Science.gov

Sample records for periodic mesoporous organosilicas

  1. Periodic Mesoporous Organosilica Nanorice

    NASA Astrophysics Data System (ADS)

    Mohanty, Paritosh; Landskron, Kai

    2009-02-01

    A periodic mesoporous organosilica (PMO) with nanorice morphology was successfully synthesized by a template assisted sol-gel method using a chain-type precursor. The PMO is composed of D and T sites in the ratio 1:2. The obtained mesoporous nanorice has a surface area of 753 m2 g-1, one-dimensional channels, and a narrow pore size distribution centered at 4.3 nm. The nanorice particles have a length of ca. 600 nm and width of ca. 200 nm.

  2. Syntheses and applications of periodic mesoporous organosilica nanoparticles

    NASA Astrophysics Data System (ADS)

    Croissant, Jonas G.; Cattoën, Xavier; Wong Chi Man, Michel; Durand, Jean-Olivier; Khashab, Niveen M.

    2015-12-01

    Periodic Mesoporous Organosilica (PMO) nanomaterials are envisioned to be one of the most prolific subjects of research in the next decade. Similar to mesoporous silica nanoparticles (MSN), PMO nanoparticles (NPs) prepared from organo-bridged alkoxysilanes have tunable mesopores that could be utilized for many applications such as gas and molecule adsorption, catalysis, drug and gene delivery, electronics, and sensing; but unlike MSN, the diversity in chemical nature of the pore walls of such nanomaterials is theoretically unlimited. Thus, we expect that PMO NPs will attract considerable interest over the next decade. In this review, we will present a comprehensive overview of the synthetic strategies for the preparation of nanoscaled PMO materials, and then describe their applications in catalysis and nanomedicine. The remarkable assets of the PMO structure are also detailed, and insights are provided for the preparation of more complex PMO nanoplatforms.

  3. Syntheses and applications of periodic mesoporous organosilica nanoparticles.

    PubMed

    Croissant, Jonas G; Cattoën, Xavier; Wong, Michel Chi Man; Durand, Jean-Olivier; Khashab, Niveen M

    2015-12-28

    Periodic Mesoporous Organosilica (PMO) nanomaterials are envisioned to be one of the most prolific subjects of research in the next decade. Similar to mesoporous silica nanoparticles (MSN), PMO nanoparticles (NPs) prepared from organo-bridged alkoxysilanes have tunable mesopores that could be utilized for many applications such as gas and molecule adsorption, catalysis, drug and gene delivery, electronics, and sensing; but unlike MSN, the diversity in chemical nature of the pore walls of such nanomaterials is theoretically unlimited. Thus, we expect that PMO NPs will attract considerable interest over the next decade. In this review, we will present a comprehensive overview of the synthetic strategies for the preparation of nanoscaled PMO materials, and then describe their applications in catalysis and nanomedicine. The remarkable assets of the PMO structure are also detailed, and insights are provided for the preparation of more complex PMO nanoplatforms. PMID:26585498

  4. Hollow periodic mesoporous organosilica nanospheres by a facile emulsion approach.

    PubMed

    Ma, Xiaobo; Zhang, Junjie; Dang, Meng; Wang, Jin; Tu, Zenzen; Yuwen, Lihui; Chen, Guotao; Su, Xiaodan; Teng, Zhaogang

    2016-08-01

    Periodic mesoporous organosilicas (PMOs) with homogeneously incorporated organic groups, highly ordered mesopores, and controllable morphology have attracted increasing attention. In this work, one-step emulsion approach for preparation of hollow periodic mesoporous organosilica (HPMO) nanospheres has been established. The method is intrinsically simple and does not require any sacrificial templates, corrosive and toxic etching agents. The obtained HPMO nanospheres have high surface area (∼950m(2)g(-1)), accessible ordered mesochannels (∼3.4nm), large pore volume (∼3.96cm(3)g(-1)), high condensation degree (77%), and diameter (∼560nm), hollow chamber size (∼400nm), and shell thickness (∼80nm). Furthermore, cytotoxicity show the cell viability is higher than 86% after incubating with the HPMO nanospheres at a concentration of up to 1200μgmL(-1) for 24h. The hemolysis of HPMO nanospheres is lower than 1.1% at concentrations ranging from 10 to 2000μgmL(-1). The lower hemolysis and cytotoxicity make the HPMO nanospheres great promise for future biomedical applications. PMID:27156086

  5. Highly ordered periodic mesoporous organosilica nanoparticles with controllable pore structures

    NASA Astrophysics Data System (ADS)

    Guan, Buyuan; Cui, Yan; Ren, Zhongyuan; Qiao, Zhen-An; Wang, Li; Liu, Yunling; Huo, Qisheng

    2012-09-01

    A general synthetic procedure for highly ordered and well-dispersed periodic mesoporous organosilica (PMO) nanoparticles is reported based on a single cationic surfactant cetyltrimethylammonium bromide (CTAB) and simple silica sources with organic bridging groups via an ammonia-catalyzed sol-gel reaction. By changing the bridging group in the silica sources, the pore structures of the as-made particles with three-dimensional hexagonal (P63/mmc), cubic (Pm3n), two-dimensional hexagonal (P6mm), and wormlike structure were evidenced by powder X-ray diffraction analysis (XRD) and transmission electron microscopy (TEM). The size range of the nanoparticles can be adjusted from 30 nm to 500 nm by variation of the ammonia concentration or the co-solvent content of the reaction medium. The PMO nanoparticles with high concentration of organic groups in the framework offered good thermal stability, good dispersion in low polarity solvent and high adsorption of small hydrophobic molecules. Finally, the dye functionalized PMO nanoparticles show low cytotoxicity and excellent cell permeability, which offers great potential for biomedical applications.A general synthetic procedure for highly ordered and well-dispersed periodic mesoporous organosilica (PMO) nanoparticles is reported based on a single cationic surfactant cetyltrimethylammonium bromide (CTAB) and simple silica sources with organic bridging groups via an ammonia-catalyzed sol-gel reaction. By changing the bridging group in the silica sources, the pore structures of the as-made particles with three-dimensional hexagonal (P63/mmc), cubic (Pm3n), two-dimensional hexagonal (P6mm), and wormlike structure were evidenced by powder X-ray diffraction analysis (XRD) and transmission electron microscopy (TEM). The size range of the nanoparticles can be adjusted from 30 nm to 500 nm by variation of the ammonia concentration or the co-solvent content of the reaction medium. The PMO nanoparticles with high concentration of organic

  6. Functionalized periodic mesoporous organosilicas for selective adsorption of proteins

    NASA Astrophysics Data System (ADS)

    Zhu, Ling; Liu, Xiaoyan; Chen, Tong; Xu, Zhigang; Yan, Wenfu; Zhang, Haixia

    2012-07-01

    The periodic mesoporous organosilicas (PMO) with an organobridged (sbnd CH2sbnd ) was synthesized and functionalized with amino or carboxylic groups by post-synthesis methods. The functionalized PMO by changing the hydrophilic/hydrophobic property and the net charge could be used to selectively adsorb and purify proteins with different shapes and different isoelectric points (pI). The experimental result showed that Bovine serum albumin (BSA) was adsorbed quicker than hemoglobin (Hb) on the materials, and lysozyme (Lys) could not be adsorbed on these PMO materials at all. The adsorption capacity of amino groups modified PMO (PMO-(NH2)2) for BSA was 44.67 mg/g and 300.0 mg/gfor Hb on carboxylic groups modified PMO (PMO-(COOH)2). The adsorption behavior of proteins was affected strongly by the interaction among different constituents in the mixture of proteins. In addition, it is found that the adsorption rate of (PMO-(NH2)2 for adsorption of proteins was much slower than PMO-(COOH)2.

  7. Synthesis of Xylylene-Bridged Periodic Mesoporous Organosilicas and Related Hollow Spherical Nanoparticles.

    PubMed

    Manchanda, Amanpreet S; Kruk, Michal

    2016-01-26

    A variety of organosilicas with p-xylylene bridging groups in the framework were synthesized using Pluronic F127 triblock copolymer as a micellar template under moderately acidic conditions in the presence of xylene as a micelle swelling agent. The resulting materials were characterized by using nitrogen adsorption, small-angle X-ray scattering, transmission electron microscopy, and (29)Si and (13)C cross-polarization magic angle spinning NMR. As the ratio of the organosilica precursor to Pluronic F127 was decreased, the structure evolved from highly ordered periodic mesoporous organosilica (PMO) to weakly ordered PMO, loosely aggregated hollow organosilica nanospheres, and finally to a significantly aggregated disordered structure. The highly ordered PMO with primarily face-centered cubic structure was effectively a closed-pore material. However, the weakly ordered variant exhibited large-diameter (∼15 nm) spherical mesopores, which were accessible after calcination under appropriate conditions or after extraction. The hollow nanospheres had readily accessible, uniform inner cavities whose size was readily tunable by adjusting the amount of the swelling agent used. It was also possible to convert the organosilica nanospheres into hollow silica nanospheres with inaccessible (closed) mesopores. The formation of distinct well-defined morphologies with spherical mesopores for an organosilica with large bridging groups in the framework shows that block-copolymer-surfactant templating is a powerful and versatile method for controlling the nanoscale structures of these remarkable materials. PMID:26714054

  8. Controlled Cell Growth and Cell Migration in Periodic Mesoporous Organosilica/Alginate Nanocomposite Hydrogels.

    PubMed

    Seda Kehr, Nermin; Riehemann, Kristina

    2016-01-21

    Nanocomposite (NC) hydrogels with different periodic mesoporous organosilica (PMO) concentrations and a NC hydrogel bilayer with various PMO concentrations inside the layers of the hydrogel matrix are prepared. The effect of the PMO concentration on cell growth and migration of cells is reported. The cells migrate in the bilayer NC hydrogel towards higher PMO concentrations and from cell culture plates to NC hydrogel scaffolds. PMID:26648333

  9. Periodic mesoporous organosilica with molecular-scale ordering self-assembled by hydrogen bonds.

    PubMed

    Mizoshita, Norihiro; Inagaki, Shinji

    2015-10-01

    Nanoporous materials with functional frameworks have attracted attention because of their potential for various applications. Silica-based mesoporous materials generally consist of amorphous frameworks, whereas a molecular-scale lamellar ordering within the pore wall has been found for periodic mesoporous organosilicas (PMOs) prepared from bridged organosilane precursors. Formation of a "crystal-like" framework has been expected to significantly change the physical and chemical properties of PMOs. However, until now, there has been no report on other crystal-like arrangements. Here, we report a new molecular-scale ordering induced for a PMO. Our strategy is to form pore walls from precursors exhibiting directional H-bonding interaction. We demonstrate that the H-bonded organosilica columns are hexagonally packed within the pore walls. We also show that the H-bonded pore walls can stably accommodate H-bonding guest molecules, which represents a new method of modifying the PMO framework. PMID:26310201

  10. Synthesis and Characterization of Periodic Mesoporous Organosilicas as Anion-Exchance Resins for Perrhenate Adsorption.

    SciTech Connect

    Lee, Byunghwan; Im, Hee-Jung; Luo, Huimin; Hagaman, Edward {Ed} W; Dai, Sheng

    2005-01-01

    A new methodology to immobilize ionic liquids through the use of a bridged silsesquioxane N-(3-triethoxysilylpropyl), N(3)-3-trimethoxysilylpropyl-4,5-dihydroimidazolium iodide that incorporates an ionic functionality for the assembly of novel periodic mesoporous organosilica (PMO) materials has been developed. The resulting PMO materials were investigated for use as novel anion exchange resins for the separation of perrhenate anions in aqueous solution. As compared with cetyltrimethylammonium chloride, 1-hexadecane-3-methylimidazolium bromide has been demonstrated to be a more efficient surfactant template for the generation of mesopores and surface areas for such PMO materials.

  11. Simple Systematic Synthesis of Periodic Mesoporous Organosilica Nanoparticles with Adjustable Aspect Ratios

    NASA Astrophysics Data System (ADS)

    Mohanty, Paritosh; Landskron, Kai

    2009-12-01

    One-dimensional periodic mesoporous organosilica (PMO) nanoparticles with tunable aspect ratios are obtained from a chain-type molecular precursor octaethoxy-1,3,5-trisilapentane. The aspect ratio can be tuned from 2:1 to >20:1 simply by variation in the precursor concentration in acidic aqueous solutions containing constant amounts of triblock copolymer Pluronic P123. The mesochannels are highly ordered and are oriented parallel to the longitudinal axis of the PMO particles. No significant Si-C bond cleavage occurs during the synthesis according to 29Si MAS NMR. The materials exhibit surface areas between 181 and 936 m2 g-1.

  12. Heterocyclic tri-urea isocyanurate bridged groups modified periodic mesoporous organosilica synthesized for Fe(III) adsorption

    SciTech Connect

    Rana, Vijay Kumar; Selvaraj, M.; Parambadath, Surendran; Chu, Sang-Wook; Park, Sung Soo; Mishra, Satyendra; Singh, Raj Pal; Ha, Chang-Sik

    2012-10-15

    To achieve a high level of heavy metal adsorption, 1,1 Prime ,1 Double-Prime -(1,3,5-triazine-2,4,6-triyl)tris(3-(3-(triethoxysilyl)propyl)urea) (TTPU) was synthesized as a novel melamine precursor and incorporated on the silica surface of periodic mesoporous organosilica (PMO). The melamine modified PMOs (MPMOs) were synthesized under acidic conditions using TTPU, tetraethylorthosilicate (TEOS) and Pluronic P123 as a template and the modified PMOs were characterized using the relevant instrumental techniques. The characteristic materials were used as adsorbents for the adsorption of Fe(III) ions. Fe(III) adsorption studies revealed MPMO-7.5 to be a good absorbent with higher adsorption efficiency than other MPMOs. - Graphical Abstract: A new organosilica precursor, TTPU, has been successfully synthesized and characterized to incorporate on the silica surface of periodic mesoporous organosilica (PMO). The melamine modified PMOs (MPMOs), in particular, the MPMO-7.5 was found to exhibit good adsorption efficiency for Fe(III). Highlights: Black-Right-Pointing-Pointer Synthesis of new melamine modified periodic mesoporous organosilicas (MPMOs). Black-Right-Pointing-Pointer A new organosilica precursor, TTPU, has been successfully synthesized for the MPMOs. Black-Right-Pointing-Pointer The MPMOs were characterized by the relevant instrumental techniques. Black-Right-Pointing-Pointer MPMO-7.5 exhibits higher adsorption efficiency for Fe(III) ions than other MPMOs.

  13. Evaluation of phenylene-bridged periodic mesoporous organosilica as a stationary phase for solid phase extraction.

    PubMed

    Carpio, A; Esquivel, D; Arce, L; Romero-Salguero, F J; Van Der Voort, P; Jiménez-Sanchidrián, C; Válcarcel, M

    2014-11-28

    A periodic mesoporous organosilica, in particular, a phenylene-bridged material (Ph-PMO), was evaluated for the first time as a sorbent for retaining and eluting fenuron, simazine, atrazine, carbaryl and terbutryn in grape must by solid phase extraction (SPE) prior to their determination with capillary electrophoresis coupled with ultraviolet detection (CE-UV). The analytes were used as model compounds to demonstrate the potential of Ph-PMO for increasing the sensitivity of CE. Under optimal conditions, the limits of detection for the analytes ranged from 0.6 to 4 μg/L, and their limits of quantitation from 2 to 10 μg/L. These values were comparable and, in some cases, even better than those obtained with C18 and HLB materials. Ph-PMO was characterized physicochemically by X-ray diffraction analysis, N2 adsorption-desorption measurements and laser diffraction particle sizing. The sorbent afforded the extraction of atrazine, carbaryl and terbutryn from grape must with mean recoveries ranging from 86 to 105%. Therefore, periodic mesoporous organosilicas possess a high potential as SPE materials. PMID:25454127

  14. Synthesis and characterization of periodic mesoporous organosilicas from bridged organosilanes in the presence of mixed salts

    NASA Astrophysics Data System (ADS)

    Zhai, Shang-Ru; Kim, Il; Ha, Chang-Sik

    2008-01-01

    A simple but effective synthetic pathway to periodic mesoporous organosilicas (PMOs) has been put forward in this article. The novelty of the present preparative route lies in that, for specific examples, highly ordered ethane- and benzenesilica PMOs can be facilely prepared in the presence of an inorganic salt pair within a wide compositional range, where no addition of mineral acids was necessary. Most of interest is that crystal-like pore walls were observed for the large-pore benzenesilica PMO promoted by this novel system, which has rarely been reported for copolymer-assembled organosilicas, even though the degree of molecular order is not as perfect as those benzenesilicas prepared under basic conditions utilizing cationic surfactants as template. Characterization results based on a series of techniques indicated that both inorganic salts are important for the assembly of ordered mesostructures under the present system, and a plausible formation mechanism deduced from the "salt-assisted" concept as previously reported for mesoporous nonsiliceous materials was discussed.

  15. Periodic mesoporous organosilicas with co-existence of diurea and sulfanilamide as an effective drug delivery carrier

    SciTech Connect

    Parambadath, Surendran; Rana, Vijay Kumar; Moorthy, Santha; Chu, Sang-Wook; Park, Shin-Kyu; Lee, Daewoo; Sung, Giju; Ha, Chang-Sik

    2011-05-15

    In this article we report the synthesis of new periodic mesoporous organosilicas (PMOs) with the co-existence of diurea and sulfanilamide-bridged organosilica that are potentially useful for controlled drug release system. The materials possess hexagonal pores with a high degree of uniformity and show long-range order as confirmed by the measurements of small-angle X-ray scattering (SAXS), N{sub 2} adsorption isotherms, and transmission electron microscopy(TEM). FT-IR and solid state {sup 29}Si MAS and {sup 13}C CP MAS NMR spectroscopic analyses proved that the bridging groups in the framework are not cleaved and covalently attached in the walls of the PMOs. It was found that the organic functionality could be introduced in a maximum of 10 mol% with respect to the total silicon content and be thermally stable up to 230 {sup o}C. The synthesized materials were shown to be particularly suitable for adsorption and desorption of hydrophilic/hydrophobic drugs from a phosphate buffer solution at pH 7.4. -- Graphical Abstract: We report the synthesis of new periodic mesoporous organosilicas (PMOs) with the co-existence of diurea and sulfanilamide-bridged organosilica that are potentially useful for controlled drug release system. Display Omitted Highlights: {yields} Synthesis of new periodic mesoporous organosilicas (PMOs) with the co-existence of diurea and sulfanilamide-bridged organosilica that are potentially useful for controlled drug release system. {yields} The organic functionality could be introduced in a maximum of 10 mol% with respect to the total silicon content and be thermally stable up to 230 {sup o}C. {yields} The synthesized materials were shown to be particularly suitable for adsorption and desorption of hydrophilic/hydrophobic drugs from a phosphate buffer solution at pH 7.4.

  16. Ruthenium-Immobilized Periodic Mesoporous Organosilica: Synthesis, Characterization, and Catalytic Application for Selective Oxidation of Alkanes.

    PubMed

    Ishito, Nobuhiro; Kobayashi, Hirokazu; Nakajima, Kiyotaka; Maegawa, Yoshifumi; Inagaki, Shinji; Hara, Kenji; Fukuoka, Atsushi

    2015-10-26

    Periodic mesoporous organosilica (PMO) is a unique material that has a crystal-like wall structure with coordination sites for metal complexes. A Ru complex, [RuCl2 (CO)3 ]2 , is successfully immobilized onto 2,2'-bipyridine (BPy) units of PMO to form a single-site catalyst, which has been confirmed by various physicochemical analyses. Using NaClO as an oxidant, the Ru-immobilized PMO oxidizes the tertiary C-H bonds of adamantane to the corresponding alcohols at 57 times faster than the secondary C-H bonds, thereby exhibiting remarkably high regioselectivity. Moreover, the catalyst converts cis-decalin to cis-9-decalol in a 63 % yield with complete retention of the substrate stereochemistry. The Ru catalyst can be separated by simple filtration and reused without loss of the original activity and selectivity for the oxidation reactions. PMID:26330333

  17. Heterogeneous Catalysis for Water Oxidation by an Iridium Complex Immobilized on Bipyridine-Periodic Mesoporous Organosilica.

    PubMed

    Liu, Xiao; Maegawa, Yoshifumi; Goto, Yasutomo; Hara, Kenji; Inagaki, Shinji

    2016-07-01

    Heterogenization of metal-complex catalysts for water oxidation without loss of their catalytic activity is important for the development of devices simulating photosynthesis. In this study, efficient heterogeneous iridium complexes for water oxidation were prepared using bipyridine-bridged periodic mesoporous organosilica (BPy-PMO) as a solid chelating ligand. The BPy-PMO-based iridium catalysts (Ir-BPy-PMO) were prepared by postsynthetic metalation of BPy-PMO and characterized through physicochemical analyses. The Ir-BPy-PMOs showed high catalytic activity for water oxidation. The turnover frequency (TOF) values for Ir-BPy-PMOs were one order of magnitude higher than those of conventional heterogeneous iridium catalysts. The reusability and stability of Ir-BPy-PMO were also examined, and detailed characterization was conducted using powder X-ray diffraction, nitrogen adsorption, (13) C DD MAS NMR spectroscopy, TEM, and XAFS methods. PMID:27168492

  18. Periodic Mesoporous Organosilica Nanocubes with Ultrahigh Surface Areas for Efficient CO2 Adsorption

    NASA Astrophysics Data System (ADS)

    Wei, Yong; Li, Xiaomin; Zhang, Renyuan; Liu, Yong; Wang, Wenxing; Ling, Yun; El-Toni, Ahmed Mohamed; Zhao, Dongyuan

    2016-02-01

    Ultrahigh surface area single-crystals of periodic mesoporous organosilica (PMOs) with uniform cubic or truncated-cubic morphology and organic/inorganic components homogeneously distributed over the whole frameworks have successfully been prepared by a sol-gel surfactant-templating method. By tuning the porous feature and polymerization degree, the surface areas of the obtained PMO nanocubes can reach as high as 2370 m2/g, which is the highest for silica-based mesoporous materials. The ultrahigh surface area of the obtained PMO single crystals is mainly resulted from abundant micropores in the mesoporous frameworks. Furthermore, the diameter of the nanocubes can also be well controlled from 150 to 600 nm. The materials show ultrahigh CO2 adsorption capacity (up to 1.42 mmol/g at 273 K) which is much higher than other porous silica materials and comparable to some carbonaceous materials. The adsorption of CO2 into the PMO nanocubes is mainly in physical interaction, therefore the adsorption-desorption process is highly reversible and the adsorption capacity is much dependent on the surface area of the materials. Moreover, the selectivity is also very high (~11 times to N2) towards CO2 adsorption.

  19. Magnetic spherical cores partly coated with periodic mesoporous organosilica single crystals

    NASA Astrophysics Data System (ADS)

    Li, Jing; Wei, Yong; Li, Wei; Deng, Yonghui; Zhao, Dongyuan

    2012-02-01

    Core-shell structured materials are of special significance in various applications. Until now, most reported core-shell structures have polycrystalline or amorphous coatings as their shell layers, with popular morphologies of microspheres or quasi-spheres. However, the single crystals, either mesoscale or atomic ones, are still rarely reported as shell layers. If single crystals can be coated on core materials, it would result in a range of new type core-shell structures with various morphologies, and probably more potential applications. In this work, we demonstrate that periodic mesoporous organosilica (PMO) single crystals can partly grow on magnetic microspheres to form incomplete Fe3O4@nSiO2@PMO core-shell materials in aqueous solution, which indeed is the first illustration that mesoporous single-crystal materials can be used as shell layers for preparation of core-shell materials. The achieved materials have advantages of high specific surface areas, good magnetic responses, embedded functional groups and cubic mesopore channels, which might provide them with various application conveniences. We suppose the partial growth is largely decided by the competition between growing tendency of single crystals and the resistances to this tendency. In principle, other single crystals, including a range of atomic single crystals, such as zeolites, are able to be developed into such core-shell structures.

  20. Periodic Mesoporous Organosilica Nanocubes with Ultrahigh Surface Areas for Efficient CO2 Adsorption

    PubMed Central

    Wei, Yong; Li, Xiaomin; Zhang, Renyuan; Liu, Yong; Wang, Wenxing; Ling, Yun; El-Toni, Ahmed Mohamed; Zhao, Dongyuan

    2016-01-01

    Ultrahigh surface area single-crystals of periodic mesoporous organosilica (PMOs) with uniform cubic or truncated-cubic morphology and organic/inorganic components homogeneously distributed over the whole frameworks have successfully been prepared by a sol-gel surfactant-templating method. By tuning the porous feature and polymerization degree, the surface areas of the obtained PMO nanocubes can reach as high as 2370 m2/g, which is the highest for silica-based mesoporous materials. The ultrahigh surface area of the obtained PMO single crystals is mainly resulted from abundant micropores in the mesoporous frameworks. Furthermore, the diameter of the nanocubes can also be well controlled from 150 to 600 nm. The materials show ultrahigh CO2 adsorption capacity (up to 1.42 mmol/g at 273 K) which is much higher than other porous silica materials and comparable to some carbonaceous materials. The adsorption of CO2 into the PMO nanocubes is mainly in physical interaction, therefore the adsorption-desorption process is highly reversible and the adsorption capacity is much dependent on the surface area of the materials. Moreover, the selectivity is also very high (~11 times to N2) towards CO2 adsorption. PMID:26868049

  1. Periodic Mesoporous Organosilica Nanocubes with Ultrahigh Surface Areas for Efficient CO₂ Adsorption.

    PubMed

    Wei, Yong; Li, Xiaomin; Zhang, Renyuan; Liu, Yong; Wang, Wenxing; Ling, Yun; El-Toni, Ahmed Mohamed; Zhao, Dongyuan

    2016-01-01

    Ultrahigh surface area single-crystals of periodic mesoporous organosilica (PMOs) with uniform cubic or truncated-cubic morphology and organic/inorganic components homogeneously distributed over the whole frameworks have successfully been prepared by a sol-gel surfactant-templating method. By tuning the porous feature and polymerization degree, the surface areas of the obtained PMO nanocubes can reach as high as 2370 m(2)/g, which is the highest for silica-based mesoporous materials. The ultrahigh surface area of the obtained PMO single crystals is mainly resulted from abundant micropores in the mesoporous frameworks. Furthermore, the diameter of the nanocubes can also be well controlled from 150 to 600 nm. The materials show ultrahigh CO2 adsorption capacity (up to 1.42 mmol/g at 273 K) which is much higher than other porous silica materials and comparable to some carbonaceous materials. The adsorption of CO2 into the PMO nanocubes is mainly in physical interaction, therefore the adsorption-desorption process is highly reversible and the adsorption capacity is much dependent on the surface area of the materials. Moreover, the selectivity is also very high (~11 times to N2) towards CO2 adsorption. PMID:26868049

  2. Mesostructured TiO2 Gated Periodic Mesoporous Organosilica-Based Nanotablets for Multistimuli-responsive Drug Release.

    PubMed

    Wang, Tao; Guan, Buyuan; Wang, Xue; Li, Xiang; Zhang, Ye; Qiao, Zhen-An; Liu, Yunling; Huo, Qisheng

    2015-11-25

    A multistimuli-responsive drug carrier is designed and successfully synthesized by self-assembly of thiol-modified periodic mesoporous organosilica (PMO) nanoparticles, coated gold nanoparticles (AuNPs), and mesostructured titanium dioxide (TiO2). Dye-loaded PMO-Au@TiO2 nanotablets are shown to respond to environmental changes (pH, temperature, and light) to achieve controlled release. PMID:26418053

  3. Facile Synthesis of Yolk-Shell-Structured Triple-Hybridized Periodic Mesoporous Organosilica Nanoparticles for Biomedicine.

    PubMed

    Teng, Zhaogang; Zhang, Junjie; Li, Wei; Zheng, Yuanyi; Su, Xiaodan; Tang, Yuxia; Dang, Meng; Tian, Ying; Yuwen, Lihui; Weng, Lixing; Lu, Guangming; Wang, Lianhui

    2016-07-01

    The synthesis of mesoporous nanoparticles with controllable structure and organic groups is important for their applications. In this work, yolk-shell-structured periodic mesoporous organosilica (PMO) nanoparticles simultaneously incorporated with ethane-, thioether-, and benzene-bridged moieties are successfully synthesized. The preparation of the triple-hybridized PMOs is via a cetyltrimethylammonium bromide-directed sol-gel process using mixed bridged silsesquioxanes as precursors and a following hydrothermal treatment. The yolk-shell-structured triple-hybridized PMO nanoparticles have large surface area (320 m(2) g(-1) ), ordered mesochannels (2.5 nm), large pore volume (0.59 cm(3) g(-1) ), uniform and controllable diameter (88-380 nm), core size (22-110 nm), and shell thickness (13-45 nm). In vitro cytotoxicity, hemolysis assay, and histological studies demonstrate that the yolk-shell-structured triple-hybridized PMO nanoparticles have excellent biocompatibility. Moreover, the organic groups in the triple-hybridized PMOs endow them with an ability for covalent connection of near-infrared fluorescence dyes, a high hydrophobic drug loading capacity, and a glutathione-responsive drug release property, which make them promising candidates for applications in bioimaging and drug delivery. PMID:27183872

  4. Iridium-bipyridine periodic mesoporous organosilica catalyzed direct C-H borylation using a pinacolborane.

    PubMed

    Maegawa, Yoshifumi; Inagaki, Shinji

    2015-08-01

    Heterogeneous catalysis for direct C-H borylation of arenes and heteroarenes in the combination of iridium (Ir) complex fixed on periodic mesoporous organosilica containing bipyridine ligands within the framework (Ir-BPy-PMO) and pinacolborane (HBpin) is reported. Ir-BPy-PMO showed higher catalytic activity toward the borylation of benzene with inexpensive HBpin compared to expensive bis(pinacolato)diboron (B2pin2). The precatalyst could be handled without the use of a glove box. The catalyst was easily recovered from reaction mixtures by simple filtration under air. The recovered catalyst still showed good catalytic activity for at least three more times for the borylation of benzene. A variety of arenes and heteroarenes were successfully borylated with high boron efficiency by Ir-BPy-PMO using HBpin, whereas almost no activity was observed for borylation of some heteroarenes with B2pin2. The system using Ir-BPy-PMO and HBpin was also utilized in syntheses of multi-boronated thiophene-based building blocks containing ladder-, acenefused-, and fused-thiophene skeletons. The combination of a stable and reusable solid catalyst and inexpensive HBpin is expected to be superior to conventional approaches for the development of industrial applications. PMID:25748945

  5. Light-harvesting three-chromophore systems based on biphenyl-bridged periodic mesoporous organosilica.

    PubMed

    Grösch, Lyubov; Lee, Young Joo; Hoffmann, Frank; Fröba, Michael

    2015-01-01

    Three-chromophore systems with light-harvesting behavior were prepared, which are based on periodic mesoporous organosilica (PMO) with crystal-like ordered structure. The organic bridges of biphenyl-PMO in the pore walls act as donors and two types of dye are incorporated in the one-dimensional channels. Consecutive two-step-Förster resonance energy transfer is observed from the biphenyl moieties to mediators (diethyl-aminocoumarin or aminoacridone), followed by energy transfer from mediators to acceptors (dibenzothiacarbocyanine, indodicarbocyanine, sulforhodamine G). High energy-transfer efficiencies ranging from 70 to 80 % are obtained for two-step-FRET, indicating that the mesochannel structure with one-dimensional ordering provides spatial arrangement of chromophore pairs for an efficient direct energy transfer. The emission wavelength can be tuned by a choice of acceptor dye: 477 nm (diethylaminocoumarin), 519 nm (aminoacridone), 567 nm (sulforhodamine G), 630 nm (dibenzothiacarbocyanine), and 692 nm (indodicarbocyanine). PMID:25352478

  6. Enantiomorphous Periodic Mesoporous Organosilica-Based Nanocomposite Hydrogel Scaffolds for Cell Adhesion and Cell Enrichment.

