Investigation and Modeling of Integrated Tri-generation Systems

    NASA Astrophysics Data System (ADS)

    Cetinkaya, Eda

    Energy demand in the world is increasing with population growth and higher living standards. Today, the need for energy requires a focus on renewable sources without abandoning fossil fuels. Efficient use of energy is one of the most important tasks in modern energy systems to achieve. In addition to the energy need, growing environmental concerns are linked with energy is emerged. Multi-purpose energy generation allows a higher efficiency by generating more outputs with the same input in the same system. Tri-generation systems are expected to provide at least three commodities, such as heating, cooling, desalination, storable fuel production and some other useful outputs, in addition to power generation. In this study, an experimental investigation of gasification is presented and two integrated tri-generation systems are proposed. The first integrated tri-generation system (System 1) utilizes solar energy as input and the outputs are power, fresh water and hot water. It consists of four sub-systems, namely solar power tower system, desalination system, Rankine cycle and organic Rankine cycle (ORC). The second integrated tri-generation system (System 2) utilizes coal and biomass as input and the outputs are power, fuel and hot water. It consists of five sub-systems: gasification plant, Brayton cycle, Rankine cycle, Fischer-Tropsch synthesis plant and an organic Rankine cycle (ORC). Experimental investigation includes coal and biomass gasification, where the experimental results of synthesis gas compositions are utilized in the analysis of the second systems. To maximize efficiency, heat losses from the system should be minimized through a recovery system to make the heat a useful commodity for other systems, such as ORCs which can utilize the low-grade heat. In this respect, ORCs are first analyzed for three different configurations in terms of energy and exergy efficiencies altering working fluids to increase the power output. Among two types of coal and one type

  8. Experimental Validation of the Piezoelectric Triple Hybrid Actuation System (TriHYBAS)

    NASA Technical Reports Server (NTRS)

    Xu, Tian-Bing; Jiang, Xiaoning; Su, Ji


    A piezoelectric triple hybrid actuation system (TriHYBAS) has been developed. In this brief presentation of the validation process the displacement profile of TriHYBAS and findings regarding displacement versus applied voltage are highlighted.

  9. Tri-modal microscope for head and neck tissue identification.


    De Montigny, Etienne; Goulamhoussen, Nadir; Madore, Wendy-Julie; Strupler, Mathias; Gologan, Olguta Ecaterina; Ayad, Tareck; Boudoux, Caroline


    A novel tri-modal microscope combining optical coherence tomography (OCT), spectrally encoded confocal microscopy (SECM) and fluorescence imaging is presented. This system aims at providing a tool for rapid identification of head and neck tissues during thyroid surgery. The development of a dual-wavelength polygon-based swept laser allows for synchronized, co-registered and simultaneous imaging with all three modalities. Further ameliorations towards miniaturization include a custom lens for optimal compromise between orthogonal imaging geometries as well as a double-clad fiber coupler for increased throughput. Image quality and co-registration is demonstrated on freshly excised swine head and neck tissue samples to illustrate the complementarity of the techniques for identifying signature cellular and structural features. PMID:27231585

  10. A Newly Developed Tri-Leaflet Polymeric Heart Valve Prosthesis

    PubMed Central

    Gaetano, Francesco De; Bagnoli, Paola; Zaffora, Adriano; Pandolfi, Anna; Serrani, Marta; Brubert, Jacob; Stasiak, Joanna; Moggridge, Geoff D.; Costantino, Maria Laura


    The potential of polymeric heart valves (PHV) prostheses is to combine the hemodynamic performances of biological valves with the durability of mechanical valves. The aim of this work is to design and develop a new tri-leaflet prosthetic heart valve (HV) made from styrenic block copolymers. A computational finite element model was implemented to optimize the thickness of the leaflets, to improve PHV mechanical and hydrodynamic performances. Based on the model outcomes, 8 prototypes of the designed valve were produced and tested in vitro under continuous and pulsatile flow conditions, as prescribed by ISO 5840 Standard. A specially designed pulse duplicator allowed testing the PHVs at different flow rates and frequency conditions. All the PHVs met the requirements specified in ISO 5840 Standard in terms of both regurgitation and effective orifice area (EOA), demonstrating their potential as HV prostheses. PMID:27274605

  11. Physical mechanism of the (tri)critical point generation

    SciTech Connect

    Bugaev, K. A. Ivanytskyi, A. I.; Nikonov, E. G.; Petrov, V. K.; Sorin, A. S.; Zinovjev, G. M.


    We discuss some ideas resulting from a phenomenological relation recently declared between the tension of string connecting the static quark-antiquark pair and surface tension of corresponding cylindrical bag. This relation analysis leads to the temperature of vanishing surface tension coefficient of the QGP bags at zero baryonic charge density as T{sub {sigma}} = 152.9 {+-} 4.5 MeV. We develop the view point that this temperature value is not a fortuitous coincidence with the temperature of (partial) chiral symmetry restoration as seen in the lattice QCD simulations. Besides, we argue that T{sub {sigma}} defines the QCD (tri)critical endpoint temperature and claim that a negative value of surface tension coefficient recently discovered is not a sole result but is quite familiar for ordinary liquids at the supercritical temperatures.

  12. PLA branching with anhydrides and tri-functional aziridine

    NASA Astrophysics Data System (ADS)

    Gu, Liangliang; Xu, Yuewen; Naredla, Rajasekhar; Hoye, Thomas; Macosko, Christopher

    Branched PLA was prepared by melt blending with tri-functional aziridine (T-Az) and pyromellitic dianhydride (PMDA). 1HNMR, gel permeation chromatography (GPC) and rheology were used to characterize the topological structures of branched PLA. Fast reaction between PLA carboxyl end group and T-Az resulted in 3-arm stars and increased the molecular weight. However, the 3-arm stars did not show strain hardening behavior under extensional flow. After modifying PLA hydroxyl end group with PMDA, PLA can react with T-Az on both chain ends and form long chain branched structure, which showed strain hardening in extension. It was found that that only 10% of the PLA hydroxyl end groups reacted with PMDA. This work is supported by Center for Sustainable Polymers.

  13. Tri-modal microscope for head and neck tissue identification

    PubMed Central

    De Montigny, Etienne; Goulamhoussen, Nadir; Madore, Wendy-Julie; Strupler, Mathias; Gologan, Olguta Ecaterina; Ayad, Tareck; Boudoux, Caroline


    A novel tri-modal microscope combining optical coherence tomography (OCT), spectrally encoded confocal microscopy (SECM) and fluorescence imaging is presented. This system aims at providing a tool for rapid identification of head and neck tissues during thyroid surgery. The development of a dual-wavelength polygon-based swept laser allows for synchronized, co-registered and simultaneous imaging with all three modalities. Further ameliorations towards miniaturization include a custom lens for optimal compromise between orthogonal imaging geometries as well as a double-clad fiber coupler for increased throughput. Image quality and co-registration is demonstrated on freshly excised swine head and neck tissue samples to illustrate the complementarity of the techniques for identifying signature cellular and structural features. PMID:27231585

  14. Aspects of Cooling at the TRI{mu}P Facility

    SciTech Connect

    Willmann, L.; Berg, G. P.; Dammalapati, U.; De, S.; Dendooven, P.; Dermois, O.; Jungmann, K.; Mol, A.; Onderwater, C. J. G.; Rogachevskiy, A.; Sohani, M.; Traykov, E.; Wilschut, H. W.


    The Tri{mu}P facility at KVI is dedicated to provide short lived radioactive isotopes at low kinetic energies to users. It comprised different cooling schemes for a variety of energy ranges, from GeV down to the neV scale. The isotopes are produced using beam of the AGOR cyclotron at KVI. They are separated from the primary beam by a magnetic separator. A crucial part of such a facility is the ability to stop and extract isotopes into a low energy beamline which guides them to the experiment. In particular we are investigating stopping in matter and buffer gases. After the extraction the isotopes can be stored in neutral atoms or ion traps for experiments. Our research includes precision studies of nuclear {beta}-decay through {beta}-{nu} momentum correlations as well as searches for permanent electric dipole moments in heavy atomic systems like radium. Such experiments offer a large potential for discovering new physics.

  15. Tri-band small monopole antenna based on SRR units

    NASA Astrophysics Data System (ADS)

    Shehata, Gehan; Mohanna, Mahmoud; Rabeh, Mohammed Lotfy


    In this paper a novel design for a tri-band monopole antenna coupled with metamaterial units is introduced. The proposed antenna was designed to cover WiMAX (2.5, 3.5) and WLAN (5.2) bands. In our proposal, a coplanar waveguide (CPW) fed circular-disk monopole antenna is coupled with three split ring resonator (SRR) units which exist on its back side. In our design a monopole antenna and SRR units are designed first to resonate at 5.2 GHz and 2.5 GHz respectively. In addition, antenna is loaded with post to force resonance at 3.5 GHz. SRR units are used for 2.5 GHz resonance to miniaturize antenna size, and our proposed antenna considered an electrically small antenna (ESA) at its first resonance frequency. Simulated and measured results exhibit a good agreement that validate our design.

  16. Development of high-performance tri-layer material

    NASA Astrophysics Data System (ADS)

    Owe-Yang, D. C.; Yano, Toshiharu; Ueda, Takafumi; Iwabuchi, Motoaki; Ogihara, Tsutomu; Shirai, Shozo


    As chip size and pattern size continue to shrink, the thickness of photo resist is getting thinner and thinner. One of the major reasons is to prevent the small resist features from collapse. It's very challenging to get enough etch resistance from such thin resist thickness. An approach of Si-tri-layer stack which consists of resist, Si ARC (Si contenting anti-reflection coating), organic underlayer from top to bottom has been adopted by many IC makers in the manufacturing of 45 nm node. Even higher resist etching selectivity is needed for 32 nm node. Si ARC, of Si content as high as 43%, provides good etch selectivity. At the same time, tri-layer also provides good control over reflectivity in high NA immersion lithography. However, there are several well know issues concern Si-rich ARC. Resist compatibility and shelf life are on top of the list. An aim of our development work was to overcome those issues in order to produce manufacturing-worthy Si-rich ARC. Several synthesis methods were investigated to form Si-rich ARC film with different properties. Collapse of resist patterns is used as an indicator of lithographic compatibility. Lithographic performance was checked by accelerated shelf life tests at high temperature in order to predict the shelf life at room temperature. It was found that adhesion between resist and Si-rich ARC is improved when contact angle of Si-rich ARC is increased to more than 60 degree. Certain synthesis methods improve shelf life. After optimization of film properties and synthesis methods of Si-rich ARC, SHB-A940 series have best litho compatibility and shelf life is six months at storage temperature below 10°C.

  17. Do subfertile women adjust their habits when trying to conceive?

    PubMed Central

    Joelsson, Lana Salih; Berglund, Anna; Wånggren, Kjell; Lood, Mikael; Rosenblad, Andreas; Tydén, Tanja


    Aim The aim of this study was to investigate lifestyle habits and lifestyle adjustments among subfertile women trying to conceive. Materials and methods Women (n = 747) were recruited consecutively at their first visit to fertility clinics in mid-Sweden. Participants completed a questionnaire. Data were analyzed using logistic regression, t tests, and chi-square tests. Results The response rate was 62% (n = 466). Mean duration of infertility was 1.9 years. During this time 13.2% used tobacco daily, 13.6% drank more than three cups of coffee per day, and 11.6% consumed more than two glasses of alcohol weekly. In this sample, 23.9% of the women were overweight (body mass index, BMI 25–29.9 kg/m2), and 12.5% were obese (BMI ≥30 kg/m2). Obese women exercised more and changed to healthy diets more frequently than normal-weight women (odds ratio 7.43; 95% confidence interval 3.7–14.9). Six out of ten women (n = 266) took folic acid when they started trying to conceive, but 11% stopped taking folic acid after some time. Taking folic acid was associated with a higher level of education (p < 0.001). Conclusions Among subfertile women, one-third were overweight or obese, and some had other lifestyle factors with known adverse effects on fertility such as use of tobacco. Overweight and obese women adjusted their habits but did not reduce their body mass index. Women of fertile age would benefit from preconception counseling, and the treatment of infertility should routinely offer interventions for lifestyle changes. PMID:27216564

  18. Fusarium graminearum Tri12p influences virulence to wheat and trichothecene accumulation

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The gene Tri12 encodes a predicted Major Facilitator Superfamily protein suggested to play a role in export of trichothecene mycotoxins produced by Fusarium species. However it is currently unclear how the Tri12 protein (Tri12p) may influence trichothecene sensitivity and virulence of the wheat path...

  19. An empirical study of the effect of granting multiple tries for online homework

    NASA Astrophysics Data System (ADS)

    Kortemeyer, Gerd


    When deploying online homework in physics courses, an important consideration is how many tries learners should be allowed to solve numerical free-response problems. While on the one hand, this number should be large enough to allow learners mastery of concepts and avoid copying, on the other hand, granting too many allowed tries encourages counter-productive behavior. We investigate data from an introductory calculus-based physics course that allowed different numbers of tries in different semesters. It turns out that the probabilities for successfully completing or abandoning problems during a particular try are independent of the number of tries already made, which indicates that students do not learn from their earlier tries. We also find that the probability for successfully completing a problem during a particular try decreases with the number of allowed tries, likely due to increased carelessness or guessing, while the probability to give up on a problem after a particular try is largely independent of the number of allowed tries. These findings lead to a mathematical model for learner usage of multiple tries, which predicts an optimum number of five allowed tries.

  20. Design Documentation for JaWE2Openflow Project

    SciTech Connect

    Mehta, N; Barter, R H


    Lawrence Livermore National Laboratory (LLNL) has chosen CIGNEX Technologies, Inc. (CIGNEX) to design and develop the JaWE2Openflow conversion software. This document was created by CIGNEX as a project deliverable.

  1. RuBPCase activase mediates growth-defense tradeoffs: Silencing RCA redirects JA flux from JA-Ile to MeJA to attenuate induced defense responses in Nicotiana attenuata

    PubMed Central

    Mitra, Sirsha; Baldwin, Ian T.


    Summary RuBPCase activase (RCA), an abundant photosynthetic protein is strongly down-regulated in response to Manduca sexta’s oral secretion (OS) in Nicotiana attenuata. RCA-silenced plants are impaired not only in photosynthetic capacity and growth, but also in jasmonic acid (JA)-isoleucine (Ile) signaling, and herbivore resistance mediated by JA-Ile dependent defense traits. These responses are consistent with a resource-based growth-defense trade-off. Since JA+Ile-supplementation of OS restored WT levels of JA-Ile, defenses and resistance to M. sexta, but OS supplemented individually with JA- or Ile did not, the JA-Ile deficiency of RCA-silenced plants could not be attributed to lower JA or Ile pools or JAR4/6 conjugating activity. Similar levels of JA-Ile derivatives after OS elicitation indicated unaltered JA-Ile turnover and lower levels of other JA-conjugates ruled out competition from other conjugation reactions. RCA-silenced plants accumulated more methyl jasmonate (MeJA) after OS elicitation, which corresponded with increased jasmonate methyltransferase (JMT) activity. RCA-silencing phenocopies JMT over-expression, wherein elevated JMT activity redirects OS-elicited JA flux towards inactive MeJA, creating a JA sink which depletes JA-Ile and its associated defense responses. Hence RCA plays an additional non-photosynthetic role in attenuating JA-mediated defenses and their associated costs potentially allowing plants to anticipate resource-based constraints on growth before they actually occur. PMID:24491116

  2. Pregnancy Intentions Among Women Who Do Not Try: Focusing On Women Who Are Okay Either Way

    PubMed Central

    Greil, Arthur L.; Shreffler, Karina M.


    Are women who are intentional about pregnancy (trying to or trying not to get pregnant) systematically different from women who are “okay either way” about getting pregnant? We use a currently sexually active subsample (n = 3,771) of the National Survey of Fertility Barriers, a random digit dialing telephone survey of reproductive-aged women (ages 25–45) in the United States. We compare women who are trying to, trying not to, or okay either way about getting pregnant on attitudes, social pressures, life course and status characteristics using bivariate analyses (chi-square tests for categorical and ANOVA tests for continuous variables). Multivariate multinomial logistic regression provides adjusted associations. Most women say that they are trying not to get pregnant (71%) or are okay either way (23%); few are trying to get pregnant. Among women with no prior pregnancies (n = 831), more say that they are trying to get pregnant (14%) but a similar percentage are okay either way (26%). Several characteristics distinguish those trying to from those okay: fertility intentions, importance of motherhood, age, parity, race/ethnicity and self identifying a fertility problem. Additional characteristics are associated with trying not to get pregnant compared to being okay: ideal number of children, wanting a baby, trusting conception, relationship satisfaction, race ethnicity, economic hardship, and attitudes about career success. Women who are “okay either way” about pregnancy should be assessed separately from women who are intentional (trying to, trying not to) about pregnancy. PMID:20449643

  3. Hanford Diversification and the Tri-Cities Economy FY 1999

    SciTech Connect

    SCOTT, M.J.


    The missions of the U.S. Department of Energy's Richland Operations Office (DOE/RL) are to safely manage the Hanford Site, to manage and clean up its legacy wastes, and to develop and deploy new science and technology in the environmental and energy fields. Collectively, DOE/RL and its contractors are the most important single entity in the Tri-Cities local economy (Pasco, Kennewick, and Richland, Washington, and the surrounding area). Although the relevant economic region affected by DOE/RL and its contractors actually embraces a geographic area reaching from Yakima in the west to Walla Walla in the east and from Moses Lake in the north to Pendleton, Oregon, in the south, over 90% of economic impacts likely occur in Benton and Franklin Counties. These two counties are defined as the ''local'' Tri-Cities economy for purposes of this study. In the federal fiscal year (FY) 1999 (October 1, 1998 through September 30, 1999), the total impact of DOE'S local $1.59 billion budget was felt through payrolls of $542 million and local purchases of goods and services of $226 million. The total local spending of $768 million was up slightly from the FY 1998 total of $765 million. Taking into account the multiplier effects of this spending, the DOE/RL budget sustained an estimated 32% of all local employment (28,250 out of 88,100 jobs) and about 35% of local earned income (almost $1.08 billion out of $3.08 billion). The decrease in these percentages from last year's report reflects an update of the model's economic structure based on the 1997 economic census year, a correction of a programming error in the model found during the update, and a broader definition of earnings that includes proprietor income, not just wages (see the Appendix for revisions to the previous forecasts). DOE budget increases in FY 2000 are expected to result in no change to the number of local DOE contractor jobs and about a $29 million increase in direct local spending.

  4. Practical application of a tri-axial intensity array

    NASA Astrophysics Data System (ADS)

    Young, Victor W.; Hines, Paul C.; Hutt, Daniel L.; Humphrey, Victor F.


    Sound intensity is a vector quantity representing the magnitude and direction of propagating energy within an acoustic field. In an underwater environment, a single omni-directional hydrophone can be used to measure instantaneous acoustic pressure and a finite difference approximation applied to the pressure signals from a pair of such hydrophones can be used to calculate particle velocity in a single direction. Because the time average of the product of instantaneous pressure and particle velocity is intensity, a pair of hydrophones is all that is required to measure a single component of the intensity vector. The complete three-dimensional intensity vector can be calculated using three orthogonal pairs of hydrophones. To evaluate this concept a tri-axial array consisting of three orthogonal pairs of omni-directional hydrophones has been developed and tested on both calibrated sources at a laboratory facility and sources of opportunity during sea trails in littoral waters. The use of this array to calculate the intensity vector and thereby localize both near-field and far-field acoustic sources and characterize the directionality of ambient noise fields will be discussed. The impact of signal-to-noise ratio and the effect of self-noise will also be examined.

  5. What Did You Try Last Semester? How Did It Work?

    NASA Astrophysics Data System (ADS)

    Moore, John W.


    As I write this, the end of the semester is less than a week away. This is a good time to reflect on what I tried this time that I had not done before, how well it worked, and how that applies to the process of change and reform in chemical education. Nearly a year ago, a good friend gave me a copy of a brief note by the Executive Director of the National Science Teachers Association, Gerald Wheeler (1). Its title was "Why doesn't change stick?" Quoting the Red Queen from Alice in Wonderland, Wheeler suggested that it might be taking all the running we could do just to maintain the status quo. He asked readers to look systematically at "the failed reform efforts begun in the 1960s" and questioned whether those efforts had actually changed anything. Although the reform efforts Wheeler questioned were aimed at the pre-college level, his point is a good one for college as well as high school teachers to consider, especially at a time when new projects are aiming to reform science education systemically. (See pages 158-160 and page 163 for more information on these projects.) If reform efforts are typically meteoric, burning brightly for but a short time and then disappearing, what might we do to make them less so? I think that the power to make reform less meteoric lies within all of us. It involves incremental, rather than revolutionary, change. My model for reform is one in which each of us continually experiments with manageable changes in courses and pedagogy, evaluating their effectiveness, casting out the less than successful ones, retaining and refining those that help students learn more effectively, and keeping the rest of the community informed about what works and what does not. This model requires continual work and dedication from all of us, but not superhuman effort that is impossible to sustain over the long term. A meteor shower definitely gets our attention, but far more light is shed by the fixed stars, and they'll still be there next week. The

  6. The Tri-Optic II: Embracing the family voice.


    Fogarty, Colleen T; Mauksch, Larry B


    In June, 2015, for the issue marking the passing of Donald Bloch, the intellectual founder of the collaborative health care movement, we wrote an editorial called, "The Tri-Optic: Next step for Collaborative Family Healthcare" (Mauksch & Fogarty, 2015). Bloch had famously proposed the "dual optic": the partnership of Dr. Biomedicine and Dr. Psychosocial (Bloch, 1988). Our readers, including many Collaborative Family Healthcare Association (CFHA) members, understand the value of a family perspective and are grappling with the next steps to truly integrate family and systems thinking into all levels of health care. A current exploration about the last 10 years of articles published in the journal by Tai Mendenhall, a member or our editorial board (personal communication, 2015), has found that the most common topic of focus is family health and functioning in 28% of the articles. This focus was also evident to varying degrees in all the plenaries at the 2015 CFHA conference held in Portland, Oregon. we pose the following questions to the FSH readership and CFHA community: Where are we, individually and collectively, with our knowledge about families as resources in and influences on health care? How are we teaching our learners about family-oriented care? How do we integrate family thinking into our various models of care? How do models of behavioral health integration include the family context in patient care? PMID:26963776

  7. Coinage metal complexes supported by the tri- and tetraphosphine ligands.


    Dau, Minh Thuy; Shakirova, Julia R; Karttunen, Antti J; Grachova, Elena V; Tunik, Sergey P; Melnikov, Alexey S; Pakkanen, Tapani A; Koshevoy, Igor O


    A series of tri- and tetranuclear phosphine complexes of d(10) metal ions supported by the polydentate ligands, bis(diphenylphosphinomethyl)phenylphosphine (PPP) and tris(diphenylphosphinomethyl)phosphine (PPPP), were synthesized. All the compounds under study, [AuM2(PPP)2](3+) (M = Au (1), Cu (2), Ag (3)), [M4(PPPP)2](4+) (M = Ag (4), Au (5)), [AuAg3(PPPP)2](4+) (6), and [Au2Cu2(PPPP)2(NCMe)4](4+) (7), were characterized crystallographically. The trinuclear clusters 1-3 contain a linear metal core, while in the isostructural tetranuclear complexes 4-6 the metal framework has a plane star-shaped arrangement. Cluster 7 adopts a structural motif that involves a digold unit bridged by two arms of the PPPP phosphines and decorated two spatially separated Cu(I) ions chelated by the remaining P donors. The NMR spectroscopic investigation in DMSO solution revealed the heterometallic clusters 2, 3, and 6 are stereochemically nonrigid and undergo reversible metal ions redistribution between several species, accompanied by their solvation-desolvation. The complexes 1-3 and 5-7 exhibit room temperature luminescence in the solid state (Φem = 6-64%) in the spectral region from 450 to 563 nm. The phosphorescence observed originates from the triplet excited states, determined by the metal cluster-centered dσ* → pσ transitions. PMID:24750114

  8. Toxic Release Inventory (TRI): United States and territories, 1987

    SciTech Connect

    Not Available


    The Toxic Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment. The set contains all of the data provided on the magnetic tape version. Twelve indexes allow easy access to the data. Section 313 of the Emergency Planning and Community Right-to-Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99-499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. The data include (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, released to publicly owned treatment works, or transferred to off-site waste disposal facilities. All releases are in pounds per year.