    PubMed

    Kehr, Nermin Seda

    2016-03-14

    The chemical functionalization of nanomaterials with bioactive molecules has been used as an effective tool to mimic extracellular matrix (ECM) and to study the cell-material interaction in tissue engineering applications. In this respect, this study demonstrates the use of enantiomerically functionalized periodic mesoporous organosilicas (PMO) for the generation of new multifunctional 3D nanocomposite (NC) hydrogels to control the affinity of cells to the hydrogel surfaces and so to control the enrichment of cells and simultaneous drug delivery in 3D network. The functionalization of PMO with enantiomers of bioactive molecules, preparation of their nanocomposite hydrogels, and the stereoselective interaction of them with selected cell types are described. The results show that the affinity of cells to the respective NC hydrogel scaffolds is affected by the nature of the biomolecule and its enantiomers, which is more pronounced in serum containing media. The differentiation of enantiomorphous NC hydrogels by cells is used to enrich one cell type from a mixture of two cells. Finally, PMO are utilized as nanocontainers to release two different dye molecules as a proof of principle for multidrug delivery in 3D NC hydrogel scaffolds. PMID:26811946

  7. A zinc phthalocyanine based periodic mesoporous organosilica exhibiting charge transfer to fullerenes.

    PubMed

    Auras, Florian; Li, Yan; Löbermann, Florian; Döblinger, Markus; Schuster, Jörg; Peter, Laurence M; Trauner, Dirk; Bein, Thomas

    2014-11-10

    Periodic mesoporous organosilica (PMO) materials offer a strategy to position molecular semiconductors within a highly defined, porous network. We developed thin films of a new semiconducting zinc phthalocyanine-bridged PMO exhibiting a face-centered orthorhombic pore structure with an average pore diameter of 11 nm. The exceptional degree of order achieved with this PMO enabled us to create thin films consisting of a single porous domain throughout their entire thickness, thus providing maximal accessibility for subsequent incorporation of a complementary phase. The phthalocyanine building blocks inside the pore walls were found to be well-aggregated, enabling electronic conductivity and extending the light-harvesting capabilities to the near IR region. Ordered 3D heterojunctions capable of promoting photo-induced charge transfer were constructed by impregnation of the PMO with a fullerene derivative. When integrated into a photovoltaic device, the infiltrated PMO is capable of producing a high open-circuit voltage and a considerable photocurrent, which represents a significant step towards potential applications of PMOs in optoelectronics. PMID:25293365

  8. Clickable Periodic Mesoporous Organosilica Monolith for Highly Efficient Capillary Chromatographic Separation.

    PubMed

    Wu, Ci; Liang, Yu; Yang, Kaiguang; Min, Yi; Liang, Zhen; Zhang, Lihua; Zhang, Yukui

    2016-02-01

    A novel clickable periodic mesoporous organosilica monolith with the surface area up to 1707 m(2) g(-1) was in situ synthesized in the capillary by the one-step condensation of the organobridged-bonded alkoxysilane precursor bis(triethoxysilyl)ethylene. With Si-C bonds in the skeleton, the monolith possesses excellent chemical and mechanical stability. With vinyl groups highly loaded and homogeneously distributed throughout the structure, the monolith can be readily functionalized with functional groups by effective thiol-ene "click" chemistry reaction. Herein, with "click" modification of C18, the obtained monolith was successfully applied for capillary liquid chromatographic separation of small molecules and proteins. The column efficiency could reach 148,000 N/m, higher than most reported hybrid monoliths. Moreover, intact proteins could be separated well with good reproducibility, even after the monolithic column was exposed by basic mobile phase (pH 10.0) overnight, demonstrating the great promising of such monolith for capillary chromatographic separation. PMID:26751092

  9. Synthesis of Coesite Nanocrystals from Periodic Mesoporous Organosilicas (PMOs) at High Pressure and Temperature

    NASA Astrophysics Data System (ADS)

    Liang, Z.; Fei, Y.; Landskron, K.

    2009-12-01

    Experiments were performed to synthesize coesite nanocrystals under high P-T conditions using a multi-anvil apparatus. Periodic mesoporous organosilicas (PMOs) with ethylene (CH2CH2) groups (Et-PMO) and methylene (CH2) groups (Me-PMO) were chosen as the starting materials. Each type of the PMOs were heated to 150 °C, 300 °C, 450°C, and 600°C at the pressure of 12 GPa in the multi-anvil apparatus. Each sample was then quenched after holding at its final temperature for 15 minutes. Wide-angle x-ray diffraction (WAXD) patterns showed that the crystallization began to occur at 300 °C for both Et-PMO and Me-PMO. Silica in the coesite phase was obtained as the final product for either PMO in the experiments at 300 °C, 450°C, and 600°C while the products of experiments at 150°C remained as amorphous silica. Scanning electron microscopy (SEM) revealed nanocrystals as the morphology for both the Et-PMO and Me-PMO that were treated at 300 °C. Crystal growth was observed as the temperature increased for either type of PMO. Coesite nanocrystals with rod-like morphology were also found in the sample obtained from Et-PMO quenched from 600 °C. The formation of coesite at 12 GPa indicates a kinetically controlled crystallization of silica due to the mesoporous nature of PMOs and the mild synthesis temperatures. The different crystal morphologies observed for the coesite obtained from Et-PMO and Me-PMO treated under the same P-T condition show that the presence of various organic functional groups in PMO could affect the crystallization process. Coesite nanocrystals with sizes of 100 - 200 nm were synthesized from Me-PMO under 12 GPa at 300 °C in the multi-anvil apparatus.

  10. Smart Cancer Cell Targeting Imaging and Drug Delivery System by Systematically Engineering Periodic Mesoporous Organosilica Nanoparticles.

    PubMed

    Lu, Nan; Tian, Ying; Tian, Wei; Huang, Peng; Liu, Ying; Tang, Yuxia; Wang, Chunyan; Wang, Shouju; Su, Yunyan; Zhang, Yunlei; Pan, Jing; Teng, Zhaogang; Lu, Guangming

    2016-02-10

    The integration of diagnosis and therapy into one nanoplatform, known as theranostics, has attracted increasing attention in the biomedical areas. Herein, we first present a cancer cell targeting imaging and drug delivery system based on engineered thioether-bridged periodic mesoporous organosilica nanoparticles (PMOs). The PMOs are stably and selectively conjugated with near-infrared fluorescence (NIRF) dye Cyanine 5.5 (Cy5.5) and anti-Her2 affibody on the outer surfaces to endow them with excellent NIRF imaging and cancer targeting properties. Also, taking the advantage of the thioether-group-incorporated mesopores, the release of chemotherapy drug doxorubicin (DOX) loaded in the PMOs is responsive to the tumor-related molecule glutathione (GSH). The drug release percentage reaches 84.8% in 10 mM of GSH solution within 24 h, which is more than 2-fold higher than that without GSH. In addition, the drug release also exhibits pH-responsive, which reaches 53.6% at pH 5 and 31.7% at pH 7.4 within 24 h. Confocal laser scanning microscopy and flow cytometry analysis demonstrate that the PMOs-based theranostic platforms can efficiently target to and enter Her2 positive tumor cells. Thus, the smart imaging and drug delivery nanoplatforms induce high tumor cell growth inhibition. Meanwhile, the Cy5.5 conjugated PMOs perform great NIRF imaging ability, which could monitor the intracellular distribution, delivery and release of the chemotherapy drug. In addition, cell viability and histological assessments show the engineered PMOs have good biocompatibility, further encouraging the following biomedical applications. Over all, the systemically engineered PMOs can serve as a novel cancer cell targeting imaging and drug delivery platform with NIRF imaging, GSH and pH dual-responsive drug release, and high tumor cell targeting ability. PMID:26767305

  11. A Facile Multi-interface Transformation Approach to Monodisperse Multiple-Shelled Periodic Mesoporous Organosilica Hollow Spheres.

    PubMed

    Teng, Zhaogang; Su, Xiaodan; Zheng, Yuanyi; Zhang, Junjie; Liu, Ying; Wang, Shouju; Wu, Jiang; Chen, Guotao; Wang, Jiandong; Zhao, Dongyuan; Lu, Guangming

    2015-06-24

    The synthesis of well-defined and complex hollow structures via a simple method is still a major challenge. In this work, a facile and controllable "multi-interface transformation" approach for preparation of monodisperse multi-shelled periodic mesoporous organosilica (PMO) hollow spheres has been established by a one-step hydrothermal treatment of successively grown organosilica particles. The multi-shelled PMO hollow spheres have inorganic-organic hybrid frameworks, controllable number (1-4) of shells, high surface area (∼805 m(2)/g), accessible ordered mesochannels (∼3.2 nm), large pore volume (1.0 cm(3)/g), and uniform and tunable diameter (300-550 nm), chamber size (4-54 nm), and shell thickness (10-30 nm). In addition, various organic groups (alkyl, aromatic, and heteroelement fragments) are successfully incorporated into the multi-shelled PMO hollow spheres by successively adding different bridged organosilica precursors. Notably, the distribution of different kinds of organic groups in the multi-shelled PMO hollow spheres can be precisely controlled, showing great potential for future applications. We propose that the formation of the multi-shelled PMO hollow structures is ascribed to the creation of multiple highly cross-linked organosilica interfaces, providing a new and interesting fundamental principle for PMO materials. Due to their unique structure and frameworks, triple-shelled ethane-bridged PMO hollow spheres were successfully loaded with an anti-cancer drug doxorubicin and perfluoropentane gas, which present excellent effects in the killing of cancer cells and ultrasound imaging. It is expected that the multi-interface transformation strategy provides a simple, controllable, versatile, and template-free method for preparation of various multifunctional PMOs for different applications. PMID:26030506

  12. Heterocyclic tri-urea isocyanurate bridged groups modified periodic mesoporous organosilica synthesized for Fe(III) adsorption

    NASA Astrophysics Data System (ADS)

    Rana, Vijay Kumar; Selvaraj, M.; Parambadath, Surendran; Chu, Sang-Wook; Park, Sung Soo; Mishra, Satyendra; Singh, Raj Pal; Ha, Chang-Sik

    2012-10-01

    To achieve a high level of heavy metal adsorption, 1,1',1″-(1,3,5-triazine-2,4,6-triyl)tris(3-(3-(triethoxysilyl)propyl)urea) (TTPU) was synthesized as a novel melamine precursor and incorporated on the silica surface of periodic mesoporous organosilica (PMO). The melamine modified PMOs (MPMOs) were synthesized under acidic conditions using TTPU, tetraethylorthosilicate (TEOS) and Pluronic P123 as a template and the modified PMOs were characterized using the relevant instrumental techniques. The characteristic materials were used as adsorbents for the adsorption of Fe(III) ions. Fe(III) adsorption studies revealed MPMO-7.5 to be a good absorbent with higher adsorption efficiency than other MPMOs.

  13. Effect of carboxylic acid of periodic mesoporous organosilicas on the fructose-to-5-hydroxymethylfurfural conversion in dimethylsulfoxide systems

    NASA Astrophysics Data System (ADS)

    Dutta, Saikat; Kao, Hsien-Ming; Wu, Kevin C.-W.

    2014-11-01

    This manuscript presents the preparation and catalytic application of highly ordered benzene bridged periodic mesoporous organosilicas (PMOs) functionalized with carboxylic acid (-COOH) group at varied density. The COOH-functionalized PMOs were synthesized by one-step condensation of 1,4-bis (triethoxysilyl) benzene and carboxylic group containing organosilane carboxyethylsilanetriol sodium salt using Brij-76 as the template. The obtained materials were characterized by a mean of methods including powder X-ray diffraction, nitrogen adsorption-desorption, scanning- and transmission electron microscopy, and 13C solid-state nuclear magnetic resonance measurements. The potentials of the obtained PMO materials with ordered mesopores were examined as solid catalysts for the chemical conversion of fructose to 5-hydroxymethylfurfural (HMF) in an organic solvent. The results showed that COOH-functionalized PMO with 10% COOH loading exhibited best results for the fructose to HMF conversion and selectivity. The high surface area, the adequate density acid functional group, and the strength of the PMO materials contributing to a promising catalytic ability were observed.

  14. Effect of carboxylic acid of periodic mesoporous organosilicas on the fructose-to-5-hydroxymethylfurfural conversion in dimethylsulfoxide systems

    SciTech Connect

    Dutta, Saikat; Wu, Kevin C.-W. E-mail: kevinwu@ntu.edu.tw; Kao, Hsien-Ming E-mail: kevinwu@ntu.edu.tw

    2014-11-01

    This manuscript presents the preparation and catalytic application of highly ordered benzene bridged periodic mesoporous organosilicas (PMOs) functionalized with carboxylic acid (–COOH) group at varied density. The COOH-functionalized PMOs were synthesized by one-step condensation of 1,4-bis (triethoxysilyl) benzene and carboxylic group containing organosilane carboxyethylsilanetriol sodium salt using Brij-76 as the template. The obtained materials were characterized by a mean of methods including powder X-ray diffraction, nitrogen adsorption-desorption, scanning- and transmission electron microscopy, and {sup 13}C solid-state nuclear magnetic resonance measurements. The potentials of the obtained PMO materials with ordered mesopores were examined as solid catalysts for the chemical conversion of fructose to 5-hydroxymethylfurfural (HMF) in an organic solvent. The results showed that COOH-functionalized PMO with 10% COOH loading exhibited best results for the fructose to HMF conversion and selectivity. The high surface area, the adequate density acid functional group, and the strength of the PMO materials contributing to a promising catalytic ability were observed.

  15. Periodic Mesoporous Organosilica Nanoparticles with Controlled Morphologies and High Drug/Dye Loadings for Multicargo Delivery in Cancer Cells.

    PubMed

    Croissant, Jonas G; Fatieiev, Yevhen; Omar, Haneen; Anjum, Dalaver H; Gurinov, Andrey; Lu, Jie; Tamanoi, Fuyuhiko; Zink, Jeffrey I; Khashab, Niveen M

    2016-07-01

    Despite the worldwide interest generated by periodic mesoporous organosilica (PMO) bulk materials, the design of PMO nanomaterials with controlled morphology remains largely unexplored and their properties unknown. In this work, we describe the first study of PMO nanoparticles (NPs) based on meta-phenylene bridges, and we conducted a comparative structure-property relationship investigation with para-phenylene-bridged PMO NPs. Our findings indicate that the change of the isomer drastically affects the structure, morphology, size, porosity and thermal stability of PMO materials. We observed a much higher porosity and thermal stability of the para-based PMO which was likely due to a higher molecular periodicity. Additionally, the para isomer could generate multipodal NPs at very low stirring speed and upon this discovery we designed a phenylene-ethylene bridged PMO with a controlled Janus morphology. Unprecedentedly high payloads could be obtained from 40 to 110 wt % regardless of the organic bridge of PMOs. Finally, we demonstrate for the first time the co-delivery of two cargos by PMO NPs. Importantly, the cargo stability in PMOs did not require the capping of the pores, unlike pure silica, and the delivery could be autonomously triggered in cancer cells by acidic pH with nearly 70 % cell killing. PMID:27245497

  16. Pickering emulsion stabilized by lipase-containing periodic mesoporous organosilica particles: a robust biocatalyst system for biodiesel production.

    PubMed

    Jiang, Yanjun; Liu, Xinlong; Chen, Yafei; Zhou, Liya; He, Ying; Ma, Li; Gao, Jing

    2014-02-01

    A novel catalytic system of Pickering emulsion stabilized by lipase-containing periodic mesoporous organosilica was constructed (named LP@PE) and used as biocatalyst for biodiesel production. The reaction parameters were optimized and the optimum conditions were as follows: the water fraction 0.65%, molar ratio of ethanol to oleic acid 2:1, immobilized lipase particles 150mg, phosphate buffer pH 7.0 and temperature 30°C. Under these conditions, the maximum biodiesel yield obtained via esterification of oleic acid with ethanol could reach 95.8%. The biodiesel yield could maintain 88.6% after LP@PE was used 15times. The LP@PE was also used in the synthesis of biodiesel from Jatropha curcas oil. The highest yield could reach 87.1% and the yield was 73.0% after 10 cycles. All these results demonstrated that Pickering emulsion system stabilized by immobilized enzyme may possess much potential in many enzymatic industrial applications. PMID:24368276

  17. Probing framework-guest interactions in phenylene-bridged periodic mesoporous organosilica using spin-probe EPR.

    PubMed

    Lin, Feng; Meng, Xiangyan; Mertens, Myrjam; Cool, Pegie; Van Doorslaer, Sabine

    2014-11-01

    The pore walls of phenylene-bridged periodic mesoporous organosilicas (B-PMOs) can be crystal-like or amorphous depending on the synthesis conditions. Here, spin-probe electron paramagnetic resonance (EPR) is used to monitor the adsorption of nitroxide radicals on three types of B-PMO with varying pore size and wall characteristics. Nitroxide radicals with varying polarity are chosen as probes to mimic guest molecules with different properties. The study shows that the B-PMO materials with amorphous walls allow an overall better adsorption of the spin probes than the one with crystalline walls, independent of the nature of the spin probe. The effect of hydration of the guest-host system on the mobility of the spin probe molecule depends more on the nature of the spin probe than on the B-PMO material. Comparison of the spin-probe adsorption on B-PMOs and ethylene-bridged PMO materials shows the sensitivity of the mobility of the guest molecule to the nature of the organic group. PMID:25231242

  18. Synthesis of highly phosphonic acid functionalized benzene-bridged periodic mesoporous organosilicas for use as efficient dye adsorbents.

    PubMed

    Deka, Juti Rani; Liu, Chia-Ling; Wang, Tzu-Hua; Chang, Wei-Chieh; Kao, Hsien-Ming

    2014-08-15

    Periodic mesoporous organosilicas (PMOs) with benzene bridging groups in the silica wall were functionalized with a tunable content of phosphonic acid groups. These bifunctional materials were synthesized by co-condensation of two different organosilane precursors, that is, 1,4-bis(triethoxysilyl)benzene (BTEB) and sodium 3-(trihydroxysilyl)propyl methyl phosphate (SPMP), under acidic conditions using nonionic surfactant Brij-S10 as template. The materials exhibited well-ordered mesostructures and were characterized by X-ray diffraction, nitrogen sorption, TEM, TGA, FTIR, and solid-state NMR measurements. The materials thus obtained were employed as adsorbents to remove different types of dyes, for example, cationic dyes methylene blue and phenosafranine, anionic orange II, and amphoteric rhodamine B, from aqueous solutions. The materials exhibited a remarkably high adsorption capacity than activated carbon due to their ordered mesostructures, a large number of phosphonic acid groups, and high surface areas. The adsorption was mainly governed by electrostatic interaction, but also involved π-π stacking interaction as well as hydrogen bonding. The adsorption kinetics can be better fitted by the pseudo-second order model. The adsorption process was controlled by the mechanisms of external mass transfer and intraparticle diffusion. The materials retained more than 97% dye removal efficiency after use for five consecutive cycles. PMID:25010459

  19. Synthesis and properties of 1,3,5-benzene periodic mesoporous organosilica (PMO): novel aromatic PMO with three point attachments and unique thermal transformations.

    PubMed

    Kuroki, Masakatsu; Asefa, Tewodros; Whitnal, Wesley; Kruk, Michal; Yoshina-Ishii, Chiaki; Jaroniec, Mietek; Ozin, Geoffrey A

    2002-11-20

    A new aromatic periodic mesoporous organosilica material containing benzene functional groups that are symmetrically integrated with three silicon atoms in an organosilica mesoporous framework is reported. The material has a high surface area, well-ordered mesoporous structure and thermally stable framework aromatic groups. The functional aromatic moieties were observed to undergo sequential thermal transformation from a three to two and then to a one point attachment within the framework upon continuous thermolysis under air before eventually being converted to periodic mesoporous silica devoid of aromatic groups at high temperatures and longer pyrolysis times. The mesoporosity of the material was characterized by powder X-ray diffraction (PXRD), transmission electron microscopy (TEM), and nitrogen porosimetry, whereas the presence and transformation of the aromatic groups in the walls of the materials were characterized by solid-state NMR spectroscopy, mass spectrometry, and thermogravimetric analysis. The attachment of a benzene ring symmetrically onto three siloxanes of the framework was used advantageously as a cross-linker to enhance the thermal stability of the organic group. Some of these properties are investigated in comparison with other aromatic PMOs that have only two point attachments and an amorphous phenylsilica gel that has only one point attachment. The successful synthesis of the first aromatic PMO with its organic group attached within the framework through more than two points is an important step toward the synthesis of PMOs having organic groups with more complex and multiple attachments within the framework. PMID:12431120

  20. Near-IR squaraine dye–loaded gated periodic mesoporous organosilica for photo-oxidation of phenol in a continuous-flow device

    PubMed Central

    Borah, Parijat; Sreejith, Sivaramapanicker; Anees, Palapuravan; Menon, Nishanth Venugopal; Kang, Yuejun; Ajayaghosh, Ayyappanpillai; Zhao, Yanli

    2015-01-01

    Periodic mesoporous organosilica (PMO) has been widely used for the fabrication of a variety of catalytically active materials. We report the preparation of novel photo-responsive PMO with azobenzene-gated pores. Upon activation, the azobenzene gate undergoes trans-cis isomerization, which allows an unsymmetrical near-infrared squaraine dye (Sq) to enter into the pores. The gate closure by cis-trans isomerization of the azobenzene unit leads to the safe loading of the monomeric dye inside the pores. The dye-loaded and azobenzene-gated PMO (Sq-azo@PMO) exhibits excellent generation of reactive oxygen species upon excitation at 664 nm, which can be effectively used for the oxidation of phenol into benzoquinone in aqueous solution. Furthermore, Sq-azo@PMO as the catalyst was placed inside a custom-built, continuous-flow device to carry out the photo-oxidation of phenol to benzoquinone in the presence of 664-nm light. By using the device, about 23% production of benzoquinone with 100% selectivity was achieved. The current research presents a prototype of transforming heterogeneous catalysts toward practical use. PMID:26601266

  1. Near-IR squaraine dye-loaded gated periodic mesoporous organosilica for photo-oxidation of phenol in a continuous-flow device.

    PubMed

    Borah, Parijat; Sreejith, Sivaramapanicker; Anees, Palapuravan; Menon, Nishanth Venugopal; Kang, Yuejun; Ajayaghosh, Ayyappanpillai; Zhao, Yanli

    2015-09-01

    Periodic mesoporous organosilica (PMO) has been widely used for the fabrication of a variety of catalytically active materials. We report the preparation of novel photo-responsive PMO with azobenzene-gated pores. Upon activation, the azobenzene gate undergoes trans-cis isomerization, which allows an unsymmetrical near-infrared squaraine dye (Sq) to enter into the pores. The gate closure by cis-trans isomerization of the azobenzene unit leads to the safe loading of the monomeric dye inside the pores. The dye-loaded and azobenzene-gated PMO (Sq-azo@PMO) exhibits excellent generation of reactive oxygen species upon excitation at 664 nm, which can be effectively used for the oxidation of phenol into benzoquinone in aqueous solution. Furthermore, Sq-azo@PMO as the catalyst was placed inside a custom-built, continuous-flow device to carry out the photo-oxidation of phenol to benzoquinone in the presence of 664-nm light. By using the device, about 23% production of benzoquinone with 100% selectivity was achieved. The current research presents a prototype of transforming heterogeneous catalysts toward practical use. PMID:26601266

  2. Dipolar rotors orderly aligned in mesoporous fluorinated organosilica architectures.

    PubMed

    Bracco, Silvia; Beretta, Mario; Cattaneo, Alice; Comotti, Angiolina; Falqui, Andrea; Zhao, Ke; Rogers, Charles; Sozzani, Piero

    2015-04-13

    New mesoporous covalent frameworks, based on hybrid fluorinated organosilicas, were prepared to realize a periodic architecture of fast molecular rotors containing dynamic dipoles in their structure. The mobile elements, designed on the basis of fluorinated p-divinylbenzene moieties, were integrated into the robust covalent structure through siloxane bonds, and showed not only the rapid dynamics of the aromatic rings (ca. 10(8) Hz at 325 K), as detected by solid-state NMR spectroscopy, but also a dielectric response typical of a fast dipole reorientation under the stimuli of an applied electric field. Furthermore, the mesochannels are open and accessible to diffusing in gas molecules, and rotor mobility could be individually regulated by I2 vapors. The iodine enters the channels of the periodic structure and reacts with the pivotal double bonds of the divinyl-fluoro-phenylene rotors, affecting their motion and the dielectric properties. PMID:25689486

  3. A metal-ion-assisted assembly approach to synthesize disulfide-bridged periodical mesoporous organosilicas with high sulfide contents and efficient adsorption

    NASA Astrophysics Data System (ADS)

    Hao, Na; Han, Lu; Yang, Yunxia; Wang, Huanting; Webley, Paul A.; Zhao, Dongyuan

    2010-06-01

    Well-ordered two-dimensional (2D) hexagonal periodic mesoporous organosilicas (PMOs) with a high content of disulfide groups have been prepared by a simple metal-ions-assisted amphiphilic surfactant templating process under a strong acidic condition. Long-chain organic bridge silane, bis(triethoxysilylpropyl)disulfide (BTSPDS) was used as a precursor which can be co-condensed with tetraethoxysilane (TEOS) to assemble with the triblock copolymer Pluronic P123 template and to construct the mesostructured organic-inorganic frameworks. The content of disulfide functional groups is up to 20% (BTSPDS molar content in the initial silane mixture) incorporated into the framework. The obtained ordered mesoporous DS-PMO materials have relatively high BET surface area (˜580 m 2/g), large uniform pore size (up to 6.3 nm) and thick pore walls (thickness up to 7.1 nm), because of the long-chain disulfide bridges. The metal ions such as Zn 2+ formed the four-coordination complex with two sulfides of BTSPDS and ethylene oxide moieties of P123 template, which could enhance the interaction between the "soft" long disulfide groups and P123 template, thus improving the mesostructural regularity correspondingly. The disulfide-bridged PMO materials exhibit excellent hydrothermal stability in boiling water for 5 days, probably due to the thick pore walls. SEM images show that after the hydrothermal treatment, the morphology of the ordered disulfide-bridged PMO materials is retained, as that of the wheat-like SBA-15. Excellent adsorption efficiency (˜716 mg/g) for Hg 2+ ions is observed, suggesting a potential application in removal of heavy metal ions in wastewater.

  4. Direct-synthesis method towards copper-containing periodic mesoporous organosilicas: detailed investigation of the copper distribution in the material.

    PubMed

    Lin, Feng; Meng, Xiangyan; Kukueva, Elena; Altantzis, Thomas; Mertens, Myrjam; Bals, Sara; Cool, Pegie; Van Doorslaer, Sabine

    2015-06-01

    Three-dimensional cubic Fm3[combining macron]m mesoporous copper-containing ethane-bridged PMO materials have been prepared through a direct-synthesis method at room temperature in the presence of cetyltrimethylammonium bromide as surfactant. The obtained materials have been unambiguously characterized in detail by several sophisticated techniques, including XRD, UV-Vis-Dr, TEM, elemental mapping, continuous-wave and pulsed EPR spectroscopy. The results show that at lower copper loading, the Cu(2+) species are well dispersed in the Cu-PMO materials, and mainly exist as mononuclear Cu(2+) species. At higher copper loading amount, Cu(2+) clusters are observed in the materials, but the distribution of the Cu(2+) species is still much better in the Cu-PMO materials prepared through the direct-synthesis method than in a Cu-containing PMO material prepared through an impregnation method. Moreover, the evolution of the copper incorporation during the PMO synthesis has been followed by EPR. The results show that the immobilization of the Cu(2+) ion/complex and the formation of the PMO materials are taking place simultaneously. The copper ions are found to be situated on the inner surface of the mesopores of the materials and are accessible, which will be beneficial for the catalytic applications. PMID:25945682

  5. Mesoporous hybrid organosilica containing urethane moieties

    SciTech Connect

    Seo, You-Kyong; Park, Sung-Bae; Ho Park, Dong . E-mail: chempdh@inje.ac.kr

    2006-04-15

    Mesoporous hybrid material containing urethane moieties in functionalized long chain organic group have been synthesized by using bis[3-(triethoxysilyl) propyl urethane]ethane (BTESPUE) and tetraethoxysilane as structural ingredients. The incorporation of BTESPUE within the framework of mesoporous material was confirmed by Fourier transform-infrared, X-ray photoelectron spectroscopy, solid-state NMR spectroscopy and thermogravimetric analysis. This material had a thick wall and uniform pore, which may be attributed to the hydrogen bonding inside framework due to urethane moieties.

  6. Organosilica: Chemistry of Mesoporous Organosilica in Nanotechnology: Molecularly Organic-Inorganic Hybridization into Frameworks (Adv. Mater. 17/2016).