  9. Toxic Release Inventory (TRI): United States and territories, 1988

    SciTech Connect

    Not Available


    The Toxic Release Inventory (TRI) data gives annual estimated releases of toxic chemicals to the environment. The set contains all of the data provided on the magnetic tape version. Twelve indexes allow easy access to the data. Section 313 of the Emergency Planning and Community Right-to-Know Act (also known as Title III) of the Superfund Amendments and Reauthorization Act (SARA) of 1986 (Public Law 99-499) requires EPA to establish an inventory of toxic chemical emissions from certain facilities. Section 313 informs the public of the presence of chemicals in their communities and releases of these chemicals into the community. The data include (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, released to publicly owned treatment works, or transferred to off-site waste disposal facilities. All releases are in pounds per year.

  10. Tunable Anomalous Supercurrent in a topological tri-junction SQUID

    NASA Astrophysics Data System (ADS)

    Kurter, C.; Finck, A. D. K.; Ghaemi, P.; Hor, Y. S.; van Harlingen, D. J.


    There has been intense interest in realizing Majorana fermions (MFs) in solid-state systems. Circuits of Josephson junctions (JJs) made of closely spaced s-wave superconductors on 3D topological insulators have been proposed to host zero energy Andreev bound states (ABSs) that act like MFs. Here, we present signatures of an anomalous supercurrent carried by topologically non-trivial low energy ABSs in a Nb/Bi2Se3/Nb tri-junction SQUID where two of the three superconducting leads are connected by a loop. An electrostatic top gate allows strong modulation of the supercurrent despite a high bulk contribution to the normal state conductance. In response to a magnetic field threading flux within the superconducting loop, we find unconventional SQUID oscillations enclosed by an envelope associated with a clear diffraction pattern, indicating spatially uniform and symmetric JJs. At a critical gate voltage, when the trivial 2DEG at the surface is nearly depleted, we observe a sharp drop in the critical current, signaling a topological phase transition in which the nature of the supercurrent-carrying states is transformed. This transition is accompanied by qualitative changes in the SQUID oscillations, magnetic diffraction pattern, and temperature dependence of the critical current. We acknowledge funding from Microsoft Station-Q.

  11. AIDS and journalism. Trying to tell too clear a story.


    Cohen, J


    Much in science is complex. Scientists, by definition, work within the realm of complex hypothesis, empirical evidence, and proof. Questions, answers, details, complexities; that is the domain of the scientist. Journalists, on the other hand, are paid to develop and present stories which are clearly read and interpreted by the general public. The mechanics and dynamics of HIV and AIDS are among the most complex scientific challenges in the history of humankind. Journalists calling upon scientists to obtain and report clear, concise, information about the agent and its resulting pandemic are therefore surely not always going to receive simple, readily reportable responses. HIV is a moving target upon which research continues. While there are some definitively affirmative and some definitively negative factors about HIV, the gray areas and speculation remain vast. The author gives a few examples of AIDS stories which the media mishandled because they were trying to tell too clear a story. He then discusses stories flawed because scientists managed to present clear information about which journalists were overly skeptical. In one case, the public was informed that AIDS vaccines were not working, with headlines which insinuated that the vaccines themselves were causing infections. None of the vaccines, however, contained infectious materials. As a result, people became overly fearful of participating in HIV vaccine trials. Coverage of the potential identification of HIV-3 was premature and only scared people, while Rolling Stone magazine's article hypothesizing the origin of HIV via trials of a contaminated polio vaccine in the Belgium Congo in the late 1950s should not have been published. Clear answers about HIV/AIDS are few and far between, but interesting and significant stories can still be found; they are just hard to tell. PMID:12319130

  12. TRY – a global database of plant traits

    PubMed Central

    Kattge, J; Díaz, S; Lavorel, S; Prentice, I C; Leadley, P; Bönisch, G; Garnier, E; Westoby, M; Reich, P B; Wright, I J; Cornelissen, J H C; Violle, C; Harrison, S P; Van Bodegom, P M; Reichstein, M; Enquist, B J; Soudzilovskaia, N A; Ackerly, D D; Anand, M; Atkin, O; Bahn, M; Baker, T R; Baldocchi, D; Bekker, R; Blanco, C C; Blonder, B; Bond, W J; Bradstock, R; Bunker, D E; Casanoves, F; Cavender-Bares, J; Chambers, J Q; Chapin, F S; Chave, J; Coomes, D; Cornwell, W K; Craine, J M; Dobrin, B H; Duarte, L; Durka, W; Elser, J; Esser, G; Estiarte, M; Fagan, W F; Fang, J; Fernández-Méndez, F; Fidelis, A; Finegan, B; Flores, O; Ford, H; Frank, D; Freschet, G T; Fyllas, N M; Gallagher, R V; Green, W A; Gutierrez, A G; Hickler, T; Higgins, S I; Hodgson, J G; Jalili, A; Jansen, S; Joly, C A; Kerkhoff, A J; Kirkup, D; Kitajima, K; Kleyer, M; Klotz, S; Knops, J M H; Kramer, K; Kühn, I; Kurokawa, H; Laughlin, D; Lee, T D; Leishman, M; Lens, F; Lenz, T; Lewis, S L; Lloyd, J; Llusià, J; Louault, F; Ma, S; Mahecha, M D; Manning, P; Massad, T; Medlyn, B E; Messier, J; Moles, A T; Müller, S C; Nadrowski, K; Naeem, S; Niinemets, Ü; Nöllert, S; Nüske, A; Ogaya, R; Oleksyn, J; Onipchenko, V G; Onoda, Y; Ordoñez, J; Overbeck, G; Ozinga, W A; Patiño, S; Paula, S; Pausas, J G; Peñuelas, J; Phillips, O L; Pillar, V; Poorter, H; Poorter, L; Poschlod, P; Prinzing, A; Proulx, R; Rammig, A; Reinsch, S; Reu, B; Sack, L; Salgado-Negret, B; Sardans, J; Shiodera, S; Shipley, B; Siefert, A; Sosinski, E; Soussana, J-F; Swaine, E; Swenson, N; Thompson, K; Thornton, P; Waldram, M; Weiher, E; White, M; White, S; Wright, S J; Yguel, B; Zaehle, S; Zanne, A E; Wirth, C


    Plant traits – the morphological, anatomical, physiological, biochemical and phenological characteristics of plants and their organs – determine how primary producers respond to environmental factors, affect other trophic levels, influence ecosystem processes and services and provide a link from species richness to ecosystem functional diversity. Trait data thus represent the raw material for a wide range of research from evolutionary biology, community and functional ecology to biogeography. Here we present the global database initiative named TRY, which has united a wide range of the plant trait research community worldwide and gained an unprecedented buy-in of trait data: so far 93 trait databases have been contributed. The data repository currently contains almost three million trait entries for 69 000 out of the world's 300 000 plant species, with a focus on 52 groups of traits characterizing the vegetative and regeneration stages of the plant life cycle, including growth, dispersal, establishment and persistence. A first data analysis shows that most plant traits are approximately log-normally distributed, with widely differing ranges of variation across traits. Most trait variation is between species (interspecific), but significant intraspecific variation is also documented, up to 40% of the overall variation. Plant functional types (PFTs), as commonly used in vegetation models, capture a substantial fraction of the observed variation – but for several traits most variation occurs within PFTs, up to 75% of the overall variation. In the context of vegetation models these traits would better be represented by state variables rather than fixed parameter values. The improved availability of plant trait data in the unified global database is expected to support a paradigm shift from species to trait-based ecology, offer new opportunities for synthetic plant trait research and enable a more realistic and empirically grounded representation of terrestrial

  13. Try-A Global Database of Plant Traits

    SciTech Connect

    Thornton, Peter E


    Plant traits the morphological, anatomical, physiological, biochemical and phenological characteristics of plants and their organs determine how primary producers respond to environmental factors, affect other trophic levels, influence ecosystem processes and services and provide a link from species richness to ecosystem functional diversity. Trait data thus represent the raw material for a wide range of research from evolutionary biology, community and functional ecology to biogeography. Here we present the global database initiative named TRY, which has united a wide range of the plant trait research community worldwide and gained an unprecedented buy-in of trait data: so far 93 trait databases have been contributed. The data repository currently contains almost three million trait entries for 69 000 out of the world s 300 000 plant species, with a focus on 52 groups of traits characterizing the vegetative and regeneration stages of the plant life cycle, including growth, dispersal, establishment and persistence. A first data analysis shows that most plant traits are approximately log-normally distributed, with widely differing ranges of variation across traits. Most trait variation is between species (interspecific), but significant intraspecific variation is also documented, up to 40% of the overall variation. Plant functional types (PFTs), as commonly used in vegetation models, capture a substantial fraction of the observed variation but for several traits most variation occurs within PFTs, up to 75% of the overall variation. In the context of vegetation models these traits would better be represented by state variables rather than fixed parameter values. The improved availability of plant trait data in the unified global database is expected to support a paradigm shift from species to trait-based ecology, offer new opportunities for synthetic plant trait research and enable a more realistic and empirically grounded representation of terrestrial vegetation in

  14. Tri-isobutylphosphate: a prenatal toxicity study in rats.


    Ruckman, S A; Green, O P; Palmer, A K; Klimisch, H J


    To assess the prenatal toxicity to rats of the anti-foaming agent, tri-isobutylphosphate (CAS 126-71-6), a study was conducted in which daily dosages of 0, 100, 300 and 1000 mg/kg were administered to different treatment groups by gavage from day 6 to 15 of pregnancy. Dams were killed and foetuses examined on day 20 of pregnancy. Maternal effects during the dosing period included a dosage-related increase in the frequency, persistence and severity of post dosing salivation in all test groups and significantly increased water consumption at 1000 mg/kg. Bodyweight gain at 1000 and 300 mg/kg was lower than that of controls but the differences were not statistically significant. The lowest dosage of 100 mg/kg could be considered as the maternal 'lowest observed adverse effect level' (LOAEL) or 'no observed adverse effect level' (NOAEL) according to whether increased salivation is perceived to be a true toxic effect or simply a reaction to the taste of the test material. Neither litter values nor the prevalence of foetuses with abnormalities indicated any embryotoxic effects (including teratogenicity) at any dosage. The most notable feature of the results was the occurrence of a cluster of foetuses with the congenital abnormality referred to as 'hunched posture syndrome' or 'squat foetus syndrome'. However, the incidence of this finding was similar to that noted among background data for the same strain and, in the absence of any other embryotoxic findings, was considered likely to have arisen coincidentally. PMID:10355544

  15. Modulation of STAT3 Folding and Function by TRiC/CCT Chaperonin

    PubMed Central

    Kasembeli, Moses; Lau, Wilson Chun Yu; Roh, Soung-Hun; Eckols, T. Kris; Frydman, Judith; Chiu, Wah; Tweardy, David J.


    Signal transducer and activator of transcription 3 (Stat3) transduces signals of many peptide hormones from the cell surface to the nucleus and functions as an oncoprotein in many types of cancers, yet little is known about how it achieves its native folded state within the cell. Here we show that Stat3 is a novel substrate of the ring-shaped hetero-oligomeric eukaryotic chaperonin, TRiC/CCT, which contributes to its biosynthesis and activity in vitro and in vivo. TRiC binding to Stat3 was mediated, at least in part, by TRiC subunit CCT3. Stat3 binding to TRiC mapped predominantly to the β-strand rich, DNA-binding domain of Stat3. Notably, enhancing Stat3 binding to TRiC by engineering an additional TRiC-binding domain from the von Hippel-Lindau protein (vTBD), at the N-terminus of Stat3, further increased its affinity for TRiC as well as its function, as determined by Stat3's ability to bind to its phosphotyrosyl-peptide ligand, an interaction critical for Stat3 activation. Thus, Stat3 levels and function are regulated by TRiC and can be modulated by manipulating its interaction with TRiC. PMID:24756126

  16. Network of nano-droplets by a tri-block polymer

    NASA Astrophysics Data System (ADS)

    Sharifi, Soheil; Doodman, Esmaeil


    Mixtures of oil in water nano-droplets with two molecular weights of a tri-block polymer was studied by quasi elastic light scattering and small angle X-ray scattering. The results showed that the size and interaction of droplets didn't change with increase of the tri-block polymer length but the order parameters increased. The increase of length of the tri-block biopolymer changed the dynamics of the droplets. A network formation is resulted with increase of the amount of tri-block polymer in the microemulsions.

  17. Tri-Laboratory Linux Capacity Cluster 2007 SOW

    SciTech Connect

    Seager, M


    well, the budget demands are extreme and new, more cost effective ways of fielding these systems must be developed. This Tri-Laboratory Linux Capacity Cluster (TLCC) procurement represents the ASC first investment vehicle in these capacity systems. It also represents a new strategy for quickly building, fielding and integrating many Linux clusters of various sizes into classified and unclassified production service through a concept of Scalable Units (SU). The programmatic objective is to dramatically reduce the overall Total Cost of Ownership (TCO) of these 'capacity' systems relative to the best practices in Linux Cluster deployments today. This objective only makes sense in the context of these systems quickly becoming very robust and useful production clusters under the crushing load that will be inflicted on them by the ASC and SSP scientific simulation capacity workload.

  18. Compression response of tri-axially braided textile composites

    NASA Astrophysics Data System (ADS)

    Song, Shunjun


    This thesis is concerned with characterizing the compression stiffness and compression strength of 2D tri-axially braided textile composites (2DTBC). Two types of 2DTBC are considered differing only on the resin type, while the textile fiber architecture is kept the same with bias tows at 45 degrees to the axial tows. Experimental, analytical and computational methods are described based on the results generated in this study. Since these composites are manufactured using resin transfer molding, the intended and as manufactured composite samples differ in their microstructure due to consolidation and thermal history effects in the manufacturing cycle. These imperfections are measured and the effect of these imperfections on the compression stiffness and strength are characterized. Since the matrix is a polymer material, the nonuniform thermal history undergone by the polymer at manufacturing (within the composite and in the presence of fibers) renders its properties to be non-homogenous. The effects of these non-homogeneities are captured through the definition of an equivalent in-situ matrix material. A method to characterize the mechanical properties of the in-situ matrix is also described. Fiber tow buckling, fiber tow kinking and matrix microcracking are all observed in the experiments. These failure mechanisms are captured through a computational model that uses the finite element (FE) technique to discretize the structure. The FE equations are solved using the commercial software ABAQUS version 6.5. The fiber tows are modeled as transversely isotropic elastic-plastic solids and the matrix is modeled as an isotropic elastic-plastic solid with and without microcracking damage. Because the 2DTBC is periodic, the question of how many repeat units are necessary to model the compression stiffness and strength are examined. Based on the computational results, the correct representative unit cell for this class of materials is identified. The computational models and

  19. 76 FR 25278 - Safety Zone; TriMet Bridge Project, Willamette River; Portland, OR

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; TriMet Bridge Project, Willamette River... is proposing the establishment of a safety zone during the construction of the TriMet Bridge on the..., 2008, issue of the Federal Register (73 FR 3316). Public Meeting We do not now plan to hold a...

  20. 77 FR 54811 - Safety Zone; TriRock San Diego, San Diego Bay, San Diego, CA

    Federal Register 2010, 2011, 2012, 2013, 2014


    .... SUPPLEMENTARY INFORMATION: Table of Acronyms DHS Department of Homeland Security FR Federal Register NPRM Notice... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; TriRock San Diego, San Diego Bay, San Diego... Competitor Group is sponsoring the TriRock Triathlon, consisting of 2000 swimmers swimming a...

  1. 78 FR 53243 - Safety Zone; TriRock San Diego, San Diego Bay, San Diego, CA

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Acronyms DHS Department of Homeland Security FR Federal Register NPRM Notice of Proposed Rulemaking A... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; TriRock San Diego, San Diego Bay, San Diego... Safety Zone; TriRock San Diego, San Diego Bay, San Diego, CA. (a) Location. The limits of the safety...

  2. Trying Physics: Analyzing the Motion of the Quickest Score in International Rugby

    ERIC Educational Resources Information Center

    Goff, John Eric; Lipscombe, Trevor Davis


    The hearts of sports fans were stirred recently by the fastest-ever try scored in international rugby. Welsh winger Dafydd Howells crossed the Fijian try line to score a mere six seconds after Angus O'Brien had started the game with a kickoff, in one of the fixtures in rugby's Junior World Cup played on June 2, 2014, in New Zealand. This…

  3. 40 CFR 721.4840 - Substituted tri-phenyl-meth-ane.

    Code of Federal Regulations, 2010 CFR


    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Substituted tri-phenyl-meth-ane. 721.4840 Section 721.4840 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) TOXIC... Substances § 721.4840 Substituted tri-phenyl-meth-ane. (a) Chemical substance and significant new...

  4. 40 CFR 721.4840 - Substituted tri-phenyl-meth-ane.

    Code of Federal Regulations, 2012 CFR


    ... 40 Protection of Environment 32 2012-07-01 2012-07-01 false Substituted tri-phenyl-meth-ane. 721.4840 Section 721.4840 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) TOXIC... Substances § 721.4840 Substituted tri-phenyl-meth-ane. (a) Chemical substance and significant new...

  5. 40 CFR 721.4840 - Substituted tri-phenyl-meth-ane.

    Code of Federal Regulations, 2014 CFR


    ... 40 Protection of Environment 31 2014-07-01 2014-07-01 false Substituted tri-phenyl-meth-ane. 721.4840 Section 721.4840 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) TOXIC... Substances § 721.4840 Substituted tri-phenyl-meth-ane. (a) Chemical substance and significant new...

  6. 40 CFR 721.4840 - Substituted tri-phenyl-meth-ane.

    Code of Federal Regulations, 2011 CFR


    ... 40 Protection of Environment 31 2011-07-01 2011-07-01 false Substituted tri-phenyl-meth-ane. 721.4840 Section 721.4840 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) TOXIC... Substances § 721.4840 Substituted tri-phenyl-meth-ane. (a) Chemical substance and significant new...

  7. Leucine metabolism regulates TRI6 expression and affects deoxynivalenol production and virulence in Fusarium graminearum.


    Subramaniam, Rajagopal; Narayanan, Swara; Walkowiak, Sean; Wang, Li; Joshi, Manisha; Rocheleau, Hélène; Ouellet, Thérèse; Harris, Linda J


    TRI6 is a positive regulator of the trichothecene gene cluster and the production of trichothecene mycotoxins [deoxynivalenol (DON)] and acetylated forms such as 15-Acetyl-DON) in the cereal pathogen Fusarium graminearum. As a global transcriptional regulator, TRI6 expression is modulated by nitrogen-limiting conditions, sources of nitrogen and carbon, pH and light. However, the mechanism by which these diverse environmental factors affect TRI6 expression remains underexplored. In our effort to understand how nutrients affect TRI6 regulation, comparative digital expression profiling was performed with a wild-type F. graminearum and a Δtri6 mutant strain, grown in nutrient-rich conditions. Analysis showed that TRI6 negatively regulates genes of the branched-chain amino acid (BCAA) metabolic pathway. Feeding studies with deletion mutants of MCC, encoding methylcrotonyl-CoA-carboxylase, one of the key enzymes of leucine metabolism, showed that addition of leucine specifically down-regulated TRI6 expression and reduced 15-ADON accumulation. Constitutive expression of TRI6 in the Δmcc mutant strain restored 15-ADON production. A combination of cellophane breach assays and pathogenicity experiments on wheat demonstrated that disrupting the leucine metabolic pathway significantly reduced disease. These findings suggest a complex interaction between one of the primary metabolic pathways with a global regulator of mycotoxin biosynthesis and virulence in F. graminearum. PMID:26248604

  8. 40 CFR 721.4840 - Substituted tri-phenyl-meth-ane.

    Code of Federal Regulations, 2013 CFR


    ... 40 Protection of Environment 32 2013-07-01 2013-07-01 false Substituted tri-phenyl-meth-ane. 721.4840 Section 721.4840 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) TOXIC... Substances § 721.4840 Substituted tri-phenyl-meth-ane. (a) Chemical substance and significant new...

  9. 76 FR 60781 - Toxics Release Inventory (TRI) Reporting for Facilities Located in Indian Country and...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... the Federal Register (FR) requiring facilities in Indian country to submit annual TRI reports to EPA... 1990, EPA finalized regulations in the Federal Register (FR) requiring facilities in Indian country to submit annual TRI reports to EPA and the appropriate Tribal government (55 FR 30632). EPA's...

  10. Technology transfer and commercialization initiatives at TRI/Austin: Resources and examples

    SciTech Connect

    Matzkanin, G.A.; Dingus, M.L.


    Located at TRI/Austin, and operated under a Department of Defense contract, is the Nondestructive Testing Information Analysis Center (NTIAC). This is a full service Information Analysis Center sponsored by the Defense Technical Information Center (DTIC), although services of NTIAC are available to other government agencies, government contractors, industry and academia. The principal objective of NTIAC is to help increase the productivity of the nation`s scientists, engineers, and technical managers involved in, or requiring, nondestructive testing by providing broad information analysis services of technical excellence. TRI/Austin is actively pursuing commercialization of several products based on results from outside funded R and D programs. As a small business, TRI/Austin has limited capabilities for large scale fabrication, production, marketing or distribution. Thus, part of a successful commercialization process involves making appropriate collaboration arrangements with other organizations to augment TRI/Austin`s capabilities. Brief descriptions are given here of two recent commercialization efforts at TRI/Austin.

  11. What Did You Try Last Semester? How Did It Work?

    NASA Astrophysics Data System (ADS)

    Moore, John W.


    As I write this, the end of the semester is less than a week away. This is a good time to reflect on what I tried this time that I had not done before, how well it worked, and how that applies to the process of change and reform in chemical education. Nearly a year ago, a good friend gave me a copy of a brief note by the Executive Director of the National Science Teachers Association, Gerald Wheeler (1). Its title was "Why doesn't change stick?" Quoting the Red Queen from Alice in Wonderland, Wheeler suggested that it might be taking all the running we could do just to maintain the status quo. He asked readers to look systematically at "the failed reform efforts begun in the 1960s" and questioned whether those efforts had actually changed anything. Although the reform efforts Wheeler questioned were aimed at the pre-college level, his point is a good one for college as well as high school teachers to consider, especially at a time when new projects are aiming to reform science education systemically. (See pages 158-160 and page 163 for more information on these projects.) If reform efforts are typically meteoric, burning brightly for but a short time and then disappearing, what might we do to make them less so? I think that the power to make reform less meteoric lies within all of us. It involves incremental, rather than revolutionary, change. My model for reform is one in which each of us continually experiments with manageable changes in courses and pedagogy, evaluating their effectiveness, casting out the less than successful ones, retaining and refining those that help students learn more effectively, and keeping the rest of the community informed about what works and what does not. This model requires continual work and dedication from all of us, but not superhuman effort that is impossible to sustain over the long term. A meteor shower definitely gets our attention, but far more light is shed by the fixed stars, and they'll still be there next week. The

  12. TriLoNet: Piecing Together Small Networks to Reconstruct Reticulate Evolutionary Histories.


    Oldman, James; Wu, Taoyang; van Iersel, Leo; Moulton, Vincent


    Phylogenetic networks are a generalization of evolutionary trees that can be used to represent reticulate processes such as hybridization and recombination. Here, we introduce a new approach called TriLoNet (Trinet Level- one Network algorithm) to construct such networks directly from sequence alignments which works by piecing together smaller phylogenetic networks. More specifically, using a bottom up approach similar to Neighbor-Joining, TriLoNet constructs level-1 networks (networks that are somewhat more general than trees) from smaller level-1 networks on three taxa. In simulations, we show that TriLoNet compares well with Lev1athan, a method for reconstructing level-1 networks from three-leaved trees. In particular, in simulations we find that Lev1athan tends to generate networks that overestimate the number of reticulate events as compared with those generated by TriLoNet. We also illustrate TriLoNet's applicability using simulated and real sequence data involving recombination, demonstrating that it has the potential to reconstruct informative reticulate evolutionary histories. TriLoNet has been implemented in JAVA and is freely available at PMID:27189565

  13. Color agreement between nanofluorapatite ceramic discs associated with try-in pastes and with resin cements.


    Rigoni, Paulo; Amaral, Flávia Lucisano Botelho do; França, Fabiana Mantovani Gomes; Basting, Roberta Tarkany


    The aim of this study was to evaluate the in vitro color agreement between nanofluorapatite ceramic discs (e.max Ceram / Ivoclar Vivadent / A2) associated with try-in pastes and those bonded with resin cements (Vitique / DMG/ try-in shade A2½ and cement shade A2½, Variolink II / Ivoclar Vivadent / try-in shade A1 and cement shade A1, and Choice 2 / Bisco / try-in shade A2 and cement shade A2), and to evaluate the shade stability of the discs bonded with resin cements. The shades of composite resin discs (Lliss / FGM / A2) and nanofluorapatite ceramic discs with try-in pastes or cements were evaluated according to the Vita Classical shade guide by a digital spectrophotometer (Micro EspectroShade, MHT) immediately after placing the try-in pastes or resin cements between composite resin discs and ceramic discs. Other evaluations were performed at 2, 5, and 6 day intervals after cementation with the resin cements. All ceramic discs that received try-in pastes presented an A2 shade. There was no statistical difference in the shade of the ceramic specimens fixed with different cements at the different intervals, as evaluated by the Friedman test (p > 0.05). Two try-in pastes presented shade compatibility with those recommended by the manufacturers. There was no similarity of shades between the ceramic discs with try-in pastes and those with the respective resin cements. Shade stability was observed in ceramic discs with resin cements within the intervals evaluated. PMID:23184164

  14. Various notions of positivity for bi-linear maps and applications to tri-partite entanglement

    NASA Astrophysics Data System (ADS)

    Han, Kyung Hoon; Kye, Seung-Hyeok


    We consider bi-linear analogues of s-positivity for linear maps. The dual objects of these notions can be described in terms of Schmidt ranks for tri-tensor products and Schmidt numbers for tri-partite quantum states. These tri-partite versions of Schmidt numbers cover various kinds of bi-separability, and so we may interpret witnesses for those in terms of bi-linear maps. We give concrete examples of witnesses for various kinds of three qubit entanglement.

  15. Apolar distal pocket mutants of yeast cytochrome c peroxidase: Binding of imidazole, 1-methylimidazole and 4-nitroimidazole to the triAla, triVal, and triLeu variants

    PubMed Central

    Bidwai, Anil; Ayala, Caitlan; Vitello, Lidia B.; Erman, James E.


    Imidazole binding to three apolar distal heme pocket mutants of yeast cytochrome c peroxidase (CcP) has been investigated between pH 4 and 8. The three CcP variants have Arg-48, Trp-51, and His-52 mutated to either all alanine, CcP(triAla), all valine, CcP(triVal), or all leucine residues, CcP(triLeu). The imidazole binding curves for all three mutants are biphasic indicating that each of the mutants exist in at least two conformational states with different affinities for imidazole. At pH 7, the high-affinity conformations of the three CcP mutants bind imidazole between 3.8 and 4.7 orders of magnitude stronger than that of wild-type CcP while the low-affinity conformations have binding affinities about 2.5 orders of magnitude larger than wild-type CcP. Imidazole binding to the three CcP mutants is pH dependent with the strongest binding observed at high pH. Apparent pKa values for the transition in binding vary between 5.6 and 7.5 for the high-affinity conformations and between 6.2 and 6.8 for the low-affinity conformations of the CcP triple mutants. The kinetics of imidazole binding are also biphasic. The fast phase of imidazole binding to CcP(triAla) and CcP(triLeu) is linearly dependent on the imidazole concentration while the slow phase is independent of imidazole concentration. Both phases of imidazole binding to CcP(triVal) have a hyperbolic dependence on the imidazole concentration. The apparent association rate constants vary between 30 and 170 M−1s−1 while the apparent dissociation rate constants vary between 0.05 and 0.43 s−1. The CcP triple mutants have higher binding affinities for 1-methylimidazole and 4-nitroimidazole than does wild-type CcP. PMID:25900360

  16. 78 FR 7993 - Amendment of Class D and E Airspace; Tri-Cities, TN; Revocation of Class E Airspace; Tri-City, TN

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... rulemaking (SNPRM) to amend Class D and Class E airspace in the Tri-Cities, TN, area (77 FR 59573). The SNPRM... read as follows: ] Authority: 49 U.S.C. 106(g); 40103, 40113, 40120; E.O. 10854, 24 FR 9565, 3 CFR... originally proposed in the NPRM of April 28, 2012 (77 FR 21505). Interested parties were invited...

  17. 77 FR 59573 - Proposed Amendment of Class D and E Airspace; Tri-Cities, TN; Revocation of Class E Airspace; Tri...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... in the Tri- Cities, TN area. DATES: Comments must be received on or before November 13, 2012... FR, 21505). The comment period closed May 25, 2012. No comments were received. Subsequent to... address and phone number) between 9 a.m. and 5 p.m., Monday through Friday, except Federal Holidays....

  18. 21 CFR 178.3505 - Glyceryl tri-(12-acetoxy-stearate).

    Code of Federal Regulations, 2011 CFR


    ... surface of calcium carbonate at a level not to exceed 1 weight-percent of the total mixture. (b) The calcium carbonate/glyceryl tri-(12-acetoxystearate) mixture is used as an adjuvant in polymers in...

  19. 21 CFR 178.3505 - Glyceryl tri-(12-acetoxy-stearate).

    Code of Federal Regulations, 2010 CFR


    ... surface of calcium carbonate at a level not to exceed 1 weight-percent of the total mixture. (b) The calcium carbonate/glyceryl tri-(12-acetoxystearate) mixture is used as an adjuvant in polymers in...

  20. 77 FR 65545 - Tri-State Generation and Transmission Association, Inc. v. Western Electric Coordinating Council...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Energy Regulatory Commission Tri-State Generation and Transmission Association, Inc. v. Western Electric Coordinating Council and North American Electric Reliability Corporation; Notice of Complaint Take notice that... petition requesting resolution of the conflict between Western Electric Coordinating Council and...

  1. The molecular architecture of the eukaryotic chaperonin TRiC/CCT

    PubMed Central

    Leitner, Alexander; Joachimiak, Lukasz A.; Bracher, Andreas; Mönkemeyer, Leonie; Walzthoeni, Thomas; Chen, Bryan; Pechmann, Sebastian; Holmes, Susan; Cong, Yao; Ma, Boxue; Ludtke, Steve; Chiu, Wah; Hartl, F. Ulrich; Aebersold, Ruedi; Frydman, Judith


    Summary TRiC/CCT is a highly conserved and essential chaperonin that uses ATP cycling to facilitate folding of approximately 10% of the eukaryotic proteome. This 1 MDa hetero-oligomeric complex consists of two stacked rings of eight paralogous subunits each. Previously proposed TRiC models differ substantially in their subunit arrangements and ring register. Here, we integrate chemical crosslinking, mass spectrometry and combinatorial modeling to reveal the definitive subunit arrangement of TRiC. In vivo disulfide mapping provided additional validation for the crosslinking-derived arrangement as the definitive TRiC topology. This subunit arrangement allowed the refinement of a structural model using existing X-ray diffraction data. The new structure explains all available crosslink experiments, provides a rationale for previously unexplained structural features and reveals a surprising asymmetry of charges within the chaperonin folding chamber. PMID:22503819

  2. Lithium cell technology and safety report of the Tri-Service Lithium Safety Committee

    NASA Technical Reports Server (NTRS)

    Reiss, E.


    The organization of the Tri-Service Lithium Safety Committee is described. The following areas concerning lithium batteries are discussed: transportation--DOT Exemption 7052, FAA; disposal; storage; individual testing/test results; and battery design and usage.

  3. Spin and valley resolved Landau level crossing in tri-layer ABA stacked graphene

    NASA Astrophysics Data System (ADS)

    Datta, Biswajit; Gupta, Vishakha; Borah, Abhinandan; Watanabe, Kenji; Taniguchi, Takashi; Deshmukh, Mandar

    We present quantum Hall measurements on a high quality encapsulated tri-layer graphene device. Low temperature field effect mobility of this device is around 500,000 cm2/Vs and we see SdH oscillations at a magnetic field as low as 0.3 T. Quantum Hall measurements confirm that the chosen tri layer graphene is Bernal (ABA) stacked. Due to the presence of both mass-less monolayer like Dirac fermions and massive bi-layer like Dirac fermions in Bernal stacked tri-layer graphene, there are Landau level crossings between monolayer and bi-layer bands in quantum Hall regime. Although most of the Landau Level crossings are predominantly present on the electron sides, we also observe signatures of the crossings on the hole side. This behaviour is consistent with the asymmetry of electron and hole in ABA tri-layer graphene. We observe a series of crossings of the spin and valley resolved Landau Levels.


    EPA Science Inventory

    In 1994, the Strategic Environmental Research and Development Program (SERDP) funded a Tri-Service effort to accelerate the development and fielding of environmental sensing technologies to extend the capabilities of the Site Characterization and Analysis Penetrometer System (SCA...

  5. Structural and functional characterization of TRI3 trichothecene 15-O-acetyltransferase from Fusarium sporotrichioides

    SciTech Connect

    Garvey, Graeme S.; McCormick, Susan P.; Alexander, Nancy J.; Rayment, Ivan


    Fusarium head blight is a devastating disease of cereal crops whose worldwide incidence is increasing and at present there is no satisfactory way of combating this pathogen or its associated toxins. There is a wide variety of trichothecene mycotoxins and they all contain a 12,13-epoxytrichothecene skeleton but differ in their substitutions. Indeed, there is considerable variation in the toxin profile across the numerous Fusarium species that has been ascribed to differences in the presence or absence of biosynthetic enzymes and their relative activity. This article addresses the source of differences in acetylation at the C15 position of the trichothecene molecule. Here, we present the in vitro structural and biochemical characterization of TRI3, a 15-O-trichothecene acetyltransferase isolated from F. sporotrichioides and the 'in vivo' characterization of Deltatri3 mutants of deoxynivalenol (DON) producing F. graminearum strains. A kinetic analysis shows that TRI3 is an efficient enzyme with the native substrate, 15-decalonectrin, but is inactive with either DON or nivalenol. The structure of TRI3 complexed with 15-decalonectrin provides an explanation for this specificity and shows that Tri3 and Tri101 (3-O-trichothecene acetyltransferase) are evolutionarily related. The active site residues are conserved across all sequences for TRI3 orthologs, suggesting that differences in acetylation at C15 are not due to differences in Tri3. The tri3 deletion mutant shows that acetylation at C15 is required for DON biosynthesis even though DON lacks a C15 acetyl group. The enzyme(s) responsible for deacetylation at the 15 position of the trichothecene mycotoxins have not been identified.

  6. The structural basis of substrate recognition by the eukaryotic chaperonin TRiC/CCT.


    Joachimiak, Lukasz A; Walzthoeni, Thomas; Liu, Corey W; Aebersold, Ruedi; Frydman, Judith


    The eukaryotic chaperonin TRiC (also called CCT) is the obligate chaperone for many essential proteins. TRiC is hetero-oligomeric, comprising two stacked rings of eight different subunits each. Subunit diversification from simpler archaeal chaperonins appears linked to proteome expansion. Here, we integrate structural, biophysical, and modeling approaches to identify the hitherto unknown substrate-binding site in TRiC and uncover the basis of substrate recognition. NMR and modeling provided a structural model of a chaperonin-substrate complex. Mutagenesis and crosslinking-mass spectrometry validated the identified substrate-binding interface and demonstrate that TRiC contacts full-length substrates combinatorially in a subunit-specific manner. The binding site of each subunit has a distinct, evolutionarily conserved pattern of polar and hydrophobic residues specifying recognition of discrete substrate motifs. The combinatorial recognition of polypeptides broadens the specificity of TRiC and may direct the topology of bound polypeptides along a productive folding trajectory, contributing to TRiC's unique ability to fold obligate substrates. PMID:25416944

  7. Colour matching of composite resin cements with their corresponding try-in pastes.


    Kampouropoulos, D; Gaintantzopoulou, M; Papazoglou, E; Kakaboura, A


    Two shades of four resin cements (Calibra, Clearfil Esthetic, Insure, Variolink II), in light- and dual-curing modes, were tested for colour matching with their corresponding try-in pastes, immediately after photopolymerization and after 24-hour dry and dark storage. Colour measurements were performed for 0.8 mm-thick specimens through a 0.8mm-thick ceramic plate. For each resin cement, colour differences (deltaE) were calculated between the two curing modes, and between the corresponding try-in paste, at baseline and after 24h. deltaE>0 values were detected between all resin cements and their try-in pastes, which were brand/shade/curing mode depended. The try-in pastes of the Variolink II system demonstrated the best colour matching (deltaE<2). Try-in pastes of Calibra and Insure, at both curing modes, did not match at an acceptable value, the shade of their corresponding resin cements (deltaE>3.3). Calibra presented the highest colour differences. deltaE values of the Clearfil Esthetic system immediately after photo-activation ranged between 2 and 3 units. A ceramic restoration may fail aesthetically as a result of not acceptable colour match (deltaE>3.3) between the shade of certain resin cements and their relevant try-in pastes. PMID:25134367

  8. Tri-Gas Pressurization System Testing and Modeling for Cryogenic Applications

    NASA Technical Reports Server (NTRS)

    Taylor, B.; Polsgrove, R.; Stephens, J.; Hedayat, A.


    The use of Tri-gas in rocket propulsion systems is somewhat of a new technology. This paper defines Tri-gas as a mixture of gases composed largely of helium with a small percentage of a stoichiometric mixture of hydrogen and oxygen. When exposed to a catalyst the hydrogen and oxygen in the mixture combusts, significantly raising the temperature of the mixture. The increase in enthalpy resulting from the combustion process significantly decreases the required quantity of gas needed to pressurize the ullage of the vehicle propellant tanks. The objective of this effort was to better understand the operating characteristics of Tri-gas in a pressurization system with low temperature applications. In conjunction with ongoing programs at NASA Marshall Space Flight Center, an effort has been undertaken to evaluate the operating characteristics of Tri-gas through modeling and bench testing. Through improved understanding of the operating characteristics, the risk of using this new technology in a launch vehicle propulsion system was reduced. Bench testing of Tri-gas was a multistep process that targeted gas characteristics and performance aspects that pose a risk to application in a pressurization system. Pressurization systems are vital to propulsion system performance. Keeping a target ullage pressure in propulsions tanks is necessary to supply propellant at the conditions and flow rates required to maintain desired engine functionality. The first component of testing consisted of sampling Tri-gas sources that had been stagnant for various lengths of time in order to determine the rate at which stratification takes place. Second, a bench test was set up in which Tri-gas was sent through a catalyst bed. This test was designed to evaluate the performance characteristics of Tri-gas, under low temperature inlet temperatures, in a flight-like catalyst bed reactor. The third, most complex, test examined the performance characteristics of Tri-gas at low temperature temperatures

  9. Coordinate expression of AOS genes and JA accumulation: JA is not required for initiation of closing layer in wound healing tubers

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Wounding induces a series of coordinated physiological responses essential for protection and healing of the damaged tissue. Wound-induced formation of jasmonic acid (JA) is important in defense responses in leaves, but comparatively little is known about the induction of JA biosynthesis and its ro...

  10. TriAnnot: A Versatile and High Performance Pipeline for the Automated Annotation of Plant Genomes.


    Leroy, Philippe; Guilhot, Nicolas; Sakai, Hiroaki; Bernard, Aurélien; Choulet, Frédéric; Theil, Sébastien; Reboux, Sébastien; Amano, Naoki; Flutre, Timothée; Pelegrin, Céline; Ohyanagi, Hajime; Seidel, Michael; Giacomoni, Franck; Reichstadt, Mathieu; Alaux, Michael; Gicquello, Emmanuelle; Legeai, Fabrice; Cerutti, Lorenzo; Numa, Hisataka; Tanaka, Tsuyoshi; Mayer, Klaus; Itoh, Takeshi; Quesneville, Hadi; Feuillet, Catherine


    In support of the international effort to obtain a reference sequence of the bread wheat genome and to provide plant communities dealing with large and complex genomes with a versatile, easy-to-use online automated tool for annotation, we have developed the TriAnnot pipeline. Its modular architecture allows for the annotation and masking of transposable elements, the structural, and functional annotation of protein-coding genes with an evidence-based quality indexing, and the identification of conserved non-coding sequences and molecular markers. The TriAnnot pipeline is parallelized on a 712 CPU computing cluster that can run a 1-Gb sequence annotation in less than 5 days. It is accessible through a web interface for small scale analyses or through a server for large scale annotations. The performance of TriAnnot was evaluated in terms of sensitivity, specificity, and general fitness using curated reference sequence sets from rice and wheat. In less than 8 h, TriAnnot was able to predict more than 83% of the 3,748 CDS from rice chromosome 1 with a fitness of 67.4%. On a set of 12 reference Mb-sized contigs from wheat chromosome 3B, TriAnnot predicted and annotated 93.3% of the genes among which 54% were perfectly identified in accordance with the reference annotation. It also allowed the curation of 12 genes based on new biological evidences, increasing the percentage of perfect gene prediction to 63%. TriAnnot systematically showed a higher fitness than other annotation pipelines that are not improved for wheat. As it is easily adaptable to the annotation of other plant genomes, TriAnnot should become a useful resource for the annotation of large and complex genomes in the future. PMID:22645565

  11. TRY-5 Is a Sperm-Activating Protease in Caenorhabditis elegans Seminal Fluid

    PubMed Central

    Smith, Joseph R.; Stanfield, Gillian M.


    Seminal fluid proteins have been shown to play important roles in male reproductive success, but the mechanisms for this regulation remain largely unknown. In Caenorhabditis elegans, sperm differentiate from immature spermatids into mature, motile spermatozoa during a process termed sperm activation. For C. elegans males, sperm activation occurs during insemination of the hermaphrodite and is thought to be mediated by seminal fluid, but the molecular nature of this activity has not been previously identified. Here we show that TRY-5 is a seminal fluid protease that is required in C. elegans for male-mediated sperm activation. We observed that TRY-5::GFP is expressed in the male somatic gonad and is transferred along with sperm to hermaphrodites during mating. In the absence of TRY-5, male seminal fluid loses its potency to transactivate hermaphrodite sperm. However, TRY-5 is not required for either hermaphrodite or male fertility, suggesting that hermaphrodite sperm are normally activated by a distinct hermaphrodite-specific activator to which male sperm are also competent to respond. Within males, TRY-5::GFP localization within the seminal vesicle is antagonized by the protease inhibitor SWM-1. Together, these data suggest that TRY-5 functions as an extracellular activator of C. elegans sperm. The presence of TRY-5 within the seminal fluid couples the timing of sperm activation to that of transfer of sperm into the hermaphrodite uterus, where motility must be rapidly acquired. Our results provide insight into how C. elegans has adopted sex-specific regulation of sperm motility to accommodate its male-hermaphrodite mode of reproduction. PMID:22125495

  12. Radiation measurement platform for balloon flights based on the TriTel silicon detector telescope

    NASA Astrophysics Data System (ADS)

    Zabori, Balazs; Hirn, Attila; Pazmandi, Tamas; Apathy, Istvan; Szanto, Peter; Deme, Sandor

    Several measurements have been performed on the cosmic radiation field from the surface of the Earth up to the maximum altitudes of research airplanes. However the cosmic radiation field is not well known between 15 km and 30 km. Our experiment idea based on to study the radiation environment in the stratosphere. The main technical goals of our experiment were to test at first time the TriTel 3D silicon detector telescope system for future ISS missons and to develop a balloon technology platform for advanced cosmic radiation and dosimetric measurements. The main scientific goals were to give an assessment of the cosmic radiation field at the altitude of the BEXUS balloons, to use the TriTel system to determine dosimetric and radiation quantities during the ballon flight and to intercompare the TriTel and Pille results to provide a correction factor definition method for the Pille ISS measurements. To fulfil the scientific and technological objectives several different dosimeter systems were included in the experiment: an advanced version of the TriTel silicon detector telescope, Geiger-Müller counters, Pille passive thermoluminescent dosimeters and Solid State Nuclear Track Detectors. The experiment was built by students from Hungarian universities and flew on board the BEXUS stratospheric balloon in Northern Sweden (from ESRANGE Space Center). The float altitude was approximately 28.6 km and the total flight time was about 4 hours. The active instruments measured in real time and the ground team received the collected data continuously during the mission. The main technical goals were received since the operation of the TriTel experienced no failures and the experiment worked as it expected. This paper presents the scientific goals and results. From the TriTel measurements the deposited energy spectra, the Linear Energy Transfer spectra, the average quality factor of the cosmic radiation as well as the absorbed dose and the dose equivalent were determined for the

  13. Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1.