    PubMed

    Chen, Yu; Shi, Jianlin

    2016-05-01

    Organic-inorganic hybrid materials can combine the advantages of organic and inorganic materials, and overcome their drawbacks accordingly. On page 3235, Y. Chen and J. L. Shi review and discuss research progress on the design, synthesis, structure, and composition control of organic-inorganic hybrid mesoporous organosilica nanoparticles (MONs). Extensive applications of MONs in nanotechnology, mainly in nanomedicine, nanocatalysis and nanofabrication are discussed. PMID:27122112

  7. A controllable asymmetrical/symmetrical coating strategy for architectural mesoporous organosilica nanostructures

    NASA Astrophysics Data System (ADS)

    Wang, Xue; He, Yapeng; Liu, Chong; Liu, Yunling; Qiao, Zhen-An; Huo, Qisheng

    2016-07-01

    We describe a facile and controllable asymmetrical/symmetrical coating strategy for the preparation of various novel periodic mesoporous organosilica (PMO) nanostructures, including Au&PMO Janus, Au@PMO yolk-shell and Au@PMO/mSiO2 yolk-double shell nanoparticles, by using Au@SiO2 nanoparticles as seeds. During this process, ammonia first functions as a basic catalyst facilitating the hydrolyzation and condensation of the organosilica precursor, and additionally as an etching agent selectively in situ dissolving the SiO2 shells of Au@SiO2 nanoparticles to form these unique nanostructures. All these three types of nanoparticles have high surface areas, large pore volumes and tailorable cavity structures. Both the Au&PMO and Au@PMO nanoparticles exhibit excellent catalytic activity for the decomposition of H2O2 and the reduction of 4-nitrophenol. Based on these unique structural merits and organic-inorganic hybrid components, the fabricated Janus and hollow PMO nanoparticles show much improved hemocompatibility, which could be further applied in nano-biomedicines without the need for surface modification.We describe a facile and controllable asymmetrical/symmetrical coating strategy for the preparation of various novel periodic mesoporous organosilica (PMO) nanostructures, including Au&PMO Janus, Au@PMO yolk-shell and Au@PMO/mSiO2 yolk-double shell nanoparticles, by using Au@SiO2 nanoparticles as seeds. During this process, ammonia first functions as a basic catalyst facilitating the hydrolyzation and condensation of the organosilica precursor, and additionally as an etching agent selectively in situ dissolving the SiO2 shells of Au@SiO2 nanoparticles to form these unique nanostructures. All these three types of nanoparticles have high surface areas, large pore volumes and tailorable cavity structures. Both the Au&PMO and Au@PMO nanoparticles exhibit excellent catalytic activity for the decomposition of H2O2 and the reduction of 4-nitrophenol. Based on these unique

  8. Efficient drug metabolism strategy based on microsome-mesoporous organosilica nanoreactors.

    PubMed

    Fang, Xiaoni; Zhang, Peng; Qiao, Liang; Feng, Xiaoyan; Zhang, Xiangmin; Girault, Hubert H; Liu, Baohong

    2014-11-01

    A rapid and accurate in vitro drug metabolism strategy has been proposed based on the design of a biomimetic nanoreactor composed of amino-functionalized periodic mesoporous organosilica (NH2-PMO) and microsomes. The amphiphilic nature and positive charge of NH2-PMO make it highly suited for the immobilization of hydrophobic and negatively charged microsomes to form nanoreactors, which can in turn extract substrates from solutions. Such nanoreactors provide a suitable environment to confine multiple enzymes and substrates with high local concentrations, as well as to maintain their catalytic activities for rapid and highly effective drug metabolic reactions. Coupled with high-performance liquid chromatography-mass spectrometry analysis, the metabolites of nifedipine and testosterone were quantitatively characterized, and the reaction kinetics was evaluated. Both the metabolism conversion and reaction rate were significantly improved with the NH2-PMO nanoreactors compared to bulk reactions. This strategy is simple and cost-effective for promising advances in biomimetic metabolism study. PMID:25313798

  9. Chemistry of Mesoporous Organosilica in Nanotechnology: Molecularly Organic-Inorganic Hybridization into Frameworks.

    PubMed

    Chen, Yu; Shi, Jianlin

    2016-05-01

    Organic-inorganic hybrid materials aiming to combine the individual advantages of organic and inorganic components while overcoming their intrinsic drawbacks have shown great potential for future applications in broad fields. In particular, the integration of functional organic fragments into the framework of mesoporous silica to fabricate mesoporous organosilica materials has attracted great attention in the scientific community for decades. The development of such mesoporous organosilica materials has shifted from bulk materials to nanosized mesoporous organosilica nanoparticles (designated as MONs, in comparison with traditional mesoporous silica nanoparticles (MSNs)) and corresponding applications in nanoscience and nanotechnology. In this comprehensive review, the state-of-art progress of this important hybrid nanomaterial family is summarized, focusing on the structure/composition-performance relationship of MONs of well-defined morphology, nanostructure, and nanoparticulate dimension. The synthetic strategies and the corresponding mechanisms for the design and construction of MONs with varied morphologies, compositions, nanostructures, and functionalities are overviewed initially. Then, the following part specifically concentrates on their broad spectrum of applications in nanotechnology, mainly in nanomedicine, nanocatalysis, and nanofabrication. Finally, some critical issues, presenting challenges and the future development of MONs regarding the rational synthesis and applications in nanotechnology are summarized and discussed. It is highly expected that such a unique molecularly organic-inorganic nanohybrid family will find practical applications in nanotechnology, and promote the advances of this discipline regarding hybrid chemistry and materials. PMID:26936391

  10. Aerosol-assisted synthesis of mesoporous organosilica microspheres with controlled organic contents

    NASA Astrophysics Data System (ADS)

    Yamauchi, Yusuke; Suzuki, Norihiro; Gupta, Prashant; Sato, Keisuke; Fukata, Naoki; Murakami, Miwa; Shimizu, Tadashi; Inoue, Satoru; Kimura, Tatsuo

    2009-04-01

    Periodic mesoporous organosilica (PMO) spherical particles with different organic contents were synthesized in one pot by reacting 1,2-bis(triethoxysilyl)ethane (BTSE) with tetraethylorthosilicate (TEOS) using a spray-drying technique. The scanning electron microscopy observation of spray-dried products clearly showed the formation of spherical particles. The 29Si magic angle spinning nuclear magnetic resonance data revealed that the organic contents due to ethane fragments embedded in the frameworks were controllable and consistent with the BTSE/TEOS molar ratios of precursor solutions. Transmission electron microscopy, small-angle x-ray scattering, and N2 adsorption data of PMO with controlled organic contents indicated that the ethane fragments were embedded in the frameworks with the formation of ordered mesostructures. PMO with a high organic content (BTSE/TEOS=0.50) only showed a hydrophobic property. According to the same procedure, benzene groups were also integrated to a similar degree in the frameworks by using 1,4-bis(triethoxysilyl)benzene.

  11. Mesoporous organosilica nanotubes containing a chelating ligand in their walls

    NASA Astrophysics Data System (ADS)

    Liu, Xiao; Goto, Yasutomo; Maegawa, Yoshifumi; Ohsuna, Tetsu; Inagaki, Shinji

    2014-11-01

    We report the synthesis of organosilica nanotubes containing 2,2'-bipyridine chelating ligands within their walls, employing a single-micelle-templating method. These nanotubes have an average pore diameter of 7.8 nm and lengths of several hundred nanometers. UV-vis absorption spectra and scanning transmission electron microscopy observations of immobilized nanotubes with an iridium complex on the bipyridine ligands showed that the 2,2'-bipyridine groups were homogeneously distributed in the benzene-silica walls. The iridium complex, thus, immobilized on the nanotubes exhibited efficient catalytic activity for water oxidation using Ce4+, due to the ready access of reactants to the active sites in the nanotubes.

  12. Mesoporous organosilica nanotubes containing a chelating ligand in their walls

    SciTech Connect

    Liu, Xiao; Goto, Yasutomo; Maegawa, Yoshifumi; Inagaki, Shinji

    2014-11-01

    We report the synthesis of organosilica nanotubes containing 2,2′-bipyridine chelating ligands within their walls, employing a single-micelle-templating method. These nanotubes have an average pore diameter of 7.8 nm and lengths of several hundred nanometers. UV-vis absorption spectra and scanning transmission electron microscopy observations of immobilized nanotubes with an iridium complex on the bipyridine ligands showed that the 2,2′-bipyridine groups were homogeneously distributed in the benzene-silica walls. The iridium complex, thus, immobilized on the nanotubes exhibited efficient catalytic activity for water oxidation using Ce{sup 4+}, due to the ready access of reactants to the active sites in the nanotubes.

  13. Large Pore-Sized Hollow Mesoporous Organosilica for Redox-Responsive Gene Delivery and Synergistic Cancer Chemotherapy.

    PubMed

    Wu, Meiying; Meng, Qingshuo; Chen, Yu; Zhang, Lingxia; Li, Mengli; Cai, Xiaojun; Li, Yaping; Yu, Pengcheng; Zhang, Linlin; Shi, Jianlin

    2016-03-01

    A stability-difference-selective bond-breakage strategy for the fabrication of largepore-sized hollow mesoporous organosilica nanoparticles (HMONs) is successfully developed. Moreover, surfacefunctionalized HMONs are successfully constructed to simultaneously deliver P-gp modulator siRNA and anticancer drug doxorubicin to reverse the multidrug resistance of cancer cells. PMID:26743228

  14. Mesoporous organosilicas functionalized by alkyl groups: Synthesis, structure and adsorption properties

    NASA Astrophysics Data System (ADS)

    Barczak, M.; Dąbrowski, A.; Iwan, M.; Rzączyńska, Z.

    2009-01-01

    Mesoporous organosilicas were synthesized by sol-gel co-condensation of tetraethoxysilane and appropriate alkoxysilanes in the presence of Pluronic P123 surfactant. Hexyl, dodecyl, and octadecyl alkyl chains have been incorporated into mesopores by such co-condensation. Obtained materials were characterized by X-ray diffraction, FTIR spectroscopy, nitrogen adsorption measurements and thermogravimetry. Two resulted materials have highly ordered SBA-15 structure (p6m symmetry), other two are less ordered. All the materials exhibit well-developed porous structure (surface areas 500 to 830m2/g, pore volumes 0.65-1.32 cm3/g) and a high content of organic pendant groups introduced during co-condensation. All materials are thermally stable to 180°C, after that thermal decomposition of alkyl pendant groups starts.

  15. Thermal switching of the reflection in chiral nematic mesoporous organosilica films infiltrated with liquid crystals.

    PubMed

    Giese, Michael; De Witt, Joanna C; Shopsowitz, Kevin E; Manning, Alan P; Dong, Ronald Y; Michal, Carl A; Hamad, Wadood Y; MacLachlan, Mark J

    2013-08-14

    Materials that undergo stimulus-induced optical changes are important for many new technologies. In this paper, we describe a new free-standing silica-based composite film that exhibits reversible thermochromic reflection, induced by a liquid crystalline guest in the pores of iridescent mesoporous films. We demonstrate that selective reflection from the novel mesoporous organosilica material with chiral nematic organization can be reversibly switched by thermal cycling of the 8CB guest between its isotropic and liquid crystalline states, which was proven by solid-state NMR experiments. The switching of the optical properties of the chiral solid-state host by stimulus-induced transitions of the guest opens the possibility of applications for these novel materials in sensors and displays. PMID:23859140

  16. A visible-light harvesting system for CO2 reduction using a Ru(II) -Re(I) photocatalyst adsorbed in mesoporous organosilica.

    PubMed

    Ueda, Yutaro; Takeda, Hiroyuki; Yui, Tatsuto; Koike, Kazuhide; Goto, Yasutomo; Inagaki, Shinji; Ishitani, Osamu

    2015-02-01

    A photocatalytic system for CO2 reduction exhibiting visible-light harvesting was developed by preparing a hybrid consisting of a supramolecular metal complex as photocatalyst and periodic mesoporous organosilica (PMO) as light harvester. A Ru(II) Re(I) binuclear complex (RuRe) with methylphosphonic acid anchor groups was adsorbed on acridone or methylacridone embedded in the walls of PMO mesochannels to yield the hybrid structure. The embedded organic groups absorbed visible light, and the excitation energy was funneled to the Ru units. The energy accumulation was followed by electron transfer and catalytic reduction of CO2 to CO on the Re unit. The light harvesting of these hybrids enhanced the photocatalytic CO evolution rate by a factor of up to ten compared with that of RuRe adsorbed on mesoporous silica without a light harvester. PMID:25524162

  17. CO₂ adsorption on amine-functionalized periodic mesoporous benzenesilicas.

    PubMed

    Sim, Kyohyun; Lee, Nakwon; Kim, Joonseok; Cho, Eun-Bum; Gunathilake, Chamila; Jaroniec, Mietek

    2015-04-01

    CO2 adsorption was investigated on amine-functionalized mesoporous silica (SBA-15) and periodic mesoporous organosilica (PMO) samples. Hexagonally (p6mm) ordered mesoporous SBA-15 and benzene-PMO (BPMO) samples were prepared in the presence of Pluronic P123 block copolymer template under acidic conditions. Three kinds of amine-containing organosilanes and polyethylenimine were used to functionalize SBA-15 and BPMO. Small-angle X-ray scattering and nitrogen adsorption isotherms showed that these samples featured ordered mesostructure, high surface area, and narrow pore size distributions. Solid-state (13)C- and (29)Si cross-polarization magic-angle spinning NMR spectra showed chemical linkage between amine-containing modifiers and the surface of mesoporous materials. The chemically linked amine-containing modifiers were found to be on both the inner and outer surfaces. N-[3-(trimethoxysilyl)propyl]ethylenediamine-modified BPMO (A2-BPMO) sample exhibited the highest CO2 uptake (i.e., ∼3.03 mmol/g measured on a volumetric adsorption analyzer) and the fastest adsorption rate (i.e., ∼13 min to attain 90% of the maximum amount) among all the samples studied. Selectivity and reproducibility measurements for the A2-BPMO sample showed quite good performance in flowing N2 gas at 40 mL/min and CO2 gas of 60 mL/min at 25 °C. PMID:25742049

  18. Synthesis of bifunctionalized mesoporous organosilica spheres for high-performance liquid chromatography.

    PubMed

    Zhu, Guiru; Yang, Qihua; Jiang, Dongmei; Yang, Jie; Zhang, Lei; Li, Ying; Li, Can

    2006-01-27

    Phenyl-functionalized mesoporous ethane-silicas with spherical morphology were synthesized by one-step co-condensation of phenyltrimethoxysilane (PTMS) and 1,2-bis(trimethoxysily)ethane (BTME) using a triblock copolymer EO(20)PO(70)EO(20) (P123) as template with the aid of a co-surfactant (cetyltrimethylammonium bromide, CTAB) and a co-solvent (ethanol) in acidic medium. Powder X-ray diffraction (XRD), nitrogen sorption measurement and scanning electron microscopy (SEM) show that phenyl-functionalized ethane-silica has wormhole-like mesostructure and perfect spherical morphology. The chemical stability of phenyl-functionalized mesoporous ethane-silica in basic medium is greatly improved owing to the ethane groups bridged in the mesoporous framework. This work also demonstrates that the phenyl-functionalized mesoporous ethane-silica spheres are excellent packing materials for potential application in the reversed-phase high-performance liquid chromatography (HPLC). PMID:16325828

  19. Periodic organosilica hollow nanospheres as anode materials for lithium ion rechargeable batteries

    NASA Astrophysics Data System (ADS)

    Sasidharan, Manickam; Nakashima, Kenichi; Gunawardhana, Nanda; Yokoi, Toshiyuki; Ito, Masanori; Inoue, Masamichi; Yusa, Shin-Ichi; Yoshio, Masaki; Tatsumi, Takashi

    2011-11-01

    Polymeric micelles with core-shell-corona architecture have been found to be the efficient colloidal templates for synthesis of periodic organosilica hollow nanospheres over a broad pH range from acidic to alkaline media. In alkaline medium, poly (styrene-b-[3-(methacryloylamino)propyl] trimethylammonium chloride-b-ethylene oxide) (PS-PMAPTAC-PEO) micelles yield benzene-silica hollow nanospheres with molecular scale periodicity of benzene groups in the shell domain of hollow particles. Whereas, an acidic medium (pH 4) produces diverse hollow particles with benzene, ethylene, and a mixture of ethylene and dipropyldisulfide bridging functionalities using poly(styrene-b-2-vinyl pyridine-b-ethylene oxide) (PS-PVP-PEO) micelles. These hollow particles were thoroughly characterized by powder X-ray diffraction (XRD), dynamic light scattering (DLS), thermogravimetric analysis (TG/DTA), Fourier transformation infrared (FTIR) spectroscopy, transmission electron microscopy (TEM), magic angle spinning-nuclear magnetic resonance (29Si MAS NMR and 13CP-MAS NMR), Raman spectroscopy, and nitrogen adsorption/desorption analyses. The benzene-silica hollow nanospheres with molecular scale periodicity in the shell domain exhibit higher cycling performance of up to 300 cycles in lithium ion rechargeable batteries compared with micron-sized dense benzene-silica particles.Polymeric micelles with core-shell-corona architecture have been found to be the efficient colloidal templates for synthesis of periodic organosilica hollow nanospheres over a broad pH range from acidic to alkaline media. In alkaline medium, poly (styrene-b-[3-(methacryloylamino)propyl] trimethylammonium chloride-b-ethylene oxide) (PS-PMAPTAC-PEO) micelles yield benzene-silica hollow nanospheres with molecular scale periodicity of benzene groups in the shell domain of hollow particles. Whereas, an acidic medium (pH 4) produces diverse hollow particles with benzene, ethylene, and a mixture of ethylene and

  20. New strategy for surface functionalization of periodic mesoporous silica based on meso-HSiO1.5.

    PubMed

    Xie, Zhuoying; Bai, Ling; Huang, Suwen; Zhu, Cun; Zhao, Yuanjin; Gu, Zhong-Ze

    2014-01-29

    Organic functionalization of periodic mesoporous silicas (PMSs) offers a way to improve their excellent properties and wide applications owing to their structural superiority. In this study, a new strategy for organic functionalization of PMSs is demonstrated by hydrosilylation of the recently discovered "impossible" periodic mesoporous hydridosilica, meso-HSiO1.5. This method overcomes the disadvantages of present pathways for organic functionalization of PMSs with organosilica. Moreover, compared to the traditional functionalization on the surface of porous silicon by hydrosilylation, the template-synthesized meso-HSiO1.5 is more flexible to access functional-groups-loaded PMSs with adjustable microstructures. The new method and materials will have wider applications based on both the structure and surface superiorities. PMID:24432761

  1. Synthesis of periodic mesoporous silica thin films

    SciTech Connect

    Anderson, M.T.; Martin, J.E.; Odinek, J.G.; Newcomer, P.

    1996-06-01

    We have synthesized periodic mesoporous silica thin films from homogeneous solutions. To synthesize the films, a thin layer of a pH 7 micellar coating solution that contains TMOS (tetramethoxysilane) is dip or spin-coated onto Si wafers, borosilicate glass, or quartz substrates. NH3 gas is diffused into the solution and causes rapid hydrolysis and condensation of the TMOS and the formation of periodic mesoporous thin films within 10 seconds. Combination of homogenous solutions and rapid product formation maximizes the concentration of the desired product and provides a controlled, predictable microstructure. The films have been made continuous and crack-free by optimizing initial silica concentration and film thickness. The films are being evaluated as high surface area, size-selective coatings for surface acoustic wave (SAW) sensors.

  2. One-pot construction of multipodal hybrid periodic mesoporous organosilica nanoparticles with crystal-like architectures.

    PubMed

    Croissant, Jonas; Cattoën, Xavier; Wong Chi Man, Michel; Dieudonné, Philippe; Charnay, Clarence; Raehm, Laurence; Durand, Jean-Olivier

    2015-01-01

    The design of hybrid multipodal PMO (mp-PMO) nanoparticles with crystal-like architectures elaborated in a one-pot, two-step process, involving the preparation of a benzene-based spherical PMO core followed by the formation of ethylene-based rod-shaped PMO pods on these cores is described. PMID:25378091

  3. Mesoporous silica nanoparticles with organo-bridged silsesquioxane framework as innovative platforms for bioimaging and therapeutic agent delivery.

    PubMed

    Du, Xin; Li, Xiaoyu; Xiong, Lin; Zhang, Xueji; Kleitz, Freddy; Qiao, Shi Zhang

    2016-06-01

    Mesoporous silica material with organo-bridged silsesquioxane frameworks is a kind of synergistic combination of inorganic silica, mesopores and organics, resulting in some novel or enhanced physicochemical and biocompatible properties compared with conventional mesoporous silica materials with pure Si-O composition. With the rapid development of nanotechnology, monodispersed nanoscale periodic mesoporous organosilica nanoparticles (PMO NPs) and organo-bridged mesoporous silica nanoparticles (MSNs) with various organic groups and structures have recently been synthesized from 100%, or less, bridged organosilica precursors, respectively. Since then, these materials have been employed as carrier platforms to construct bioimaging and/or therapeutic agent delivery nanosystems for nano-biomedical application, and they demonstrate some unique and/or enhanced properties and performances. This review article provides a comprehensive overview of the controlled synthesis of PMO NPs and organo-bridged MSNs, physicochemical and biocompatible properties, and their nano-biomedical application as bioimaging agent and/or therapeutic agent delivery system. PMID:27017579

  4. Refractometry of organosilica microspheres

    SciTech Connect

    Seet, Katrina Y. T.; Vogel, Robert; Nieminen, Timo A.; Knoener, Gregor; Rubinsztein-Dunlop, Halina; Trau, Matt; Zvyagin, Andrei V

    2007-03-20

    The refractive index of novel organosilica (nano/micro) material is determined using two methods. The first method is based on analysis of optical extinction efficiency of organosilica beads versus wavelength, which is obtained by a standard laboratory spectrometer. The second method relies on the measurable trapping potential of these beads in the focused light beam (laser tweezers). Polystyrene beads were used to test these methods, and the determined dispersion curves of refractive-index values have been found accurate. The refractive index of organosilica beads has been determined to range from 1.60 to 1.51 over the wavelength range of300-1100 nm.

  5. Sunlight-Triggered Nanoparticle Synergy: Teamwork of Reactive Oxygen Species and Nitric Oxide Released from Mesoporous Organosilica with Advanced Antibacterial Activity.

    PubMed

    Gehring, Julia; Trepka, Bastian; Klinkenberg, Nele; Bronner, Hannah; Schleheck, David; Polarz, Sebastian

    2016-03-01

    Colonization of surfaces by microorganisms is an urging problem. In combination with the increasing antibiotic resistance of pathogenic bacteria, severe infections are reported more frequently in medical settings. Therefore, there is a large demand to explore innovative surface coatings that provide intrinsic and highly effective antibacterial activity. Materials containing silver nanoparticles have been developed in the past for this purpose, but this solution has come into criticism due to various disadvantages like notable toxicity against higher organisms, the high price, and low abundance of silver. Here, we introduce a new, sunlight-mediated organosilica nanoparticle (NP) system based on silver-free antibacterial activity. The simultaneous release of nitric oxide (NO) in combination with singlet oxygen and superoxide radicals (O2(•-)) as reactive oxygen species (ROS) leads to the emergence of highly reactive peroxynitrite molecules with significantly enhanced biocidal activity. This special cooperative effect can only be realized, if the ROS-producing moieties and the functional entities releasing NO are spatially separated from each other. In one type of particle, Rose Bengal as an efficient singlet oxygen ((1)O2) producer was covalently bound to SH functionalities applying thiol-ene click chemistry. "Charging" the second type of particles with NO was realized by quantitatively transferring the thiol groups into S-nitrosothiol functionalities. We probed the oxidation power of ROS-NP alone and in combination with NO-NP using sunlight as a trigger. The high antibacterial efficiency of dual-action nanoparticles was demonstrated using disinfection assays with the pathogenic bacterium Pseudomonas aeruginosa. PMID:26883897

  6. Directional Materials—Nanoporous Organosilica Monoliths with Multiple Gradients Prepared Using Click Chemistry.

    PubMed

    Schachtschneider, Andreas; Wessig, Martin; Spitzbarth, Martin; Donner, Adrian; Fischer, Christian; Drescher, Malte; Polarz, Sebastian

    2015-09-01

    The existence of more than one functional entity is fundamental for materials, which are desired of fulfilling complementary or succeeding tasks. Whereas it is feasible to make materials with a homogeneous distribution of two different, functional groups, cases are extremely rare exhibiting a smooth transition from one property to the next along a defined distance. We present a new approach leading to high-surface area solids with functional gradients at the microstructural level. Periodically ordered mesoporous organosilicas (PMOs) and aerogel-like monolithic bodies with a maximum density of azide groups were prepared from a novel sol-gel precursor. The controlled and fast conversion of the azide into numerous functions by click chemistry is the prerequisite for the implementation of manifold gradient profiles. Herein we discuss materials with chemical, optical and structural gradients, which are interesting for all applications requiring directionality, for example, chromatography. PMID:26190518

  7. Non-ionic block copolymers leading to a highly ordered organosilica material

    NASA Astrophysics Data System (ADS)

    Rebbin, V.; Rothkirch, A.; Vainio, U.; Funari, S. S.

    2012-03-01

    Phenylene-bridged periodic mesoporous organosilica (PMO) materials with hexaethylene glycol mono hexadecylether (C16(EO)6) as structure directing agent (SDA) in acidic solution were synthesised and the reaction was studied in different conditions, including in situ small angle X-ray scattering at room temperature and at 60 °C. The in situ SAXS investigations at 60 °C show the formation of a 2D hexagonal mesostructure after 3 hours reaction time. In contrast to these results the same reaction performed in the laboratory produced a powder that, after drying at room temperature, shows a large number of diffraction peaks, allowing identifying a lamellar structure, possibly in coexistence of a micellar cubic structure (space group Pm3n). Aposteriori removal of the surfactant from the powder synthesised in the laboratory led to the collapse of the lamellar structure.

  8. Fuel-Cell Electrolytes Based on Organosilica Hybrid Proton Conductors

    NASA Technical Reports Server (NTRS)

    Narayan, Sri R.; Yen, Shiao-Pin S.

    2008-01-01

    A new membrane composite material that combines an organosilica proton conductor with perfluorinated Nafion material to achieve good proton conductivity and high-temperature performance for membranes used for fuel cells in stationary, transportation, and portable applications has been developed. To achieve high proton conductivities of the order of 10(exp -1)S/cm over a wide range of temperatures, a composite membrane based on a new class of mesoporous, proton-conducting, hydrogen-bonded organosilica, used with Nafion, will allow for water retention and high proton conductivity over a wider range of temperatures than currently offered by Nafion alone. At the time of this reporting, this innovation is at the concept level. Some of the materials and processes investigated have shown good proton conductivity, but membranes have not yet been prepared and demonstrated.

  9. A general strategy for the rational design of size-selective mesoporous catalysts.

    PubMed

    Zapilko, Clemens; Liang, Yucang; Nerdal, Willy; Anwander, Reiner

    2007-01-01

    A series of functionalized mesoporous silicas with cagelike pore topology has been synthesized and screened for size-selective catalytic transformations. The aluminum-catalyzed Meerwein-Ponndorf-Verley (MPV) reduction of differently sized aromatic aldehydes (benzaldehyde and 1-pyrenecarbox-aldehyde) has been investigated as a test reaction. The catalysts were synthesized in a two-step grafting sequence comprising pore-size engineering of mesoporous silicas (SBA-1, SBA-2, SBA-16) with long-chain alkyl dimethylaminosilanes and surface organoaluminum chemistry with triethylaluminum [{Al(CH(2)CH(3))3}2]. Size-selective reaction behavior was found for small pore SBA-1 materials, and the selectivity could be efficiently tuned by selecting a silylating reagent of appropriate size. The results are compared with the catalytic performance of a large-pore periodic mesoporous organosilica PMO[SBA-1] and the nonporous high-surface-area silicas Aerosil 300/380. PMID:17203494

  10. Probing the molecular character of periodic mesoporous organosilicates via photoluminescence of Lewis acid-base adducts.

    PubMed

    Thiel, Indre; Fedorov, Alexey; Verel, Rene; Yakunin, Sergii; Kovalenko, Maksym V; Copéret, Christophe

    2016-05-18

    Photoluminescence decay was used as a structure-sensitive method to compare the distribution of emitting sites in periodic mesoporous organosilicates (PMOs) to their respective molecular analogs. The observed close similarity of PL decays confirms the molecular nature of PMOs and high homogeneity of emitting sites. PMID:27156706

  11. Nanocasting of Periodic Mesoporous Materials as an Effective Strategy to Prepare Mixed Phases of Titania.

    PubMed

    Mahoney, Luther; Rasalingam, Shivatharsiny; Wu, Chia-Ming; Koodali, Ranjit T

    2015-01-01

    Mesoporous titanium dioxide materials were prepared using a nanocasting technique involving silica SBA-15 as the hard-template. At an optimal loading of titanium precursor, the hexagonal periodic array of pores in SBA-15 was retained. The phases of titanium dioxide could be easily varied by the number of impregnation cycles and the nature of titanium alkoxide employed. Low number of impregnation cycles produced mixed phases of anatase and TiO₂(B). The mesoporous TiO₂ materials were tested for solar hydrogen production, and the material consisting of 98% anatase and 2% TiO₂(B) exhibited the highest yield of hydrogen from the photocatalytic splitting of water. The periodicity of the pores was an important factor that influenced the photocatalytic activity. This study indicates that mixed phases of titania containing ordered array of pores can be prepared by using the nanocasting strategy. PMID:26670222

  12. 3-D periodic mesoporous nickel oxide for nonenzymatic uric acid sensors with improved sensitivity

    NASA Astrophysics Data System (ADS)

    Huang, Wei; Cao, Yang; Chen, Yong; Zhou, Yang; Huang, Qingyou

    2015-12-01

    3-D periodic mesoporous nickel oxide (NiO) particles with crystalline walls have been synthesized through the microwave-assisted hard template route toward the KIT-6 silica. It was investigated as a nonenzymatic amperometric sensor for the detection of uric acid. 3-D periodic nickel oxide matrix has been obtained by the hard template route from the KIT-6 silica template. The crystalline nickel oxide belonged to the Ia3d space group, and its structure was characterized by X-ray diffraction (XRD), N2 adsorption-desorption, and transmission electron microscopy (TEM). The analysis results showed that the microwave-assisted mesoporous NiO materials were more appropriate to be electrochemical sensors than the traditional mesoporous NiO. Cyclic voltammetry (CV) revealed that 3-D periodic NiO exhibited a direct electrocatalytic activity for the oxidation of uric acid in sodium hydroxide solution. The enzyme-less amperometric sensor used in the detection of uric acid with detection limit of 0.005 μM (S/N = 3) over wide linear detection ranges up to 0.374 mM and with a high sensitivity of 756.26 μA mM-1 cm-2, and a possible mechanism was also given in the paper.