    Freund, Adam; Zhong, Franklin L; Venteicher, Andrew S; Meng, Zhaojing; Veenstra, Timothy D; Frydman, Judith; Artandi, Steven E


    Telomere maintenance by telomerase is impaired in the stem cell disease dyskeratosis congenita and during human aging. Telomerase depends upon a complex pathway for enzyme assembly, localization in Cajal bodies, and association with telomeres. Here, we identify the chaperonin CCT/TRiC as a critical regulator of telomerase trafficking using a high-content genome-wide siRNA screen in human cells for factors required for Cajal body localization. We find that TRiC is required for folding the telomerase cofactor TCAB1, which controls trafficking of telomerase and small Cajal body RNAs (scaRNAs). Depletion of TRiC causes loss of TCAB1 protein, mislocalization of telomerase and scaRNAs to nucleoli, and failure of telomere elongation. DC patient-derived mutations in TCAB1 impair folding by TRiC, disrupting telomerase function and leading to severe disease. Our findings establish a critical role for TRiC-mediated protein folding in the telomerase pathway and link proteostasis, telomere maintenance, and human disease. PMID:25467444

  14. The structural basis of substrate recognition by the eukaryotic chaperonin TRiC/CCT

    PubMed Central

    Joachimiak, Lukasz A.; Walzthoeni, Thomas; Liu, Corey; Aebersold, Ruedi; Frydman, Judith


    Summary The eukaryotic chaperonin TRiC (also called CCT) is the obligate chaperone for many essential proteins. TRiC is hetero-oligomeric, comprising two stacked rings of eight different subunits each. Subunit diversification from simpler archaeal chaperonins appears linked to proteome expansion. Here, we integrate structural, biophysical and modeling approaches to identify the hitherto unknown substrate-binding site in TRiC and uncover the basis of substrate recognition. NMR and modeling provided a structural model of a chaperonin-substrate complex. Mutagenesis and crosslinking-mass spectrometry validated the identified substrate binding interface and demonstrate that TRiC contacts full-length substrates combinatorially in a subunit-specific manner. The binding site of each subunit has a distinct, evolutionarily conserved, pattern of polar and hydrophobic residues specifying recognition of discrete substrate motifs. The combinatorial recognition of polypeptides broadens the specificity of TRiC and may direct the topology of bound polypeptides along a productive folding trajectory, contributing to its unique ability to fold obligate substrates. PMID:25416944

  15. Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1

    PubMed Central

    Freund, Adam; Zhong, Franklin L.; Venteicher, Andrew S.; Meng, Zhaojing; Veenstra, Timothy D.; Frydman, Judith; Artandi, Steven E.


    SUMMARY Telomere maintenance by telomerase is impaired in the stem cell disease dyskeratosis congenita and during human aging. Telomerase depends upon a complex pathway for enzyme assembly, localization in Cajal bodies and association with telomeres. Here, we identify the chaperonin CCT/TRiC as a critical regulator of telomerase trafficking, using a high content genome-wide siRNA screen in human cells for factors required for Cajal body-localization. We find that TRiC is required for folding the telomerase cofactor TCAB1, which controls trafficking of telomerase and small Cajal body RNAs (scaRNAs). Depletion of TRiC causes loss of TCAB1 protein, mislocalization of telomerase and scaRNAs to nucleoli, and failure of telomere elongation. DC patient-derived mutations in TCAB1 impair folding by TRiC, disrupting telomerase function and leading to severe disease. Our findings establish a critical role for TRiC-mediated protein folding in the telomerase pathway and link proteostasis, telomere maintenance and human disease. PMID:25467444

  16. TriAnd and its siblings: satellites of satellites in the Milky Way halo

    NASA Astrophysics Data System (ADS)

    Deason, A. J.; Belokurov, V.; Hamren, K. M.; Koposov, S. E.; Gilbert, K. M.; Beaton, R. L.; Dorman, C. E.; Guhathakurta, P.; Majewski, S. R.; Cunningham, E. C.


    We explore the Triangulum-Andromeda (TriAnd) overdensity in the SPLASH (Spectroscopic and Photometric Landscape of Andromeda's Stellar Halo) and SEGUE (the Sloan Extension for Galactic Understanding and Exploration) spectroscopic surveys. Milky Way main-sequence turn-off stars in the SPLASH survey reveal that the TriAnd overdensity and the recently discovered Pan-Andromeda Archaeological Survey (PAndAS) stream share a common heliocentric distance (D ˜ 20 kpc), position on the sky, and line-of-sight velocity (VGSR ˜ 50 km s-1). Similarly, A-type, giant, and main-sequence turn-off stars selected from the SEGUE survey in the vicinity of the Segue 2 satellite show that TriAnd is prevalent in these fields, with a velocity and distance similar to Segue 2. The coincidence of the PAndAS stream and Segue 2 satellite in positional and velocity space to TriAnd suggests that these substructures are all associated, and may be a fossil record of group-infall on to the Milky Way halo. In this scenario, the Segue 2 satellite and PAndAS stream are `satellites of satellites', and the large, metal-rich TriAnd overdensity is the remains of the group central.

  17. Molecular architecture of the human U4/U6.U5 tri-snRNP.


    Agafonov, Dmitry E; Kastner, Berthold; Dybkov, Olexandr; Hofele, Romina V; Liu, Wen-Ti; Urlaub, Henning; Lührmann, Reinhard; Stark, Holger


    The U4/U6.U5 triple small nuclear ribonucleoprotein (tri-snRNP) is a major spliceosome building block. We obtained a three-dimensional structure of the 1.8-megadalton human tri-snRNP at a resolution of 7 angstroms using single-particle cryo-electron microscopy (cryo-EM). We fit all known high-resolution structures of tri-snRNP components into the EM density map and validated them by protein cross-linking. Our model reveals how the spatial organization of Brr2 RNA helicase prevents premature U4/U6 RNA unwinding in isolated human tri-snRNPs and how the ubiquitin C-terminal hydrolase-like protein Sad1 likely tethers the helicase Brr2 to its preactivation position. Comparison of our model with cryo-EM three-dimensional structures of the Saccharomyces cerevisiae tri-snRNP and Schizosaccharomyces pombe spliceosome indicates that Brr2 undergoes a marked conformational change during spliceosome activation, and that the scaffolding protein Prp8 is also rearranged to accommodate the spliceosome's catalytic RNA network. PMID:26912367

  18. Effect of MeJA treatment on polyamine, energy status and anthracnose rot of loquat fruit.


    Cao, Shifeng; Cai, Yuting; Yang, Zhenfeng; Joyce, Daryl C; Zheng, Yonghua


    The effect of methyl jasmonate (MeJA) on changes in polyamines content and energy status and their relation to disease resistance was investigated. Freshly harvested loquat fruit were treated with 10 μmol l(-1) MeJA and wound inoculated with Colletotrichum acutatum spore suspension (1.0 × 10(5) spores ml(-1)) after 24h, and then stored at 20 °C for 6 days. MeJA treatment significantly reduced decay incidence. MeJA treated fruit manifested higher contents of polyamines (putrescine, spermidine and spermine) compared with the control fruit, during storage. MeJA treatment also maintained higher levels of adenosine triphosphate, and suppressed an increase in adenosine monophosphate content in loquat fruit. These results suggest that MeJA treatment may inhibit anthracnose rot by increasing polyamine content and maintaining the energy status. PMID:24128452

  19. Tri-layer wrinkling as a mechanism for anchoring center initiation in the developing cerebellum.


    Lejeune, Emma; Javili, Ali; Weickenmeier, Johannes; Kuhl, Ellen; Linder, Christian


    During cerebellar development, anchoring centers form at the base of each fissure and remain fixed in place while the rest of the cerebellum grows outward. Cerebellar foliation has been extensively studied; yet, the mechanisms that control anchoring center initiation and position remain insufficiently understood. Here we show that a tri-layer model can predict surface wrinkling as a potential mechanism to explain anchoring center initiation and position. Motivated by the cerebellar microstructure, we model the developing cerebellum as a tri-layer system with an external molecular layer and an internal granular layer of similar stiffness and a significantly softer intermediate Purkinje cell layer. Including a weak intermediate layer proves key to predicting surface morphogenesis, even at low stiffness contrasts between the top and bottom layers. The proposed tri-layer model provides insight into the hierarchical formation of anchoring centers and establishes an essential missing link between gene expression and evolution of shape. PMID:27252048

  20. Try-It-On: Experiential Learning of Holistic Stress Management in a Graduate Nursing Curriculum.


    Gregg, S Renee; Twibell, K Renee


    The aim of this article is to relate how nursing students in a graduate curriculum can learn, personally practice, and prepare to disseminate stress management strategies to patients. Advanced practice nurses often provide care for patients experiencing stress-related disorders while concurrently trying to manage their own high levels of stress. Through the innovative Try-It-On teaching-learning strategy, graduate students experimented with holistic stress management approaches, with the intention of sharing with patients what worked effectively. Student comments on course evaluations were positive regarding Try-It-On. In the pilot trial of a quantitative survey to expand the evaluation of the strategy, students who trialed holistic stress management techniques reported satisfaction, engagement, perceived relevance, and intention to trial techniques with patients in future clinical courses. Modeling role modeling theory and the Kirkpatrick evaluation model guided the project, which filled gaps in current knowledge about experiential learning in graduate nursing programs. PMID:26597999

  1. Characterization of new glycolipid biosurfactants, tri-acylated mannosylerythritol lipids, produced by Pseudozyma yeasts.


    Fukuoka, Tokuma; Morita, Tomotake; Konishi, Masaaki; Imura, Tomohiro; Kitamoto, Dai


    Mannosylerythritol lipids (MELs) are glycolipid biosurfactants produced by Pseudozyma yeasts. They show not only the excellent interfacial properties but also versatile biochemical actions. In the course of MEL production from soybean oil by P. antarctica and P. rugulosa, some new extracellular glycolipids (more hydrophobic than the previously reported di-acylated MELs) were found in the culture medium. The most hydrophobic one was identified as 1-O-alka(e)noyl-4-O-[(4',6'-di-O-acetyl-2',3'-di-O-alka(e)noyl)-beta-D-mannopyranosyl]-D-erythritol, namely tri-acylated MEL. Others were tri-acylated MELs bearing only one acetyl group. The tri-acylated MEL could be prepared by the lipase-catalyzed esterification of a di-acylated MEL with oleic acid implying that the new glycolipids are synthesized from di-acylated MELs in the culture medium containing the residual fatty acids. PMID:17417694

  2. The TriBeam system: Femtosecond laser ablation in situ SEM

    SciTech Connect

    Echlin, McLean P.; Straw, Marcus; Randolph, Steven; Filevich, Jorge; Pollock, Tresa M.


    Femtosecond laser ablation offers the unique ability to remove material at rates that are orders of magnitude faster than existing ion beam technologies with little or no associated damage. By combining ultrafast lasers with state-of-the-art electron microscopy equipment, we have developed a TriBeam system capable of targeted, in-situ tomography providing chemical, structural, and topographical information in three dimensions of near mm{sup 3} sized volumes. The origins, development, physics, current uses, and future potential for the TriBeam system are described in this tutorial review. - Graphical abstract: Display Omitted - Highlights: • An emerging tool, the TriBeam, for in situ femtosecond (fs) laser ablation is presented. • Fs laser ablation aided tomography at the mm{sup 3}-scale is demonstrated. • Fs laser induced deposition of Pt is demonstrated at sub-diffraction limit resolution. • Fs laser surface structuring is reviewed as well as micromachining applications.

  3. How big is a Cp? Novel cycloheptatrienyl zirconium complexes with tri-, tetra- and pentasubstituted cyclopentadienyl ligands.


    Bauer, Heiko; Glöckner, Andreas; Tagne Kuate, Alain C; Schäfer, Sebastian; Sun, Yu; Freytag, Matthias; Tamm, Matthias; Walter, Marc D; Sitzmann, Helmut


    The new bulky cyclopentadienyl anions 1,2,4-tri(cyclopentyl)cyclopentadienide and 2,3-diisopropyl-1,4-dimethyl-5-trimethylsilyl-cyclopentadienide were prepared. These and the already known 1,2,4-tri(cyclohexyl)-, 1,2,4-tri(isopropyl)-, 2,3-diisopropyl-1,4-dimethyl-, 1,3,4-triisopropyl-2,5-dimethyl-, pentaphenyl-, and p-butylphenyl-tetraphenyl-cyclopentadienide as well as tert-butylindenide were coordinated to the cycloheptatrienylzirconium fragment [(CHT)ZrCl(tmeda)]. The nine zirconium complexes of the [(CHT)Zr(Cp)] type were characterized by elemental analysis and NMR spectroscopy. For five of the sandwich complexes X-ray crystal structure determination could be carried out; structures of the four others were obtained by DFT calculations. The data serve as a basis for cone angle measurements of cyclopentadienyl ligands to evaluate the steric demand of these ligands. PMID:25222005

  4. Analysis of weak signal detection based on tri-stable system under Levy noise

    NASA Astrophysics Data System (ADS)

    Li-Fang, He; Ying-Ying, Cui; Tian-Qi, Zhang; Gang, Zhang; Ying, Song


    Stochastic resonance system is an effective method to extract weak signal. However, system output is directly influenced by system parameters. Aiming at this, the Levy noise is combined with a tri-stable stochastic resonance system. The average signal-to-noise ratio gain is regarded as an index to measure the stochastic resonance phenomenon. The characteristics of tri-stable stochastic resonance under Levy noise is analyzed in depth. First, the method of generating Levy noise, the effect of tri-stable system parameters on the potential function and corresponding potential force are presented in detail. Then, the effects of tri-stable system parameters w, a, b, and Levy noise intensity amplification factor D on the resonant output can be explored with different Levy noises. Finally, the tri-stable stochastic resonance system is applied to the bearing fault detection. Simulation results show that the stochastic resonance phenomenon can be induced by tuning the system parameters w, a, and b under different distributions of Levy noise, then the weak signal can be detected. The parameter intervals which can induce stochastic resonances are approximately equal. Moreover, by adjusting the intensity amplification factor D of Levy noise, the stochastic resonances can happen similarly. In bearing fault detection, the detection effect of the tri-stable stochastic resonance system is superior to the bistable stochastic resonance system. Project supported by the National Natural Science Foundation of China (Grant No. 61371164), the Chongqing Municipal Distinguished Youth Foundation, China (Grant No. CSTC2011jjjq40002), and the Research Project of Chongqing Municipal Educational Commission, China (Grant No. KJ130524).

  5. Synthesis, structural characterization and biological activity of two diastereomeric JA-Ile macrolactones.


    Jimenez-Aleman, Guillermo H; Machado, Ricardo A R; Görls, Helmar; Baldwin, Ian T; Boland, Wilhelm


    Jasmonates are phytohormones involved in a wide range of plant processes, including growth, development, senescence, and defense. Jasmonoyl-L-isoleucine (JA-Ile, 2), an amino acid conjugate of jasmonic acid (JA, 1), has been identified as a bioactive endogenous jasmonate. However, JA-Ile (2) analogues trigger different responses in the plant. ω-Hydroxylation of the pentenyl side chain leads to the inactive 12-OH-JA-Ile (3) acting as a “stop” signal. On the other hand, a lactone derivative of 12-OH-JA (5) (jasmine ketolactone, JKL) occurs in nature, although with no known biological function. Inspired by the chemical structure of JKL (6) and in order to further explore the potential biological activities of 12-modified JA-Ile derivatives, we synthesized two macrolactones (JA-Ile-lactones (4a) and (4b)) derived from 12-OH-JA-Ile (3). The biological activity of (4a) and (4b) was tested for their ability to elicit nicotine production, a well-known jasmonate dependent secondary metabolite. Both macrolactones showed strong biological activity, inducing nicotine accumulation to a similar extent as methyl jasmonate does in Nicotiana attenuata leaves. Surprisingly, the highest nicotine contents were found in plants treated with the JA-Ile-lactone (4b), which has (3S,7S) configuration at the cyclopentanone not known from natural jasmonates. Macrolactone (4a) is a valuable standard to explore for its occurrence in nature. PMID:25806705

  6. The mealybug Phenacoccus solenopsis suppresses plant defense responses by manipulating JA-SA crosstalk

    PubMed Central

    Zhang, Peng-Jun; Huang, Fang; Zhang, Jin-Ming; Wei, Jia-Ning; Lu, Yao-Bin


    Induced plant defenses against herbivores are modulated by jasmonic acid-, salicylic acid-, and ethylene-signaling pathways. Although there is evidence that some pathogens suppress plant defenses by interfering with the crosstalk between different signaling pathways, such evidence is scarce for herbivores. Here, we demonstrate that the mealybug Phenacoccus solenopsis suppresses the induced defenses in tomato. We found that exogenous JA, but not SA, significantly decreased mealybug feeding time and reduced nymphal performance. In addition, constitutive activation of JA signaling in 35s::prosys plants reduced mealybug survival. These data indicate that the JA signaling pathway plays a key role in mediating the defense responses against P. solenopsis. We also found that mealybug feeding decreased JA production and JA-dependent defense gene expression, but increased SA accumulation and SA-dependent gene expression. In SA-deficient plants, mealybug feeding did not suppress but activated JA accumulation, indicating that the suppression of JA-regulated defenses depends on the SA signaling pathway. Mealybugs benefit from suppression of JA-regulated defenses by exhibiting enhanced nymphal performance. These findings confirm that P. solenopsis manipulates plants for its own benefits by modulating the JA-SA crosstalk and thereby suppressing induced defenses. PMID:25790868

  7. More than just great quotes: An introduction to the Canadian Tri-Council’s qualitative requirements

    PubMed Central

    Boffa, Jody; Moules, Nancy; Mayan, Maria; Cowie, Robert L


    Although at times misunderstood by the general research community, qualitative research has developed out of diverse, rich and complex philosophical traditions and theoretical paradigms. In the most recent Canadian Tri-Council policy statement on the ethical conduct of research involving humans, a chapter was devoted to a summary of methods and methodological requirements that characterize robust qualitative research, despite the diversity of approaches. To dispel common misperceptions about qualitative research and introduce the unfamiliar reader to these requirements, the work of a qualitative study on isoniazid preventive therapy for prophylaxis of tuberculosis published in AIDS is critiqued alongside each of the Tri-Council’s nine requirements. PMID:24421811

  8. Hanford and the Tri-Cities Economy: Historical Trends 1970-2008

    SciTech Connect

    Fowler, Richard A.; Scott, Michael J.


    This white paper examines the effect that the Hanford Site has had on the Tri-Cities economy from 1970-2008. Total area employment levels, population, and the real estate market are compared to DOE contractor employment and funding levels, which tended to follow each other until the mid-1990s. Since 1994, area employment, total incomes, population and the real estate market have increased significantly despite very little changes in Hanford employment levels. The data indicate that in recent history, the Tri-Cities economy has become increasingly independent of Hanford.

  9. Hanford and the tri-cities economy: Review and outlook, March 1989

    SciTech Connect

    Scott, M.J.; Belzer, D.B.; March, S.J.; Beck, D.M.; Schultz, R.W.; Harkreader, S.A.


    The economy of the Tri-Cities, Washington area (primarily, Benton and Franklin Counties) is in transition due to major changes in two Department of Energy programs at Hanford---the abrupt ending of the Basalt Waste Isolation Project (BWIP) in December 1987 and the placing of the N Reactor in ''cold standby'' status in February 1988. This report reviews the economic situation in the Tri-Cities during 1988 and presents forecasts for key economic indicators for 1989. This report will be updated about every six months to review the changes in the area economy and forecast the near-term outlook. 6 figs., 33 tabs.

  10. Wake structure of axial-flow hydrokinetic turbines in tri-frame arrangement

    NASA Astrophysics Data System (ADS)

    Chawdhary, Saurabh; Yang, Xiaolei; Hill, Craig; Khosronejad, Ali; Guala, Michele; Sotiropoulos, Fotis


    Marine and hydro-kinetic (MHK) energy hold promise for future of sustainable energy generation. Tri-frame of turbines, three turbines mounted on vertices of a triangle, are an effective way to build a power producing array of hydrokinetic turbines in marine environment. Large eddy simulation (LES) is used to simulate the flow past a tri-frame and characterize its wake. Full geometry of all three turbines in the tri-frame is resolved using the Curvilinear Immersed Boundary (CURVIB) method of Kang et al. (2011). High fidelity solution of flow field is obtained owing to the inclusion of detailed geometry of the turbines. Excellent agreement is obtained with the experiments conducted in a flume at Saint Anthony Falls Laboratory (SAFL). The wake evolution of the three turbines is compared to that of an isolated single turbine. The differences in wake dynamics are highlighted to elucidate the importance of turbine wake interaction in an array. The simulations indicate lower levels of TKE and lower levels of momentum deficit in the wake of the upstream turbine of tri-frame compared to the other turbines. Analysis of the far wake recovery is useful for the optimal MHK array design. This work was supported by NSF grant IIP-1318201. The simulations were carried out at the Minnesota Supercomputing Institute.

  11. The TRY Foundation: A Case Study in Private Community Development Organizations.

    ERIC Educational Resources Information Center

    McClure, Paul T.

    This is a case study of the TRY Foundation, a privately funded non-profit corporation devoting its resources to "community and human development in disadvantaged areas." Activities sponsored by its primate unit, the Willowbrook Chapter of Watts, Los Angeles, include: thrift shop, preventive dentistry clinic, Operation Vegetable Basket--which…

  12. "Just Try Harder and You Will Shine": A Study of 20 Lazy Children

    ERIC Educational Resources Information Center

    Gilmore, Linda; Boulton-Lewis, Gillian


    Attributions of laziness, reflected in teacher comments such as "Just try harder and you will shine", may mask specific cognitive, learning, attentional or emotional problems that could explain low motivation in some children. This paper reports findings from an investigation of 20 children, aged 7 to 10 years, who were regarded as lazy…

  13. Columbia Basin College Facts & Impacts: A Report to the Tri-Cities Community.

    ERIC Educational Resources Information Center

    Knutzen, Judi; LaGrange, Jill; Jones, Ty

    This fact book for Columbia Basin College (CBC) (Washington) covers seven subject areas: (1) mission statement; (2) access; (3) academics; (4) career and workforce development; (5) basic skills; (6) cultural enrichment; and (7) physical and emotional well-being. Report highlights include: (1) in 2001, CBC presented to the Tri-Cities community a…

  14. Investment in hydrogen tri-generation for wastewater treatment plants under uncertainties

    NASA Astrophysics Data System (ADS)

    Gharieh, Kaveh; Jafari, Mohsen A.; Guo, Qizhong


    In this article, we present a compound real option model for investment in hydrogen tri-generation and onsite hydrogen dispensing systems for a wastewater treatment plant under price and market uncertainties. The ultimate objective is to determine optimal timing and investment thresholds to exercise initial and subsequent options such that the total savings are maximized. Initial option includes investment in a 1.4 (MW) Molten Carbonate Fuel Cell (MCFC) fed by mixture of waste biogas from anaerobic digestion and natural gas, along with auxiliary equipment. Produced hydrogen in MCFC via internal reforming, is recovered from the exhaust gas stream using Pressure Swing Adsorption (PSA) purification technology. Therefore the expansion option includes investment in hydrogen compression, storage and dispensing (CSD) systems which creates additional revenue by selling hydrogen onsite in retail price. This work extends current state of investment modeling within the context of hydrogen tri-generation by considering: (i) Modular investment plan for hydrogen tri-generation and dispensing systems, (ii) Multiple sources of uncertainties along with more realistic probability distributions, (iii) Optimal operation of hydrogen tri-generation is considered, which results in realistic saving estimation.