  13. Critical aspects in the production of periodically ordered mesoporous titania thin films.

    PubMed

    Soler-Illia, Galo J A A; Angelomé, Paula C; Fuertes, M Cecilia; Grosso, David; Boissiere, Cedric

    2012-04-21

    Periodically ordered mesoporous titania thin films (MTTF) present a high surface area, controlled porosity in the 2-20 nm pore diameter range and an amorphous or crystalline inorganic framework. These materials are nowadays routinely prepared by combining soft chemistry and supramolecular templating. Photocatalytic transparent coatings and titania-based solar cells are the immediate promising applications. However, a wealth of new prospective uses have emerged on the horizon, such as advanced catalysts, perm-selective membranes, optical materials based on plasmonics and photonics, metamaterials, biomaterials or new magnetic nanocomposites. Current and novel applications rely on the ultimate control of the materials features such as pore size and geometry, surface functionality and wall structure. Even if a certain control of these characteristics has been provided by the methods reported so far, the needs for the next generation of MTTF require a deeper insight in the physical and chemical processes taking place in their preparation and processing. This article presents a critical discussion of these aspects. This discussion is essential to evolve from know-how to sound knowledge, aiming at a rational materials design of these fascinating systems. PMID:22419250

  14. Anisotropic growth-induced synthesis of dual-compartment Janus mesoporous silica nanoparticles for bimodal triggered drugs delivery.

    PubMed

    Li, Xiaomin; Zhou, Lei; Wei, Yong; El-Toni, Ahmed Mohamed; Zhang, Fan; Zhao, Dongyuan

    2014-10-22

    Multifunctional dual-compartment Janus mesoporous silica nanocomposites of UCNP@SiO2@mSiO2&PMO (UCNP = upconversion nanoparticle, PMO = periodic mesoporous organosilica) containing core@shell@shell structured UCNP@SiO2@mSiO2 nanospheres and PMO single-crystal nanocubes have been successfully synthesized via a novel anisotropic island nucleation and growth approach with the ordered mesostructure. The asymmetric Janus nanocomposites show a very uniform size of ~300 nm and high surface area of ~1290 m(2)/g. Most importantly, the Janus nanocomposites possess the unique dual independent mesopores with different pore sizes (2.1 nm and 3.5-5.5 nm) and hydrophobicity/hydrophilicity for loading of multiple guests. The distinct chemical properties of the silica sources and the different mesostructures of the dual-compartments are the necessary prerequisites for the formation of the Janus nanostructure. With the assistance of the near-infrared (NIR) to ultraviolet/visible (UV-vis) optical properties of UCNPs and heat-sensitive phase change materials, the dual-compartment Janus mesoporous silica nanocomposites can be further applied into nanobiomedicine for heat and NIR light bimodal-triggered dual-drugs controllable release. It realizes significantly higher efficiency for cancer cell killing (more than 50%) compared to that of the single-triggered drugs delivery system (~25%). PMID:25251874

  15. Acid Functionalized Mesoporous Ordered Materials for the Production of 5-Hydroxymethyfurfural from Carbohydrates

    NASA Astrophysics Data System (ADS)

    Crisci, Anthony J.

    Solid acid catalysts were designed for the conversion of fructose to 5-hydroxymethylfurfural (HMF). Some of the catalysts incorporate thioether groups to promote the tautomerization of fructose to its furanose form, as well as sulfonic acid groups to catalyze its dehydration. A bifunctional silane, 3-((3-(trimethoxysilyl)propyl)thio)propane-1-sulfonic acid (TESAS), was designed for incorporation into SBA-15-type silica by co-condensation. To achieve mesopore ordering in the functionalized silica, the standard SBA-15 synthetic protocol was modified, resulting in well-formed hexagonal particles. Functional groups incorporated into mesoporous silica by co-condensation are more robust under the reaction conditions than those grafted onto a non-porous silica. In a variation, the thioether group of TESAS was oxidized by H2O 2 to the sulfone during the synthesis of the modified SBA-15. The materials were tested in batch reactors and compared in the selective dehydration of fructose to 5-hydroxymethylfurfural (HMF). Compared to benchmark catalysts, the thioether-containing TESAS-SBA-15 showed the highest activity in the dehydration of aqueous fructose, as well as the highest selectivity towards HMF (71 % at 84 % conversion). In addition, the stability of several supported acid catalysts was evaluated in tubular reactors designed to produce 5-hydroxymethylfurfural (HMF) continuously. The reactors, packed with the solid catalysts, were operated at 403 K for extended periods, up to 180 h. The behaviors of three propylsulfonic acid-functionalized, ordered porous silicas (one inorganic SBA-15-type silica, and two ethane-bridged SBA-15-type organosilicas) were compared with that of a propylsulfonic acid-modified, non-ordered porous silica. The HMF selectivity of the catalysts with ordered pore structures ranged from 60 to 75 %, while the selectivity of the non-ordered catalyst peaked at 20 %. The latter was also the least stable, deactivating with a first-order rate constant of

  16. Preparation of periodic mesoporous silica-included divacant Keggin units for the catalytic oxidation of styrene to synthesize styrene oxide

    NASA Astrophysics Data System (ADS)

    Yu, Xiaodan; Xu, Leilei; Yang, Xia; Guo, Yingna; Li, Kexin; Hu, Jianglei; Li, Wei; Ma, Fengyan; Guo, Yihang

    2008-05-01

    Periodic mesoporous composite catalysts, [( n-C 4H 9) 4N] 4[γ-SiW 10O 34(H 2O) 2]/SBA-15 (TBA-1*/SBA-15, where TBA-1* = [( n-C 4H 9) 4N] 4[γ-SiW 10O 34(H 2O) 2]), with TBA-1* loadings of 4.3-14.8% were prepared by simultaneous hydrolysis and co-condensation of the tetraethoxysilane (TEOS) in the presence of divacant Keggin-type polyoxometalate and triblock copolymer surfactant (P123) followed by hydrothermal treatment process. Structure integrity of the Keggin unit in as-prepared composites was studied by Fourier transform infrared spectroscopy (FT-IR), Raman scattering spectra, and 29Si magic-angle spinning (MAS) NMR. Periodic mesoporous structure of the composites was evaluated by low-angle X-ray powder diffraction (LXRD) patterns, nitrogen porosimetry, and transmission electron microscope (TEM) measurements. As-prepared TBA-1*/SBA-15 was used as an heterogeneous oxidation catalyst for the styrene epoxidation reaction to synthesize styrene oxide in the presence of dilute H 2O 2 (30%), and influences of solvent, molar ratio of styrene to H 2O 2, TBA-1* loading on the styrene conversion, styrene oxide yield and selectivity were considered.

  17. Breakable Hybrid Organosilica Nanocapsules for Protein Delivery.

    PubMed

    Prasetyanto, Eko Adi; Bertucci, Alessandro; Septiadi, Dedy; Corradini, Roberto; Castro-Hartmann, Pablo; De Cola, Luisa

    2016-03-01

    The direct delivery of specific proteins to live cells promises a tremendous impact for biological and medical applications, from therapeutics to genetic engineering. However, the process mostly involves tedious techniques and often requires extensive alteration of the protein itself. Herein we report a straightforward approach to encapsulate native proteins by using breakable organosilica matrices that disintegrate upon exposure to a chemical stimulus. The biomolecule-containing capsules were tested for the intracellular delivery of highly cytotoxic proteins into C6 glioma cells. We demonstrate that the shell is broken, the release of the active proteins occurs, and therefore our hybrid architecture is a promising strategy to deliver fragile biomacromolecules into living organisms. PMID:26643574

  18. Mesoporous silicates: Materials science and biological applications

    NASA Astrophysics Data System (ADS)

    Roggers, Robert Anthony

    concentrations of particles. The lipid bilayer allowed the particle to interface with particle without resulting in haemolysis. It was observed however, that spiculation (damage) of the RBCs still occurred despite the lack of cell lysis. During the course of the study, the composition of the outer leaflet of the lipid bilayer was altered to more closely match that of the outer leaflet of RBCs. This alteration proved to make the LB-l-MSN particle extremely compatible with RBCs in that spiculation of the cells was reduced by more than 50 % according to observations by scanning electron microscopy. A new synthetic route to mesoporous silica nanoparticles (MSNs) was developed using water in oil (W/O) emulsions was developed. This method relies on the presence of an amphiphilic stabilizer molecule to control the size and quality of the spherical morphology of the particles. Partitioning of the oil phase into cetyltrimethylammonium bromide surfactant molecules is implicated in expanding the size of the mesopores from the standard 3 nm pore to 7 nm. This material is extensively characterized using X-ray diffraction techniques and TEM microscopy. Chapter 3 also outlines the synthesis of a new periodic mesoporous organosilica (PMO) in which the bridging organic group is a benzobisoxazole molecule synthesized in the research group of Dr. Malika Jeffries-EL. While no immediate application of this new particle was proven, we propose this structure as the basis for a new class of light harvesting or light emitting diode material based on the performance of the polymers containing these benzobisoxazole moieties and functionalized dyes. The final project was the initial development of an N-heterocyclic carbene ligand based on an imidazole framework. This project represents significant synthetic challenges in that the pattern of substitution on the imidazole framework has not been reported in the literature to the best of our knowledge. Despite the synthetic challenges, significant progress has

  19. Multifunctional Gold-Mesoporous Silica Nanocomposites for Enhanced Two-Photon Imaging and Therapy of Cancer Cells

    PubMed Central

    Croissant, Jonas G.; Qi, Christian; Maynadier, Marie; Cattoën, Xavier; Wong Chi Man, Michel; Raehm, Laurence; Mongin, Olivier; Blanchard-Desce, Mireille; Garcia, Marcel; Gary-Bobo, Magali; Durand, Jean-Olivier

    2016-01-01

    Three dimensional sub-micron resolution has made two-photon nanomedicine a very promising medical tool for cancer treatment since current techniques cause significant side effects for lack of spatial selectivity. Two-photon-excited (TPE) photodynamic therapy (PDT) has been achieved via mesoporous nanoscaffolds, but the efficiency of the treatment could still be improved. Herein, we demonstrate the enhancement of the treatment efficiency via gold-mesoporous organosilica nanocomposites for TPE-PDT in cancer cells when compared to mesoporous organosilica particles. We performed the first comparative study of the influence of the shape and spatial position of gold nanoparticles (AuNPs) with mesoporous silica nanoparticles (MSN) functionalized with thiol groups and doped with a two-photon electron donor (2PS). The resulting multifunctional nanocarriers displayed TPE-fluorescence and were imaged inside cells. Furthermore, mesoporous organosilica NPs decorated gold nanospheres (AuNSs) induced 63 percent of selective killing on MCF-7 breast cancer cells. This study thus provides insights for the design of more effective multifunctional two-photon-sensitive nanocomposites via AuNPs for biomedical applications. PMID:26870736

  20. Preparation and characterization of mesoporous silicas modified with chiral selectors as stationary phase for high-performance liquid chromatography.

    PubMed

    Pérez-Quintanilla, Damián; Morante-Zarcero, Sonia; Sierra, Isabel

    2014-01-15

    New hybrid materials were prepared as novel chiral stationary phases (CSPs) for high-performance liquid chromatography (HPLC). Pure mesoporous silica (SM) and ethylene-bridged periodic mesostructured organosilica (PMO) were functionalized, by a post-synthesis method, with derivates of erythromycin and vancomycin. N2 adsorption-desorption measurements, XRD, FT-IR, MAS NMR, SEM, TEM and elemental analysis were used to characterize the physico-chemical properties of these mesostructured materials, before and after the modification process. The synthesized particles had non-symmetrical 3-D wormhole-like mesostructure, spherical morphology, and a mean pore diameter between 53 and 59 Å. CSPs prepared were tested for the separation of four chiral β-blockers (atenolol, metoprolol, pindolol and propranolol) in normal phase (NP) and polar organic phase (PO) elution modes. Much stronger chiral interaction was observed in vancomycin-modified silicas. Results obtained in these preliminary studies will permit in future works to improve the synthesis route in order to design mesoporous materials with better performance as a chiral stationary phase for HPLC. PMID:24231079

  1. Fluorescent hybrid with electron acceptor methylene viologen units inside the pore walls of mesoporous MCM-48 silica.

    PubMed

    Liu, Aifeng; Han, Shuhua; Che, Hongwei; Hua, Lan

    2010-03-01

    A fluorescent material with methylene viologen units bonded into the pore walls of the mesoporous MCM-48 silica is synthesized using the method of periodic mesoporous organosilicas with bridging groups (PMOs), in which the methylene viologen units are located within the channel walls through the cohydrolysis and cocondensation of dichloride of N,N'-bis(triethoxysilylmethyl)-4,4'-bipyridinium (VP) and tetraethoxysilane (TEOS). It is found that the suspension of the hybrid emits fluorescence at ca. 380 and 420 nm, which is attributed to the S(1) state (pi* --> pi) of the viologen and the charge-transfer complex between the bipyridinium units as electron acceptor and accompanying halide (Br(-), Cl(-)) as donor components, respectively. The fluorescent emission intensity increases with increasing the amount of the VP covalently bonded to MCM-48 framework. The fluorescent intensity of VP adsorbed on the surface of the pore channel of MCM-48 was greatly weaker than that of the hybrid MCM-48-VP at the same molar ratio of TEOS to VP. No fluorescence was observed for pure VP. The different fluorescent intensity is ascribed to the fact that restricted degree of the rotation between two pyridine rings is different. It could be prospected that this material is potentially applied in drug delivery and fluorescence probing for medical diagnosis and synchronous therapy. PMID:20104919

  2. The development of chiral nematic mesoporous materials.

    PubMed

    Kelly, Joel A; Giese, Michael; Shopsowitz, Kevin E; Hamad, Wadood Y; MacLachlan, Mark J

    2014-04-15

    of the mesoporous films can be varied by using assorted organosilica precursors. After removal of the cellulose by acid-catalyzed hydrolysis, highly porous, iridescent organosilica films are obtained. These materials are flexible and offer the ability to tune the chemical and mechanical properties through variation of the organic spacer. Chiral nematic mesoporous silica and organosilica materials, obtainable as centimeter-scale freestanding films, are interesting hosts for nanomaterials. When noble metal nanoparticles are incorporated into the pores, they show strong circular dichroism signals associated with their surface plasmon resonances that arise from dipolar coupling of the particles within the chiral nematic host. Fluorescent conjugated polymers show induced circular dichroism spectra when encapsulated in the chiral nematic host. The porosity, film structure, and optical properties of these materials could enable their use in sensors. We describe the development of chiral nematic mesoporous silica and organosilica, demonstrate different avenues of host-guest chemistry, and identify future directions that exploit the unique combination of properties present in these materials. The examples covered in this Account demonstrate that there is a rich diversity of composite materials accessible using CNC templating. PMID:24694253

  3. Kinetic analysis of the thermal processing of silica and organosilica.

    PubMed

    Kappert, Emiel J; Bouwmeester, Henny J M; Benes, Nieck E; Nijmeijer, Arian

    2014-05-15

    The incorporation of an organic group into sol-gel-derived silica causes significant changes in the structure and properties of these materials. Therefore, the thermal treatment of organosilica materials may require a different approach. In the present paper, kinetic parameters (activation energy, pre-exponential constant, and reaction models) have been determined from mass loss data for the dehydration, dehydroxylation, and decomposition reactions that take place upon heating silica and organosilica. Parameters were obtained by employing model-free isoconversional methods to data obtained under multiple heating rates as well as by multivariate analysis of the kinetics using a multistep reaction model with distributed activation energy. For silica, it can be concluded that the reaction atmosphere (i.e., inert or thermo-oxidative) has no influence on the reaction rate of the dehydration and dehydroxylation reactions that are responsible for the densification of the material. Under inert atmosphere, full dehydration can be reached without affecting the organic moiety. Achieving complete dehydroxylation of the organosilica is practically impossible as decomposition does manifest itself under commonly employed calcination temperatures. This indicates that prudence is required in designing a heat treatment program for these hybrid materials. To aid in optimizing the thermal treatment, a predictive model was developed, which can be used to forecast the extent of dehydration, dehydroxylation, and decomposition reactions under a multitude of temperature programs. PMID:24754674

  4. Detection of the volatile organic compounds emitted from paints using optical fibre long period grating modified with the mesoporous nano-scale coating

    NASA Astrophysics Data System (ADS)

    Hromadka, Jiri; James, Stephen; Davis, Frank; Tatam, Ralph P.; Crump, Derrick; Korposh, Sergiy

    2015-09-01

    An optical fibre long period grating (LPG) modified with a mesoporous film infused with a calixarene as a functional compound was employed for the detection of a mixture of volatile organic compounds (VOCs). The sensing mechanism is based on the transduction of the refractive index change induced by the complexion of the VOCs with calixarene into a change in the form of the transmission spectrum of the LPG. An LPG, modified with a calixarene-infused coating comprising 5 cycles of silica nanoparticles/poly(allylamine hydrochloride) polycation (SiO2/PAH), was exposed to mixture of VOCs emitted from paint at conditions simulating ISO standards test (16000-10).

  5. Enzyme Shielding in an Enzyme-thin and Soft Organosilica Layer.

    PubMed

    Correro, M Rita; Moridi, Negar; Schützinger, Hansjörg; Sykora, Sabine; Ammann, Erik M; Peters, E Henrik; Dudal, Yves; Corvini, Philippe F-X; Shahgaldian, Patrick

    2016-05-17

    The fragile nature of most enzymes is a major hindrance to their use in industrial processes. Herein, we describe a synthetic chemical strategy to produce hybrid organic/inorganic nanobiocatalysts; it exploits the self-assembly of silane building blocks at the surface of enzymes to grow an organosilica layer, of controlled thickness, that fully shields the enzyme. Remarkably, the enzyme triggers a rearrangement of this organosilica layer into a significantly soft structure. We demonstrate that this change in stiffness correlates with the biocatalytic turnover rate, and that the organosilica layer shields the enzyme in a soft environment with a markedly enhanced resistance to denaturing stresses. PMID:27062137

  6. Formation of Periodically Arranged Nanobubbles in Mesopores: Capillary Bridge Formation and Cavitation during Sorption and Solidification in an Hierarchical Porous SBA-15 Matrix.

    PubMed

    Hofmann, Tommy; Wallacher, Dirk; Perlich, Jan; Koyiloth Vayalil, Sarathlal; Huber, Patrick

    2016-03-29

    We report synchrotron-based small-angle X-ray scattering experiments on a template-grown porous silica matrix (Santa Barbara Amorphous-15) upon in situ sorption of fluorinated pentane C5F12 along with volumetric gas sorption isotherm measurements. Within the mean-field model of Saam and Cole for vapor condensation in cylindrical pores, a nitrogen and C5F12 sorption isotherm is well described by a bimodal pore radius distribution dominated by meso- and micropores with 3.4 and 1.6 nm mean radius, respectively. In the scattering experiments, two different periodicities become evident. One of them (d1 = 11.5 nm) reflects the next nearest neighbor distance in a 2D-hexagonal lattice of tubular mesopores. A second periodicity (d2 = 11.4 nm) found during in situ sorption and freezing experiments is traced back to a superstructure along the cylindrical mesopores. It is compatible with periodic pore corrugations found in electron tomograms of empty SBA-15 by Gommes et al. ( Chem. Mater. 2009, 21, 1311 - 1317). A Rayleigh-Plateau instability occurring at the cylindrical blockcopolymer micelles characteristic of the SBA-15 templating process quantitatively accounts for the superstructure and thus the spatial periodicity of the pore wall corrugation. The consequences of this peculiar morphological feature on the spatial arrangement of C5F12, in particular the formation of periodically arranged nanobubbles (or voids) upon adsorption, desorption, and freezing of liquids, are discussed in terms of capillary bridge formation and cavitation in tubular but periodically corrugated pores. PMID:26940230

  7. Mesoporous silicates: Materials science and biological applications

    NASA Astrophysics Data System (ADS)

    Roggers, Robert Anthony

    concentrations of particles. The lipid bilayer allowed the particle to interface with particle without resulting in haemolysis. It was observed however, that spiculation (damage) of the RBCs still occurred despite the lack of cell lysis. During the course of the study, the composition of the outer leaflet of the lipid bilayer was altered to more closely match that of the outer leaflet of RBCs. This alteration proved to make the LB-l-MSN particle extremely compatible with RBCs in that spiculation of the cells was reduced by more than 50 % according to observations by scanning electron microscopy. A new synthetic route to mesoporous silica nanoparticles (MSNs) was developed using water in oil (W/O) emulsions was developed. This method relies on the presence of an amphiphilic stabilizer molecule to control the size and quality of the spherical morphology of the particles. Partitioning of the oil phase into cetyltrimethylammonium bromide surfactant molecules is implicated in expanding the size of the mesopores from the standard 3 nm pore to 7 nm. This material is extensively characterized using X-ray diffraction techniques and TEM microscopy. Chapter 3 also outlines the synthesis of a new periodic mesoporous organosilica (PMO) in which the bridging organic group is a benzobisoxazole molecule synthesized in the research group of Dr. Malika Jeffries-EL. While no immediate application of this new particle was proven, we propose this structure as the basis for a new class of light harvesting or light emitting diode material based on the performance of the polymers containing these benzobisoxazole moieties and functionalized dyes. The final project was the initial development of an N-heterocyclic carbene ligand based on an imidazole framework. This project represents significant synthetic challenges in that the pattern of substitution on the imidazole framework has not been reported in the literature to the best of our knowledge. Despite the synthetic challenges, significant progress has

  8. Label-Free Luminescent Mesoporous Silica Nanoparticles for Imaging and Drug Delivery

    PubMed Central

    Chen, Hongmin; Zhen, Zipeng; Tang, Wei; Todd, Trever; Chuang, Yen-Jun; Wang, Lianchun; Pan, Zhengwei; Xie, Jin

    2013-01-01

    We report herein a straightforward and label-free approach to prepare luminescent mesoporous silica nanoparticles. We found that calcination at 400 °C can grant mesoporous organosilica nanoparticles with strong fluorescence of great photo- and chemical stability. The luminescence is found to originate from the carbon dots generated from the calcination, rather than the defects in the silica matrix as was believed previously. The calcination does not impact the particles' abilities to load drugs and conjugate to biomolecules. In a proof-of-concept study, we demonstrated that doxorubicin (Dox) can be efficiently encapsulated into these fluorescent mesoporous silica nanoparticles. After coupled to c(RGDyK), the nanoconjugates can efficiently home to tumors through interactions with integrin αvβ3 overexpressed on the tumor vasculature. This calcination-induced luminescence is expected to find wide applications in silica-based drug delivery, nanoparticle coating, and immunofluorescence imaging. PMID:24052805

  9. Controllable Synthesis and Surface Wettability of Flower-Shaped Silver Nanocube-Organosilica Hybrid Colloidal Nanoparticles.

    PubMed

    Sun, Yangyi; Chen, Min; Zhou, Shuxue; Hu, Jing; Wu, Limin

    2015-12-22

    Synthesis of hybrid colloidal particles with complex and hierarchical structures is attracting much interest theoretically and technically in recent years, but still remains a tremendous challenge. Here, we present a mild and controllable wet-chemical method for the synthesis of silver nanocube (Ag NC)-organosilica hybrid particles with finely tuned numbers (with one, two, three, four, five, or six) and sizes of organosilica petals, by simply controlling the affinity with Ag NC/nature, amount, and prehydrolysis process of alkoxysilanes. The morphologies of hybrid colloidal particles have an obvious influence on the surface wettability of the hybrid particle-based films. More and larger organosilica petals can increase the surface hydrophobicity of the hybrid particle-based films. PMID:26564332

  10. Mesoporous catalysts, supports and catalytic membranes based on MCM-41. Final report for the period January 15,2000 - January 14, 2001

    SciTech Connect

    Haller, Gary L.

    2001-07-01

    The research had two objectives: to understand the effect of pore size on the chemistry and activity of active sites, and to investigate both the pore size and anchoring effect of Me-MCM-41 on Pt clusters (where Me is a metal incorporated in silica-based MCM-41). The focus is not on the effect of pore size on transport of reactants and products, but on how the local radius of curvature might affect the properties of a foreign ion embedded in a silicon wall that acts as a catalytic site or anchor for the catalytic site. The mesoporous molecular sieve, MCM-41, allows the variation of pore size with constant composition and pore geometry so these new materials allow this scientific question to be addressed for the first time. For the anchoring effect, concentration was on Sn-MCM-41 to prepare Pt/Sn-MCM-41 catalysts, by characterizing these and by testing them with probe reforming reactions (dehydrogenation, isomerization and aromatization). Although this is a final report on activity January 15, 2000 - January 14, 2001, this was a continuation of work initiated in the three-year grant period January 15, 1997 - January 14, 2000, so the summary of progress for these three years is appended for completeness.

  11. Synthesis of a metal-organic framework confined in periodic mesoporous silica with enhanced hydrostability as a novel fiber coating for solid-phase microextraction.

    PubMed

    Abolghasemi, Mir Mahdi; Yousefi, Vahid; Piryaei, Marzieh

    2015-04-01

    A metal-organic framework/periodic mesoporous silica (MOF-5@SBA-15) hybrid material has been prepared by using SBA-15 as a matrix. The prepared MOF-5@SBA-15 hybrid material was then deposited on a stainless-steel wire to obtain the fiber for the solid-phase microextraction of phenolic compounds. Modifications in the metal-organic framework structure have proven to improve the extraction performance of MOF/SBA-15 hybrid materials, compared to pure MOF-5 and SBA-15. Optimum conditions include an extraction temperature of 75°C, a desorption temperature of 260°C, and a salt concentration of 20% w/v. The dynamic linear range and limit of detection range from 0.1-500 and from 0.01-3.12 ng/mL, respectively. The repeatability for one fiber (n = 3), expressed as relative standard deviation, is between 4.3 and 9.6%. The method offers the advantage of being simple to use, rapid, and low cost, the thermal stability of the fiber, and high relative recovery (compared to conventional methods) represent additional attractive features. PMID:25645539

  12. Breakable mesoporous silica nanoparticles for targeted drug delivery.

    PubMed

    Maggini, Laura; Cabrera, Ingrid; Ruiz-Carretero, Amparo; Prasetyanto, Eko A; Robinet, Eric; De Cola, Luisa

    2016-04-01

    "Pop goes the particle". Here we report on the preparation of redox responsive mesoporous organo-silica nanoparticles containing disulfide (S-S) bridges (ss-NPs) that, even upon the exohedral grafting of targeting ligands, retained their ability to undergo structural degradation, and increase their local release activity when exposed to a reducing agent. This degradation could be observed also inside glioma C6 cancer cells. Moreover, when anticancer drug-loaded pristine and derivatized ss-NPs were fed to glioma C6 cells, the responsive hybrids were more effective in their cytotoxic action compared to non-breakable particles. The possibility of tailoring the surface functionalization of this hybrid, yet preserving its self-destructive behavior and enhanced drug delivery properties, paves the way for the development of effective biodegradable materials for in vivo targeted drug delivery. PMID:26974603

  13. Breakable mesoporous silica nanoparticles for targeted drug delivery

    NASA Astrophysics Data System (ADS)

    Maggini, Laura; Cabrera, Ingrid; Ruiz-Carretero, Amparo; Prasetyanto, Eko A.; Robinet, Eric; de Cola, Luisa

    2016-03-01

    ``Pop goes the particle''. Here we report on the preparation of redox responsive mesoporous organo-silica nanoparticles containing disulfide (S-S) bridges (ss-NPs) that, even upon the exohedral grafting of targeting ligands, retained their ability to undergo structural degradation, and increase their local release activity when exposed to a reducing agent. This degradation could be observed also inside glioma C6 cancer cells. Moreover, when anticancer drug-loaded pristine and derivatized ss-NPs were fed to glioma C6 cells, the responsive hybrids were more effective in their cytotoxic action compared to non-breakable particles. The possibility of tailoring the surface functionalization of this hybrid, yet preserving its self-destructive behavior and enhanced drug delivery properties, paves the way for the development of effective biodegradable materials for in vivo targeted drug delivery.``Pop goes the particle''. Here we report on the preparation of redox responsive mesoporous organo-silica nanoparticles containing disulfide (S-S) bridges (ss-NPs) that, even upon the exohedral grafting of targeting ligands, retained their ability to undergo structural degradation, and increase their local release activity when exposed to a reducing agent. This degradation could be observed also inside glioma C6 cancer cells. Moreover, when anticancer drug-loaded pristine and derivatized ss-NPs were fed to glioma C6 cells, the responsive hybrids were more effective in their cytotoxic action compared to non-breakable particles. The possibility of tailoring the surface functionalization of this hybrid, yet preserving its self-destructive behavior and enhanced drug delivery properties, paves the way for the development of effective biodegradable materials for in vivo targeted drug delivery. Electronic supplementary information (ESI) available: Full experimental procedures, additional SEM and TEM images of particles, complete UV-Vis and PL-monitored characterization of the breakdown of

  14. Aligned mesoporous architectures and devices.

    SciTech Connect

    Brinker, C. Jeffrey; Lu, Yunfeng

    2011-03-01

    This is the final report for the Presidential Early Career Award for Science and Engineering - PECASE (LDRD projects 93369 and 118841) awarded to Professor Yunfeng Lu (Tulane University and University of California-Los Angeles). During the last decade, mesoporous materials with tunable periodic pores have been synthesized using surfactant liquid crystalline as templates, opening a new avenue for a wide spectrum of applications. However, the applications are somewhat limited by the unfavorabe pore orientation of these materials. Although substantial effort has been devoted to align the pore channels, fabrication of mesoporous materials with perpendicular pore channels remains challenging. This project focused on fabrication of mesoporous materials with perpendicularly aligned pore channels. We demonstrated structures for use in water purification, separation, sensors, templated synthesis, microelectronics, optics, controlled release, and highly selective catalysts.

  15. Mesoporous carbon materials

    DOEpatents

    Dai, Sheng; Fulvio, Pasquale Fernando; Mayes, Richard T.; Wang, Xiqing; Sun, Xiao-Guang; Guo, Bingkun

    2014-09-09

    A conductive mesoporous carbon composite comprising conductive carbon nanoparticles contained within a mesoporous carbon matrix, wherein the conductive mesoporous carbon composite possesses at least a portion of mesopores having a pore size of at least 10 nm and up to 50 nm, and wherein the mesopores are either within the mesoporous carbon matrix, or are spacings delineated by surfaces of said conductive carbon nanoparticles when said conductive carbon nanoparticles are fused with each other, or both. Methods for producing the above-described composite, devices incorporating them (e.g., lithium batteries), and methods of using them, are also described.

  16. Multifunctional mesoporous silica catalyst

    DOEpatents

    Lin, Victor Shang-Yi; Tsai, Chih-Hsiang; Chen, Hung-Ting; Pruski, Marek; Kobayashi, Takeshi

    2015-03-31

    The present invention provides bifunctional silica mesoporous materials, including mesoporous silica nanoparticles ("MSN"), having pores modified with diarylammonium triflate and perfluoroaryl moieties, that are useful for the acid-catalyzed esterification of organic acids with organic alcohols.

  17. Location of laccase in ordered mesoporous materials

    NASA Astrophysics Data System (ADS)

    Mayoral, Álvaro; Gascón, Victoria; Blanco, Rosa M.; Márquez-Álvarez, Carlos; Díaz, Isabel

    2014-11-01

    The functionalization with amine groups was developed on the SBA-15, and its effect in the laccase immobilization was compared with that of a Periodic Mesoporous Aminosilica. A method to encapsulate the laccase in situ has now been developed. In this work, spherical aberration (Cs) corrected scanning transmission electron microscopy combined with high angle annular dark field detector and electron energy loss spectroscopy were applied to identify the exact location of the enzyme in the matrix formed by the ordered mesoporous solids.

  18. Location of laccase in ordered mesoporous materials

    SciTech Connect

    Mayoral, Álvaro; Gascón, Victoria; Blanco, Rosa M.; Márquez-Álvarez, Carlos; Díaz, Isabel

    2014-11-01

    The functionalization with amine groups was developed on the SBA-15, and its effect in the laccase immobilization was compared with that of a Periodic Mesoporous Aminosilica. A method to encapsulate the laccase in situ has now been developed. In this work, spherical aberration (C{sub s}) corrected scanning transmission electron microscopy combined with high angle annular dark field detector and electron energy loss spectroscopy were applied to identify the exact location of the enzyme in the matrix formed by the ordered mesoporous solids.

  19. A Single-Crystalline Mesoporous Quartz Superlattice.

    PubMed

    Matsuno, Takamichi; Kuroda, Yoshiyuki; Kitahara, Masaki; Shimojima, Atsushi; Wada, Hiroaki; Kuroda, Kazuyuki

    2016-05-10

    There has been significant interest in the crystallization of nanostructured silica into α-quartz because of its physicochemical properties. We demonstrate a single-crystalline mesoporous quartz superlattice, a silica polymorph with unprecedentedly ordered hierarchical structures on both the several tens of nanometers scale and the atomic one. The mesoporous quartz superlattice consists of periodically arranged α-quartz nanospheres whose crystalline axes are mostly oriented in an assembly. The superlattice is prepared by thermal crystallization of amorphous silica nanospheres constituting a colloidal crystal. We found that the deposition of a strong flux of Li(+) only on the surface of silica nanospheres is effective for crystallization. PMID:27060365

  20. Tailoring the Separation Behavior of Polymer-Supported Organosilica Layered-Hybrid Membranes via Facile Post-Treatment Using HCl and HN3 Vapors.

    PubMed

    Gong, Genghao; Nagasawa, Hiroki; Kanezashi, Masakoto; Tsuru, Toshinori

    2016-05-01

    A promising layered-hybrid membrane consisting of a microporous organosilica active layer deposited onto a porous polymer support was prepared via a facile sol-gel spin-coating process. Subsequently, the pore sizes and structures of the organosilica top layers on the membrane surface were tuned at mild temperature combined with vapor treatment from either hydrochloric acid (HVT) or ammonia (AVT), thereby tailoring the desalination performance of the membranes during reverse osmosis (RO) processing. The effects of HVT and AVT on the pore size, structure, and morphology of organosilica layers and on the separation performances of membranes were investigated in detail. We confirmed that both HVT and AVT processes accelerated the condensation of silanol (Si-OH) in the organosilica layer, which led to dense silica networks. The layered-hybrid membranes after HVT showed an improved salt rejection and reduced water flux, while membranes after AVT exhibited a decrease in both salt rejection and water permeability. We found that HVT gave rise to smoother and denser organosilica layers, while AVT produced large voids and formed pinholes due to Ostwald ripening. These conclusions were supported by a comparative analysis of the results obtained via FTIR, TG-MS, SPM, and RO desalination. PMID:27070105

  1. Surface-functionalized mesoporous carbon materials

    DOEpatents

    Dai, Sheng; Gorka, Joanna; Mayes, Richard T.

    2016-02-02

    A functionalized mesoporous carbon composition comprising a mesoporous carbon scaffold having mesopores in which polyvinyl polymer grafts are covalently attached, wherein said mesopores have a size of at least 2 nm and up to 50 nm. Also described is a method for producing the functionalized mesoporous composition, wherein a reaction medium comprising a precursor mesoporous carbon, vinyl monomer, initiator, and solvent is subjected to sonication of sufficient power to result in grafting and polymerization of the vinyl monomer into mesopores of the precursor mesoporous carbon. Also described are methods for using the functionalized mesoporous carbon, particularly in extracting metal ions from metal-containing solutions.

  2. Mesoporous carbon materials

    SciTech Connect

    Dai, Sheng; Wang, Xiqing

    2012-02-14

    The invention is directed to a method for fabricating a mesoporous carbon material, the method comprising subjecting a precursor composition to a curing step followed by a carbonization step, the precursor composition comprising: (i) a templating component comprised of a block copolymer, (ii) a phenolic compound or material, (iii) a crosslinkable aldehyde component, and (iv) at least 0.5 M concentration of a strong acid having a pKa of or less than -2, wherein said carbonization step comprises heating the precursor composition at a carbonizing temperature for sufficient time to convert the precursor composition to a mesoporous carbon material. The invention is also directed to a mesoporous carbon material having an improved thermal stability, preferably produced according to the above method.

  3. Mesoporous carbon materials

    DOEpatents

    Dai, Sheng; Wang, Xiqing

    2013-08-20

    The invention is directed to a method for fabricating a mesoporous carbon material, the method comprising subjecting a precursor composition to a curing step followed by a carbonization step, the precursor composition comprising: (i) a templating component comprised of a block copolymer, (ii) a phenolic compound or material, (iii) a crosslinkable aldehyde component, and (iv) at least 0.5 M concentration of a strong acid having a pKa of or less than -2, wherein said carbonization step comprises heating the precursor composition at a carbonizing temperature for sufficient time to convert the precursor composition to a mesoporous carbon material. The invention is also directed to a mesoporous carbon material having an improved thermal stability, preferably produced according to the above method.

  4. Theoretical studies on Si-C bond cleavage in organosilane precursors during polycondensation to organosilica hybrids.

    PubMed

    Shirai, Soichi; Goto, Yasutomo; Mizoshita, Norihiro; Ohashi, Masataka; Tani, Takao; Shimada, Toyoshi; Hyodo, Shi-aki; Inagaki, Shinji

    2010-05-20

    Molecular orbital theory calculations were carried out to predict the occurrence of Si-C bond cleavage in various organosilane precursors during polycondensation to organosilica hybrids under acidic and basic conditions. On the basis of proposed mechanisms for cleavage of the Si-C bonds, the proton affinity (PA) of the carbon atom at the ipso-position and the PA of the carbanion generated after Si-C cleavage were chosen as indices for Si-C bond stability under acidic and basic conditions, respectively. The indices were calculated using a density functional theory (DFT) method for model compounds of organosilane precursors (R-Si(OH)(3)) having organic groups (R) of benzene (Ph), biphenyl (Bp), terphenyl (Tph), naphthalene (Nph), N-methylcarbazole (MCz), and anthracene (Ant). The orders for the predicted stability of the Si-C bond were Ph > Nph > Bp > Ant > Tph > MCz for acidic conditions and Ph > MCz > Bp > Nph > Tph > Ant for basic conditions. These behaviors were primarily in agreement with experimental results where cleavage of the Si-C bonds occurred for Tph (both acidic and basic), MCz (acidic), and Ant (basic). The Si-C bond cleavage of organosilane precursors during polycondensation is qualitatively predicted from these indices based on our theoretical approach. PMID:20429568

  5. Solar hydrogen and solar electricity using mesoporous materials

    NASA Astrophysics Data System (ADS)

    Mahoney, Luther

    The development of cost-effective materials for effective utilization of solar energy is a major challenge for solving the energy problems that face the world. This thesis work relates to the development of mesoporous materials for solar energy applications in the areas of photocatalytic water splitting and the generation of electricity. Mesoporous materials were employed throughout the studies because of their favorable physico-chemical properties such as high surface areas and large porosities. The first project was related to the use of a cubic periodic mesoporous material, MCM-48. The studies showed that chromium loading directly affected the phase of mesoporous silica formed. Furthermore, within the cubic MCM-48 structure, the loading of polychromate species determined the concentration of solar hydrogen produced. In an effort to determine the potential of mesoporous materials, titanium dioxide was prepared using the Evaporation-Induced Self-Assembly (EISA) synthetic method. The aging period directly determined the amount of various phases of titanium dioxide. This method was extended for the preparation of cobalt doped titanium dioxide for solar simulated hydrogen evolution. In another study, metal doped systems were synthesized using the EISA procedure and rhodamine B (RhB) dye sensitized and metal doped titania mesoporous materials were evaluated for visible light hydrogen evolution. The final study employed various mesoporous titanium dioxide materials for N719 dye sensitized solar cell (DSSC) materials for photovoltaic applications. The materials were extensively characterized using powder X-ray diffraction (XRD), nitrogen physisorption, diffuse reflectance spectroscopy (DRS), UV-Vis spectroscopy, Fourier-Transform-Infrared Spectroscopy (FT-IR), Raman spectroscopy, chemisorption, photoluminescence (PL), X-ray photoelectron spectroscopy (XPS), and transmission electron microscopy (TEM). In addition, photoelectrochemical measurements were completed using

  6. Mesoporous carbons and polymers

    DOEpatents

    Bell, William; Dietz, Steven

    2001-01-01

    A mesoporous material prepared by polymerizing a resorcinol/formaldehyde system from an aqueous solution containing resorcinol, formaldehyde and a surfactant and optionally pyrolyzing the polymer to form a primarily carbonaceous solid. The material has an average pore size between 4 and 75 nm and is suitable for use in liquid-phase surface limited applications, including sorbent, catalytic, and electrical applications.

  7. A facile synthesis of highly water-soluble, core-shell organo-silica nanoparticles with controllable size via sol-gel process.

    PubMed

    Du, Hongwei; Hamilton, Paul D; Reilly, Matthew A; d'Avignon, André; Biswas, Pratim; Biswas, Pramit; Ravi, Nathan

    2009-12-15

    A series of highly water-soluble organo-silica nanoparticles, ranging from 2 to 10nm in diameter, were synthesized by the cohydrolysis and copolycondensation reactions. omega-methoxy(polyethyleneoxy)propyltrimethoxysilane (PEG6-9) and hydroxymethyltriethoxysilane (HMTEOS) mixtures were catalyzed by sodium hydroxide in the presence of surfactant benzethonium chloride (BTC) with various ratios of PEG6-9/HMTEOS at room temperature. The synthesized organo-silica nanoparticles possess a core-shell structure with a core of organo-silica resulting from HMTEOS and a monolayer shell of PEG6-9. The chemo-physical characteristics of the particles were studied by gel permeation chromatography (GPC), Fourier transform infrared (FTIR) spectroscopy, (29)Si nuclear magnetic resonance (NMR), dynamic light scattering (DLS), transmission electron microscopy (TEM), and thermogravimetric analysis (TGA). The molecular weight and particle size of the particles increased with increasing HMTEOS molar ratios. The richest HMTEOS composition for the water-soluble particles was found to be HMTEOS:PEG6-9=80:20, where the particles had a 6nm diameter core and a 0.8nm thick shell. We propose that these water-soluble organo-silica nanoparticles will be suitable for biomedical applications. PMID:19783256

  8. Mesoporous aluminum phosphite

    SciTech Connect

    El Haskouri, Jamal; Perez-Cabero, Monica; Guillem, Carmen; Latorre, Julio; Beltran, Aurelio; Beltran, Daniel; Amoros, Pedro

    2009-08-15

    High surface area pure mesoporous aluminum-phosphorus oxide-based derivatives have been synthesized through an S{sup +}I{sup -} surfactant-assisted cooperative mechanism by means of a one-pot preparative procedure from aqueous solution and starting from aluminum atrane complexes and phosphoric and/or phosphorous acids. A soft chemical extraction procedure allows opening the pore system of the parent as-prepared materials by exchanging the surfactant without mesostructure collapse. The nature of the pore wall can be modulated from mesoporous aluminum phosphate (ALPO) up to total incorporation of phosphite entities (mesoporous aluminum phosphite), which results in a gradual evolution of the acidic properties of the final materials. While phosphate groups in ALPO act as network building blocks (bridging Al atoms), the phosphite entities become basically attached to the pore surface, what gives practically empty channels. The mesoporous nature of the final materials is confirmed by X-ray diffraction (XRD), transmission electron microscopy (TEM) and N{sub 2} adsorption-desorption isotherms. The materials present regular unimodal pore systems whose order decreases as the phosphite content increases. NMR spectroscopic results confirm the incorporation of oxo-phosphorus entities to the framework of these materials and also provide us useful information concerning the mechanism through which they are formed. - Abstract: TEM image of the mesoporous aluminum phosphite showing the hexagonal disordered pore array that is generated by using surfactant micelles as template. Also a scheme emphasizing the presence of an alumina-rich core and an ALPO-like pore surface is presented.

  9. Gyroidal mesoporous multifunctional nanocomposites via atomic layer deposition

    NASA Astrophysics Data System (ADS)

    Werner, Jörg G.; Scherer, Maik R. J.; Steiner, Ullrich; Wiesner, Ulrich

    2014-07-01

    We demonstrate the preparation of rationally designed, multifunctional, monolithic and periodically ordered mesoporous core-shell nanocomposites with tunable structural characteristics. Three-dimensionally (3D) co-continuous gyroidal mesoporous polymer monoliths are fabricated from a solution-based triblock terpolymer-resol co-assembly and used as the functional templates for the fabrication of free-standing core-shell carbon-titania composites using atomic layer deposition (ALD). The deposition depth into the torturous gyroidal nanonetwork is investigated as a function of ALD conditions and the resulting composites are submitted to different thermal treatments. Results suggest that ALD can homogenously coat mesoporous templates with well defined pore sizes below 50 nm and thicknesses above 10 μm. Structural tunability like titania shell thickness and pore size control is demonstrated. The ordered nanocomposites exhibit triple functionality; a 3D continuous conductive carbon core that is coated with a crystalline titania shell that in turn is in contact with a 3D continuous mesopore network in a compact monolithic architecture. This materials design is of interest for applications including energy conversion and storage. Gyroidal mesoporous titania monoliths can be obtained through simultaneous titania crystallization and template removal in air.We demonstrate the preparation of rationally designed, multifunctional, monolithic and periodically ordered mesoporous core-shell nanocomposites with tunable structural characteristics. Three-dimensionally (3D) co-continuous gyroidal mesoporous polymer monoliths are fabricated from a solution-based triblock terpolymer-resol co-assembly and used as the functional templates for the fabrication of free-standing core-shell carbon-titania composites using atomic layer deposition (ALD). The deposition depth into the torturous gyroidal nanonetwork is investigated as a function of ALD conditions and the resulting composites are

  10. Synthesis and characterization of mesoporous semiconductors and their energy applications

    NASA Astrophysics Data System (ADS)

    Kang, Chris Byung-hwa

    In this dissertation, we examine the structure and physical properties of mesoporous group IV materials. Two different synthetic routes were developed to synthesize mesoporous germanium powder and thin film mesoporous silicon. The structural of these materials was confirmed by various analytical techniques. The electrochemical behavior of mesoporous silicon was further explored for applications as anodes in lithium ion batteries. The thermal conductivity was also measured and the electrical conductivity was tuned for potential applications as thermoelectrics. Ordered nanostructured germanium composite materials were produced using solution-phase surfactant templating methods. Anionic germanium/surfactand frameworks with a 2-D hexagonal structure were prepared and then condensed to form zero-valent porous germanium using oxidative coupling. The majority of the cationic surfactant inside the pores can be removed, resulting in mesoporous germanium with surface areas up to 500 m2/g. Thin film of mesoporous silicon was produced from polymer template porous silica films at relatively low temperature (<700 C) using magnesium vapor as reducing agent. The final porous silicon retains its ordered cubic mesoporosity. The lithium ion cycling performance of mesoporous silicon anodes was then examined. Mesoporous silicon films formed directly on a metal current collector showed stable cycling with excellent coulomb efficiency over 3000 cycles with capacities up to 3000 mAh/g at cycling rates between 1C to 20C. The results indicate porous silicon material in this size scale can accommodate the volume expansion associated with Li alloying without cracking or loosing contact with the current collector. The thermal conductivity of mesoporous silicon was also measured using the 3 omega method. Periodic pores and grain boundaries enhance phonon scattering to dissipate thermal energy throughout the material, resulting in a decrease in the thermal conductivity by 3-5 orders of magnitude

  11. Mesoporous materials for antihydrogen production.

    PubMed

    Consolati, Giovanni; Ferragut, Rafael; Galarneau, Anne; Di Renzo, Francesco; Quasso, Fiorenza

    2013-05-01

    Antimatter is barely known by the chemist community and this article has the vocation to explain how antimatter, in particular antihydrogen, can be obtained, as well as to show how mesoporous materials could be used as a further improvement for the production of antimatter at very low temperatures (below 1 K). The first experiments with mesoporous materials highlighted in this review show very promising and exciting results. Mesoporous materials such as mesoporous silicon, mesoporous material films, pellets of MCM-41 and silica aerogel show remarkable features for antihydrogen formation. Yet, the characteristics for the best future mesoporous materials (e.g. pore sizes, pore connectivity, shape, surface chemistry) remain to be clearly identified. For now among the best candidates are pellets of MCM-41 and aerogel with pore sizes between 10 and 30 nm, possessing hydrophobic patches on their surface to avoid ice formation at low temperature. From a fundamental standpoint, antimatter experiments could help to shed light on open issues, such as the apparent asymmetry between matter and antimatter in our universe and the gravitational behaviour of antimatter. To this purpose, basic studies on antimatter are necessary and a convenient production of antimatter is required. It is exactly where mesoporous materials could be very useful. PMID:23250616

  12. Facile synthesis of yolk-shell magnetic mesoporous carbon microspheres for efficient enrichment of low abundance peptides.

    PubMed

    Wan, Hao; Qin, Hongqiang; Xiong, Zhichao; Zhang, Weibing; Zou, Hanfa

    2013-11-21

    Magnetic mesoporous carbon microspheres with a yolk-shell structure (YSMMCS) have been prepared via a new in situ carbon source strategy. The material was fabricated by two shells coated onto the Fe3O4 particles; the inner dense and thick silica shell could protect the magnetic core from harsh acidic solvents as well as induce the void between the core and the outer shell for the yolk-shell structure, while the outer organosilica shell was used as the template and carbon source for in situ preparation of a carbon shell with mesoporous structure. A C18-alkyl chain was incorporated in situ as the carbon precursor efficiently, avoiding the conventional infiltration step, which was very difficult to manipulate and time-consuming with the possibility of losing the carbon precursor. The resulting yolk-shell magnetic mesoporous carbon microspheres exhibited a high surface area (273.15 m(2) g(-1)), a large pore volume (0.31 cm(3) g(-1)), and a strong magnetic response (a saturation magnetization value of 34.57 emu g(-1)). As a result of the void between the core and the outer shell and the π-π stacking effect, adsorption capacity reached 191.64 mg g(-1) by using Rhodamine B as a standard analyte, indicating the great potential application of the material as drug carriers. Owing to the inherent hydrophobicity and high surface area, the composite material showed better performance in the enrichment of peptides than a magnetic mesoporous silica material (Fe2O3@nSiO2@mSiO2). According to the LC-MS/MS results, about 51 and 29 nonredundant peptides were identified from tryptic digests of 5 nM BSA. Additionally, taking advantage of the mesoporous structure and strong magnetic response, the material was utilized to selectively extract low abundance endogenous peptides from human serum in the presence of high abundance proteins. Based on the LC-MS/MS results, 962 endogenous peptides were obtained by 2.5 mg YSMMCS relative to 539 endogenous peptides by 5 mg Fe2O3@nSiO2@mSiO2

  13. Preparation of hybrid organic-inorganic mesoporous silicas applied to mercury removal from aqueous media: Influence of the synthesis route on adsorption capacity and efficiency.

    PubMed

    Pérez-Quintanilla, Damián; Sánchez, Alfredo; Sierra, Isabel

    2016-06-15

    New hybrid organic-inorganic mesoporous silicas were prepared by employing three different synthesis routes and mercury adsorption studies were done in aqueous media using the batch technique. The organic ligands employed for the functionalization were derivatives of 2-mercaptopyrimidine or 2-mercaptothiazoline, and the synthesis pathways used were post-synthesis, post-synthesis with surface ion-imprinting and co-condensation with ion-imprinting. The incorporation of functional groups and the presence of ordered mesopores in the organosilicas was confirmed by XRD, TEM and SEM, nitrogen adsorption-desorption isotherms, (13)C MAS-NMR, (29)Si MAS-NMR, elemental and thermogravimetric analysis. The highest adsorption capacity and selectivity observed was for the material functionalized with 2-mercaptothiazoline ligand by means the co-condensation with ion-imprinting route (1.03mmolg(-1) at pH 6). The prepared material could be potential sorbent for the extraction of this heavy metal from environmental and drinking waters. PMID:27023632

  14. Biological Activity of Mesoporous Dendrimer-Coated Titanium Dioxide: Insight on the Role of the Surface-Interface Composition and the Framework Crystallinity.

    PubMed

    Milowska, Katarzyna; Rybczyńska, Aneta; Mosiolek, Joanna; Durdyn, Joanna; Szewczyk, Eligia M; Katir, Nadia; Brahmi, Younes; Majoral, Jean-Pierre; Bousmina, Mosto; Bryszewska, Maria; El Kadib, Abdelkrim

    2015-09-16

    Hitherto, the field of nanomedicine has been overwhelmingly dominated by the use of mesoporous organosilicas compared to their metal oxide congeners. Despite their remarkable reactivity, titanium oxide-based materials have been seldom evaluated and little knowledge has been gained with respect to their "structure-biological activity" relationship. Herein, a fruitful association of phosphorus dendrimers (both "ammonium-terminated" and "phosphonate-terminated") and titanium dioxide has been performed by means of the sol-gel process, resulting in mesoporous dendrimer-coated nanosized crystalline titanium dioxide. A similar organo-coating has been reproduced using single branch-mimicking dendrimers that allow isolation of an amorphous titanium dioxide. The impact of these materials on red blood cells was evaluated by studying cell hemolysis. Next, their cytotoxicity toward B14 Chinese fibroblasts and their antimicrobial activity were also investigated. Based on their variants (cationic versus anionic terminal groups and amorphous versus crystalline titanium dioxide phase), better understanding of the role of the surface-interface composition and the nature of the framework has been gained. No noticeable discrimination was observed for amorphous and crystalline material. In contrast, hemolysis and cytotoxicity were found to be sensitive to the nature of the interface composition, with the ammonium-terminated dendrimer-coated titanium dioxide being the most hemolytic and cytotoxic material. This surface-functionalization opens the door for creating a new synergistic machineries mechanism at the cellular level and seems promising for tailoring the biological activity of nanosized organic-inorganic hybrid materials. PMID:26305597

  15. Engineered monodisperse mesoporous materials

    SciTech Connect

    Saunders, R.S.; Small, J.H.; Lagasse, R.R.; Schroeder, J.L.; Jamison, G.M.

    1997-08-01

    Porous materials technology has developed products with a wide variety of pore sizes ranging from 1 angstrom to 100`s of microns and beyond. Beyond 15{angstrom} it becomes difficult to obtain well ordered, monodisperse pores. In this report the authors describe efforts in making novel porous material having monodisperse, controllable pore sizes spanning the mesoporous range (20--500 {angstrom}). They set forth to achieve this by using unique properties associated with block copolymers--two linear homopolymers attached at their ends. Block copolymers phase separate into monodisperse mesophases. They desired to selectively remove one of the phases and leave the other behind, giving the uniform monodisperse pores. To try to achieve this the authors used ring-opening metathesis polymerization to make the block copolymers. They synthesized a wide variety of monomers and surveyed their polymers by TGA, with the idea that one phase could be made thermally labile while the other phase would be thermally stable. In the precipitated and sol-gel processed materials, they determined by porosimetry measurements that micropores, mesopores, and macropores were created. In the film processed sample there was not much porosity present. They moved to a new system that required much lower thermal treatments to thermally remove over 90% of the labile phase. Film casting followed by thermal treatment and solvent extraction produced the desired monodisperse materials (based solely on SEM results). Modeling using Density Functional Theory was also incorporated into this project. The modeling was able to predict accurately the domain size and spacing vs. molecular weight for a model system, as well as accurate interfacial thicknesses.

  16. Facile synthesis of yolk-shell magnetic mesoporous carbon microspheres for efficient enrichment of low abundance peptides

    NASA Astrophysics Data System (ADS)

    Wan, Hao; Qin, Hongqiang; Xiong, Zhichao; Zhang, Weibing; Zou, Hanfa

    2013-10-01

    Magnetic mesoporous carbon microspheres with a yolk-shell structure (YSMMCS) have been prepared via a new in situ carbon source strategy. The material was fabricated by two shells coated onto the Fe3O4 particles; the inner dense and thick silica shell could protect the magnetic core from harsh acidic solvents as well as induce the void between the core and the outer shell for the yolk-shell structure, while the outer organosilica shell was used as the template and carbon source for in situ preparation of a carbon shell with mesoporous structure. A C18-alkyl chain was incorporated in situ as the carbon precursor efficiently, avoiding the conventional infiltration step, which was very difficult to manipulate and time-consuming with the possibility of losing the carbon precursor. The resulting yolk-shell magnetic mesoporous carbon microspheres exhibited a high surface area (273.15 m2 g-1), a large pore volume (0.31 cm3 g-1), and a strong magnetic response (a saturation magnetization value of 34.57 emu g-1). As a result of the void between the core and the outer shell and the π-π stacking effect, adsorption capacity reached 191.64 mg g-1 by using Rhodamine B as a standard analyte, indicating the great potential application of the material as drug carriers. Owing to the inherent hydrophobicity and high surface area, the composite material showed better performance in the enrichment of peptides than a magnetic mesoporous silica material (Fe2O3@nSiO2@mSiO2). According to the LC-MS/MS results, about 51 and 29 nonredundant peptides were identified from tryptic digests of 5 nM BSA. Additionally, taking advantage of the mesoporous structure and strong magnetic response, the material was utilized to selectively extract low abundance endogenous peptides from human serum in the presence of high abundance proteins. Based on the LC-MS/MS results, 962 endogenous peptides were obtained by 2.5 mg YSMMCS relative to 539 endogenous peptides by 5 mg Fe2O3@nSiO2@mSiO2, confirming the

  17. Mesoporous Silicate Materials in Sensing

    PubMed Central

    Melde, Brian J.; Johnson, Brandy J.; Charles, Paul T.

    2008-01-01

    Mesoporous silicas, especially those exhibiting ordered pore systems and uniform pore diameters, have shown great potential for sensing applications in recent years. Morphological control grants them versatility in the method of deployment whether as bulk powders, monoliths, thin films, or embedded in coatings. High surface areas and pore sizes greater than 2 nm make them effective as adsorbent coatings for humidity sensors. The pore networks also provide the potential for immobilization of enzymes within the materials. Functionalization of materials by silane grafting or through co-condensation of silicate precursors can be used to provide mesoporous materials with a variety of fluorescent probes as well as surface properties that aid in selective detection of specific analytes. This review will illustrate how mesoporous silicas have been applied to sensing changes in relative humidity, changes in pH, metal cations, toxic industrial compounds, volatile organic compounds, small molecules and ions, nitroenergetic compounds, and biologically relevant molecules.

  18. Reversible and Precise Self-Assembly of Janus Metal-Organosilica Nanoparticles through a Linker-Free Approach.

    PubMed

    Hu, Huicheng; Ji, Fei; Xu, Yong; Yu, Jiaqi; Liu, Qipeng; Chen, Lei; Chen, Qian; Wen, Peng; Lifshitz, Yeshayahu; Wang, Yan; Zhang, Qiao; Lee, Shuit-Tong

    2016-08-23

    Reversible self-assembly of nanoparticles into ordered structures is essential for both fundamental study and practical applications. Although extensive work has been conducted, the demand for simple, cheap, reversible, and versatile ordering methods is still a central issue in current nanoscience and nanotechnology. Here we report a reversible and precise self-assembly of nanoparticles through a linker-free and fast approach by manipulating the interparticle forces, e.g., van der Waals (VDW) force and electrostatic force. Because VDW force is nondirectional, an oriented interaction is achieved to induce the directional binding of nanoparticles utilizing the Janus nanostructure. An effective sol-gel approach has been developed to synthesize metal-organosilica Janus nanoparticles. Dimers and trimers can be obtained by tuning the steric hindrance. After assembly, "hot-spots" can be generated between adjacent nanoparticles, and dramatic enhancement has been observed in surface-enhanced Raman scattering. The present strategy overcomes several limitations of existing approaches and allows the controlled assembly of small particles into various structures. PMID:27392069

  19. Site-selective electroless metallization on porous organosilica films by multisurface modification of alkyl monolayer and vacuum plasma.

    PubMed

    Chen, Giin-Shan; Chen, Sung-Te; Chen, Yenying W; Hsu, Yen-Che

    2013-01-15

    Taking plasma-enhanced chemical vapor deposited porous SiOCH (p-SiOCH) and octadecyltrichlorosilane (OTS) as model cases, this study elucidates the chemical reaction pathways for alkyl-based self-assembled monolayers (SAMs) on porous carbon-doped organosilica films under N(2)-H(2) vacuum plasma illumination. In contrast to previous findings that carboxylic groups are found in alkyl-based SAMs only by exposure to oxygen-based plasma, this study discovers that, upon exposure to reductive nitrogen-based vacuum plasma, surface carboxylic functional groups can be instantly formed on OTS-coated p-SiOCH films. Particular attention is given to developing a multisurface modification process, starting with the modification of p-SiOCH films by N(2)-H(2) plasma and continuing with SAM deposition and plasma patterning; this ultimately leads to site-selective seeding for the spatially controlled fabrication of Cu-wire metallization by electroless deposition. Plasma diagnosis and X-ray near-edge absorption and Fourier transform infrared spectroscopies show that, by adequately controlling the plasma parameters, the bulk of the p-SiOCH films are free from plasma damage (in terms of degradation in bonding structures and electrical properties); the formation of the seed-trapping carboxylic functional groups on the surface, the key factor for the validity of this new seeding process, is due to a water-mediated chemical oxygenation route. PMID:23205708

  20. Single crystalline mesoporous silicon nanowires

    SciTech Connect

    Hochbaum, Allon; Dargas, Daniel; Hwang, Yun Jeong; Yang, Peidong

    2009-08-18

    Herein we demonstrate a novel electroless etching synthesis of monolithic, single-crystalline, mesoporous silicon nanowire arrays with a high surface area and luminescent properties consistent with conventional porous silicon materials. The photoluminescence of these nanowires suggest they are composed of crystalline silicon with small enough dimensions such that these arrays may be useful as photocatalytic substrates or active components of nanoscale optoelectronic devices. A better understanding of this electroless route to mesoporous silicon could lead to facile and general syntheses of different narrow bandgap semiconductor nanostructures for various applications.