  15. Trying Physics: Analyzing the Motion of the Quickest Score in International Rugby

    NASA Astrophysics Data System (ADS)

    Goff, John Eric; Lipscombe, Trevor Davis


    The hearts of sports fans were stirred recently by the fastest-ever try scored in international rugby. Welsh winger Dafydd Howells crossed the Fijian try line to score a mere six seconds after Angus O'Brien had started the game with a kickoff, in one of the fixtures in rugby's Junior World Cup played on June 2, 2014, in New Zealand. This startlingly quick score, though, is of interest to physics players as well as rugby players. Howells' try serves as an intriguing way to involve students in one of the "core competencies" of physicists—to model events in the real world. And with the Rugby World Cup taking place in 2015 in England, and rugby sevens making its debut in the 2016 Summer Olympics in Brazil (U.S. teams have qualified for both events), rugby is increasing in popularity in America and is even gaining some coverage on television. Thanks to You-Tube, Howells' try is readily available to serve as a laboratory experiment for students to analyze.

  16. Factors associated with BMI, weight perceptions and trying to lose weight in African-American smokers.

    PubMed Central

    Lee, Rebecca E.; Harris, Kari Jo; Catley, Delwyn; Shostrom, Valerie; Choi, Simon; Mayo, Matthew S.; Okuyemi, Kola; Kaur, Harsohena; Ahluwalia, Jasjit S.


    This study examined sociodemographic, behavioral and psychosocial factors associated with BMI, weight perceptions and trying to lose weight among African-American smokers (N=600, M=44.2 years, 70% female). Sixty-eight percent of the sample were overweight or obese (sample BMI M=28.0, SD=6.7). Three separate, simultaneous multivariable regression models were used to determine which factors were associated with BMI, weight perceptions and trying to lose weight. Poorer health, female gender and high-school education or higher were significantly associated with higher BMIs (p<0.05). Being female (OR=5.8, 95% CI=3.6-9.3) and having a higher BMI (OR=0.6, 95% CI=0.5-0.6) was associated with perception of overweight and smoking more cigarettes per day (OR=1.0, 95% CI=1.0-1.1), and perceiving oneself as overweight (OR=14.1, 95% CI=8.2-24.2) was associated with trying to lose weight. Participants somewhat underestimated their BMI in their weight perceptions. Those who perceived themselves as overweight were more likely to be trying to lose weight; therefore, increasing participant awareness of actual BMI status may lead to improved weight-control efforts in African-American smokers. Several expected associations with outcomes were not found, suggesting that BMI and weight constructs are not well-understood in this population. PMID:15719872

  17. Using Constructivist Career Development to Improve Career Decision Self-Efficacy in TRiO Students

    ERIC Educational Resources Information Center

    Grier-Reed, Tabitha; Ganuza, Zoila


    Although more high school graduates are attending college, many are not graduating (The Bill and Melinda Gates Foundation, 2004). First-generation, low-income, and underrepresented students are especially at risk for falling through the cracks. To help address this issue, programs such as TRiO Student Support Services (SSS) assist…

  18. Middle School Learners' Ontological "Trying-on" of Dimensions: A Phenomenological Investigation

    ERIC Educational Resources Information Center

    Valentine, Keri Duncan; Kopcha, Theodore J.


    This paper shares findings from a post-intentional phenomenological study aimed at understanding learners' experience investigating space and dimension concepts in a fifth and sixth grade mathematics class. Findings indicate experiences in this study manifest as an ontological "trying-on" of geometric dimensions (e.g., through…

  19. 77 FR 25080 - Safety Zones; TriMet Bridge Project, Willamette River, Portland, OR

    Federal Register 2010, 2011, 2012, 2013, 2014


    ...The Coast Guard is establishing safety zones encompassing the work trestles and construction cranes involved in the construction of the TriMet Bridge on the Willamette River, in Portland, OR. This action is necessary to ensure the safety of recreational vessels and commercial vessels transiting in close proximity to cranes and overhead work associated with this construction project. These......

  20. Challenges and Mental Health Experiences of Lesbian and Bisexual Women Who Are Trying to Conceive

    ERIC Educational Resources Information Center

    Yager, Christina; Brennan, David; Steele, Leah S.; Epstein, Rachel; Ross, Lori E.


    To date, there is little evidence to inform social work practice with lesbian and bisexual women who are trying to conceive (TTC). The authors report a preliminary examination of the mental health experiences of lesbian and bisexual women who are TTC, through a comparison with lesbian and bisexual women in the postpartum period (PP). Thirty-three…

  1. Metallic conductance at the interface of tri-color titanate superlattices

    SciTech Connect

    Kareev, M. Cao, Yanwei; Liu, Xiaoran; Middey, S.; Meyers, D.; Chakhalian, J.


    Ultra-thin tri-color (tri-layer) titanate superlattices ([3 u.c. LaTiO{sub 3}/2 u.c. SrTiO{sub 3}/3 u.c. YTiO{sub 3}], u.c. = unit cells) were grown in a layer-by-layer way on single crystal TbScO{sub 3} (110) substrates by pulsed laser deposition. High sample quality and electronic structure were characterized by the combination of in-situ photoelectron and ex-situ structure and surface morphology probes. Temperature-dependent sheet resistance indicates the presence of metallic interfaces in both [3 u.c. LaTiO{sub 3}/2 u.c. SrTiO{sub 3}] bi-layers and all the tri-color structures, whereas a [3 u.c. YTiO{sub 3}/2 u.c. SrTiO{sub 3}] bi-layer shows insulating behavior. Considering that in the bulk YTiO{sub 3} is ferromagnetic below 30 K, the tri-color titanate superlattices provide an opportunity to induce tunable spin-polarization into the two-dimensional electron gas with Mott carriers.

  2. A Theory of Institutional Change and Control: Tri-Partite Power. Revised.

    ERIC Educational Resources Information Center

    Shapiro, Arthur

    This paper describes the Tri-Partite Theory of institutional change, which proposes that organizations in general and educational institutions in particular pass through three phases, each dominated by a specific personality type: person-orientation (loyalty to a charismatic leader as the basis of motivation); plan-orientation (functions…

  3. Diversity of tri-functional histidine biosynthesis gene (his) in cereal Phaeosphaeria species

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The full length genomic sequences of tri-functional histidine biosynthesis (his) gene were obtained and compared from cereal Phaeosphaeria species by PCR amplification. The his gene coding sequence in wheat-biotype P. nodorum (PN-w) was 2697 bp in size. The his genes in barley-biotype P. nodorum (PN...

  4. 76. ARAII. After SL1 explosion, operators shielded crane cab try ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    76. ARA-II. After SL-1 explosion, operators shielded crane cab try to open door of SL-1 tank building. January 6, 1961. Ineel photo no. 61-80. Photographer: Holmes. - Idaho National Engineering Laboratory, Army Reactors Experimental Area, Scoville, Butte County, ID

  5. Traversing State Boundaries with Distance Education: The Tri-State Agricultural Distance Delivery Alliance.

    ERIC Educational Resources Information Center

    Anderson, Erik T.; Makus, Larry; Fanno, Wayne; Swan, Mike

    The Tri-State Agricultural Distance Delivery Alliance (TADDA) is a new distance education consortium. The three land grant universities in the Pacific Northwest (the University of Idaho, Oregon State University, and Washington State University) developed TADDA in cooperation with Eastern Oregon University and four of the region's community…

  6. Columbia Basin College Facts & Impacts: A Report to the Tri-Cities Community, 2000.

    ERIC Educational Resources Information Center

    Columbia Basin Coll., Pasco, WA.

    This booklet presents the 2000 Facts and Impacts report to the Tri-Cities community served by Columbia Basin College (CBC). It provides a snapshot of the college in the late 1990s. Following a message from CBC's president and a list of the members of the Board of Trustees, legislators (District 8), legislators (District 16), president, vice…

  7. Flexible inverted polymer solar cells with an indium-free tri-layer cathode

    SciTech Connect

    El Hajj, Ahmad; Lucas, Bruno Schirr-Bonnans, Martin; Ratier, Bernard; Kraft, Thomas M.; Torchio, Philippe


    Indium tin oxide (ITO)-free inverted polymer solar cells (PSCs) have been fabricated without the need of an additional electron transport layer. The indium-free transparent electrode consists of a tri-layer stack ZnO (30 nm)/Ag (14 nm)/ZnO (30 nm) deposited on glass and plastic substrates via ion-beam sputtering. The tri-layer electrodes exhibit similar physical properties to its ITO counterpart, specifically yielding high transmittance and low resistivity (76.5% T at 550 nm, R{sub sq} of 8 Ω/◻) on plastic substrates. The novel tri-layer electrode allows for the fabrication of inverted PSCs without the additional ZnO interfacial layer commonly deposited between ITO and the photoactive layer. This allows for the preparation of thinner plastic solar cells using less material than conventional architectures. Initial studies involving the newly realized architecture (tri-layer electrode/P3HT:PCBM/PEDOT:PSS/Ag) have shown great promise for the transition from ITO to other viable electrodes in organic electronics.

  8. Evaluation of tri-steps modified styrene-butadiene-styrene block copolymer membrane for wound dressing.


    Yang, Jen Ming; Huang, Huei Tsz


    Tri-steps modified styrene-butadiene-styrene block copolymer (SBS) membrane was prepared with epoxidation, ring opening reaction with maleated ionomer and layer-by-layer assembled polyelectrolyte technique. The tri-steps modified SBS membrane was characterized by infrared spectroscopy and X-ray photoelectron spectroscope (XPS). The structures of the modified SBS membranes were identified with methylene blue and azocarmine G. The content of amino group on the surface of the modified membrane was calculated from uptake of an acid dye. The values of the contact angle, water absorption, water vapor transmission rate and the adsorption of fibronectin on the membranes were determined. To evaluate the biocompatibility of the tri-steps modified SBS membrane, the cytotoxicity, antibacterial and growth profile of the cell culture of 3T3 fibroblasts on the membrane were evaluated. The bactericidal activity was found on the modified SBS. From the cell culture of 3T3 fibroblasts on the membrane, it revealed that the cells not only remained viable but also proliferated on the surface of the tri-steps modified SBS membranes. As the membranes are sterile semipermeable with bactericidal activity and transparent allowing wound checks, they can be considered for shallow wound with low exudates. PMID:24364963

  9. Bioprospecting for TRI101 in Fusarium: Searching for a Better Enzyme to Detoxify Deoxynivalenol (DON)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The mycotoxin deoxynivalenol (DON) is a common contaminant of wheat and barley in the United States. New strategies to mitigate the threat of DON need to be developed and implemented. Previous research has shown the value of an enzyme (TRI101) to modify DON and reduce its toxicity. Recent work by...

  10. The TriLab, a Novel ICT Based Triple Access Mode Laboratory Education Model

    ERIC Educational Resources Information Center

    Abdulwahed, Mahmoud; Nagy, Zoltan K.


    This paper introduces a novel model of laboratory education, namely the TriLab. The model is based on recent advances in ICT and implements a three access modes to the laboratory experience (virtual, hands-on and remote) in one software package. A review of the three modes is provided with highlights of advantages and disadvantages of each mode.…

  11. Making Mission Statements Operational: Perceptions of Principals from Tri-Association Schools

    ERIC Educational Resources Information Center

    Fayad, Juan David; Yoshida, Roland K.


    Researchers and theorists in the management and educational leadership fields have debated the importance of mission statements. This study investigated this issue within the context of American schools that are members of the Tri-Association (Mexico, Central America, Colombia, and the Caribbean). The results showed that about the same percentage…

  12. Tri-P-LETS: Changing the Face of High School Computer Science

    ERIC Educational Resources Information Center

    Sherrell, Linda; Malasri, Kriangsiri; Mills, David; Thomas, Allen; Greer, James


    From 2004-2007, the University of Memphis carried out the NSF-funded Tri-P-LETS (Three P Learning Environment for Teachers and Students) project to improve local high-school computer science curricula. The project reached a total of 58 classrooms in eleven high schools emphasizing problem solving skills, programming concepts as opposed to syntax,…

  13. Dynamics and coherence resonance of tri-stable energy harvesting system

    NASA Astrophysics Data System (ADS)

    Haitao, Li; Weiyang, Qin; Chunbo, Lan; Wangzheng, Deng; Zhiyong, Zhou


    To improve the efficiency of energy harvesting, this paper presents a tri-stable energy harvesting device, which can realize inter-well oscillation at low-frequency base excitation and obtain a high harvesting efficiency by tri-stable coherence resonance. First, the model of a magnetic coupling tri-stable piezoelectric energy harvester is established and the corresponding equations are derived. The formula for the magnetic repulsion force between three magnets is given. Then, the dynamic responses of a system subject to harmonic excitation and Gaussian white noise excitation are explored by a numerical method and validated by experiments. Compared with a bi-stable energy harvester, the threshold for inter-well oscillation to occur can be moved forward to the low frequency, and the tri-stable device can create a dense high output voltage and power at the low intensity of stochastic excitation. Results show that for a definite deterministic or stochastic excitation, the system can be optimally designed such that it increases the frequency bandwidth and achieves a high energy harvesting efficiency at coherence resonance.

  14. 78 FR 43971 - Amendment of Class E Airspace; Tri-Cities, TN

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... Class D and E airspace in the Tri-Cities, TN, area (78 FR 7993). The line defining the exclusion of...; (2) is not a ``significant rule'' under DOT Regulatory Policies and Procedures (44 FR 11034; February...: Authority: 49 U.S.C. 106(g); 40103, 40113, 40120; E.O. 10854, 24 FR 9565, 3 CFR, 1959-1963 Comp., p....

  15. A Tri-Reference Point Theory of Decision Making under Risk

    ERIC Educational Resources Information Center

    Wang, X. T.; Johnson, Joseph G.


    The tri-reference point (TRP) theory takes into account minimum requirements (MR), the status quo (SQ), and goals (G) in decision making under risk. The 3 reference points demarcate risky outcomes and risk perception into 4 functional regions: success (expected value of x greater than or equal to G), gain (SQ less than x less than G), loss (MR…


    EPA Science Inventory

    On November 12-13, 1999, Approximately 300 people attended the Delmarva Coastal Bays Conference III: Tri-State Approaches to Preserving Aquatic Resources (CBCIII). The conference was organized by the Assateague Coastal Trust with planning and financial assistance from twenty-one ...

  17. Youth Experience of Trying to Get off the Street: What Has Helped and Hindered

    ERIC Educational Resources Information Center

    Brown, Tracy L.; Amundson, Norman E.


    This qualitative study involved 20 youth (18 males, 1 female, 1 transgender, ages 19-24) living in Vancouver, British Columbia, who reported 259 critical incidents of what helped or hindered their experiences as they tried to get off the street. What helped included (a) taking responsibility, (b) engaging in constructive activities, (c) friends…

  18. Exciton Binding Energy in Organic-Inorganic Tri-Halide Perovskites.


    Askar, Abdelrahman M; Shankar, Karthik


    The recent dramatic increase in the power conversion efficiencies of organic-inorganic tri-halide perovskite solar cells has triggered intense research worldwide and created a paradigm shift in the photovoltaics field. It is crucial to develop a solid understanding of the photophysical processes underlying solar cell operation in order to both further improve the photovoltaic performance of perovskite solar cells as well as to exploit the broader optoelectronic applications of the tri-halide perovskites. In this short review, we summarize the main research findings about the binding energy of excitons in tri-halide perovskite materials and find that a value in the range of 2-22 meV at room temperature would be a safe estimate. Spontaneous free carrier generation is the dominant process taking place directly after photoexcitation in organic-inorganic tri-halide perovskites at room temperature, which eliminates the exciton diffusion bottleneck present in organic solar cells and constitutes a major contributing factor to the high photovoltaic performance of this material. PMID:27427650

  19. "How To Succeed in Business Without Really Trying." Spotlight on Theater Notes.

    ERIC Educational Resources Information Center

    Carr, John C.

    This booklet presents a variety of materials concerning the current revival of the 1961 play "How to Succeed in Business Without Really Trying." After a brief introduction to the play, the booklet discusses the plot of the play, how it went from best seller to prize-winning musical, biographical information on the lead actor (Matthew Broderick)…

  20. Coronary Heart Disease Knowledge and Risk Factors among Tri-Ethnic College Students

    ERIC Educational Resources Information Center

    Koutoubi, Samer; Huffman, Fatma G.; Ciccazzo, Michele W.; Himburg, Susan P.; Johnson, Paulette


    Objectives: Coronary heart disease (CHD) is the leading cause of death in the United States and Europe. This study identified and compared nutritional knowledge associated with CHD risk factors among tri-ethnic college students. Design: A quantitative, cross-sectional, observational study using questionnaires. Setting: University laboratory.…

  1. 77 FR 23409 - Toxics Release Inventory (TRI) Reporting for Facilities Located in Indian Country and...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... are located. In 1990, EPA finalized regulations in the Federal Register (FR) requiring facilities in Indian country to submit annual TRI reports to EPA and the appropriate tribal government (55 FR 30632... preambles to the proposed and final rules. Id.; 54 FR 12992 (March 29, 1989). These amendments,...

  2. Design of tri-level excitation signals for broadband bioimpedance spectroscopy.


    Yang, Yuxiang; Wang, Lianhuan; Wang, Peipei; Yang, Xiufang; Zhang, Fu; Wen, He; Teng, Zhaosheng


    Bioimpedance spectroscopy (BIS) measurement methods have been evolving from the traditional frequency-sweep approach to the multi-frequency simultaneous measurement technique which can drastically reduce measuring time and will be increasingly attractive for time-varying biological applications. Multi-frequency mixed (MFM) signals with sparsely distributed spectra are desirable for broadband BIS measurement. This paper proposes a synthesis method to design a series of tri-level MFM signals which contain only three values (+1, 0, -1), and has majority energy distributed on its (2(n))th primary harmonics. Tri-level MFM signals have both high energy efficiency and a low crest factor. An impedance measurement experiment excited by an 8th-order tri-level MFM signal on a RC three-element equivalent model has been performed, and the results on 8 primary harmonic frequencies ranging from 8 to 1024 kHz show a high accuracy with the mean amplitude relative error of 0.41% and mean phase absolute error of 0.18°, which has validated the feasibility of the tri-level MFM signals for broadband BIS measurement. PMID:26261063

  3. Biochemical, biophysical and IgE-epitope characterization of the wheat food allergen, Tri a 37.


    Pahr, Sandra; Selb, Regina; Weber, Milena; Focke-Tejkl, Margarete; Hofer, Gerhard; Dordić, Andela; Keller, Walter; Papadopoulos, Nikolaos G; Giavi, Stavroula; Mäkelä, Mika; Pelkonen, Anna; Niederberger, Verena; Vrtala, Susanne; Valenta, Rudolf


    Wheat is an important staple food and potent allergen source. Recently, we isolated a cDNA coding for wheat alpha-purothionin which is recognized by wheat food allergic patients at risk for severe wheat-induced allergy. The purpose of the present study was the biochemical, biophysical and IgE epitope characterization of recombinant alpha-purothionin. Synthetic genes coding for alpha-purothionin were expressed in a prokaryotic system using Escherichia coli and in a eukaryotic expression system based on baculovirus-infected Sf9-insect cells. Recombinant proteins were purified and characterized by SDS-PAGE, mass spectrometry, circular dichroism, chemical cross-linking and size exclusion chromatography. Five overlapping peptide were synthesized for epitope mapping. Alpha-purothionin-specific rabbit antibodies were raised to perform IgE-inhibition experiments and to study the resistance to digestion. The IgE reactivity of the proteins and peptides from ten wheat food allergic patients was studied in non-denaturing RAST-based binding assays. Alpha-purothionin was expressed in the prokaryotic (EcTri a 37) and in the eukaryotic system (BvTri a 37) as a soluble and monomeric protein. However, circular dichroism analysis revealed that EcTri a 37 was unfolded whereas BvTri a 37 was a folded protein. Both proteins showed comparable IgE-reactivity and the epitope mapping revealed the presence of sequential IgE epitopes in the N-terminal basic thionin domain (peptide1:KSCCRSTLGRNCYNLCRARGAQKLCAGVCR) and in the C-terminal acidic extension domain (peptide3:KGFPKLALESNSDEPDTIEYCNLGCRSSVC, peptide4:CNLGCRSSVCDYMVNAAADDEEMKLYVEN). Natural Tri a 37 was digested under gastric conditions but resistant to duodenal digestion. Immunization with EcTri a 37 induced IgG antibodies which recognized similar epitopes as IgE antibodies from allergic patients and inhibited allergic patients' IgE binding. Reactivity to Tri a 37 does not require a folded protein and the presence of sequential Ig

  4. Biochemical, Biophysical and IgE-Epitope Characterization of the Wheat Food Allergen, Tri a 37

    PubMed Central

    Pahr, Sandra; Selb, Regina; Weber, Milena; Focke-Tejkl, Margarete; Hofer, Gerhard; Dordić, Andela; Keller, Walter; Papadopoulos, Nikolaos G.; Giavi, Stavroula; Mäkelä, Mika; Pelkonen, Anna; Niederberger, Verena; Vrtala, Susanne; Valenta, Rudolf


    Wheat is an important staple food and potent allergen source. Recently, we isolated a cDNA coding for wheat alpha-purothionin which is recognized by wheat food allergic patients at risk for severe wheat-induced allergy. The purpose of the present study was the biochemical, biophysical and IgE epitope characterization of recombinant alpha-purothionin. Synthetic genes coding for alpha-purothionin were expressed in a prokaryotic system using Escherichia coli and in a eukaryotic expression system based on baculovirus-infected Sf9-insect cells. Recombinant proteins were purified and characterized by SDS-PAGE, mass spectrometry, circular dichroism, chemical cross-linking and size exclusion chromatography. Five overlapping peptid were synthesized for epitope mapping. Alpha-purothionin-specific rabbit antibodies were raised to perform IgE-inhibition experiments and to study the resistance to digestion. The IgE reactivity of the proteins and peptides from ten wheat food allergic patients was studied in non-denaturing RAST-based binding assays. Alpha-purothionin was expressed in the prokaryotic (EcTri a 37) and in the eukaryotic system (BvTri a 37) as a soluble and monomeric protein. However, circular dichroism analysis revealed that EcTri a 37 was unfolded whereas BvTri a 37 was a folded protein. Both proteins showed comparable IgE-reactivity and the epitope mapping revealed the presence of sequential IgE epitopes in the N-terminal basic thionin domain (peptide1:KSCCRSTLGRNCYNLCRARGAQKLCAGVCR) and in the C-terminal acidic extension domain (peptide3:KGFPKLALESNSDEPDTIEYCNLGCRSSVC, peptide4:CNLGCRSSVCDYMVNAAADDEEMKLYVEN). Natural Tri a 37 was digested under gastric conditions but resistant to duodenal digestion. Immunization with EcTri a 37 induced IgG antibodies which recognized similar epitopes as IgE antibodies from allergic patients and inhibited allergic patients' IgE binding. Reactivity to Tri a 37 does not require a folded protein and the presence of sequential Ig

  5. Shock initiation of the tri-amino-tri-nitro-benzene based explosive PBX 9502 cooled to -55 bold">°C

    NASA Astrophysics Data System (ADS)

    Gustavsen, Richard L.; Gehr, Russell J.; Bucholtz, Scott M.; Alcon, Robert R.; Bartram, Brian D.