  1. Large-scale template-free synthesis of ordered mesoporous platinum nanocubes and their electrocatalytic properties

    NASA Astrophysics Data System (ADS)

    Cao, Yanqin; Yang, Yong; Shan, Yufeng; Fu, Chaoli; Viet Long, Nguyen; Huang, Zhengren; Guo, Xiangxin; Nogami, Masayuki

    2015-11-01

    Here we report a facile, one-pot and template-free approach to synthesize mesoporous monocrystalline Pt nanocubes with uniform shapes and sizes, in which small Pt particles with a size of ~5 nm are three-dimensionally and periodically built up into cubes with a size of ~50 nm. The forming process is illustrated through a novel meso-crystal self-assembly mechanism. Very interestingly, the mesoporous structures are ordered, which are thought to be beneficial to increase their catalytic activity. Compared with nonporous Pt nanoparticles and porous Pt nanoparticles without order, the ordered mesoporous Pt nanocubes exhibit a highly improved electrocatalytic ability for methanol and formic acid oxidation, and are potentially applicable as electrocatalysts for direct methanol and formic acid fuel cells. Furthermore, this approach can be used to synthesize other Pt-series metallic mesoporous nanoparticles, such as Pd.Here we report a facile, one-pot and template-free approach to synthesize mesoporous monocrystalline Pt nanocubes with uniform shapes and sizes, in which small Pt particles with a size of ~5 nm are three-dimensionally and periodically built up into cubes with a size of ~50 nm. The forming process is illustrated through a novel meso-crystal self-assembly mechanism. Very interestingly, the mesoporous structures are ordered, which are thought to be beneficial to increase their catalytic activity. Compared with nonporous Pt nanoparticles and porous Pt nanoparticles without order, the ordered mesoporous Pt nanocubes exhibit a highly improved electrocatalytic ability for methanol and formic acid oxidation, and are potentially applicable as electrocatalysts for direct methanol and formic acid fuel cells. Furthermore, this approach can be used to synthesize other Pt-series metallic mesoporous nanoparticles, such as Pd. Electronic supplementary information (ESI) available. See DOI: 10.1039/c5nr05772h

  2. Magnetic mesoporous material for the sequestration of algae

    SciTech Connect

    Trewyn, Brian G.; Kandel, Kapil; Slowing, Igor Ivan; Lee, Show-Ling

    2014-09-09

    The present invention provides a magnetic mesoporous nanoparticle that includes a mesoporous silicate nanoparticle and iron oxide. The present invention also provides a method of using magnetic mesoporous nanoparticles to sequester microorganisms from a media.

  3. Bimodal mesoporous silica with bottleneck pores.

    PubMed

    Reber, M J; Brühwiler, D

    2015-11-01

    Bimodal mesoporous silica consisting of two sets of well-defined mesopores is synthesized by a partial pseudomorphic transformation of an ordered mesoporous starting material (SBA-15 type). The introduction of a second set of smaller mesopores (MCM-41 type) establishes a pore system with bottlenecks that restricts the access to the core of the bimodal mesoporous silica particles. The particle size and shape of the starting material are retained, but micropores present in the starting material disappear during the transformation, leading to a true bimodal mesoporous product. A varying degree of transformation allows the adjustment of the pore volume contribution of the two mesopore domains. Information on the accessibility of the mesopores is obtained by the adsorption of fluorescence-labeled poly(amidoamine) dendrimers and imaging by confocal laser scanning microscopy. This information is correlated with nitrogen sorption data to provide insights regarding the spatial distribution of the two mesopore domains. The bimodal mesoporous materials are excellent model systems for the investigation of cavitation effects in nitrogen desorption isotherms. PMID:26399172

  4. Mesoporous Silicon-Based Anodes

    NASA Technical Reports Server (NTRS)

    Peramunage, Dharmasena

    2015-01-01

    For high-capacity, high-performance lithium-ion batteries. A new high-capacity anode composite based on mesoporous silicon is being developed. With a structure that resembles a pseudo one-dimensional phase, the active anode material will accommodate significant volume changes expected upon alloying and dealloying with lithium (Li).

  5. THE BIOCOMPATIBILITY OF MESOPOROUS SILICATES

    PubMed Central

    Hudson, Sarah; Padera, Robert F.; Langer, Robert; Kohane, Daniel S.

    2008-01-01

    Micro- and nano- mesoporous silicate particles are considered potential drug delivery systems because of their ordered pore structures, large surface areas and the ease with which they can be chemically modified. However, few cytotoxicity or biocompatibility studies have been reported, especially when silicates are administered in the quantities necessary to deliver low-potency drugs. The biocompatibility of mesoporous silicates of particle sizes ~ 150 nm, ~ 800 nm and ~ 4 µm and pore sizes of 3 nm, 7 nm and 16 nm respectively are examined here. In vitro, mesoporous silicates showed a significant degree of toxicity at high concentrations with mesothelial cells. Following subcutaneous injection of silicates in rats, the amount of residual material decreased progressively over three months, with good biocompatibility on histology at all time points. In contrast, intra peritoneal and intra venous injections in mice resulted in death or euthanasia. No toxicity was seen with subcutaneous injection of the same particles in mice. Microscopic analysis of the lung tissue of the mice indicates that death may be due to thrombosis. Although local tissue reaction to mesoporous silicates was benign, they caused severe systemic toxicity. This toxicity could be mitigated by modification of the materials. PMID:18675454

  6. Synthesis and characterization of mesoporous materials

    NASA Astrophysics Data System (ADS)

    Cheng, Wei

    Mesoporous materials are highly porous solids with pore sizes in the range of 20 to 500 A and a narrow pore size distribution. Creating a mesoporous morphology in transition metal oxides is expected to increase the kinetics of electrochemical photoelectrochemical processes due to the improved accessibility of electrolyte to electrode. The objective of the dissertation research is to prepare functional mesoporous materials based on transition metal oxides and to determine the effects of the mesoporous structure on the resulting charge transfer, electrochromism, and optical properties. In this dissertation, mesoporous tungsten oxide and niobium oxide were synthesized by incorporating tri-block copolymer surfactant templates into the sol-gel synthesis procedure. Both mesoporous materials have surface areas in the range of 130 m2/g with a narrow pore size distribution centered at ˜45A. Their electrochromic properties were characterized and found to be strongly influenced by the mesoporous morphology. Both mesoporous systems exhibit better electrochemical and optical reversibilities than the analogous sol-gel materials (without using surfactant) and the kinetics of bleaching is substantially faster. Coloration efficiencies for the mesoporous tungsten oxide and niobium oxide films are in the range of 16--37 cm 2/C and 12--16 cm2/C, respectively. Dye sensitized solar cells (DSSC) were fabricated using mesoporous niobium oxide as electrodes. Due to the higher surface area, the mesoporous electrodes have greater dye adsorption and electrolyte penetration compared to sol-gel electrodes, which leads to better electron injection, faster dye regeneration and thus, better cell performance. The mesoporous DSSC exhibits photocurrents of 2.9 mA and fill factors of 0.61. Open circuit voltages of the mesoporous DSSC are in the range of 0.6--0.83V.

  7. Mesoporous metal oxide graphene nanocomposite materials

    DOEpatents

    Liu, Jun; Aksay, Ilhan A.; Kou, Rong; Wang, Donghai

    2016-05-24

    A nanocomposite material formed of graphene and a mesoporous metal oxide having a demonstrated specific capacity of more than 200 F/g with particular utility when employed in supercapacitor applications. A method for making these nanocomposite materials by first forming a mixture of graphene, a surfactant, and a metal oxide precursor, precipitating the metal oxide precursor with the surfactant from the mixture to form a mesoporous metal oxide. The mesoporous metal oxide is then deposited onto a surface of the graphene.

  8. Mesoporous Silica: A Suitable Adsorbent for Amines

    PubMed Central

    2009-01-01

    Mesoporous silica with KIT-6 structure was investigated as a preconcentrating material in chromatographic systems for ammonia and trimethylamine. Its adsorption capacity was compared to that of existing commercial materials, showing its increased adsorption power. In addition, KIT-6 mesoporous silica efficiently adsorbs both gases, while none of the employed commercial adsorbents did. This means that KIT-6 Mesoporous silica may be a good choice for integrated chromatography/gas sensing micro-devices. PMID:20628459

  9. Cellular membrane trafficking of mesoporous silica nanoparticles

    SciTech Connect

    Fang, I-Ju

    2012-01-01

    This dissertation mainly focuses on the investigation of the cellular membrane trafficking of mesoporous silica nanoparticles. We are interested in the study of endocytosis and exocytosis behaviors of mesoporous silica nanoparticles with desired surface functionality. The relationship between mesoporous silica nanoparticles and membrane trafficking of cells, either cancerous cells or normal cells was examined. Since mesoporous silica nanoparticles were applied in many drug delivery cases, the endocytotic efficiency of mesoporous silica nanoparticles needs to be investigated in more details in order to design the cellular drug delivery system in the controlled way. It is well known that cells can engulf some molecules outside of the cells through a receptor-ligand associated endocytosis. We are interested to determine if those biomolecules binding to cell surface receptors can be utilized on mesoporous silica nanoparticle materials to improve the uptake efficiency or govern the mechanism of endocytosis of mesoporous silica nanoparticles. Arginine-glycine-aspartate (RGD) is a small peptide recognized by cell integrin receptors and it was reported that avidin internalization was highly promoted by tumor lectin. Both RGD and avidin were linked to the surface of mesoporous silica nanoparticle materials to investigate the effect of receptor-associated biomolecule on cellular endocytosis efficiency. The effect of ligand types, ligand conformation and ligand density were discussed in Chapter 2 and 3. Furthermore, the exocytosis of mesoporous silica nanoparticles is very attractive for biological applications. The cellular protein sequestration study of mesoporous silica nanoparticles was examined for further information of the intracellular pathway of endocytosed mesoporous silica nanoparticle materials. The surface functionality of mesoporous silica nanoparticle materials demonstrated selectivity among the materials and cancer and normal cell lines. We aimed to determine

  10. Synthesis of non-siliceous mesoporous oxides.

    PubMed

    Gu, Dong; Schüth, Ferdi

    2014-01-01

    Mesoporous non-siliceous oxides have attracted great interest due to their unique properties and potential applications. Since the discovery of mesoporous silicates in 1990s, organic-inorganic assembly processes by using surfactants or block copolymers as soft templates have been considered as a feasible path for creating mesopores in metal oxides. However, the harsh sol-gel conditions and low thermal stabilities have limited the expansion of this method to various metal oxide species. Nanocasting, using ordered mesoporous silica or carbon as a hard template, has provided possibilities for preparing novel mesoporous materials with new structures, compositions and high thermal stabilities. This review concerns the synthesis, composition, and parameter control of mesoporous non-siliceous oxides. Four synthesis routes, i.e. soft-templating (surfactants or block copolymers as templates), hard-templating (mesoporous silicas or carbons as sacrificial templates), colloidal crystal templating (3-D ordered colloidal particles as a template), and super lattice routes, are summarized in this review. Mesoporous metal oxides with different compositions have different properties. Non-siliceous mesoporous oxides are comprehensively described, including a discussion of constituting elements, synthesis, and structures. General aspects concerning pore size control, atomic scale crystallinity, and phase control are also reviewed. PMID:23942521

  11. Magnetic Mesoporous Photonic Cellulose Films.

    PubMed

    Giese, Michael; Blusch, Lina K; Schlesinger, Maik; Meseck, Georg R; Hamad, Wadood Y; Arjmand, Mohammad; Sundararaj, Uttandaraman; MacLachlan, Mark J

    2016-09-13

    Novel hybrid materials of cellulose and magnetic nanoparticles (NPs) were synthesized and characterized. The materials combine the chiral nematic structural features of mesoporous photonic cellulose (MPC) with the magnetic properties of cobalt ferrite (CoFe2O4). The photonic, magnetic, and dielectric properties of the hybrid materials were investigated during the dynamic swelling and deswelling of the MPC films. It was observed that the dielectric properties of the generated MPC films increased tremendously following swelling in water, endorsing efficient swelling ability of the generated mesoporous films. The high magnetic permeability of the developed MPC films in conjunction with their superior dielectric properties, predominantly in the swollen state, makes them interesting for electromagnetic interference shielding applications. PMID:27588561

  12. Synthesis of hollow and mesoporous polycaprolactone nanocapsules,

    NASA Astrophysics Data System (ADS)

    Paik, Pradip; Zhang, Yong

    2011-05-01

    New polycaprolactone (PCL) nanocapsules with a hollow core and mesoporous shell have been synthesized. The PCL nanocapsules have an average size of about 100nm and a mesopores shell of about 20nm. The size of the mesopores on the shell is about 4nm. Fluorescent dye Rhodamin 6G was loaded into the nanocapsules to demonstrate the mesoporous structure of the capsules and their ability to load small molecules. The nanocapsules with such a structure can be used in many areas for various applications such as drug and gene delivery.New polycaprolactone (PCL) nanocapsules with a hollow core and mesoporous shell have been synthesized. The PCL nanocapsules have an average size of about 100nm and a mesopores shell of about 20nm. The size of the mesopores on the shell is about 4nm. Fluorescent dye Rhodamin 6G was loaded into the nanocapsules to demonstrate the mesoporous structure of the capsules and their ability to load small molecules. The nanocapsules with such a structure can be used in many areas for various applications such as drug and gene delivery. Dr. Pradip Paik is currently an assistant professor at the University of Hyderabad (Central University), India.

  13. Mesoporous carbonates and method of making

    DOEpatents

    Fryxell, Glen; Liu, Jun; Zemanian, Thomas S.

    2004-06-15

    Mesoporous metal carbonate structures are formed by providing a solution containing a non-ionic surfactant and a calcium acetate salt, adding sufficient base to react with the acidic byproducts to be formed by the addition of carbon dioxide, and adding carbon dioxide, thereby forming a mesoporous metal carbonate structure containing the metal from said metal salt.

  14. Non-destructively shattered mesoporous silica for protein drug delivery

    SciTech Connect

    Lei, Chenghong; Chen, Baowei; Li, Xiaolin; Qi, Wen N.; Liu, Jun

    2013-07-15

    Mesoporous silicas have been extensively used for entrapping small chemical molecules and biomacromolecules. We hypothesize that the loading density of biomacromlecules such as proteins in mesoporous silicas could be limited due to mesopore disorderness and depth because of some pore volume inaccessible. We innovatively shattered mesoporous silicas resulting in reduced particle sizes and improved intramesoporous structures in aqueous solution by a powerful sonication, where the mesoporous structures were still well maintained. The sonication-shattered mesoporous silicas can allow protein loading densities to be increased by more than 170%, demonstrating that significantly more mesoporous room of the silicas could become accessible for biomacromolecule loading after the sonication-shattering.

  15. Single crystalline mesoporous silicon nanowires

    SciTech Connect

    Hochbaum, A.I.; Gargas, Daniel; Jeong Hwang, Yun; Yang, Peidong

    2009-08-04

    Herein we demonstrate a novel electroless etching synthesis of monolithic, single-crystalline, mesoporous silicon nanowire arrays with a high surface area and luminescent properties consistent with conventional porous silicon materials. These porous nanowires also retain the crystallographic orientation of the wafer from which they are etched. Electron microscopy and diffraction confirm their single-crystallinity and reveal the silicon surrounding the pores is as thin as several nanometers. Confocal fluorescence microscopy showed that the photoluminescence (PL) of these arrays emanate from the nanowires themselves, and their PL spectrum suggests that these arrays may be useful as photocatalytic substrates or active components of nanoscale optoelectronic devices.

  16. Synthesis and characterization of mesoporous zirconia and aluminated mesoporous zirconia

    NASA Astrophysics Data System (ADS)

    Zhao, Elizabeth Sun

    Synthesis of mesoporous zirconia has been performed by slowly hydrolyzing zirconium propoxide in the presence of anionic surfactants: namely, dodecyl phosphate or sulfate (P12 and Sf12) and hexadecyl sulfonate (So16) The zirconia. outgassed at 140--150°C has T-plot surface areas higher than 400 M2/g. This outgassing does not remove the surfactant. After calcination in air at 500°C and combustion of the surfactant, the mesoporous volume is reduced by a factor of about 2, whereas the pore wall material crystallizes in the tetragonal phase. The high-resolution electron microscopic study reveals the presence of a disorganized network of polygonal pores structure. It is suggested that the chemistry of the hydrolysis solution is instrumental in determining the pore structure. A schematic model in which the surfactant is a scaffold component is suggested in order to explain these results and the fixation of PO4, or SO4 in the walls may help to preserve the porous structure. It is very different from the templating mechanism. From the density obtained from phase transition temperature, and from the mesoporous volume (N2 adsorption), the thickness of the wall can be calculated as well as the pseudo-length of the pores. From the thickness, the T-plot area can be recalculated and agrees well with the measured T-plot surface area for the sample calcined at 500°C. Around 900°C, the walls become thicker and crystallizes into monoclinic zirconia without pore structure. In order to try to modify, the acidity of the mesoporous sulfated and oxo-phosphated zirconia, they were doped with aluminum. The sulfated zirconia only has a coating layer of amorphous alumina, while the phosphated zirconia has aluminum in the lattice and the alumina coat. A maximum ratio of Al/Zr ˜ 0.04 can be reached in the lattice. The introduction of aluminum into the lattice prevents the crystallization of the oxo-phosphate at 900°C, and helps to preserve the surface area and porosity of the sulfated

  17. Block copolymer self-assembly–directed synthesis of mesoporous gyroidal superconductors

    PubMed Central

    Robbins, Spencer W.; Beaucage, Peter A.; Sai, Hiroaki; Tan, Kwan Wee; Werner, Jörg G.; Sethna, James P.; DiSalvo, Francis J.; Gruner, Sol M.; Van Dover, Robert B.; Wiesner, Ulrich

    2016-01-01

    Superconductors with periodically ordered mesoporous structures are expected to have properties very different from those of their bulk counterparts. Systematic studies of such phenomena to date are sparse, however, because of a lack of versatile synthetic approaches to such materials. We demonstrate the formation of three-dimensionally continuous gyroidal mesoporous niobium nitride (NbN) superconductors from chiral ABC triblock terpolymer self-assembly–directed sol-gel–derived niobium oxide with subsequent thermal processing in air and ammonia gas. Superconducting materials exhibit a critical temperature (Tc) of about 7 to 8 K, a flux exclusion of about 5% compared to a dense NbN solid, and an estimated critical current density (Jc) of 440 A cm−2 at 100 Oe and 2.5 K. We expect block copolymer self-assembly–directed mesoporous superconductors to provide interesting subjects for mesostructure-superconductivity correlation studies. PMID:27152327

  18. Block copolymer self-assembly-directed synthesis of mesoporous gyroidal superconductors.

    PubMed

    Robbins, Spencer W; Beaucage, Peter A; Sai, Hiroaki; Tan, Kwan Wee; Werner, Jörg G; Sethna, James P; DiSalvo, Francis J; Gruner, Sol M; Van Dover, Robert B; Wiesner, Ulrich

    2016-01-01

    Superconductors with periodically ordered mesoporous structures are expected to have properties very different from those of their bulk counterparts. Systematic studies of such phenomena to date are sparse, however, because of a lack of versatile synthetic approaches to such materials. We demonstrate the formation of three-dimensionally continuous gyroidal mesoporous niobium nitride (NbN) superconductors from chiral ABC triblock terpolymer self-assembly-directed sol-gel-derived niobium oxide with subsequent thermal processing in air and ammonia gas. Superconducting materials exhibit a critical temperature (T c) of about 7 to 8 K, a flux exclusion of about 5% compared to a dense NbN solid, and an estimated critical current density (J c) of 440 A cm(-2) at 100 Oe and 2.5 K. We expect block copolymer self-assembly-directed mesoporous superconductors to provide interesting subjects for mesostructure-superconductivity correlation studies. PMID:27152327

  19. Surfactant-Templated Mesoporous Metal Oxide Nanowires

    DOE PAGESBeta

    Luo, Hongmei; Lin, Qianglu; Baber, Stacy; Naalla, Mahesh

    2010-01-01

    We demore » monstrate two approaches to prepare mesoporous metal oxide nanowires by surfactant assembly and nanoconfinement via sol-gel or electrochemical deposition. For example, mesoporous Ta 2 O 5 and zeolite nanowires are prepared by block copolymer Pluronic 123-templated sol-gel method, and mesoporous ZnO nanowires are prepared by electrodeposition in presence of anionic surfactant sodium dodecyl sulfate (SDS) surfactant, in porous membranes. The morphologies of porous nanowires are studied by scanning electron microscopy (SEM) and transmission electron microscopy (TEM) analyses.« less

  20. Drug Loading of Mesoporous Silicon

    NASA Astrophysics Data System (ADS)

    Moffitt, Anne; Coffer, Jeff; Wang, Mengjia

    2011-03-01

    The nanostructuring of crystalline solids with low aqueous solubilities by their incorporation into mesoporous host materials is one route to improve the bioavailability of such solids. Earlier studies suggest that mesoporous Si (PSi), with pore widths in the range of 5-50 nm, is a candidate for such an approach. In this presentation, we describe efforts to load curcumin into free-standing microparticles of PSi. Curcumin is a compound extracted from turmeric root, which is an ingredient of curry. Curucmin has shown activity against selected cancer cell lines, bacteria, and other medical conditions. However, curcumin has a very low bioavailability due to its extremely low water solubility (0.6 μ g/mL). Incorporation of curcumin was achieved by straightforward loading of the molten solid at 185circ; C. Loading experiments were performed using PSi particles of two different size ranges, 45-75 μ m and 150-250 μ m. Longer loading times and ratio of curcumin to PSi leads to a higher percentage of loaded curcumin in both PSi particle sizes (as determined by weight difference). The extent of curcumin crystallinity was assessed by x-ray diffraction (XRD). The solubility and release kinetics of loaded curcumin from the PSi was determined by extraction into water at 37circ; C, with analysis using UV-VIS spectrometry. NSF-REU and TCU.

  1. Sample Desorption/Onization From Mesoporous Silica

    DOEpatents

    Iyer, Srinivas; Dattelbaum, Andrew M.

    2005-10-25

    Mesoporous silica is shown to be a sample holder for laser desorption/ionization of mass spectrometry. Supported mesoporous silica was prepared by coating an ethanolic silicate solution having a removable surfactant onto a substrate to produce a self-assembled, ordered, nanocomposite silica thin film. The surfactant was chosen to provide a desired pore size between about 1 nanometer diameter and 50 nanometers diameter. Removal of the surfactant resulted in a mesoporous silica thin film on the substrate. Samples having a molecular weight below 1000, such as C.sub.60 and tryptophan, were adsorbed onto and into the mesoporous silica thin film sample holder and analyzed using laser desorption/ionization mass spectrometry.

  2. Mesoporous Carbon Membranes for Selective Gas Separations

    SciTech Connect

    2009-04-01

    This factsheet describes a study whose focus is on translating a novel class of material developed at Oak Ridge National Laboratory—selfassembled mesoporous carbon—into robust, efficient membrane systems for selective industrial gas separations.

  3. Synthesis of mesoporous silica nanoparticles.

    PubMed

    Wu, Si-Han; Mou, Chung-Yuan; Lin, Hong-Ping

    2013-05-01

    Good control of the morphology, particle size, uniformity and dispersity of mesoporous silica nanoparticles (MSNs) is of increasing importance to their use in catalyst, adsorption, polymer filler, optical devices, bio-imaging, drug delivery, and biomedical applications. This review discusses different synthesis methodologies to prepare well-dispersed MSNs and hollow silica nanoparticles (HSNs) with tunable dimensions ranging from a few to hundreds of nanometers of different mesostructures. The methods include fast self-assembly, soft and hard templating, a modified Stöber method, dissolving-reconstruction and modified aerogel approaches. In practical applications, the MSNs prepared by these methods demonstrate good potential for use in high-performance catalysis, antireflection coating, transparent polymer-MSNs nanocomposites, drug-release and theranostic systems. PMID:23403864

  4. Preparation of irregular mesoporous hydroxyapatite

    SciTech Connect

    Wang Hualin Zhai Linfeng; Li Yanhong; Shi Tiejun

    2008-06-03

    An irregular mesoporous hydroxyapatite (meso-HA), Ca{sub 10}(PO{sub 4}){sub 6}(OH){sub 2}, is successfully prepared from Ca(NO{sub 3}){sub 2}.4H{sub 2}O and NH{sub 4}H{sub 2}PO{sub 4} using surfactant cetyltrimethyl ammonium bromide (CTAB) as template. Fourier transform infrared spectroscopy (FTIR) and differential scanning calorimetry (DSC) results reveal that the positive head of CTAB is assembled on the surface precipitated HA and much NH{sub 4}{sup +} is enclosed in precipitated HA before calcination. Field scanning electron microscope (FSEM) reveals that there exist many interconnected pores throughout the HA reticular skeleton. Nitrogen adsorption-desorption experiment exhibits a mesoporous material type IV curve, and pore size distribution calculated from the desorption branch of the isotherms based on Barrett-Joyner-Halenda (BJH) model shows that most pores throughout the HA reticular skeleton are sized at about 40 nm, but the pores are not uniform on the whole, owning to decomposition of the 'organic' CTAB templating structures and ammonium salt enclosed in the precipitated HA. The specific surface area of irregular meso-HA is calculated to be 37.6 m{sup 2}/g according to the Brunauer-Emmett-Teller (BET) equation. Moreover, after polylactic acid/meso-HA (PLA/meso-HA) composites degraded 12 weeks in normal saline at 37 deg. C, the interconnected pores throughout the HA skeleton were enlarged and sized in micron degree, which resemble trabecular bone structure very much.

  5. Luminescent mesoporous nanoreservoirs for the effective loading and intracellular delivery of therapeutic drugs.

    PubMed

    Kwon, Sooyeon; Singh, Rajendra K; Kim, Tae-Hyun; Patel, Kapil D; Kim, Jung-Ju; Chrzanowski, Wojciech; Kim, Hae-Won

    2014-03-01

    Development of biocompatible and multifunctional nanocarriers is important for the therapeutic efficacy of drug molecules in the treatment of disease and tissue repair. A novel nanocarrier of luminescent hollowed mesoporous silica (L-hMS) was explored for the loading and controlled delivery of drugs. For the synthesis of L-hMS, self-activated luminescence hydroxyapatite (LHA) was used as a template. Different thicknesses (∼ 7-62 nm) of mesoporous silica shell were obtained by varying the volume of silica precursor and the subsequent removal of the LHA core, which resulted in hollow-cored (size of ∼ 40 nm × 10 nm) mesoporous silica nanoreservoirs, L-hMS. While the silica shell provided a highly mesoporous structure, enabling an effective loading of drug molecules, the luminescent property of LHA was also well preserved in both the silica-shelled and the hollow-cored nanocarriers. Doxorubicin (DOX), used as a model drug, was shown to be effectively loaded onto the mesopore structure and within the hollow space of the nanoreservoir. The DOX release was fairly pH-dependent, occurring more rapidly at pH 5.3 than at pH 7.4, and a long-term sustainable delivery over the test period of 2weeks was observed. The nanoreservoir exhibited favorable cell compatibility with low cytotoxicity and excellent cell uptake efficiency (over 90%). Treatment of HeLa cells with DOX-loaded L-hMS elicited a sufficient degree of biological efficacy of DOX, as confirmed in the DOX-induced apoptotic behaviors, including stimulation in caspase-3 expression, and was even more effective than the direct DOX treatment. Overall, the newly developed L-hMS nanoreservoirs may be potentially useful as a multifunctional (luminescent, mesoporous and biocompatible) carrier system to effectively load and sustainably deliver small molecules, including anticancer drugs. PMID:24239681

  6. Hollow mesoporous silica nanoparticles for intracellular delivery of fluorescent dye

    PubMed Central

    2011-01-01

    In this study, hollow mesoporous silica nanoparticles (HMSNs) were synthesized using the sol-gel/emulsion approach and its potential application in drug delivery was assessed. The HMSNs were characterized, by transmission electron microscopy (TEM), Scanning Electron Microscopy (SEM), nitrogen adsorption/desorption and Brunauer-Emmett-Teller (BET), to have a mesoporous layer on its surface, with an average pore diameter of about 2 nm and a surface area of 880 m2/g. Fluorescein isothiocyanate (FITC) loaded into these HMSNs was used as a model platform to assess its efficacy as a drug delivery tool. Its release kinetic study revealed a sequential release of FITC from the HMSNs for over a period of one week when soaked in inorganic solution, while a burst release kinetic of the dye was observed just within a few hours of soaking in organic solution. These FITC-loaded HMSNs was also found capable to be internalized by live human cervical cancer cells (HeLa), wherein it was quickly released into the cytoplasm within a short period of time after intracellular uptake. We envision that these HMSNs, with large pores and high efficacy to adsorb chemicals such as the fluorescent dye FITC, could serve as a delivery vehicle for controlled release of chemicals administered into live cells, opening potential to a diverse range of applications including drug storage and release as well as metabolic manipulation of cells. PMID:21208421

  7. A highly ordered cubic mesoporous silica/graphene nanocomposite.

    PubMed

    Lee, Chang-Wook; Roh, Kwang Chul; Kim, Kwang-Bum

    2013-10-21

    A highly ordered cubic mesoporous silica (KIT-6)/graphene nanocomposite and 2D KIT-6 nanoflakes were synthesized using a novel synthesis methodology. The non-ionic triblock copolymer, P123, played a dual role as a structure-directing agent in the formation of the cubic mesoporous structure and as a cross-linking agent between mesoporous silica and graphene. The prepared (KIT-6)/graphene nanocomposite could act as a template for the preparation of mesoporous material/graphene nanocomposites. PMID:24057016

  8. Facile mesoporous template-assisted hydrothermal synthesis of ordered mesoporous magnesium silicate as an efficient adsorbent

    NASA Astrophysics Data System (ADS)

    Lu, Qingshan; Li, Qiang; Zhang, Jingjing; Li, Jingfeng; Lu, Jinhua

    2016-01-01

    Mesoporous materials with unique structure as well as special morphology have potential applications in pollutant adsorption. In this work, using mesoporous silica SBA-15 filled with carbon (C@SBA-15) as both silicon source and assisted template, the ordered mesoporous magnesium silicate (Mg3Si4O9(OH)4) has been fabricated at 140 °C by a novel and facile hydrothermal method. During the hydrothermal process, the magnesium silicate grew along the silica walls at the expense of consuming silica and deposited on the carbon surface of the C@SBA-15. Meanwhile, the rigid carbon inside the pores of the SBA-15 supported the magnesium silicate as mesoporous walls under hydrothermal condition. The obtained magnesium silicate possessed ordered mesoporous structure, high specific surface area of 446 m2/g, large pore volume of 0.84 cm3/g, and hierarchical structure assembled with ultrathin nanosheets of 15 nm in thickness. These characteristics endow the ordered mesoporous magnesium silicate with the fast adsorption rate and high adsorption capacity of 382 mg/g for methylene blue. In addition, this synthesis method opens a new approach to fabricate other ordered mesoporous silicates.

  9. Corrosion behavior of mesoporous transition metal nitrides

    SciTech Connect

    Yang, Minghui; Allen, Amy J.; Nguyen, Minh T.; Ralston, Walter T.; MacLeod, Michelle J.; DiSalvo, Francis J.

    2013-09-15

    Transition metal nitrides (TMN) have many desirable characteristics such as high hardness and good thermal stability under reducing conditions. This work reports an initial survey of the chemical stability of mesoporous TMNs (TM=Nb, V, Cr and Ti) in water at 80 °C at neutral, acidic and alkaline pH. The mesoporous TMNs had specific surface areas of 25–60 m{sup 2}/g with average pore sizes ranging from 10 to 50 nm. The high surface areas of these materials enhance the rate of corrosion per unit mass over that of a bulk material, making detection of corrosion much easier. The products were characterized by Rietveld refinement of powder X-ray diffraction (PXRD) patterns and by scanning electron microscopy (SEM). Several nitrides have corrosion rates that are, within error, not distinguishable from zero (±1 Å/day). Of the nitrides examined, CrN appears to be the most corrosion resistant under acidic conditions. None of the nitrides studied are corrosion resistant under alkaline conditions. - Graphical abstract: Corrosion behavior of mesoporous transition metal nitrides (TM=Nb, V, Cr and Ti) in acidic and alkaline solutions at 80 °C for 2 weeks. Display Omitted - highlights: • Corrosion rates of mesoporous transition metal nitrides in aqueous solution is reported. • The mesoporous TMNs had surface areas of 25–60 m{sup 2}/g. • CrN is the most corrosion resistant under the conditions studied.

  10. Carbon Nanotube Synthesis Using Mesoporous Silica Templates

    SciTech Connect

    Zheng, Feng; Liang, Liang; Gao, Yufei; Sukamto, Johanes H.; Aardahl, Chris L.

    2002-07-01

    Well-aligned carbon nanotubes (CNTs) were grown on mesoporous silica films by chemical vapor deposition (CVD). Ethylene was used as the carbon source and CVD was performed at 1023 K and atmospheric pressure. The films were doped with Fe during gelation, and three different structure directing agents were used for mesoporous silica synthesis: polyoxyethylene (10) cetyl ether (C16EO10), Pluronic tri-block copolymer (P123), and cetyltriethylammonium chloride (CTAC). A high degree of CNT alignment on C16EO10-mesoporous silica films was produced at Fe:Si molar ratio of 1.80. Similar alignment of CNTs was achieved on the other two types of films but on CTAC-mesoporous silica films, CNTs only grew parallel to the substrate surface from the cracks in the films because of the in-plane arrangement of the mesopores in such films. Considerable progress has been made in producing multi-walled carbon nanotubes (CNTs) by catalytic CVD techniques. If CNTs are to be integrated into certain useful devices, it is critical to be able to grow highly aligned arrays of CNTs with narrow size distribution and at specific locations on a substrate. Long-range alignment normal to the substrate results from steric crowding if the initial catalyst sites are sufficiently dense. Alignment may be improved with better control of the density of catalytic sites by means of a template of appropriate pore structure. The confinement of CNTs by the pores during the initial growth may also help align CNTs.

  11. Exoelectrogenic biofilm as a template for sustainable formation of a catalytic mesoporous structure.

    PubMed

    Yates, Matthew D; Cusick, Roland D; Ivanov, Ivan; Logan, Bruce E

    2014-11-01

    Mesoporous structures can increase catalytic activity by maximizing the ratio of surface area to volume, but current synthesis techniques utilize expensive polymers and toxic chemicals. A Geobacter sulfurreducens biofilm was used as a sustainable template to form mesoporous Pd structures while eliminating the need for synthetic chemicals. The bulk of the biofilm material was removed by thermal treatments after nanoparticle formation, producing a catalytic Pd mesoporous (pore size 9.7 ± 0.1 nm) structure attached to the graphite electrode with a 1.5-2 µm thick backbone composed of nanoparticles (∼200 nm). A control electrode electrochemically plated with Pd in the absence of a biofilm exhibited a variable planar Pd base (∼0.5-3 µm thick) with sporadic Pd extrusions (∼2 µm across, 1-5 µm tall) from the surface. The biotemplated mesoporous structure produced 15-20% higher stable current densities during H2 oxidation tests than the electrochemically plated control electrode, even though 30% less Pd was present in the biotemplated catalyst. These results indicate that electroactive biofilms can be used as a sustainable base material to produce nanoporous structures without the need for synthetic polymers. Biotechnol. Bioeng. 2014;111: 2349-2354. © 2014 Wiley Periodicals, Inc. PMID:24771104

  12. Drug release from ordered mesoporous silicas.

    PubMed

    Doadrio, Antonio L; Salinas, Antonio J; Sánchez-Montero, José M; Vallet-Regí, M

    2015-01-01

    The state-of-the-art in the investigation of drugs release from Silica-based ordered Mesoporous Materials (SMMs) is reviewed. First, the SMM systems used like host matrixes are described. Then, the model drugs studied until now, including their pharmacological action, structure and the mesoporous matrix employed for each drug, are comprehensively listed. Next, the factors influencing the release of drugs from SMMs and the strategies used to control the drug delivery, specially the chemical functionalization of the silica surface, are discussed. In addition, how all these factors were gathered in a kinetic equation that describes the drug release from the mesoporous matrixes is explained. The new application of molecular modeling and docking in the investigation of the drug delivery mechanisms from SMMs is also presented. Finally, the new approaches under investigation in this field are mentioned including the design of smart stimuli-responsive materials and other recent proposals for a future investigation. PMID:26549760

  13. Nonenzymatic glucose detection using mesoporous platinum.

    PubMed

    Park, Sejin; Chung, Taek Dong; Kim, Hee Chan

    2003-07-01

    Roughness of nanoscopic dimensions can be used to selectively enhance the faradaic current of a sluggish reaction. Using this principle, we constructed mesoporous structures on the surfaces of pure platinum electrodes responding even more sensitively to glucose than to common interfering species, such as L-ascorbic acid and 4-acetamidophenol. Good sensitivities, as high as 9.6 microA cm(-2) mM(-1), were reproducibly observed in the presence of high concentration of chloride ion. The selectivities, sensitivities, and stabilities determined experimentally have demonstrated the potential of mesoporous platinum as a novel candidate for nonenzymatic glucose sensors. PMID:12964749

  14. Orientation specific deposition of mesoporous particles

    NASA Astrophysics Data System (ADS)

    Kjellman, Tomas; Bodén, Niklas; Wennerström, Hâkan; Edler, Karen J.; Alfredsson, Viveka

    2014-11-01

    We present a protocol for a facile orientation specific deposition of plate-like mesoporous SBA-15 silica particles onto a surface (mesopores oriented normal to surface). A drop of an aqueous dispersion of particles is placed on the surface and water vaporizes under controlled relative humidity. Three requirements are essential for uniform coverage: particle dispersion should not contain aggregates, a weak attraction between particles and surface is needed, and evaporation rate should be low. Aggregates are removed by stirring/sonication. Weak attraction is realized by introducing cationic groups to the surface. Insight into the mechanisms of the so-called coffee stain effect is also provided.

  15. Microwave assisted N-alkylation of amine functionalized crystal-like mesoporous phenylene-silica.

    PubMed

    Lourenço, Mirtha A O; Siegel, Renée; Mafra, Luís; Ferreira, Paula

    2013-04-28

    N-alkylation reaction of amine functionalized phenylene moieties in crystal-like mesoporous silica is successfully achieved with about 87% of conversion in two reaction cycles. A potassium iodide catalyzed method commonly used for the selective N-monoalkylation of aniline is adapted and optimized to the N-monoalkylation reactions of the amine functionalized periodic mesoporous phenylene-silica (NH2-PMO) under microwave irradiation with preservation of the ordered mesostructure and of the crystal-like molecular scale periodicity of the material. This functionalization opens an avenue for the preparation of new materials with different amino-alkyl groups specially designed for a desired application, namely on the adsorption or catalytic fields. PMID:23508286

  16. High-Temperature-Stable and Regenerable Catalysts: Platinum Nanoparticles in Aligned Mesoporous Silica Wells

    SciTech Connect

    Xiao, Chaoxian; Maligal-Ganesh, Raghu V.; Li, Tao; Wi, Zhiyuan; Guo, Zhiyong; Brashler, Kyle T.; Goes, Shannon; Li, Xinle; Goh, Tian Wei; Winans, Randall E.; Huang, Wenyu

    2013-08-22

    We report the synthesis, structural characterization, thermal stability study, and regeneration of nanostructured catalysts made of 2.9 nm Pt nanoparticles sandwiched between a 180 nm SiO2 core and a mesoporous SiO2 shell. The SiO2 shell consists of 2.5 nm channels that are aligned perpendicular to the surface of the SiO2 core. The nanostructure mimics Pt nanoparticles that sit in mesoporous SiO2 wells (Pt@MSWs). By using synchrotron-based small-angle X-ray scattering, we were able to prove the ordered structure of the aligned mesoporous shell. By using high-temperature cyclohexane dehydrogenation as a model reaction, we found that the Pt@MSWs of different well depths showed stable activity at 500 °C after the induction period. Conversely, a control catalyst, SiO2-sphere-supported Pt nanoparticles without a mesoporous SiO2 shell (Pt/SiO2), was deactivated. We deliberately deactivated the Pt@MSWs catalyst with a 50 nm deep well by using carbon deposition induced by a low H2/cyclohexane ratio. The deactivated Pt@MSWs catalyst was regenerated by calcination at 500 °C with 20 % O2 balanced with He. After the regeneration treatments, the activity of the Pt@MSWs catalyst was fully restored. Our results suggest that the nanostructured catalysts—Pt nanoparticles confined inside mesoporous SiO2 wells—are stable and regenerable for treatments and reactions that require high temperatures.

  17. High-temperature-stable and regenerable catalysts: platinum nanoparticles in aligned mesoporous silica wells.

    PubMed

    Xiao, Chaoxian; Maligal-Ganesh, Raghu V; Li, Tao; Qi, Zhiyuan; Guo, Zhiyong; Brashler, Kyle T; Goes, Shannon; Li, Xinle; Goh, Tian Wei; Winans, Randall E; Huang, Wenyu

    2013-10-01

    We report the synthesis, structural characterization, thermal stability study, and regeneration of nanostructured catalysts made of 2.9 nm Pt nanoparticles sandwiched between a 180 nm SiO2 core and a mesoporous SiO2 shell. The SiO2 shell consists of 2.5 nm channels that are aligned perpendicular to the surface of the SiO2 core. The nanostructure mimics Pt nanoparticles that sit in mesoporous SiO2 wells (Pt@MSWs). By using synchrotron-based small-angle X-ray scattering, we were able to prove the ordered structure of the aligned mesoporous shell. By using high-temperature cyclohexane dehydrogenation as a model reaction, we found that the Pt@MSWs of different well depths showed stable activity at 500 °C after the induction period. Conversely, a control catalyst, SiO2 -sphere-supported Pt nanoparticles without a mesoporous SiO2 shell (Pt/SiO2 ), was deactivated. We deliberately deactivated the Pt@MSWs catalyst with a 50 nm deep well by using carbon deposition induced by a low H2 /cyclohexane ratio. The deactivated Pt@MSWs catalyst was regenerated by calcination at 500 °C with 20 % O2 balanced with He. After the regeneration treatments, the activity of the Pt@MSWs catalyst was fully restored. Our results suggest that the nanostructured catalysts-Pt nanoparticles confined inside mesoporous SiO2 wells-are stable and regenerable for treatments and reactions that require high temperatures. PMID:24039118

  18. Tetracycline-Containing MCM-41 Mesoporous Silica Nanoparticles for the Treatment of Escherichia coli.

    PubMed

    Koneru, Bhuvaneswari; Shi, Yi; Wang, Yu-Chieh; Chavala, Sai H; Miller, Michael L; Holbert, Brittany; Conson, Maricar; Ni, Aiguo; Di Pasqua, Anthony J

    2015-01-01

    Tetracycline (TC) is a well-known broad spectrum antibiotic, which is effective against many Gram positive and Gram negative bacteria. Controlled release nanoparticle formulations of TC have been reported, and could be beneficial for application in the treatment of periodontitis and dental bone infections. Furthermore, TC-controlled transcriptional regulation systems (Tet-on and Tet-off) are useful for controlling transgene expression in vitro and in vivo for biomedical research purposes; controlled TC release systems could be useful here, as well. Mesoporous silica nanomaterials (MSNs) are widely studied for drug delivery applications; Mobile crystalline material 41 (MCM-41), a type of MSN, has a mesoporous structure with pores forming channels in a hexagonal fashion. We prepared 41 ± 4 and 406 ± 55 nm MCM-41 mesoporous silica nanoparticles and loaded TC for controlled dug release; TC content in the TC-MCM-41 nanoparticles was 18.7% and 17.7% w/w, respectively. Release of TC from TC-MCM-41 nanoparticles was then measured in phosphate-buffered saline (PBS), pH 7.2, at 37 °C over a period of 5 h. Most antibiotic was released from both over this observation period; however, the majority of TC was released over the first hour. Efficacy of the TC-MCM-41 nanoparticles was then shown to be superior to free TC against Escherichia coli (E. coli) in culture over a 24 h period, while blank nanoparticles had no effect. PMID:26528964

  19. Functionalized bimodal mesoporous silicas as carriers for controlled aspirin delivery

    NASA Astrophysics Data System (ADS)

    Gao, Lin; Sun, Jihong; Li, Yuzhen

    2011-08-01

    The bimodal mesoporous silica modified with 3-aminopropyltriethoxysilane was performed as the aspirin carrier. The samples' structure, drug loading and release profiles were characterized with X-ray diffraction, scanning electron microscopy, N 2 adsorption and desorption, Fourier transform infrared spectroscopy, TG analysis, elemental analysis and UV-spectrophotometer. For further exploring the effects of the bimodal mesopores on the drug delivery behavior, the unimodal mesoporous material MCM-41 was also modified as the aspirin carrier. Meantime, Korsmeyer-Peppas equation ft= ktn was employed to analyze the dissolution data in details. It is indicated that the bimodal mesopores are beneficial for unrestricted drug molecules diffusing and therefore lead to a higher loading and faster releasing than that of MCM-41. The results show that the aspirin delivery properties are influenced considerably by the mesoporous matrix, whereas the large pore of bimodal mesoporous silica is the key point for the improved controlled-release properties.

  20. Electrical Relaxation in ULTEM® and ULTEM® Containing Mesoporous Silica

    NASA Astrophysics Data System (ADS)

    Turo, Andrew; Edmondson, Charles E.; Lomax, Joseph F.; Bendler, John T.; Fontanella, John J.; Wintersgill, Mary C.

    2008-08-01

    Mesoporous silica has been added to Ultem® 1000 polyetherimide using solution casting. The mesoporous silica that was added was either uncoated or coated with polystyrene. Audio frequency dielectric relaxation studies were then carried out over the temperature range 5.5 to 550 K. Several interesting results were obtained. First, the uncoated mesoporous silica caused essentially no change in the relaxation spectrum of pure Ultem®. The polystyrene coated mesoporous silica caused rather large changes. The most striking example is the introduction of a new relaxation. This relaxation occurs at about 150 K and 1000 Hz as showing in fig. 1 via the open circles.

  1. Surface functionalized mesoporous material and method of making same

    DOEpatents

    Feng, Xiangdong [West Richland, WA; Liu, Jun [West Richland, WA; Fryxell, Glen E [Kennewick, WA

    2001-12-04

    According to the present invention, an organized assembly of functional molecules with specific interfacial functionality (functional group(s)) is attached to available surfaces including within mesopores of a mesoporous material. The method of the present invention avoids the standard base soak that would digest the walls between the mesopores by boiling the mesoporous material in water for surface preparation then removing all but one or two layers of water molecules on the internal surface of a pore. Suitable functional molecule precursor is then applied to permeate the hydrated pores and the precursor then undergoes condensation to form the functional molecules on the interior surface(s) of the pore(s).

  2. Mesoporous carbon/zirconia composites: a potential route to chemically functionalized electrically-conductive mesoporous materials.

    PubMed

    Oh, Jung-Min; Kumbhar, Amar S; Geiculescu, Olt; Creager, Stephen E

    2012-02-14

    Mesoporous nanocomposite materials in which nanoscale zirconia (ZrO(2)) particles are embedded in the carbon skeleton of a templated mesoporous carbon matrix were prepared, and the embedded zirconia sites were used to accomplish chemical functionalization of the interior surfaces of mesopores. These nanocomposite materials offer a unique combination of high porosity (e.g., ∼84% void space), electrical conductivity, and surface tailorability. The ZrO(2)/carbon nanocomposites were characterized by thermogravimetric analysis, nitrogen-adsorption porosimetry, helium pychnometry, powder X-ray diffraction, Raman spectroscopy, scanning electron microscopy, transmission electron microscopy, and X-ray photoelectron spectroscopy. Comparison was made with templated mesoporous carbon samples prepared without addition of ZrO(2). Treatment of the nanocomposites with phenylphosphonic acid was undertaken and shown to result in robust binding of the phosphonic acid to the surface of ZrO(2) particles. Incorporation of nanoscale ZrO(2) surfaces in the mesoporous composite skeleton offers unique promise as a means for anchoring organophosphonates inside of pores through formation of robust covalent Zr-O-P bonds. PMID:22248432

  3. Alendronate decorated nano hydroxyapatite in mesoporous silica: Cytotoxicity and osteogenic properties

    NASA Astrophysics Data System (ADS)

    Huang, Wei; Liu, Weiqiang; She, Zhending; Wu, Hongkai; Shi, Xuetao

    2011-09-01

    Mesoporous silica is a promising drug delivery vehicle due to its large surface area and order porous structure. Hydroxyapatite-modified mesoporous silica materials (MSH) have been developed, and the cytotoxicity of MSH and unmodified mesoporous silica (HMS) has also been studied in this work. The results indicated that MSH exhibited lower cytotoxicity than HMS. The drug release property of MSH was also investigated in this paper. Alendronate (AL) was laden into MSH and HMS, respectively. MSH exhibited long release period lasting over 30 days with a weak burst release in the first 5 days; however, the AL release period of HMS was just 5 days with a remarkable burst release. In addition, the osteogenic commitment induced in human marrow mesenchymal stem cells (MSCs) by MSH-alendronate (MSH-AL) was also investigated, and the osteogenesis of MSCs was evaluated by alkaline phosphatase (ALP) assay. The osteogenesis of MSCs induced by MSH-AL is comparable to that induced by the osteogenic medium. Taken together, MSH can be severed as potential bone repair materials with lower cytotoxicity.

  4. Mesoporous structured MIPs@CDs fluorescence sensor for highly sensitive detection of TNT.

    PubMed

    Xu, Shoufang; Lu, Hongzhi

    2016-11-15

    A facile strategy was developed to prepare mesoporous structured molecularly imprinted polymers capped carbon dots (M-MIPs@CDs) fluorescence sensor for highly sensitive and selective determination of TNT. The strategy using amino-CDs directly as "functional monomer" for imprinting simplify the imprinting process and provide well recognition sites accessibility. The as-prepared M-MIPs@CDs sensor, using periodic mesoporous silica as imprinting matrix, and amino-CDs directly as "functional monomer", exhibited excellent selectivity and sensitivity toward TNT with detection limit of 17nM. The recycling process was sustainable for 10 times without obvious efficiency decrease. The feasibility of the developed method in real samples was successfully evaluated through the analysis of TNT in soil and water samples with satisfactory recoveries of 88.6-95.7%. The method proposed in this work was proved to be a convenient and practical way to prepare high sensitive and selective fluorescence MIPs@CDs sensors. PMID:27315521

  5. Polymer/mesoporous metal oxide composites

    NASA Astrophysics Data System (ADS)

    Ver Meer, Melissa Ann

    Understanding the nature of the interfacial region between an organic polymer matrix and an inorganic filler component is essential in determining how this region impacts the overall bulk properties of the organic/inorganic hybrid composite material. In this work, polystyrene was used as the model polymer matrix coupled with silica-based filler materials to investigate the nature of structure-property relationships in polymer composites. Initial work was conducted on synthesis and characterization of colloidal and mesoporous silica particles melt blended into the polystyrene matrix. Modification of the interface was accomplished by chemically bonding the silica particles with the polystyrene chains through polymerization from the particle surface via atom transfer radical polymerization. High molecular weight polystyrene chains were formed and bulk test samples were evaluated with increased thermal stability of the grafted polymer composite system versus equivalent melt blended polymer composites. Polymer grafting was also conducted from the internal pores of mesoporous silica, further improving the thermal stability of the composite system without degrading dynamic mechanical properties. Characterization of the polymer composites was conducted with gel permeation chromatography, transmission electron microscopy, thermogravimetric analysis and dynamic mechanical analysis. It was also discovered during the polystyrene-silica composite studies that amorphous polystyrene can possess a less mobile phase, evident in a second peak of the loss tangent (tan delta). The long annealing times necessitated by the mesoporous silica composites were replicated in as received polystyrene. This new, less mobile phase is of particular interest in determining the mobility of polymer chains in the interfacial region.

  6. Mesoporous silica nanoparticles for active corrosion protection.

    PubMed

    Borisova, Dimitriya; Möhwald, Helmuth; Shchukin, Dmitry G

    2011-03-22

    This work presents the synthesis of monodisperse, mesoporous silica nanoparticles and their application as nanocontainers loaded with corrosion inhibitor (1H-benzotriazole (BTA)) and embedded in hybrid SiOx/ZrOx sol-gel coating for the corrosion protection of aluminum alloy. The developed porous system of mechanically stable silica nanoparticles exhibits high surface area (∼1000 m2·g(-1)), narrow pore size distribution (d∼3 nm), and large pore volume (∼1 mL·g(-1)). As a result, a sufficiently high uptake and storage of the corrosion inhibitor in the mesoporous nanocontainers was achieved. The successful embedding and homogeneous distribution of the BTA-loaded monodisperse silica nanocontainers in the passive anticorrosive SiOx/ZrOx film improve the wet corrosion resistance of the aluminum alloy AA2024 in 0.1 M sodium chloride solution. The enhanced corrosion protection of this newly developed active system in comparison to the passive sol-gel coating was observed during a simulated corrosion process by the scanning vibrating electrode technique (SVET). These results, as well as the controlled pH-dependent release of BTA from the mesoporous silica nanocontainers without additional polyelectrolyte shell, suggest an inhibitor release triggered by the corrosion process leading to a self-healing effect. PMID:21344888

  7. The Synthesis of Functional Mesoporous Materials

    SciTech Connect

    Fryxell, Glen E.

    2006-11-01

    The ability to decorate a silica surface with specific ligand fields and/or metal complexes creates powerful new capabilities for catalysis, chemical separations and sensor development. Integrating this with the ability to control the spacing of these complexes across the surface, as well as the symmetry and size of the pore structure, allows the synthetic chemist to hierarchically tailor these structured nanomaterials to specific needs. The next step up the “scale ladder” is provided by the ability to coat these mesoporous materials onto complex shapes, allowing for the intimate integration of these tailored materials into device interfaces. The ability to tailor the pore structure of these mesoporous supports is derived from the surfactant templated synthesis of mesoporous materials, an area which has seen an explosion of activity over the last decade.[1,2] The ability to decorate the surface with the desired functionality requires chemical modification of the oxide interface, most commonly achieved using organosilane self-assembly.[3-6] This manuscript describes recent results from the confluence of these two research areas, with a focus on synthetic manipulation of the morphology and chemistry of the interface, with the ultimate goal of binding metal centers in a chemically useful manner.

  8. Mesoporous carbon nanomaterials as environmental adsorbents.

    PubMed

    Tripathi, Pranav K; Gan, Lihua; Liu, Mingxian; Rao, Nageswara N

    2014-02-01

    The transportation and diffusion of the guest objects or molecules in the porous carbon nanomaterials can be facilitated by reducing the pathway and resistance. The reduced pathway depends on the porous nature of carbon nanomaterials. Classification of porous carbon materials by the International Union of Pure and Applied Chemistry (IUPAC) has given a new opportunity to design the pores as per their applicability and to understand the mobility of ions, atoms, and molecules in the porous network of carbon materials and also advanced their countless applicability. However, synthesis of carbon nanomaterials with a desired porous network is still a great challenge. Although, remarkable developments have taken place in the recent years, control over the pores size and/or hierarchical porous architectures, especially in the synthesis of carbon nanospheres (CNSs) and ordered mesoporous carbon (OMCs) is still intriguing. The micro and mesoporous CNSs and OMCs have been prepared by a variety of procedures and over a wide range of compositions using various different surfactant templates and carbon precursors etc. The mechanisms of formation of micromesopore in the CNSs and OMCs are still evolving. On the other hand, the urge for adsorbents with very high adsorption capacities for removing contaminants from water is growing steadily. In this review, we address the state-of-the-art synthesis of micro and mesoporous CNSs and OMCs, giving examples of their applications for adsorptive removals of contaminants including our own research studies. PMID:24749459

  9. Phosphorylated Mesoporous Carbon as a Solid Acid Catalyst

    SciTech Connect

    Dai, Sheng; Mayes, Richard T; Fulvio, Pasquale F; Ma, Zhen

    2011-01-01

    Mesoporous carbon catalyst supports are attractive due to their wide chemical stability while potentially increasing masstransport through and providing a path for larger molecules to access catalytic sites. Herein we report the synthesis of a 10 phosphorylated mesoporous carbon solid-acid catalyst characterized by NH3-TPD and isopropanol dehydration.

  10. The Synthesis of Cadmium Doped Mesoporous TiO2

    SciTech Connect

    Li, Xiaohong S.; Fryxell, Glen E.; Engelhard, Mark H.; Wang, Chong M.

    2007-06-01

    Cd doped mesoporous titanium oxide was prepared using non-ionic surfactants and easily handled titanium precursors. The Cd doping was found to be able to significantly inhibit the growth of anatase crystal size, stabilize the mesoporous structure, and retard the densification of nanoporous TiO2 at elevated temperatures.

  11. Protection of Organic Matter from Enzyme Degradation by Mineral Mesopores

    NASA Astrophysics Data System (ADS)

    Zimmerman, A. R.; Chorover, J. D.; Brantley, S. L.

    2003-12-01

    Mineral mesopores (2-50 nm diameter) may sequester organic matter (natural and pollutant) and protect it from microbial and fungal enzymatic degradation in soils and sediments. Synthetic mesoporous alumina and silica minerals with uniform pore sizes and shapes were used to test the role of mesopores in protecting organic matter from enzymatic degradation. A model humic compound, L-3-4-dihydroxyphenylalanine (L-DOPA), was sorbed to the internal surfaces of mesoporous alumina (8.2 nm diameter pores) and mesoporous silica (3.4 nm diameter pores) as well as to the external surfaces of nonporous alumina and silica analogues. A fungal derived enzyme, laccase, was added to these sorbate-sorbent pairs in aqueous solution and activity was monitored by oxygen consumption. Though enzyme activity was suppressed in both cases by mineral-enzyme interaction (enzyme inhibition likely due to adsorption of the enzyme), both the rate and total extent of enzyme-mediated degradation of mesopore-sorbed L-DOPA was 3-40 times lower than that of the externally-sorbed analogue. These results provide, for the first time, direct evidence for the viability of the proposed mesopore protection mechanism for the sequestration and preservation of sedimentary organic matter and organic contaminants. Mesopore adsorption/desorption phenomena may also help explain the slow degradation of organic contaminants in soil and sediment and may prove useful as delivery vehicles for organic compounds to agricultural, medical or environmental systems.

  12. Transport properties of fast proton conducting mesoporous silica xerogels

    NASA Astrophysics Data System (ADS)

    Colomer, M. T.; Rubio, F.; Jurado, J. R.

    Mesoporous acid-free silica xerogels exhibiting a proton conductivity of 2.0 × 10 -2 S cm -1 at 80 °C and 81% RH is reported for the first time. The proton conductivity values, lower cost and higher hydrophilicity of mesoporous silica xerogels make them potential substitutes for Nafion membranes in proton exchange membranes fuel cells (PEMFCs).

  13. [Study on absorbing volatile oil with mesoporous carbon].

    PubMed

    Yan, Hong-mei; Jia, Xiao-bin; Zhang, Zhen-hai; Sun, E; Yang Nan

    2014-11-01

    Clove oil and turmeric oil were absorbed by mesoporous carbon. The absorption ratio of mesoporous carbon to volatile oil was optimized with the eugenol yield and curcumol yield as criteria Curing powder was characterized by scanning electron microscopy (SEM) and differential scanning calorietry (DSC). The effects of mesoporous carbon on dissolution in vitro and thermal stability of active components were studied. They reached high adsorption rate when the absorption ratio of mesoporous carbon to volatile oil was 1:1. When volatile oil was absorbed, dissolution rate of active components had a little improvement and their thermal stability improved after volatile oil was absorbed by the loss rate decreasing more than 50%. Absorbing herbal volatile oil with mesoporous carbon deserves further studying. PMID:25850263

  14. Biodegradation-tunable mesoporous silica nanorods for controlled drug delivery.

    PubMed

    Park, Sung Bum; Joo, Young-Ho; Kim, Hyunryung; Ryu, WonHyoung; Park, Yong-il

    2015-05-01

    Mesoporous silica in the forms of micro- or nanoparticles showed great potentials in the field of controlled drug delivery. However, for precision control of drug release from mesoporous silica-based delivery systems, it is critical to control the rate of biodegradation. Thus, in this study, we demonstrate a simple and robust method to fabricate "biodegradation-tunable" mesoporous silica nanorods based on capillary wetting of anodic aluminum oxide (AAO) template with an aqueous alkoxide precursor solution. The porosity and nanostructure of silica nanorods were conveniently controlled by adjusting the water/alkoxide molar ratio of precursor solutions, heat-treatment temperature, and Na addition. The porosity and biodegradation kinetics of the fabricated mesoporous nanorods were analyzed using N2 adsorption/desorption isotherm, TGA, DTA, and XRD. Finally, the performance of the mesoporous silica nanorods as drug delivery carrier was demonstrated with initial burst and subsequent "zero-order" release of anti-cancer drug, doxorubicin. PMID:25746247

  15. Synthesis and catalytic applications of combined zeolitic/mesoporous materials

    PubMed Central

    Vernimmen, Jarian; Cool, Pegie

    2011-01-01

    Summary In the last decade, research concerning nanoporous siliceous materials has been focused on mesoporous materials with intrinsic zeolitic features. These materials are thought to be superior, because they are able to combine (i) the enhanced diffusion and accessibility for larger molecules and viscous fluids typical of mesoporous materials with (ii) the remarkable stability, catalytic activity and selectivity of zeolites. This review gives an overview of the state of the art concerning combined zeolitic/mesoporous materials. Focus is put on the synthesis and the applications of the combined zeolitic/mesoporous materials. The different synthesis approaches and formation mechanisms leading to these materials are comprehensively discussed and compared. Moreover, Ti-containing nanoporous materials as redox catalysts are discussed to illustrate a potential implementation of combined zeolitic/mesoporous materials. PMID:22259762

  16. Mesoporous aluminosilicates assembled from dissolved LTA zeolite and triblock copolymer in the presence of tetramethylammonium hydroxide.