    We report a series of shock initiation experiments on PBX 9502 cooled to -55 °C. PBX 9502 consists of 95% dry aminated tri-amino-tri-nitro-benzene (TATB) and 5% poly-chloro-trifluoro-ethylene5 (Kel-F 800) binder. PBX 9502 samples were shock initiated by projectile impact from a two stage gas gun. Buildup to detonation was measured with 10 or more particle velocity gauges embedded at different depths in the sample. Three shock wave trackers measured the position of the shock front with time. Particle velocity vs. time wave-profiles and coordinates for onset of detonation were obtained as a function of the impact stress or pressure. PBX 9502 sample temperatures were monitored using type-E thermocouples, two inside the sample and two on the sample surface. Additional thermocouples were mounted on other parts of the cooling apparatus. Wave profiles from embedded gauges are qualitatively similar to those observed at 23 °C. However, at -55 °C, PBX 9502 is much less sensitive than at 23 °C. For example, at an inpact stress of 15.4 GPa, the distance to detonation at -55 °C is 7.8 mm. At 23 °C, the distance is 4.3 mm.

  6. Quantification of Tri5 gene, expression, and deoxynivalenol production during the malting of barley.


    Vegi, Anuradha; Schwarz, Paul; Wolf-Hall, Charlene E


    Fusarium can survive, grow, and produce mycotoxins during malting. We evaluated the percentage of barley kernels infected with Fusarium (FI) and deoxynivalenol (DON) concentration in three barley treatments (high-quality, naturally infected, and Fusarium graminearum inoculated barley) during various stages of malting. We also applied real-time polymerase chain reaction (real-time PCR) and real-time reverse transcriptase PCR (real-time RT-PCR) methods to quantify trichothecene-producing (Tri5) DNA concentration and expression, respectively. We observed that FI significantly (P<0.05) increased during the germination stage of malting in all barley treatments. Temperatures of 49°C and higher during kilning reduced the FI in high-quality barley treatments, but for inoculated treatments temperatures in excess of 60°C were needed to reduce FI. The Tri5 DNA concentration ranged from non-detectable to 3.9 ng/50mg, 0.1 to 109.8 ng/50mg and 3.4 to 397.5 ng/50 mg in malted high-quality, inoculated and naturally infected barley treatments respectively. Strong gene expression (Tri5) in naturally infected barley treatments was found during the third day of germination, when compared to high-quality and inoculated barley treatments during malting. Deoxynivalenol was present even at high kilning temperatures, as DON is heat stable. The average DON concentration ranged from non-detectable to 0.1 μg/g, non-detectable to 1.1 μg/g, and 1.5 to 45.9 μg/g during various stages of malting in high-quality, inoculated and infected barley and malt samples respectively. Overall, the last 2 days of germination and initial stages of kilning were peak stages for FI, Tri5 gene production, Tri5 gene expression and DON production. PMID:21871683

  7. High Performance Computing for Dsm Extraction from ZY-3 Tri-Stereo Imagery

    NASA Astrophysics Data System (ADS)

    Lu, Shuning; Huang, Shicun; Pan, Zhiqiang; Deng, Huawu; Stanley, David; Xin, Yubin


    ZY-3 has been acquiring high quality imagery since its launch in 2012 and its tri-stereo (three-view or three-line-array) imagery has become one of the top choices for extracting DSM (Digital Surface Model) products in China over the past few years. The ZY-3 tri-stereo sensors offer users the ability to capture imagery over large regions including an entire territory of a country, such as China, resulting in a large volume of ZY-3 tri-stereo scenes which require timely (e.g., near real time) processing, something that is not currently possible using traditional photogrammetry workstations. This paper presents a high performance computing solution which can efficiently and automatically extract DSM products from ZY-3 tri-stereo imagery. The high performance computing solution leverages certain parallel computing technologies to accelerate computation within an individual scene and then deploys a distributed computing technology to increase the overall data throughput in a robust and efficient manner. By taking advantage of the inherent efficiencies within the high performance computing environment, the DSM extraction process can exploit all combinations offered from a set of tri-stereo images (forward-backword, forward-nadir and backword-nadir). The DSM results merged from all of the potential combinations can minimize blunders (e.g., incorrect matches) and also offer the ability to remove potential occlusions which may exist in a single stereo pair, resulting in improved accuracy and quality versus those that are not merged. Accelerated performance is inherent within each of the individual steps of the DSM extraction workflow, including the collection of ground control points and tie points, image bundle adjustment, the creation of epipolar images, and computing elevations. Preliminary experiments over a large area in China have proven that the high performance computing system can generate high quality and accurate DSM products in a rapid manner.

  8. Male injection drug users try new drugs following U.S. deportation to Tijuana, Mexico

    PubMed Central

    Robertson, Angela M.; Rangel, M. Gudelia; Lozada, Remedios; Vera, Alicia; Ojeda, Victoria D.


    Background Among male injection drug users (IDUs) in Tijuana, Mexico, U.S. deportation is associated with HIV transmission. Changing drug use behaviors following deportation, including the use of new drugs, may increase HIV risk but are understudied. We identify correlates of trying new drugs following male IDUs’ most recent U.S. deportation to Mexico. Methods In 2010, we recruited 328 deported male IDUs in Tijuana, Mexico. Questionnaires collected retrospective data on drug use and other HIV risk behaviors throughout migratory events. Logistic regression identified correlates of trying new drugs/combinations following their most recent deportations. Informed consent was obtained from all participants. Results Nearly one in six men (n=52, 16%) tried new drugs following their most recent deportation, including heroin (n=31), methamphetamine (n=5), and heroin/methamphetamine combined (n=17). Trying new drugs following deportation was independently associated with U.S. incarceration (adjusted odds ratio [AOR]= 3.96; 95% confidence interval [C.I.] 1.78, 8.84), increasing numbers of U.S. deportations (AOR=1.11 per deportation; C.I. 1.03, 1.20), feeling sad following deportation (AOR 2.69; C.I. 1.41, 5.14), and perceiving that one’s current lifestyle increases HIV/AIDS risk (AOR 3.91; C.I. 2.05, 7.44). Conclusions Trying new drugs following U.S. deportation may be related to the unique contexts and stressors experienced by drug-abusing migrants as they attempt to reestablish their lives in Mexico. Findings imply an unmet need for health and social programs to alleviate pre-and post-deportation stressors faced by undocumented and return migrants in the U.S.-Mexico context. PMID:21835559

  9. Crystal structures of three complexes of zinc chloride with tri-tert-butyl­phosphane

    PubMed Central

    Finke, Aaron D.; Gray, Danielle L.; Moore, Jeffrey S.


    Under anhydrous conditions and in the absence of a Lewis-base solvent, a zinc chloride complex with tri-tert-butyl­phosphane as the μ-bridged dimer is formed, viz. di-μ-chlorido-bis­[chlorido­bis­(tri-tert-butyl­phosphane)zinc], [ZnCl4(C12H27P)2], (1), which features a nearly square-shaped (ZnCl)2 cyclic core and whose Cl atoms inter­act weakly with C—H groups on the phosphane ligand. In the presence of THF, monomeric di­chlorido­(tetra­hydro­furan-κO)(tri-tert-butyl­phosphane-κP)zinc, [ZnCl2(C4H8O)(C12H27P)] or [P(tBu3)(THF)ZnCl2], (2), is formed. This slightly distorted tetra­hedral Zn complex has weak C—H⋯Cl inter­actions between the Cl atoms and phosphane and THF C—H groups. Under ambient conditions, the hydrolysed complex tri-tert-butyl­phospho­nium aqua­tri­chlorido­zincate 1,2-di­chloro­ethane monosolvate, (C12H28P)[ZnCl3(H2O)]·C2H4Cl2 or [HPtBu3]+ [(H2O)ZnCl3]−·C2H4Cl2, (3), is formed. This complex forms chains of [(H2O)ZnCl3]− anions from hydrogen-bonding inter­actions between the water H atoms and Cl atoms that propagate along the b axis. PMID:26870580

  10. Crystal structures of three complexes of zinc chloride with tri-tert-butyl-phosphane.


    Finke, Aaron D; Gray, Danielle L; Moore, Jeffrey S


    Under anhydrous conditions and in the absence of a Lewis-base solvent, a zinc chloride complex with tri-tert-butyl-phosphane as the μ-bridged dimer is formed, viz. di-μ-chlorido-bis-[chlorido-bis-(tri-tert-butyl-phosphane)zinc], [ZnCl4(C12H27P)2], (1), which features a nearly square-shaped (ZnCl)2 cyclic core and whose Cl atoms inter-act weakly with C-H groups on the phosphane ligand. In the presence of THF, monomeric di-chlorido-(tetra-hydro-furan-κO)(tri-tert-butyl-phosphane-κP)zinc, [ZnCl2(C4H8O)(C12H27P)] or [P(tBu3)(THF)ZnCl2], (2), is formed. This slightly distorted tetra-hedral Zn complex has weak C-H⋯Cl inter-actions between the Cl atoms and phosphane and THF C-H groups. Under ambient conditions, the hydrolysed complex tri-tert-butyl-phospho-nium aqua-tri-chlorido-zincate 1,2-di-chloro-ethane monosolvate, (C12H28P)[ZnCl3(H2O)]·C2H4Cl2 or [HPtBu3](+) [(H2O)ZnCl3](-)·C2H4Cl2, (3), is formed. This complex forms chains of [(H2O)ZnCl3](-) anions from hydrogen-bonding inter-actions between the water H atoms and Cl atoms that propagate along the b axis. PMID:26870580

  11. Fusarium Tri4 encodes a key multifunctional cytochrome P450 monooxygenase for four consecutive oxygenation steps in trichothecene biosynthesis

    SciTech Connect

    Tokai, Takeshi; Koshino, Hiroyuki; Takahashi-Ando, Naoko; Sato, Masayuki; Fujimura, Makoto; Kimura, Makoto . E-mail:


    Fusarium Tri4 encodes a cytochrome P450 monooxygenase (CYP) for hydroxylation at C-2 of First committed intermediate trichodiene (TDN) in the biosynthesis of trichothecenes. To examine whether this CYP further participates in subsequent oxygenation steps leading to isotrichotriol (4), we engineered Saccharomyces cerevisiae for de novo production of the early intermediates by introducing cDNAs of Fusarium graminearum Tri5 (FgTri5 encoding TDN synthase) and Tri4 (FgTri4). From a culture of the engineered yeast grown on induction medium (final pH 2.7), we identified two intermediates, 2{alpha}-hydroxytrichodiene (1) and 12,13-epoxy-9,10-trichoene-2{alpha}-ol (2), and a small amount of non-Fusarium trichothecene 12,13-epoxytrichothec-9-ene (EPT). Other intermediates isotrichodiol (3) and 4 were identified in the transgenic yeasts grown on phosphate-buffered induction medium (final pH 5.5-6.0). When Trichothecium roseum Tri4 (TrTri4) was used in place of FgTri4, 4 was not detected in the culture. The three intermediates, 1, 2, and 3, were converted to 4,15-diacetylnivalenol (4,15-diANIV) when fed to a toxin-deficient mutant of F. graminearum with the FgTri4 {sup +} genetic background (viz., by introducing a FgTri5 {sup -} mutation), but were not metabolized by an FgTri4 {sup -} mutant. These results provide unambiguous evidence that FgTri4 encodes a multifunctional CYP for epoxidation at C-12,13, hydroxylation at C-11, and hydroxylation at C-3 in addition to hydroxylation at C-2.

  12. Characteristics of smokers who have never tried to quit: evidence from the British Opinions and Lifestyle Survey

    PubMed Central


    Background An understanding of the characteristics of smokers who have never tried to quit may be useful to help identify and target these individuals and encourage them to attempt to give up smoking. Using national survey data we investigated variables associated with smokers reporting never having tried to quit. Methods Using data from the 2007 and 2009 UK Office for National Statistics Opinions and Lifestyle Survey we identified all self-reported current smokers aged 16+. The primary outcome was response to the question ‘have you ever tried to quit smoking?’ Univariable and multivariable logistic regression quantified the association between this outcome and several potential explanatory variables, including age, sex, socioeconomic status, health status, smoking behaviour, and knowledge of the dangers of smoking. Results Desire to quit was the most significant independent predictor of whether a smoker reported never having tried to quit. Smokers who reported that their health was good or very good were more likely to report never having tried to quit than those whose health was fair, bad or very bad (OR 1.59, 95% CI 1.05-2.41). Smokers who reported that no family members, friends or colleagues had been trying to get them to quit smoking in the last year were more likely to report never having tried to quit than those who reported that someone was trying to persuade them (OR 1.57, 95% CI 1.09-2.28). Smokers who hadn’t received any cessation advice from a health professional in the last five years which they considered to be helpful were also more likely to report never having tried to quit. Conclusions Smokers who do not want to quit, who are in good health, whose friends and family are not trying to get them to quit, and who do not report receiving helpful advice to quit from a health professional, are more likely to report never having tried to quit. PMID:24721488

  13. NASA Marshall Space Flight Center Tri-gas Thruster Performance Characterization

    NASA Technical Reports Server (NTRS)

    Dorado, Vanessa; Grunder, Zachary; Schaefer, Bryce; Sung, Meagan; Pedersen, Kevin


    Historically, spacecraft reaction control systems have primarily utilized cold gas thrusters because of their inherent simplicity and reliability. However, cold gas thrusters typically have a low specific impulse. It has been determined that a higher specific impulse can be achieved by passing a monopropellant fluid mixture through a catalyst bed prior to expulsion through the thruster nozzle. This research analyzes the potential efficiency improvements from using tri-gas, a mixture of hydrogen, oxygen, and an inert gas, which in this case is helium. Passing tri-gas through a catalyst causes the hydrogen and oxygen to react and form water vapor, ultimately heating the exiting fluid and generating a higher specific impulse. The goal of this project was to optimize the thruster performance by characterizing the effects of varying several system components including catalyst types, catalyst lengths, and initial catalyst temperatures.

  14. Elastic behavior of methyltrimethoxysilane based aerogels reinforced with tri-isocyanate.


    Nguyen, Bao Chau N; Meador, Mary Ann B; Medoro, Alexandra; Arendt, Victoria; Randall, Jason; McCorkle, Linda; Shonkwiler, Brian


    The elastic properties and/or flexibility of polymer reinforced silica aerogels having methyltrimethoxysilane (MTMS) and bis(trimethoxysilylpropyl)amine (BTMSPA) making up the silica structure are examined. The dipropylamine spacer from BTMSPA is used both to provide a flexible linking group in the silica structure, and as a reactive site via its secondary amine for reaction with a tri-isocyanate, Desmodur N3300A. The tri-isocyanate provides an extended degree of branching or reinforcement, resulting in increased compressive strength of the aerogel monoliths while the overall flexibility arising from the underlying silica structure is maintained. The compressive moduli of the reinforced aerogel monoliths in this study range from 0.001 to 158 MPa. Interestingly, formulations across this entire range of modulus recover nearly all of their length after two compressions to 25% strain. Differences in pore structure of the aerogels due to processing conditions and solvent are also discussed. PMID:20426430

  15. Contribution of the Type II Chaperonin, TRiC/CCT, to Oncogenesis

    PubMed Central

    Roh, Soung-Hun; Kasembeli, Moses; Bakthavatsalam, Deenadayalan; Chiu, Wah; Tweardy, David J.


    The folding of newly synthesized proteins and the maintenance of pre-existing proteins are essential in sustaining a living cell. A network of molecular chaperones tightly guides the folding, intracellular localization, and proteolytic turnover of proteins. Many of the key regulators of cell growth and differentiation have been identified as clients of molecular chaperones, which implies that chaperones are potential mediators of oncogenesis. In this review, we briefly provide an overview of the role of chaperones, including HSP70 and HSP90, in cancer. We further summarize and highlight the emerging the role of chaperonin TRiC (T-complex protein-1 ring complex, also known as CCT) in the development and progression of cancer mediated through its critical interactions with oncogenic clients that modulate growth deregulation, apoptosis, and genome instability in cancer cells. Elucidation of how TRiC modulates the folding and function of oncogenic clients will provide strategies for developing novel cancer therapies. PMID:26561808

  16. Tri-Gate Normally-Off GaN Power MISFET

    SciTech Connect

    Lu, B; Matioli, E; Palacios, T


    We present a new normally-off GaN transistor-the tri-gate normally-off GaN metal-insulator-semiconductor field-effect transistor (MISFET). Due to the excellent channel control of a new 3-D gate structure, a breakdown voltage of 565 V has been achieved at a drain leakage current of 0.6 mu A/mm and V-gs = 0. The new device has an on/off current ratio of more than eight orders of magnitude and a subthreshold slope of 86 +/- 9 mV/decade. The threshold voltage of the new device is 0.80 +/- 0.06 V with a maximum drain current of 530 mA/mm. These results confirm the great potential of the tri-gate normally-off GaN-on-Si MISFETs for the next generation of power electronics.

  17. Three-dimensional shape measurement of small object based on tri-frequency heterodyne method

    NASA Astrophysics Data System (ADS)

    Liu, Shouqi; Feng, Wei; Zhang, Qican; Liu, Yuankun


    Among temporal phase unwrapping methods based on structured light projection, tri-frequency heterodyne method, with the merits of less projected fringe, high precision and high reliability, has become a practical method in objects three-dimensional (3D) shape measurement. In this paper, a 3D shape measuring system was developed with a digital micromirror device (DMD) and synchronously trigged CCD camera. The 3D shape of a measured object was reconstructed from the deformed fringe patterns based on tri-frequency heterodyne method. The practical experiments were carried on some coins, and the results show that the system can restore their 3D shape on the tested partition with an accuracy of microns. This measurement system is prominent in 3D shape measurement of small or tiny objects, sample testing, and many other application fields.

  18. The growth and crystallography of bismuth tri-iodide crystals grown by vapor transport

    SciTech Connect

    Nason, D.; Keller, L.


    A single crystal of bismuth tri-iodide (BiI{sub 3}) of dimensions 1.2 {times} 1.2 {times} 0.4 cm{sup 3} has been grown by physical vapor transport. The lattice parameters of the hexagonal crystal and its polycrystaleme powder precursor were measured by x-ray diffraction (XRD) and were in agreement, indicating that the vapor phase growth and sublimation purification processing at temperatures below 330{degree}C did not significantly affect the stoichiometry. X-ray rocking measurements of the single crystal showed low angle boundaries of the order of 0.05{degree}. In tests as gamma radiation detectors, neither melt grown nor vapor grown crystals were satisfactory, but the vapor grown crystals were promising. Several observations suggest that better performance may be achievable with purer bismuth tri-iodide.

  19. Toxic Release Inventory (TRI), Pennsylvania, 1989 (in Macintosh Excel format) (for microcomputers). Data file

    SciTech Connect

    Not Available


    The Toxic Chemical Release Inventory (TRI) data on diskette includes (1) the names, addresses, counties, and public contacts of facilities manufacturing, processing or using the reported chemicals; (2) the SIC code for the plants; (3) the chemical involved; and (4) the estimated quantity emitted into the air (point and non-point emissions), discharged into bodies of water, injected underground, released to land, or released to publicly owned treatment works. All releases are in pounds per year.

  20. Quantum nature of ROT and TRI asymmetries in the ternary fission of nuclei

    NASA Astrophysics Data System (ADS)

    Bunakov, V. E.; Kadmensky, S. G.; Kadmensky, S. S.


    Effects of T-odd asymmetry in ternary-nuclear-fission reactions induced by polarized cold neutrons are considered within quantum theory. It is shown that the asymmetry coefficient can be expressed in terms of experimental angular distributions of third particles in reactions induced by unpolarized neutrons. The explicit form of this coefficient makes it possible to explain the difference in the magnitudes and signs of the TRI and ROT effects observed experimentally for different targets.

  1. The tri-Hamiltonian dual system of supersymmetric two boson system

    NASA Astrophysics Data System (ADS)

    Zhang, Mengxia; Tian, Kai; Zhang, Lei


    The dual system of the supersymmetric two boson system is constructed through the approach of tri-Hamiltonian duality, and inferred from this duality, its zero-curvature representation is also figured out. Furthermore, the dual system is shown to be equivalent to a N = 2 supersymmetric Camassa-Holm equation, and this relation results in a new linear spectral problem for the N = 2 supersymmetric Camassa-Holm equation.

  2. 76 FR 53054 - Safety Zone; TriMet Bridge Project, Willamette River; Portland, OR

    Federal Register 2010, 2011, 2012, 2013, 2014


    ...The U.S. Coast Guard will establish a safety zone during the construction of the TriMet Bridge on the Willamette River, in Portland, OR. This action is necessary to ensure the safety of recreational vessels and commercial vessels transiting in close proximity to cranes and overhead work associated with this construction project. During the enforcement period, all vessels will be required to......

  3. Ligands with an NPNPN-framework and their application in chromium catalysed ethene tri-/tetramerization.


    Peulecke, N; Müller, B H; Spannenberg, A; Höhne, M; Rosenthal, U; Wöhl, A; Müller, W; Alqahtani, A; Al Hazmi, M


    Novel Cr(iii) catalysts supported by linear phosph(iii)azanes of the type R(1)R(2)N-P(Ph)-NR(3)-P(Ph)-NR(4)R(5) have been prepared, all of which, upon activation with MMAO-3A, are highly active for ethene tri-/tetramerization with considerable selectivity. The effect of ligand substitution as well as solvent on the catalytic performance has been examined. PMID:27151679

  4. Crystal structures of three 3,4,5-tri-meth-oxy-benzamide-based derivatives.


    Gomes, Ligia R; Low, John Nicolson; Oliveira, Catarina; Cagide, Fernando; Borges, Fernanda


    The crystal structures of three benzamide derivatives, viz. N-(6-hy-droxy-hex-yl)-3,4,5-tri-meth-oxy-benzamide, C16H25NO5, (1), N-(6-anilinohex-yl)-3,4,5-tri-meth-oxy-benzamide, C22H30N2O4, (2), and N-(6,6-di-eth-oxy-hex-yl)-3,4,5-tri-meth-oxy-benzamide, C20H33NO6, (3), are described. These compounds differ only in the substituent at the end of the hexyl chain and the nature of these substituents determines the differences in hydrogen bonding between the mol-ecules. In each mol-ecule, the m-meth-oxy substituents are virtually coplanar with the benzyl ring, while the p-meth-oxy substituent is almost perpendicular. The carbonyl O atom of the amide rotamer is trans related with the amidic H atom. In each structure, the benzamide N-H donor group and O acceptor atoms link the mol-ecules into C(4) chains. In 1, a terminal -OH group links the mol-ecules into a C(3) chain and the combined effect of the C(4) and C(3) chains is a ribbon made up of screw related R 2 (2)(17) rings in which the ⋯O-H⋯ chain lies in the centre of the ribbon and the tri-meth-oxy-benzyl groups forms the edges. In 2, the combination of the benzamide C(4) chain and the hydrogen bond formed by the terminal N-H group to an O atom of the 4-meth-oxy group link the mol-ecules into a chain of R 2 (2)(17) rings. In 3, the mol-ecules are linked only by C(4) chains. PMID:27308017

  5. Ambipolar Organic Tri-Gate Transistor for Low-Power Complementary Electronics.


    Torricelli, Fabrizio; Ghittorelli, Matteo; Smits, Edsger C P; Roelofs, Christian W S; Janssen, René A J; Gelinck, Gerwin H; Kovács-Vajna, Zsolt M; Cantatore, Eugenio


    Ambipolar transistors typically suffer from large off-current inherently due to ambipolar conduction. Using a tri-gate transistor it is shown that it is possible to electrostatically switch ambipolar polymer transistors from ambipolar to unipolar mode. In unipolar mode, symmetric characteristics with an on/off current ratio of larger than 10(5) are obtained. This enables easy integration into low-power complementary logic and volatile electronic memories. PMID:26573767

  6. Operator Interface and Control Software for the Reconfigurable Surface System Tri-ATHLETE

    NASA Technical Reports Server (NTRS)

    Norris, Jeffrey S.; Vona, Marsette A.; Rus, Daniela


    Graphical operator interface methods have been developed for modular, reconfigurable articulated surface systems in general, and a specific instantiation thereof for JPL's Tri-ATHLETE. The All- Terrain Hex-Limbed Extra-Terrestrial Explorer Robot (ATHLETE) has six limbs with six kinematic degrees of freedom each. The core advancement of this work was the development of a novel set of algorithms for dynamically maintaining a reduced coordinate model of any connected assembly of robot modules.

  7. The architecture of the spliceosomal U4/U6.U5 tri-snRNP

    PubMed Central

    Nguyen, Thi Hoang Duong; Galej, Wojciech P.; Bai, Xiao-chen; Savva, Christos G.; Newman, Andrew J.; Scheres, Sjors H. W.; Nagai, Kiyoshi


    U4/U6.U5 tri-snRNP is a 1.5 MDa pre-assembled spliceosomal complex comprising U5 snRNA, extensively base-paired U4/U6 snRNAs and >30 proteins, including the key components Prp8, Brr2 and Snu114. The tri-snRNP combines with a pre-mRNA substrate bound to U1 and U2 snRNPs and transforms into a catalytically active spliceosome following extensive compositional and conformational changes triggered by unwinding of the U4/U6 snRNAs. CryoEM single-particle reconstruction of yeast tri-snRNP at 5.9Å resolution reveals the essentially complete organization of its RNA and protein components. The single-stranded region of U4 snRNA between its 3′-stem-loop and the U4/U6 snRNA stem I is loaded into the Brr2 helicase active site ready for unwinding. Snu114 and the N-terminal domain of Prp8 position U5 snRNA to insert its Loop I, which aligns the exons for splicing, into the Prp8 active site cavity. The structure provides crucial insights into the activation process and the active site of the spliceosome. PMID:26106855

  8. Close-in blasting at the TRI-MET light rail tunnels in Portland, Oregon

    SciTech Connect

    Revey, G.F.; Painter, D.Z.


    Frontier/Traylor Joint Venture is presently constructing a section of the Tri-County Metropolitan Transit District of Oregon`s (TRI-MET) Westside Light Rail System. This new section will extend Portland`s existing transit system to the western suburbs of Beaverton and Hillsboro. The drill-blast excavations at this project include 10,000 feet of 20 foot tunnel, 18 cross passages, three shafts, an underground railway station, and a U-wall open cut. From a blast designer`s perspective, this job has been extremely challenging. Blast vibration is limited to 0.5 ips at 200 feet or at the nearest structure, and airblast is limited to 129 dB--linear peak and 96 dB--C scale. The tunnels pass under heavily built up areas and have top of tunnel to surface cover distances as low as 70 feet. Surface blasting in the 26,000 cubic yard U-wall excavation was limited to five short nighttime periods due to its proximity to the very busy highway 26. This paper describes the techniques that were used to develop safe blasting designs for the TRI-MET Surface blasts and tunnel rounds. It also discusses the measures that were necessary to mitigate noise, vibration, and flyrock.

  9. The Targeted Reading Intervention (TRI): A Classroom Teacher Tier 2 Intervention to Help Struggling Readers in Early Elementary School

    ERIC Educational Resources Information Center

    Vernon-Feagans, Lynne; Amendum, Steve; Kainz, Kirsten; Ginsburg, Marnie


    The two studies presented in this report were designed to test the effectiveness of a new diagnostic-based reading intervention for classroom teachers, called the Targeted Reading Intervention (TRI). This TRI Tier 2 intervention stressed diagnostic teaching as the key to helping struggling readers make rapid progress in reading in the regular…

  10. Plasma immersion ion implantation for sub-22 nm node devices: FD-SOI and Tri-Gate

    SciTech Connect

    Duchaine, J.; Milesi, F.; Coquand, R.; Barraud, S.; Reboh, S.; Gonzatti, F.; Mazen, F.; Torregrosa, Frank


    Here, we present and discuss the electrical characteristics of fully depleted MOSFET transistors of planar and tridimensional architecture, doped by Plasma Immersion Ion Implantation (PIII) or Beam Line Ion Implantation (BLII). Both techniques delivered similar and satisfactory results in considering the planar architecture. For tri-dimensional Tri-Gate transistors, the results obtained with PIII are superior.

  11. 33 CFR 165.T13-209 - Safety Zones; TriMet Bridge Project, Willamette River; Portland, OR.

    Code of Federal Regulations, 2014 CFR


    ... 33 Navigation and Navigable Waters 2 2014-07-01 2014-07-01 false Safety Zones; TriMet Bridge... Coast Guard District § 165.T13-209 Safety Zones; TriMet Bridge Project, Willamette River; Portland, OR.... In accordance with the general regulations in 33 CFR Part 165, Subpart C, no vessel operator...

  12. 33 CFR 165.T13-209 - Safety Zones; TriMet Bridge Project, Willamette River; Portland, OR.

    Code of Federal Regulations, 2012 CFR


    ... 33 Navigation and Navigable Waters 2 2012-07-01 2012-07-01 false Safety Zones; TriMet Bridge... Coast Guard District § 165.T13-209 Safety Zones; TriMet Bridge Project, Willamette River; Portland, OR.... In accordance with the general regulations in 33 CFR Part 165, Subpart C, no vessel operator...

  13. 75 FR 24799 - Safety Zone; Tri-City Water Follies Hydroplane Races Practice Sessions, Columbia River, Kennewick...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... SECURITY Coast Guard 33 CFR Part 165 RIN 1625-AA00 Safety Zone; Tri-City Water Follies Hydroplane Races..., Washington for hydroplane race practice sessions being held in preparation for the Tri-City Water Follies... provide for the safety of life and property on navigable waters. Under 5 U.S.C. 553(d)(3), the Coast...

  14. Mexican American First-Generation/Low-Income Students: A Rural Community College, TRiO Student Support Services Experience

    ERIC Educational Resources Information Center

    O'Meara, Daniel J.


    This study is an ethnographic inquiry into the beliefs and perceptions of first-generation/low-income Mexican American students in a rural community college located near the U.S.-Mexico border. It explored their experiences as TRiO Student Support Services participants. TRiO Student Support Services plays an increasingly vital role helping…

  15. The Training and Research Institute for Residential Youth Centers, Inc. (TRI-RYC). Final Report, 1969-1970.

    ERIC Educational Resources Information Center

    Training and Research Inst. for Residential Youth Centers, Inc., New Haven, CT.

    This report describes and details the experiences of the Training and Research Institute for Residential Youth Centers (TRI-RYC) during its first year of operation. The TRI-RYC was established by the Department of Labor, Office of Special Manpower Programs, to provide a capability for initiating, training staff for, and evaluating the…

  16. 78 FR 17652 - Tri-State Generation and Transmission Association, Inc. v. Public Service Company of New Mexico...

    Federal Register 2010, 2011, 2012, 2013, 2014


    ... From the Federal Register Online via the Government Publishing Office DEPARTMENT OF ENERGY Federal Energy Regulatory Commission Tri-State Generation and Transmission Association, Inc. v. Public Service... Energy Regulatory Commission (Commission), 18 CFR 385.206 and 18 CFR 385.212, Tri-State Generation...

  17. Maize MeJA-responsive proteins identified by high-resolution 2-DE PAGE.


    Zhang, Yuliang; Pennerman, Kayla K; Yang, Fengshan; Yin, Guohua


    Exogenous methyl jasmonate (MeJA) is well-known to induce plant defense mechanisms effective against a wide variety of insect and microbial pests. High-resolution 2-DE gel electrophoresis was used to discover changes in the leaf proteome of maize exposed to MeJA. We sequenced 62 MeJA-responsive proteins by tandem mass spectroscopy, and deposited the mass spectra and identities in the EMBL-EBI PRIDE repository under reference number PXD001793. An analysis and discussion of the identified proteins in relation to maize defense against Asian corn borer is published by Zhang et al. (2015) [1]. PMID:26509185

  18. First analysis of eight Algol-type systems: V537 And, GS Boo, AM CrB, V1298 Her, EL Lyn, FW Per, RU Tri, and WW Tri

    NASA Astrophysics Data System (ADS)

    Zasche, P.


    Analyzing available photometry from the Super WASP and other databases, we performed the very first light curve analysis of eight eclipsing binary systems V537 And, GS Boo, AM CrB, V1298 Her, EL Lyn, FW Per, RU Tri, and WW Tri. All of these systems were found to be detached ones of Algol-type, having the orbital periods of the order of days. 722 new times of minima for these binaries were derived and presented, trying to identify the period variations caused by the third bodies in these systems.

  19. Mutations in jasmonoyl-L-isoleucine-12-hydroxylases suppress multiple JA-dependent wound responses in Arabidopsis thaliana.


    Poudel, Arati N; Zhang, Tong; Kwasniewski, Misha; Nakabayashi, Ryo; Saito, Kazuki; Koo, Abraham J


    Plants rapidly perceive tissue damage, such as that inflicted by insects, and activate several key defense responses. The importance of the fatty acid-derived hormone jasmonates (JA) in dictating these wound responses has been recognized for many years. However, important features pertaining to the regulation of the JA pathway are still not well understood. One key unknown is the inactivation mechanism of the JA pathway and its relationship with plant response to wounding. Arabidopsis cytochrome P450 enzymes in the CYP94 clade metabolize jasmonoyl-L-isoleucine (JA-Ile), a major metabolite of JA responsible for many biological effects attributed to the JA signaling pathway; thus, CYP94s are expected to contribute to the attenuation of JA-Ile-dependent wound responses. To directly test this, we created the double and triple knock-out mutants of three CYP94 genes, CYP94B1, CYP94B3, and CYP94C1. The mutations blocked the oxidation steps and caused JA-Ile to accumulate 3-4-fold the WT levels in the wounded leaves. Surprisingly, over accumulation of JA-Ile did not lead to a stronger wound response. On the contrary, the mutants displayed a series of symptoms reminiscent of JA-Ile deficiency, including resistance to wound-induced growth inhibition, decreased anthocyanin and trichomes, and increased susceptibility to insects. The mutants, however, responded normally to exogenous JA treatments, indicating that JA perception or signaling pathways were intact. Untargeted metabolite analyses revealed >40% reduction in wound-inducible metabolites in the mutants. These observations raise questions about the current JA signaling model and point toward a more complex model perhaps involving JA derivatives and/or feedback mechanisms. This article is part of a Special Issue entitled: Plant Lipid Biology edited by Kent D. Chapman and Ivo Feussner. PMID:26968098

  20. Continuous Dust Formation in SNe 2010jl and 2011ja

    NASA Astrophysics Data System (ADS)

    Krafton, Kelsie; Clayton, Geoffrey; Andrews, Jennifer; Barlow, Michael; De Looze, Ilse


    Studies in the last 10 years of dust formation in core-collapse supernovae (CCSNe) have found only small amounts, ~0.001 solar masses. This is far less than the amount needed to account for the large masses of dust seen in some high redshift galaxies. However, the recent discovery of ~1 solar mass of cold dust in the ejecta of SN 1987A has has caused a complete re-evaluation of dust formation in CCSNe. It has been suggested that the CCSNe are continuously forming dust so that by the time they are about 25 years old they will have dust masses similar to SN 1987A. However, there is a wide time gap between the CCSNe that have been studied recently and SN 1987A. We plan to use the sensitivity of Spitzer to detect dust emission from CCSNe 5 or more years after explosion. Radiative transfer models will be used to estimate the dust masses. This proposal is to continue our study of two interesting SNe 2010jl and 2011ja. These observations are part of a long term study requiring multiple epochs of Spitzer observations to look for evidence of continuous dust formation. These observations will help shed light on the mystery of dust in SN 1987A.

  1. Integrated piezoelectric actuators in deep drawing tools to reduce the try-out

    NASA Astrophysics Data System (ADS)

    Neugebauer, Reimund; Mainda, Patrick; Kerschner, Matthias; Drossel, Welf-Guntram; Roscher, Hans-Jürgen


    Tool making is a very time consuming and expensive operation because many iteration loops are used to manually adjust tool components during the try-out process. That means that trying out deep drawing tools is 30% of the total costs. This is the reason why an active deep drawing tool was developed at the Fraunhofer Institute for Machine Tools and Forming Technology IWU in cooperation with Audi and Volkswagen to reduce the costs and production rates. The main difference between the active and conventional deep drawing tools is using piezoelectric actuators to control the forming process. The active tool idea, which is the main subject of this research, will be presented as well as the findings of experiments with the custom-built deep drawing tool. This experimental tool was designed according to production requirements and has been equipped with piezoelectric actuators that allow active pressure distribution on the sheet metal flange. The disposed piezoelectric elements are similar to those being used in piezo injector systems for modern diesel engines. In order to achieve the required force, the actuators are combined in a cluster that is embedded in the die of the deep drawing tool. One main objective of this work, i.e. reducing the time-consuming try-out-period, has been achieved with the experimental tool which means that the actuators were used to set static pressure distribution between the blankholder and die. We will present the findings of our analysis and the advantages of the active system over a conventional deep drawing tool. In addition to the ability of changing the static pressure distribution, the piezoelectric actuator can also be used to generate a dynamic pressure distribution during the forming process. As a result the active tool has the potential to expand the forming constraints to make it possible to manage forming restrictions caused by light weight materials in future.

  2. Exposure to tri-o-cresyl phosphate detected in jet airplane passengers

    PubMed Central

    Liyasova, Mariya; Li, Bin; Schopfer, Lawrence M.; Nachon, Florian; Masson, Patrick; Furlong, Clement E.; Lockridge, Oksana


    The aircraft cabin and flight deck ventilation are supplied from partially compressed unfiltered bleed air directly from the engine. Worn or defective engine seals can result in the release of engine oil into the cabin air supply. Aircrew and passengers have complained of illness following such “fume events”. Adverse health effects are hypothesized to result from exposure to tricresyl phosphate mixed esters, a chemical added to jet engine oil and hydraulic fluid for its anti-wear properties. Our goal was to develop a laboratory test for exposure to tricresyl phosphate. The assay was based on the fact that the active-site serine of butyrylcholinesterase reacts with the active metabolite of tri-o-cresyl phosphate, cresyl saligenin phosphate, to make a stable phosphorylated adduct with an added mass of 80 Da. No other organophosphorus agent makes this adduct in vivo on butyrylcholinesterase. Blood samples from jet airplane passengers were obtained 24–48 hours after completing a flight. Butyrylcholinesterase was partially purified from 25 ml serum or plasma, digested with pepsin, enriched for phosphorylated peptides by binding to titanium oxide, and analyzed by mass spectrometry. Of 12 jet airplane passengers tested, 6 were positive for exposure to tri-o-cresyl phosphate that is, they had detectable amounts of the phosphorylated peptide FGEpSAGAAS. The level of exposure was very low. No more than 0.05 to 3% of plasma butyrylcholinesterase was modified. None of the subjects had toxic symptoms. Four of the positive subjects were retested 3 to 7 months following their last airplane trip and were found to be negative for phosphorylated butyrylcholinesterase. In conclusion, this is the first report of an assay that detects exposure to tri-o-cresyl phosphate in jet airplane travelers. PMID:21723309

  3. An Effective Tri-Clustering Algorithm Combining Expression Data with Gene Regulation Information

    PubMed Central

    Li, Ao; Tuck, David


    Motivation Bi-clustering algorithms aim to identify sets of genes sharing similar expression patterns across a subset of conditions. However direct interpretation or prediction of gene regulatory mechanisms may be difficult as only gene expression data is used. Information about gene regulators may also be available, most commonly about which transcription factors may bind to the promoter region and thus control the expression level of a gene. Thus a method to integrate gene expression and gene regulation information is desirable for clustering and analyzing. Methods By incorporating gene regulatory information with gene expression data, we define regulated expression values (REV) as indicators of how a gene is regulated by a specific factor. Existing bi-clustering methods are extended to a three dimensional data space by developing a heuristic TRI-Clustering algorithm. An additional approach named Automatic Boundary Searching algorithm (ABS) is introduced to automatically determine the boundary threshold. Results Results based on incorporating ChIP-chip data representing transcription factor-gene interactions show that the algorithms are efficient and robust for detecting tri-clusters. Detailed analysis of the tri-cluster extracted from yeast sporulation REV data shows genes in this cluster exhibited significant differences during the middle and late stages. The implicated regulatory network was then reconstructed for further study of defined regulatory mechanisms. Topological and statistical analysis of this network demonstrated evidence of significant changes of TF activities during the different stages of yeast sporulation, and suggests this approach might be a general way to study regulatory networks undergoing transformations. PMID:19838334

  4. Exposure to tri-o-cresyl phosphate detected in jet airplane passengers.


    Liyasova, Mariya; Li, Bin; Schopfer, Lawrence M; Nachon, Florian; Masson, Patrick; Furlong, Clement E; Lockridge, Oksana


    The aircraft cabin and flight deck ventilation are supplied from partially compressed unfiltered bleed air directly from the engine. Worn or defective engine seals can result in the release of engine oil into the cabin air supply. Aircrew and passengers have complained of illness following such "fume events". Adverse health effects are hypothesized to result from exposure to tricresyl phosphate mixed esters, a chemical added to jet engine oil and hydraulic fluid for its anti-wear properties. Our goal was to develop a laboratory test for exposure to tricresyl phosphate. The assay was based on the fact that the active-site serine of butyrylcholinesterase reacts with the active metabolite of tri-o-cresyl phosphate, cresyl saligenin phosphate, to make a stable phosphorylated adduct with an added mass of 80 Da. No other organophosphorus agent makes this adduct in vivo on butyrylcholinesterase. Blood samples from jet airplane passengers were obtained 24-48 h after completing a flight. Butyrylcholinesterase was partially purified from 25 ml serum or plasma, digested with pepsin, enriched for phosphorylated peptides by binding to titanium oxide, and analyzed by mass spectrometry. Of 12 jet airplane passengers tested, 6 were positive for exposure to tri-o-cresyl phosphate that is, they had detectable amounts of the phosphorylated peptide FGEpSAGAAS. The level of exposure was very low. No more than 0.05 to 3% of plasma butyrylcholinesterase was modified. None of the subjects had toxic symptoms. Four of the positive subjects were retested 3 to 7 months following their last airplane trip and were found to be negative for phosphorylated butyrylcholinesterase. In conclusion, this is the first report of an assay that detects exposure to tri-o-cresyl phosphate in jet airplane travelers. PMID:21723309

  5. Presumable Scenario of One of the Collinear Cluster Tri-Partition Modes

    NASA Astrophysics Data System (ADS)

    Pyatkov, Yu. V.; Kamanin, D. V.; Alexandrov, A. A.; Alexandrova, I. A.; Kondratyev, N. A.; Kuznetsova, E. A.; Jacobs, N.; Malaza, V.; Pham Minh, D.; Zhuchko, V. E.

    Collinear cluster tri-partition (CCT) channel in 252Cf(sf) was studied using COMETA apparatus. The setup consists of a double arm time of flight heavy ion spectrometer with two mosaic "stop" detectors. Also included in the setup is a neutron registration channel based on 3He filled counters. Specific CCT mode manifesting itself as a rectangular structure in the mass-mass plot of detected fragments was revealed both by neutron gating and direct detection of all three decay partners. Presumable scenario which stands behind the mode observed is discussed.

  6. Studies on novel single crystals of tri-nitrophenol methyl p-hydroxybenzoate

    NASA Astrophysics Data System (ADS)

    Vesta, C.; Uthrakumar, R.; Vinitha, G.; Ramalingam, A.; Jerome Das, S.


    Good quality single crystal of tri-nitrophenol methyl p-hydroxybenzoate (TNMPHB) has been successfully grown from aqueous solution by a slow evaporation technique. Single-crystal X-ray diffraction analysis confirms that the crystal formed by crystallizing in triclinic system with space group P1¯ is of a new kind. The functional groups of the compound are confirmed qualitatively by FT-IR spectral analysis. An optical absorption study on this sample reveals the minimum absorption region is well suited for optical applications. Thermal analysis carried out on the compound reveals that the sample is stable up to 187 °C.

  7. Exposure to tri-o-cresyl phosphate detected in jet airplane passengers

    SciTech Connect

    Liyasova, Mariya; Li, Bin; Schopfer, Lawrence M.; Nachon, Florian; Masson, Patrick; Furlong, Clement E.; Lockridge, Oksana


    The aircraft cabin and flight deck ventilation are supplied from partially compressed unfiltered bleed air directly from the engine. Worn or defective engine seals can result in the release of engine oil into the cabin air supply. Aircrew and passengers have complained of illness following such 'fume events'. Adverse health effects are hypothesized to result from exposure to tricresyl phosphate mixed esters, a chemical added to jet engine oil and hydraulic fluid for its anti-wear properties. Our goal was to develop a laboratory test for exposure to tricresyl phosphate. The assay was based on the fact that the active-site serine of butyrylcholinesterase reacts with the active metabolite of tri-o-cresyl phosphate, cresyl saligenin phosphate, to make a stable phosphorylated adduct with an added mass of 80 Da. No other organophosphorus agent makes this adduct in vivo on butyrylcholinesterase. Blood samples from jet airplane passengers were obtained 24-48 h after completing a flight. Butyrylcholinesterase was partially purified from 25 ml serum or plasma, digested with pepsin, enriched for phosphorylated peptides by binding to titanium oxide, and analyzed by mass spectrometry. Of 12 jet airplane passengers tested, 6 were positive for exposure to tri-o-cresyl phosphate that is, they had detectable amounts of the phosphorylated peptide FGEpSAGAAS. The level of exposure was very low. No more than 0.05 to 3% of plasma butyrylcholinesterase was modified. None of the subjects had toxic symptoms. Four of the positive subjects were retested 3 to 7 months following their last airplane trip and were found to be negative for phosphorylated butyrylcholinesterase. In conclusion, this is the first report of an assay that detects exposure to tri-o-cresyl phosphate in jet airplane travelers. -- Highlights: Black-Right-Pointing-Pointer Travel on jet airplanes is associated with an illness, aerotoxic syndrome. Black-Right-Pointing-Pointer A possible cause is exposure to tricresyl

  8. Holmium Nitrate Complexation with Tri-n-butyl Phosphate in Supercritical Carbon Dioxide

    SciTech Connect

    Robert V. Fox; R. Duane Ball; Peter de B. Harrington; Harry W. Rollins; Chien M. Wai


    Holmium nitrate pentahydrate was reacted with tri-n-butyl phosphate in supercritical carbon dioxide at 308 K. The products of the complexation reaction were measured under supercritical fluid conditions using UV-vis spectroscopy. The solubility of the metal complexes in the supercritical fluid phase was measured. The mole-ratio titration method was used to determine the stoichiometry of the soluble complexes. Conditional extraction coefficients were calculated from spectral data using least-squares regression and hard-equilibria models. Data indicate that the holmium nitrate-tributyl phosphate system forms 1:2 and 1:4 holmium-tributyl phosphate complexes.

  9. The investigation of single, dual and tri-band frequency selective surface

    NASA Astrophysics Data System (ADS)

    Aziz, Mohamad Zoinol Abidin Abd.; Shukor, Mahfuzah Md.; Mustafa, Nur Hanim; Fauzi, Noor Azamiah Md; Ahmad, Badrul Hisham; Suaidi, Mohamad Kadim; Johar, Fauzi Mohd; Salleh, Siti Nadzirah; Azmin, Farah Ayuni; Malek, Mohd Fareq Abd.


    The single, dual and tri-band Frequency Selective Surface (FSS) design structure is designed and simulated by using CST Microwave Studio software. The reflection (S11) and transmission (S21) of the design FSS structure is analyzed based on the six types of configuration that have been set up. All configurations are simulated with the same size of the FSS design structure. The hybrid material (FR4 and glass) affects the transmission and reflection signals of the FSS which led to the compact structure. The measurement results are agreed for all FSS design structures but the difference is due to the transmission losses.

  10. Fabrication of Planar, Layered Nanoparticles Using Tri-layer Resist Templates

    PubMed Central

    Hu, Wei; Zhang, Mingliang; Wilson, Robert J.; Koh, Ai Leen; Wi, Jung-Sub; Tang, Mary; Sinclair, Robert; Wang, Shan X.


    A simple and universal pathway to produce free multilayer synthetic nanoparticles is developed based on lithography, vapor phase deposition and a tri-layer resist lift off and release process. The fabrication method presented in this work is ideal for production of a broad range of nanoparticles, either free in solution or still attached to an intact release layer, with unique magnetic, optical, radioactive, electronic and catalytic properties. Multi-modal capabilities are implicit in the layered architecture. As an example, directly fabricated magnetic nanoparticles are evaluated to illustrate the structural integrity of thin internal multilayers and the nanoparticle stability in aggressive biological environments, which is highly desired for biomedical applications. PMID:21415483

  11. Uptake of tri-p-cresyl phosphate (TCP) in soybean plants

    SciTech Connect

    Casterline, J.L. Jr.; Ku, Y.; Barnett, N.M.


    Because of the possible release of TCP to the environment, this study was undertaken to determine the uptake and translocation of TCP by soybean plants, using pure tri-p-cresyl phosphate (TpCP) as a model compound. The authors wished to learn the propensity of TpCP to move into the food crops from the soil. This study was not concerned with phytotoxicity, but with the possibility of foods becoming contaminated with TCP through the use of sludge or waste-water on agricultural lands.

  12. Measurement of Creep on the Calaveras Fault at Coyote Dam using Terrestrial Radar Interferometry (TRI).

    NASA Astrophysics Data System (ADS)

    Baker, B.; Cassotto, R.; Fahnestock, M. A.; Werner, C. L.; Boettcher, M. S.


    The Calaveras fault in central California is part of the San Andreas fault system. Coyote Dam, an earthen dam that straddles the fault ~13km northeast of Gilroy, experiences creep style deformation that ranges from 10 to 15 mm/yr. Uncertainty in the location of the fault, coupled with the historic rate of deformation, affect the dam's safety factor. Assessing the impact of fault creep on the dam's stability is paramount to its safety evaluation, but is difficult to resolve due to limited spatial and temporal sampling of conventional methods. Terrestrial radar interferometry (TRI), like satellite-based observations, produces high spatial resolution maps of ground deformation. Unlike space-based sensors, TRI can be readily deployed and the observation geometry selected to get the maximum line of sight (LOS) signal. TRI also benefits from high temporal sampling which can be used to reduce errors related to atmospheric phase delays and high temporal sampling also facilitates tracking rapidly moving features such as landslides and glaciers. GAMMA Portable Radar Interferometer (GPRI) measurements of Coyote Dam rock faces were made from concrete piers built upstream and downstream of the dam. The GPRI operates at a radar frequency of 17.2 GHz with a spatial resolution at the dam of approximately 0.9 m x 2.0 m. Changes in LOS path length smaller than 0.1mm can be measured. Data were acquired approximately every 2 to 3 weeks over a 7-month period to map the fault trace through the dam faces. Our study exploits the dense record of observations obtained, and the relatively short distance of the radar to the dam to minimize atmospheric affects. We investigate how the deformation evolves in time and the orientation of fault through the dam, including the strike and dip as measured along the dam surface. Our results show rates consistent with GPS data and regional satellite observations, but produce a much more detailed map of the fault on the dam than possible with GPS or

  13. Dynamics of Leslie-Gower type generalist predator in a tri-trophic food web system

    NASA Astrophysics Data System (ADS)

    Priyadarshi, A.; Gakkhar, S.


    In this paper, the dynamics of a tri-trophic food web system consists of Leslie-Gower type generalist predator has been explored. The system is bounded under certain conditions. The Hopf-bifurcation has been established in the phase planes. The bifurcation diagrams exhibit coexistence of all three species in the form of periodic/chaotic solutions. The "snail-shell" chaotic attractor has very high Lyapunov exponents. The coexistence in the form of stable equilibrium is also possible for lower values of parameters. The two-parameter bifurcation diagrams are drawn for critical parameters.

  14. Use of the TriSpan Coil to Facilitate the Transcatheter Occlusion of Pulmonary Arteriovenous Malformation

    SciTech Connect

    Cil, Barbaros E. E-mail:; Erdogan, Cueneyt; Akmangit, Ilkay; Cekirge, Saruhan; Balkanci, Ferhun


    Pulmonary arteriovenous malformation (PAVM) is a rare vascular malformation of the lung which may occur as an isolated entity or in association with hereditary hemorrhagic telangiectasia (HHT). Because of considerable risk of serious complications such as cerebral embolism, brain abscess and pulmonary hemorrhage, definitive treatment should be considered in most patients. Embolization with coils or detachable balloons is currently the preferred treatment. Paradoxical embolization of coils and balloons may happen, especially in patients with PAVMs with large feeding arteries. In this report we present our initial experience with the use of the TriSpan coil to lower the risk of coil migration during the transcatheter occlusion of PAVMs.

  15. Multiple-try Metropolis Hastings for modeling extreme PM10 data

    NASA Astrophysics Data System (ADS)

    Amin, Nor Azrita Mohd; Adam, Mohd Bakri; Ibrahim, Noor Akma


    Awareness of catastrophic events brings the attention to work out the relationship of these events by using statistical analysis of Extreme Value Theory (EVT). This study focused on extreme PM10 data using a Gumbel distribution which is one of the Extreme Value distributions. The parameters were estimated using the new Bayesian approach in extreme called Multiple Try Metropolis-Hastings algorithms. We compared this approach with another Markov Chain Monte Carlo approach which is the classical Metropolis-Hastings algorithm and the frequentist approach, Maximum Likelihood Estimation. It appears that these three approaches provide comparable results. Data are taken for Pasir Gudang station for year 1996 to 2010.

  16. Biological and chemical study of fused tri- and tetracyclic indazoles and analogues with important antiparasitic activity

    NASA Astrophysics Data System (ADS)

    Díaz-Urrutia, Christian A.; Olea-Azar, Claudio A.; Zapata, Gerald A.; Lapier, Michel; Mura, Francisco; Aguilera-Venegas, Benjamín; Arán, Vicente J.; López-Múñoz, Rodrigo A.; Maya, Juan D.

    A series of fused tri- and tetracyclic indazoles and analogues compounds (NID) with potential antiparasitic effects were studied using voltamperometric and spectroscopic techniques. Nitroanion radicals generated by cyclic voltammetry were characterized by electron spin resonance spectroscopy (ESR) and their spectral lines were explained and analyzed using simulated spectra. In addition, we examined the interaction between radical species generated from nitroindazole derivatives and glutathione (GSH). Biological assays such as activity against Trypanosoma cruzi and cytotoxicity against macrophages were carried out. Finally, spin trapping and molecular modeling studies were also done in order to elucidate the potentials action mechanisms involved in the trypanocidal activity.

  17. New Developments in TRI{mu}P and RIASH at KVI

    SciTech Connect

    Dendooven, P.


    The status of the TRI{mu}P facility at KVI is reviewed. Recent results on ion catcher devices are described. A thermo-ionizer for use with alkali and earth-alkali elements is close to completion. Concerning the use of superfluid helium as stopping medium, evidence that second sound pulses can be used to extract ions from the helium surface has been obtained. Based on the observation of highly efficient ion transport in helium, neon and argon gas below about 100 K, we propose the operation of noble gas ion catchers at cryogenic temperatures.

  18. Antimalarial Isocyano and Isothiocyanato Sesquiterpenes with Tri- and Bicyclic Skeletons from the Nudibranch Phyllidia ocellata.


    White, Andrew M; Pierens, Gregory K; Skinner-Adams, Tina; Andrews, Katherine T; Bernhardt, Paul V; Krenske, Elizabeth H; Mollo, Ernesto; Garson, Mary J


    Five new isocyano/isothiocyanato sesquiterpenes (1-5) with tri- or bicyclic carbon skeletons have been characterized from Australian specimens of the nudibranch Phyllidia ocellata. Spectroscopic analyses at 900 MHz were informed by DFT calculations. The 1S, 5S, 8R configuration of 2-isocyanoclovene (1) was determined by X-ray crystallographic analysis of formamide 6. A biosynthetic pathway to clovanes 1 and 2 from epicaryolane precursors is proposed. Isocyanides 1, 2, and 4 showed activity against Plasmodium falciparum (IC50 0.26-0.30 μM), while isothiocyanate 3 and formamide 6 had IC50 values of >10 μM. PMID:26056748

  19. Fabrication of C60 Tri-Diethyl Malonate Membrane via an Electrospinning Method and Its Antibacterial Property.


    Li, Hui; Chen, Shou; Peng, Xiaohua; Sun, Jiangning; Shu, Chunying; Jiang, Li; Wang, Chunru


    A homogeneous C60 tri-diethyl malonate membrane was fabricated by a facile electro-spinning method. Comprehensive characterizations of its assembling structure, such as SEM, TEM, TGA, UV-vis, and FTIR, were carried out. Different fullerene derivatives show different assembling characters during the electrospining process. Notably, C60 tri-diethyl malonate with close-knite structures can form a stable structure after removing the assistant polymer of PVP. The antibacterial experiments of C60 tri-diethyl malonate membrane were performed, and the results revealed that this membrane owns excellent antibacterial activity. PMID:27455662

  20. Public report for options to make the Toxic Release Inventory (TRI) data base accessible to the public

    SciTech Connect

    Not Available


    This paper presents appropriate options for implementation of a publicly accessible Toxic Release Inventory (TRI) data base, analyzes and evaluates the costs and benefits of those options, and recommends one or more of the best alternatives for making the TRI data base available to the public. The analysis addresses only the data-base options. It does not address other means of public access to TRI data, e.g., printed versions of the data or Freedom of Information Act (FOIA) requests, other than to note the potential effect of other means on usage of the data base.

  1. Shared binding sites in Lepidoptera for Bacillus thuringiensis Cry1Ja and Cry1A toxins.


    Herrero, S; González-Cabrera, J; Tabashnik, B E; Ferré, J


    Bacillus thuringiensis toxins act by binding to specific target sites in the insect midgut epithelial membrane. The best-known mechanism of resistance to B. thuringiensis toxins is reduced binding to target sites. Because alteration of a binding site shared by several toxins may cause resistance to all of them, knowledge of which toxins share binding sites is useful for predicting cross-resistance. Conversely, cross-resistance among toxins suggests that the toxins share a binding site. At least two strains of diamondback moth (Plutella xylostella) with resistance to Cry1A toxins and reduced binding of Cry1A toxins have strong cross-resistance to Cry1Ja. Thus, we hypothesized that Cry1Ja shares binding sites with Cry1A toxins. We tested this hypothesis in six moth and butterfly species, each from a different family: Cacyreus marshalli (Lycaenidae), Lobesia botrana (Tortricidae), Manduca sexta (Sphingidae), Pectinophora gossypiella (Gelechiidae), P. xylostella (Plutellidae), and Spodoptera exigua (Noctuidae). Although the extent of competition varied among species, experiments with biotinylated Cry1Ja and radiolabeled Cry1Ac showed that Cry1Ja and Cry1Ac competed for binding sites in all six species. A recent report also indicates shared binding sites for Cry1Ja and Cry1A toxins in Heliothis virescens (Noctuidae). Thus, shared binding sites for Cry1Ja and Cry1A occur in all lepidopteran species tested so far. PMID:11722929

  2. Shared Binding Sites in Lepidoptera for Bacillus thuringiensis Cry1Ja and Cry1A Toxins

    PubMed Central

    Herrero, Salvador; González-Cabrera, Joel; Tabashnik, Bruce E.; Ferré, Juan


    Bacillus thuringiensis toxins act by binding to specific target sites in the insect midgut epithelial membrane. The best-known mechanism of resistance to B. thuringiensis toxins is reduced binding to target sites. Because alteration of a binding site shared by several toxins may cause resistance to all of them, knowledge of which toxins share binding sites is useful for predicting cross-resistance. Conversely, cross-resistance among toxins suggests that the toxins share a binding site. At least two strains of diamondback moth (Plutella xylostella) with resistance to Cry1A toxins and reduced binding of Cry1A toxins have strong cross-resistance to Cry1Ja. Thus, we hypothesized that Cry1Ja shares binding sites with Cry1A toxins. We tested this hypothesis in six moth and butterfly species, each from a different family: Cacyreus marshalli (Lycaenidae), Lobesia botrana (Tortricidae), Manduca sexta (Sphingidae), Pectinophora gossypiella (Gelechiidae), P. xylostella (Plutellidae), and Spodoptera exigua (Noctuidae). Although the extent of competition varied among species, experiments with biotinylated Cry1Ja and radiolabeled Cry1Ac showed that Cry1Ja and Cry1Ac competed for binding sites in all six species. A recent report also indicates shared binding sites for Cry1Ja and Cry1A toxins in Heliothis virescens (Noctuidae). Thus, shared binding sites for Cry1Ja and Cry1A occur in all lepidopteran species tested so far. PMID:11722929

  3. Update from the Japanese Center for the Validation of Alternative Methods (JaCVAM).


    Kojima, Hajime


    The Japanese Center for the Validation of Alternative Methods (JaCVAM) was established in 2005 to promote the use of alternatives to animal testing in regulatory studies, thereby replacing, reducing, or refining the use of animals, according to the Three Rs principles. JaCVAM assesses the utility, limitations and suitability for use in regulatory studies, of test methods needed to determine the safety of chemicals and other materials. JaCVAM also organises and performs validation studies of new test methods, when necessary. In addition, JaCVAM co-operates and collaborates with similar organisations in related fields, both in Japan and internationally, which also enables JaCVAM to provide input during the establishment of guidelines for new alternative experimental methods. These activities help facilitate application and approval processes for the manufacture and sale of pharmaceuticals, chemicals, pesticides, and other products, as well as for revisions to standards for cosmetic products. In this manner, JaCVAM plays a leadership role in the introduction of new alternative experimental methods for regulatory acceptance in Japan. PMID:24512226

  4. Wireless portable electrocardiogram and a tri-axis accelerometer implementation and application on sleep activity monitoring.


    Chang, Kang-Ming; Liu, Shin-Hong


    Night-to-night variability of sleep activity requires more home-based portable sleep monitoring instead of clinical polysomnography examination in the laboratory. In this article, a wireless sleep activity monitoring system is described. The system is light and small for the user. Sleep postures, such as supine or left/right side, were observed by a signal from a tri-axis accelerometer. An overnight electrocardiogram was also recorded with a single lead. Using an MSP430 as microcontroller, both physiological signals were transmitted by a Bluetooth chip. A Labview-based interface demonstrated the recorded signal and sleep posture. Three nights of sleep recordings were used to examine night-to-night variability. The proposed system can record overnight heart rate. Results show that sleep posture and posture change can be precisely detected via tri-axis accelerometer information. There is no significant difference within subject data sets, but there are statistically significant differences among subjects, both for heart rate and for sleep posture distribution. The wireless transmission range is also sufficient for home-based users. PMID:21413872

  5. Two new polytypes of 2,4,6-tri­bromo­benzo­nitrile

    PubMed Central

    Britton, Doyle; Noland, Wayland E.; Tritch, Kenneth J.


    Three polymorphs of 2,4,6-tri­bromo­benzo­nitrile (RCN), C7H2Br3N, two of which are novel and one of which is a redetermination of the original structure first determined by Carter & Britton [(1972). Acta Cryst. B28, 945–950] are found to be polytypic. Each has a layer structure which differs only in the stacking of the layers. Each layer is composed of mol­ecules associated through C N⋯Br contacts which form R 2 2(10) rings. Two such rings are associated with each N atom; one with each ortho-Br atom. No new polytypes of 1,3,5-tri­bromo-2-iso­cyano­benzene (RNC) were found but a re-determination of the original structure by Carter et al. [(1977). Cryst. Struct. Commun. 6, 543–548] is presented. RNC was found to be isostructural with one of the novel polytypes of RCN. Unit cells were determined for 23 RCN samples and 11 RNC samples. Polytypes could not be distinguished based on crystal habits. In all four structures, each mol­ecule of the asymmetric unit lies across a mirror plane. PMID:26958382

  6. Along the Ta Diffusion Path Through a Boron and Oxygen Containing Tri-layer Structure

    NASA Astrophysics Data System (ADS)

    Ying, Ji-Feng; Ji, Rong; Wang, Chen Chen; Ter Lim, Sze; Xie, Huiqing; Gerard, Ernult F.


    Diffusion and migration of elements are commonly observed in the fabrication of multilayer thin-film devices, including those of STT-RAM. The CoFeB/MgO/CoFeB tri-layer thin-film stack has been widely used in the design of STT-RAM devices as the functional magnetic-tunnel-junction (MTJ) structure. Such issues faced in the fabrication of these devices have been extensively researched from the stand point of engineering the materials property and structure to achieve the best MTJ performance. In this work, we conducted a detailed examination of the chemical-state change of the Ta and B in a CoFeB/MgO/CoFeB/Ta film stack by using x-ray photoelectron spectroscopy (XPS) and time-of-flight secondary ion mass spectrometry. We showed that the chemical-state change of Ta and B is a result of the Ta diffusion phenomena through the CoFeB/MgO/CoFeB tri-layer structure. In particular, we report the evidences of the formation of TaB x O y compound at some considerable depth away from the Ta layer. Also of value to XPS spectroscopy, the Ta binding energy for such TaB x O y compound is reported for the first time.

  7. The transverse space-charge force in tri-gaussian distribution

    SciTech Connect

    Ng, K.Y.; /Fermilab


    In tracking, the transverse space-charge force can be represented by changes in the horizontal and vertical divergences, {Delta}x{prime} and {Delta}y{prime} at many locations around the accelerator ring. In this note, they are going to list some formulas for {Delta}x{prime} and {delta}y{prime} arising from space-charge kicks when the beam is tri-Gaussian distributed. They will discuss separately a flat beam and a round beam. they are not interested in the situation when the emittance growth arising from space charge becomes too large and the shape of the beam becomes weird. For this reason, they can assume the bunch still retains its tri-Gaussian distribution, with its rms sizes {sigma}{sub x}, {sigma}{sub y}, and {sigma}{sub z} increasing by certain factors. Thus after each turn, {sigma}{sub x}, {sigma}{sub y}, and {sigma}{sub z} can be re-calculated.

  8. A Tri-part Model for Genetics Literacy: Exploring Undergraduate Student Reasoning About Authentic Genetics Dilemmas

    NASA Astrophysics Data System (ADS)

    Shea, Nicole A.; Duncan, Ravit Golan; Stephenson, Celeste


    Genetics literacy is becoming increasingly important as advancements in our application of genetic technologies such as stem cell research, cloning, and genetic screening become more prevalent. Very few studies examine how genetics literacy is applied when reasoning about authentic genetic dilemmas. However, there is evidence that situational features of a reasoning task may influence how students apply content knowledge as they generate and support arguments. Understanding how students apply content knowledge to reason about authentic and complex issues is important for considering instructional practices that best support student thinking and reasoning. In this conceptual report, we present a tri-part model for genetics literacy that embodies the relationships between content knowledge use, argumentation quality, and the role of situational features in reasoning to support genetics literacy. Using illustrative examples from an interview study with early career undergraduate students majoring in the biological sciences and late career undergraduate students majoring in genetics, we provide insights into undergraduate student reasoning about complex genetics issues and discuss implications for teaching and learning. We further discuss the need for research about how the tri-part model of genetics literacy can be used to explore students' thinking and reasoning abilities in genetics.

  9. Tri-Metal Layered Semitransparent Electrode for Red Phosphorescent Organic Light-Emitting Diodes.


    Lee, Jae Woo; Lee, Ho Won; Lee, Song Eun; Yang, Hyung Jin; Lee, Sung Kyu; Hwang, Kyo Min; Park, Soo Na; Yoon, Seung Soo; Kim, Young Kwan


    In this paper, we fabricated tri-metal layered thin film semitransparent electrodes consisting of a thin conductive metal layer, sandwiched between two nickel layers. An equal red phosphorescent organic light-emitting diode (PHOLED) structure was deposited on the anodes of indium tin oxide (ITO) and three types of tri-metal layers (Ni/Al/Ni, Ni/Cu/Ni, and Ni/Ag/Ni, thickness of 3/7/3 nm in common) on a glass substrate. The optical and electrical performances of the device using Ni/Ag/Ni were improved more than the performances of the other devices due to the micro-cavity effect in accordance with the various electrode characteristics. Moreover, we fabricated the same red PHOLED structures on a flexible substrate, as a consequence, showed competitive emission characteristics compared to the devices fabricated on a glass substrate. Therefore, this study could succeed to additional research on flexible display panel and light-emitting devices with ITO-free electrodes. PMID:26726477

  10. Effective detection method for falls according to the distance between two tri-axial accelerometers

    NASA Astrophysics Data System (ADS)

    Kim, Jae-Hyung; Park, Geun-Chul; Kim, Soo-Hong; Kim, Soo-Sung; Lee, Hae-Rim; Jeon, Gye-Rok


    Falls and fall-related injuries are a significant problem in the elderly population. A number of different approaches for detecting falls and activities of daily living (ADLs) have been conducted in recent years. However, distinguishing between real falls and certain fall-like ADL is often difficult. The aim of this study is to discriminate falls from fall-like ADLs such as jogging, jumping, and jumping down. The distance between two tri-axial accelerometers attached to the abdomen and the sternum was increased from 10 to 30 cm in 10-cm intervals. Experiments for falls and ADLs were performed to investigate the feasibility of the detection system for falls developed in this study. When the distances between the two tri-axial electrometers were 20 and 30 cm, fall-like ADLs were effectively distinguished from falls. The thresholds for three parameters — SVM, Diff Z, and Sum_diff_Z — were set; falls could be distinguished from ADL action sequences when the SVM value was larger than 4 g (TH1), the Diff_Z parameter was larger than 1.25 g (TH2), and the Sum_diff_Z parameter was larger than 15 m/s (TH3). In particular, when the SVM, Diff_Z, and Sum_diff_Z parameter were sequentially applied to thresholds (TH1, TH2, and TH3), fall-like ADL action sequences were accurately discriminated from falls.