    PubMed

    Tanaka, Shunsuke; Okada, Hiroaki; Nakatani, Norihito; Maruo, Takanori; Nishiyama, Norikazu; Miyake, Yoshikazu

    2009-05-15

    Zeolite Na-A crystals dissolved in a HCl solution were used as a single-source of silicon and aluminum for the synthesis of mesoporous aluminosilicates via a template-assisted method with an organic base tetramethylammonium hydroxide (TMAOH). Amphiphilic triblock copolymer Pluronic F127 (EO(106)PO(70)EO(106)) was used as template. Increasing the amount of TMAOH in the synthetic solution resulted in an increase in the aluminum content of the products. On the other hand, mesostructural periodicity was deteriorated with higher content of aluminum incorporated into the mesoporous framework. The samples with low Si/Al ratios less than 5 have wormhole-like pore structure, while the samples with Si/Al ratios more than 7 possess highly ordered mesoporous structure, a body-centered Im3m symmetry, with single crystal like morphology. The samples with Si/Al ratio of 7, which prepared at TMAOH molar concentration of 25 mM in the templating solution, possess BET surface area of 470 m(2)/g, pore size of 6.4 nm, and pore volume of 0.56 cm(3)/g. Aluminum atoms have successfully been incorporated in a tetra-coordinated position and remained stable even after calcination at 600 degrees C. PMID:19223041

  17. Doxorubicin-loaded mesoporous silica nanoparticle composite nanofibers for long-term adjustments of tumor apoptosis

    NASA Astrophysics Data System (ADS)

    Yuan, Ziming; Pan, Yue; Cheng, Ruoyu; Sheng, Lulu; Wu, Wei; Pan, Guoqing; Feng, Qiming; Cui, Wenguo

    2016-06-01

    There is a high local recurrence (LR) rate in breast-conserving therapy (BCT) and enhancement of the local treatment is promising as a way to improve this. Thus we propose a drug delivery system using doxorubicin (DOX)-loaded mesoporous silica nanoparticle composite nanofibers which can release anti-tumor drugs in two phases—burst release in the early stage and sustained release at a later stage—to reduce the LR of BCT. In the present study, we designed a novel composite nanofibrous scaffold to realize the efficient release of drugs by loading both DOX and DOX-loaded mesoporous silica nanoparticles into an electrospun PLLA nanofibrous scaffold. In vitro results demonstrated that this kind of nanomaterial can release DOX in two phases, and the results of in vivo experiments showed that this hybrid nanomaterial significantly inhibited the tumor growth in a solid tumor model. Histopathological examination demonstrated that the apoptosis of tumor cells in the treated group over a 10 week period was significant. The anti-cancer effects were also accompanied with decreased expression of Bcl-2 and TNF-α, along with up-regulation of Bax, Fas and the activation of caspase-3 levels. The present study illustrates that the mesoporous silica nanoparticle composite nanofibrous scaffold could have anti-tumor properties and could be further developed as adjuvant therapeutic protocols for the treatment of cancer.

  18. Problem Periods

    MedlinePlus

    ... gov/ Home Body Getting your period Problem periods Problem periods It’s common to have cramps or feel ... doctor Some common period problems Signs of period problems top One way to know if you may ...

  19. A highly ordered cubic mesoporous silica/graphene nanocomposite

    NASA Astrophysics Data System (ADS)

    Lee, Chang-Wook; Roh, Kwang Chul; Kim, Kwang-Bum

    2013-09-01

    A highly ordered cubic mesoporous silica (KIT-6)/graphene nanocomposite and 2D KIT-6 nanoflakes were synthesized using a novel synthesis methodology. The non-ionic triblock copolymer, P123, played a dual role as a structure-directing agent in the formation of the cubic mesoporous structure and as a cross-linking agent between mesoporous silica and graphene. The prepared (KIT-6)/graphene nanocomposite could act as a template for the preparation of mesoporous material/graphene nanocomposites.A highly ordered cubic mesoporous silica (KIT-6)/graphene nanocomposite and 2D KIT-6 nanoflakes were synthesized using a novel synthesis methodology. The non-ionic triblock copolymer, P123, played a dual role as a structure-directing agent in the formation of the cubic mesoporous structure and as a cross-linking agent between mesoporous silica and graphene. The prepared (KIT-6)/graphene nanocomposite could act as a template for the preparation of mesoporous material/graphene nanocomposites. Electronic supplementary information (ESI) available: S1: TEM images of disordered mesoporous silica/graphene nanocomposite; S2: TEM images of KIT-6/GO nanocomposite; S3: Thermogravimetric analysis of KIT-6/GO and KG-400-700; S4: SEM and TEM images of KIT-6; S5: Low angle XRD, Raman spectra, N2 adsorption isotherms, pore size distribution and photographic images of the prepared samples; S6: TEM image and N2 adsorption isotherms of mesoporous carbon/graphene nanocomposite; S7: XPS C1s spectra of the prepared samples. See DOI: 10.1039/c3nr03108j

  20. Controlling drug delivery kinetics from mesoporous titania thin films by pore size and surface energy

    PubMed Central

    Karlsson, Johan; Atefyekta, Saba; Andersson, Martin

    2015-01-01

    The osseointegration capacity of bone-anchoring implants can be improved by the use of drugs that are administrated by an inbuilt drug delivery system. However, to attain superior control of drug delivery and to have the ability to administer drugs of varying size, including proteins, further material development of drug carriers is needed. Mesoporous materials have shown great potential in drug delivery applications to provide and maintain a drug concentration within the therapeutic window for the desired period of time. Moreover, drug delivery from coatings consisting of mesoporous titania has shown to be promising to improve healing of bone-anchoring implants. Here we report on how the delivery of an osteoporosis drug, alendronate, can be controlled by altering pore size and surface energy of mesoporous titania thin films. The pore size was varied from 3.4 nm to 7.2 nm by the use of different structure-directing templates and addition of a swelling agent. The surface energy was also altered by grafting dimethylsilane to the pore walls. The drug uptake and release profiles were monitored in situ using quartz crystal microbalance with dissipation (QCM-D) and it was shown that both pore size and surface energy had a profound effect on both the adsorption and release kinetics of alendronate. The QCM-D data provided evidence that the drug delivery from mesoporous titania films is controlled by a binding–diffusion mechanism. The yielded knowledge of release kinetics is crucial in order to improve the in vivo tissue response associated to therapeutic treatments. PMID:26185444

  1. In vitro degradability, bioactivity and cell responses to mesoporous magnesium silicate for the induction of bone regeneration.

    PubMed

    Wu, Zhaoying; Tang, Tingting; Guo, Han; Tang, Songchao; Niu, Yunfei; Zhang, Jue; Zhang, Wenjing; Ma, Rui; Su, Jiacan; Liu, Changsheng; Wei, Jie

    2014-08-01

    Mesoporous magnesium silicate (m-MS) was synthesized, and the in vitro degradability, bioactivity and primary cell responses to m-MS were investigated. The results suggested that the m-MS with mesoporous channels of approximately 5nm possessed the high specific surface area of 451.0m(2)/g and a large specific pore volume of 0.41cm(3)/g compared with magnesium silicate (MS) without mesopores of 75m(2)/g and 0.21cm(3)/g, respectively. The m-MS was able to absorb a large number of water, with water absorption of 74% compared with 26% for MS. The m-MS was also degradable in a Tris-HCl solution, with a weight loss ratio of 40wt% after a 70-day immersion period. The m-MS exhibited good in vitro bioactivity, inducing apatite formation on its surfaces after soaking in simulated body fluid (SBF) at a faster rate than observed for MS. The m-MS surface clearly promoted the proliferation and differentiation of MC3T3-E1 cells, and their normal cell morphology indicated excellent cytocompatibility. This study suggested that mesoporous magnesium silicate with a high specific surface area and pore volume had suitable degradability and good bioactivity and biocompatibility, making it an excellent candidate biomaterial for the induction of bone regeneration. PMID:24905677

  2. Contribution of mesopores in MgO-templated mesoporous carbons to capacitance in non-aqueous electrolytes

    NASA Astrophysics Data System (ADS)

    Kado, Yuya; Soneda, Yasushi; Yoshizawa, Noriko

    2015-02-01

    MgO-templated mesoporous carbons were fabricated by annealing trimagnesium dicitrate nonahydrate at various temperatures from 700 to 1000 °C with subsequent acid leaching of MgO. The obtained carbons contained a large amount of mesopores. Performances of electric double-layer capacitors using these carbons were examined for propylene carbonate electrolyte containing 1 M tetraethylammonium tetrafluoroborate. The mesoporous carbons synthesized at higher temperatures showed better rate capabilities. AC impedance measurements indicated that high-temperature annealing of the carbon precursors and the presence of mesopores were important for high rate performance. In addition, the contribution of mesopores to capacitance was more significant at higher current densities of 30 A g-1.

  3. Modified Mesoporous Silica for Efficient Siloxane Capture.

    PubMed

    Jafari, Tahereh; Jiang, Ting; Zhong, Wei; Khakpash, Nasser; Deljoo, Bahareh; Aindow, Mark; Singh, Prabhakar; Suib, Steven L

    2016-03-15

    In this study, octamethylcyclotetrasiloxane (D4) was removed by using a novel modified solid adsorbent of mesoporous silica. The adsorbent was synthesized using inverse micelles with some modifications in the synthesis process (temperature of gelation) and in the post treatment conditions (calcination temperature and heating rate) with a concomitant improvement of D4 uptake. This is the first report on regulating the textural properties of the mesoporous silica material UCT-14 to develop an active silica adsorbent. These adjustments resulted in an increase of the silica surface area from 391 to 798 m(2)·g(-1), which leads to a high capacity (686 mg·g(-1)) of D4-capture for the silica synthesized at 80 °C, calcined at 450 °C with the heating rate of 100 °C·min(-1) (Si-Syn80). This adsorbent showed comparable adsorption performance with the widely used commercial silica gel under dry and humid condition. Recyclability tests on the commercial silica gel and mesoporous silica synthesized at 120 °C and calcined at 450 °C with a heating rate of 100 °C·min(-1) (called Si-Syn120 or Si-450 or Si-100 °C·min(-1)) indicated that the Si-Syn120 (capacity drop 10%) is more efficient than silica gel (capacity drop 15%) after three cycles. Although, the presence of moisture (25%) in the nitrogen gas stream led to capacity reduction in both Si-Syn120 and commercial silica gel, the modified UCT-14 shows slightly better resistance to humid condition. PMID:26890152

  4. Fluorescence properties of dye doped mesoporous silica

    NASA Astrophysics Data System (ADS)

    Carbonaro, Carlo M.; Corpino, Riccardo; Ricci, Pier Carlo; Chiriu, Daniele; Cannas, Carla

    2014-10-01

    In this paper we present a review of the main results we obtained studying the emission properties of organic-inorganic hybrids obtained combining mesoporous silica and Xantene dyes, in particular the standard referenc Rhodamine 6G. The purpose of the review is to show the possibility to efficiently "dope" the transparent inorganic porous matrix to obtain promising systems for photonic and biomedical applications. The strategies to solve the concentration effect and the leaching phenomenon are discussed within the framework of the single exciton theory.

  5. Mesoporous silica-titania composed materials.

    PubMed

    Messina, Paula V; Morini, Marcela A; Sierra, María B; Schulz, Pablo C

    2006-08-01

    Titania mesosized particles were obtained by TiCl4 hydrolysis in Aerosol OT/water/n-hexane microemulsion. These particles were incorporated in surfactant templated silica mesoporous materials of MCM-41 and MCM-50 structures. Results depended on the surfactant: hexadecyltrimethylammonium bromide templated materials retained the honeycomb structure with small modifications in their characteristics. The dodecyltrimethylammonium bromide templated material changed from honeycomb to lamellar structure when the titania particles were included, with dramatic changes in the structure characteristics. The didodecyldimethylammonium bromide templated lamellar structure was retained after TIO2 inclusion, with a slight increase in the specific area, pore diameter and pore walls thickness. PMID:16600274

  6. Fluorescence properties of dye doped mesoporous silica

    SciTech Connect

    Carbonaro, Carlo M. Corpino, Riccardo Ricci, Pier Carlo Chiriu, Daniele; Cannas, Carla

    2014-10-21

    In this paper we present a review of the main results we obtained studying the emission properties of organic-inorganic hybrids obtained combining mesoporous silica and Xantene dyes, in particular the standard reference Rhodamine 6G. The purpose of the review is to show the possibility to efficiently 'dope' the transparent inorganic porous matrix to obtain promising systems for photonic and biomedical applications. The strategies to solve the concentration effect and the leaching phenomenon are discussed within the framework of the single exciton theory.

  7. Branched artificial nanofinger arrays by mesoporous interfacial atomic rearrangement.

    PubMed

    Kong, Biao; Tang, Jing; Zhang, Yueyu; Selomulya, Cordelia; Gong, Xingao; Liu, Yang; Zhang, Wei; Yang, Jianping; Wang, Wenshuo; Sun, Xiaotian; Wang, Yufei; Zheng, Gengfeng; Zhao, Dongyuan

    2015-04-01

    The direct production of branched semiconductor arrays with highly ordered orientation has proven to be a considerable challenge over the last two decades. Here we report a mesoporous interfacial atomic rearrangement (MIAR) method to directly produce highly crystalline, finger-like branched iron oxide nanoarrays from the mesoporous nanopyramids. This method has excellent versatility and flexibility for heteroatom doping of metallic elements, including Sn, Bi, Mn, Fe, Co, Ni, Cu, Zn, and W, in which the mesoporous nanopyramids first absorb guest-doping molecules into the mesoporous channels and then convert the mesoporous pyramids into branching artificial nanofingers. The crystalline structure can provide more optoelectronic active sites of the nanofingers by interfacial atomic rearrangements of doping molecules and mesopore channels at the porous solid-solid interface. As a proof-of-concept, the Sn-doped Fe2O3 artificial nanofingers (ANFs) exhibit a high photocurrent density of ∼1.26 mA/cm(2), ∼5.25-fold of the pristine mesoporous Fe2O3 nanopyramid arrays. Furthermore, with surface chemical functionalization, the Sn-doped ANF biointerfaces allow nanomolar level recognition of metabolism-related biomolecules (∼5 nm for glutathione). This MIAR method suggests a new growth means of branched mesostructures, with enhanced optoelectronic applications. PMID:25764364

  8. Functionalized bimodal mesoporous silicas as carriers for controlled aspirin delivery

    SciTech Connect

    Gao Lin; Sun Jihong; Li Yuzhen

    2011-08-15

    The bimodal mesoporous silica modified with 3-aminopropyltriethoxysilane was performed as the aspirin carrier. The samples' structure, drug loading and release profiles were characterized with X-ray diffraction, scanning electron microscopy, N{sub 2} adsorption and desorption, Fourier transform infrared spectroscopy, TG analysis, elemental analysis and UV-spectrophotometer. For further exploring the effects of the bimodal mesopores on the drug delivery behavior, the unimodal mesoporous material MCM-41 was also modified as the aspirin carrier. Meantime, Korsmeyer-Peppas equation f{sub t}=kt{sup n} was employed to analyze the dissolution data in details. It is indicated that the bimodal mesopores are beneficial for unrestricted drug molecules diffusing and therefore lead to a higher loading and faster releasing than that of MCM-41. The results show that the aspirin delivery properties are influenced considerably by the mesoporous matrix, whereas the large pore of bimodal mesoporous silica is the key point for the improved controlled-release properties. - Graphical abstract: Loading (A) and release profiles (B) of aspirin in N-BMMs and N-MCM-41 indicated that BMMs have more drug loading capacity and faster release rate than that MCM-41. Highlights: > Bimodal mesoporous silicas (BMMs) and MCM-41 modified with amino group via post-treatment procedure. > Loading and release profiles of aspirin in modified BMMs and MCM-41. > Modified BMMs have more drug loading capacity and faster release rate than that modified MCM-41.

  9. Mesoporous silica material TUD-1 as a drug delivery system.

    PubMed

    Heikkilä, T; Salonen, J; Tuura, J; Hamdy, M S; Mul, G; Kumar, N; Salmi, T; Murzin, D Yu; Laitinen, L; Kaukonen, A M; Hirvonen, J; Lehto, V-P

    2007-02-22

    For the first time the feasibility of siliceous mesoporous material TUD-1 (Technische Universiteit Delft) for drug delivery was studied. Model drug, ibuprofen, was adsorbed into TUD-1 mesopores via a soaking procedure. Characterizations with nitrogen adsorption, XRD, TG, HPLC and DSC demonstrated the successful inclusion of ibuprofen into TUD-1 host. The amount of ibuprofen adsorbed into the nanoreservoir of TUD-1 material was higher than reported for other mesoporous silica drug carriers (drug/carrier 49.5 wt.%). Drug release studies in vitro (HBSS buffer pH 5.5) demonstrated a fast and unrestricted liberation of ibuprofen, with 96% released at 210 min of the dissolution assay. The drug dissolution profile of TUD-1 material with the random, foam-like three-dimensional mesopore network and high accessibility to the dissolution medium was found to be much faster (kinetic constant k = 10.7) and more diffusion based (release constant n = 0.64) compared to a mesoporous MCM-41 material with smaller, unidirectional mesopore channels (k = 4.7, n = 0.71). Also, the mesoporous carriers were found to significantly increase the dissolution rate of ibuprofen, when compared to the pure crystalline form of the drug (k = 0.6, n = 0.96). TUD-1 was constituted as a potential drug delivery device with fast release property, with prospective applications in the formulation of poorly soluble drug compounds. PMID:17046183

  10. Silica-based mesoporous nanoparticles for controlled drug delivery.

    PubMed

    Kwon, Sooyeon; Singh, Rajendra K; Perez, Roman A; Abou Neel, Ensanya A; Kim, Hae-Won; Chrzanowski, Wojciech

    2013-01-01

    Drug molecules with lack of specificity and solubility lead patients to take high doses of the drug to achieve sufficient therapeutic effects. This is a leading cause of adverse drug reactions, particularly for drugs with narrow therapeutic window or cytotoxic chemotherapeutics. To address these problems, there are various functional biocompatible drug carriers available in the market, which can deliver therapeutic agents to the target site in a controlled manner. Among the carriers developed thus far, mesoporous materials emerged as a promising candidate that can deliver a variety of drug molecules in a controllable and sustainable manner. In particular, mesoporous silica nanoparticles are widely used as a delivery reagent because silica possesses favourable chemical properties, thermal stability and biocompatibility. Currently, sol-gel-derived mesoporous silica nanoparticles in soft conditions are of main interest due to simplicity in production and modification and the capacity to maintain function of bioactive agents. The unique mesoporous structure of silica facilitates effective loading of drugs and their subsequent controlled release. The properties of mesopores, including pore size and porosity as well as the surface properties, can be altered depending on additives used to fabricate mesoporous silica nanoparticles. Active surface enables functionalisation to modify surface properties and link therapeutic molecules. The tuneable mesopore structure and modifiable surface of mesoporous silica nanoparticle allow incorporation of various classes of drug molecules and controlled delivery to the target sites. This review aims to present the state of knowledge of currently available drug delivery system and identify properties of an ideal drug carrier for specific application, focusing on mesoporous silica nanoparticles. PMID:24020012

  11. Incorporation of antimicrobial compounds in mesoporous silica film monolith.

    PubMed

    Izquierdo-Barba, Isabel; Vallet-Regí, María; Kupferschmidt, Natalia; Terasaki, Osamu; Schmidtchen, Artur; Malmsten, Martin

    2009-10-01

    Incorporation of the antimicrobial peptide LL-37 ([LL-37, 37 aa]), as well as low molecular weight antimicrobial chlorhexidine, into mesoporous silica was obtained using an EISA one-pot synthesis method. FTIR confirmed efficient encapsulation of both LL-37 and chlorhexidine into mesoporous silica, while XRD and TEM showed that antimicrobial agent incorporation can be achieved without greatly affecting the structure of the mesoporous silica. The modified mesoporous silica released LL-37 and chlorhexidine slowly, reaching maximum release after about 200 h. The release rate could also be controlled through incorporation of SH groups in the pore walls, adding to pore hydrophobicity and reducing the release rate by about 50% compared to the unmodified mesoporous silica. Mesoporous silica containing either LL-37 or chlorhexidine displayed potent bactericidal properties against both Gram-positive Staphylococcus aureus and Gram-negative Escherichia coli. While chlorhexidine-loaded mesoporous silica displayed an accompanying high toxicity, as judged from hemolysis, LDH release, and MTT assay, the corresponding material containing LL-37 showed very low toxicity by all these assays, comparable to that observed for mesoporous silica in the absence of antibacterial drug, as well as to the negative controls in the respective assays. Mesoporous silica containing LL-37 therefore holds potential as an implantable material or a surface coating for such materials, as it combines potent bactericidal action with low toxicity, important features for controlling implant-related infections, e.g., for multi-resistant pathogens or for cases where access to the infection site of systemically administered antibiotics is limited due to collagen capsule formation or other factors. PMID:19628277

  12. Silica-based mesoporous nanoparticles for controlled drug delivery

    PubMed Central

    Kwon, Sooyeon; Singh, Rajendra K; Perez, Roman A; Abou Neel, Ensanya A

    2013-01-01

    Drug molecules with lack of specificity and solubility lead patients to take high doses of the drug to achieve sufficient therapeutic effects. This is a leading cause of adverse drug reactions, particularly for drugs with narrow therapeutic window or cytotoxic chemotherapeutics. To address these problems, there are various functional biocompatible drug carriers available in the market, which can deliver therapeutic agents to the target site in a controlled manner. Among the carriers developed thus far, mesoporous materials emerged as a promising candidate that can deliver a variety of drug molecules in a controllable and sustainable manner. In particular, mesoporous silica nanoparticles are widely used as a delivery reagent because silica possesses favourable chemical properties, thermal stability and biocompatibility. Currently, sol-gel-derived mesoporous silica nanoparticles in soft conditions are of main interest due to simplicity in production and modification and the capacity to maintain function of bioactive agents. The unique mesoporous structure of silica facilitates effective loading of drugs and their subsequent controlled release. The properties of mesopores, including pore size and porosity as well as the surface properties, can be altered depending on additives used to fabricate mesoporous silica nanoparticles. Active surface enables functionalisation to modify surface properties and link therapeutic molecules. The tuneable mesopore structure and modifiable surface of mesoporous silica nanoparticle allow incorporation of various classes of drug molecules and controlled delivery to the target sites. This review aims to present the state of knowledge of currently available drug delivery system and identify properties of an ideal drug carrier for specific application, focusing on mesoporous silica nanoparticles. PMID:24020012

  13. Mesoporous Trimetallic PtPdRu Spheres as Superior Electrocatalysts.

    PubMed

    Jiang, Bo; Ataee-Esfahani, Hamed; Li, Cuiling; Alshehri, Saad M; Ahamad, Tansir; Henzie, Joel; Yamauchi, Yusuke

    2016-05-17

    Mesoporous Trimetallic PtPdRu Spheres with well-defined spherical morphology and uniformly sized pores were synthesized in an aqueous solution using ascorbic acid as the reducing agent and triblock copolymer F127 as the pore directing agent. These mesoporous PtPdRu spheres exhibited enhanced electrocatalytic activity compared to commercial Pt black, resulting in a ∼4.9 times improvement in mass activity for the methanol oxidation reaction. The excellent electrocatalytic activity and stability are due to the unique mesoporous architecture and electronic landscape between different elements. PMID:27072776

  14. Distributions of noble metal Pd and Pt in mesoporous silica

    NASA Astrophysics Data System (ADS)

    Arbiol, J.; Cabot, A.; Morante, J. R.; Chen, Fanglin; Liu, Meilin

    2002-10-01

    Mesoporous silica nanostructures have been synthesized and loaded with Pd and Pt catalytic noble metals. It is found that Pd forms small nanoclusters (3-5 nm) on the surface of the mesoporous structure whereas Pt impregnation results in the inclusion of Pt nanostructures within the silica hexagonal pores (from nanoclusters to nanowires). It is observed that these materials have high catalytic properties for CO-CH4 combustion, even in a thick film form. In particular, results indicate that the Pt and Pd dispersed in mesoporous silica are catalytically active as a selective filter for gas sensors.

  15. Crystalline mesoporous zirconia catalysts having stable tetragonal pore wall structure

    DOEpatents

    Sachtler, Wolfgang M. H.; Huang, Yin-Yan

    1998-01-01

    Methods for the preparation of new sulfated mesoporous zirconia materials/catalysts with crystalline pore walls of predominantly tetragonal crystal structure, characterized by nitrogen physisorption measurement, X-ray diffraction, transmission electron microscopy and catalytic tests using n-butane isomerization to iso-butane and alkylation of 1-naphthol with 4-tert-butylstyrene as probe reactions. Sulfate deposition is preferred for the transformation of a mesoporous precursor with amorphous pore walls into a material with crystalline pore walls maintaining the mesoporous characteristics.

  16. Crystalline mesoporous zirconia catalysts having stable tetragonal pore wall structure

    DOEpatents

    Sachtler, W.M.H.; Huang, Y.Y.

    1998-07-28

    Methods are disclosed for the preparation of new sulfated mesoporous zirconia materials/catalysts with crystalline pore walls of predominantly tetragonal crystal structure, characterized by nitrogen physical sorption measurement, X-ray diffraction, transmission electron microscopy and catalytic tests using n-butane isomerization to iso-butane and alkylation of 1-naphthol with 4-tert-butylstyrene as probe reactions. Sulfate deposition is preferred for the transformation of a mesoporous precursor with amorphous pore walls into a material with crystalline pore walls maintaining the mesoporous characteristics. 17 figs.

  17. Synthesis of biomorphological mesoporous TiO2 templated by mimicking bamboo membrane in supercritical CO2.

    PubMed

    Li, Jinhong; Shi, Xiaoying; Wang, Lijuan; Liu, Fei

    2007-11-01

    A new approach is presented for preparing biomorphological mesoporous TiO2 templated by mimicking bamboo inner shell membrane via supercritical CO2 (SCCO2) transportation through titanium tetrabutyloxide (TTBO). The analysis of wide-angle X-ray powder diffraction (XRD) showed the prepared TiO2 in phase of anatase, and the small-angle XRD revealed the presence of mesopores without periodicity. The product exhibited the shape of crinkled films and extended in two dimensions up to centimeters. The electron microscopic observation showed that the TiO2 films were around 200 nm in thickness, and across the films there were numerous round or ellipse-shaped mesopores, being 10-50 nm in diameter, which were formed by the close packing of TiO2 particles. High-resolution transmission electron microscope (HRTEM) displayed that the single TiO2 particle size was about 12.5 nm. The UV-vis absorption spectrum was transparent in the wavelength of 320-350 nm for suspensions of the prepared mesoporous TiO2 in ethanol at the concentration of 5.0 mg/l. The mesoporous TiO2 prepared with the aid of SCCO2 exhibited an obvious blue shift compared with the TiO2 prepared by sol-gel infiltration. The possible mechanism for the formation of the mesoporous TiO2 is summarized into a biomimetic mineralization pathway. First, TTBO was transported to the membrane surface via SCCO2, and then condensed. Hydrolysis reactions between the functional groups of organic membrane and TTBO took place to form the nuclear TiO2, and the TiO2 seeds grew around the organic membrane into TiO2 mesoporous materials. The approach provides a low-cost and efficient route for the production of ceramics nanomaterials with unique structural features, which may have potential application in designing UV-selective shielding devices [S. Zhao, X.H. Wang, S.B. Xin, Q. Jiang, X.P. Liang, Rare Metal Mater. Eng. 35 (2006) 508-510]. PMID:17689547

  18. Gated Silica Mesoporous Materials in Sensing Applications

    PubMed Central

    Sancenón, Félix; Pascual, Lluís; Oroval, Mar; Aznar, Elena; Martínez-Máñez, Ramón

    2015-01-01

    Silica mesoporous supports (SMSs) have a large specific surface area and volume and are particularly exciting vehicles for delivery applications. Such container-like structures can be loaded with numerous different chemical substances, such as drugs and reporters. Gated systems also contain addressable functions at openings of voids, and cargo delivery can be controlled on-command using chemical, biochemical or physical stimuli. Many of these gated SMSs have been applied for drug delivery. However, fewer examples of their use in sensing protocols have been reported. The approach of applying SMSs in sensing uses another concept—that of loading pores with a reporter and designing a capping mechanism that is selectively opened in the presence of a target analyte, which results in the delivery of the reporter. According to this concept, we provide herein a complete compilation of published examples of probes based on the use of capped SMSs for sensing. Examples for the detection of anions, cations, small molecules and biomolecules are provided. The diverse range of gated silica mesoporous materials presented here highlights their usefulness in recognition protocols. PMID:26491626

  19. Optically tunable chiral nematic mesoporous cellulose films.

    PubMed

    Schlesinger, Maik; Hamad, Wadood Y; MacLachlan, Mark J

    2015-06-21

    Demand for sustainable functional materials has never been larger. The introduction of functionality into pure cellulose might be one step forward in this field as it is one of the most abundant natural biopolymers. In this paper, we demonstrate a straightforward and scalable way to produce iridescent, mesoporous cellulose membranes with tunable colors and porosity. Concomitant assembly of cellulose nanocrystals (CNCs) and condensation of silica precursors results in CNC-silica composites with chiral nematic structures and tunable optical properties. Removal of the stabilizing silica matrix by alkaline or acid treatment gives access to novel chiral nematic mesoporous cellulose (CNMC) films. Importantly, the optical properties and the mesoporosity can be controlled by either varying the silica-to-CNC ratio, or by varying the substrate used during the evaporation-induced self-assembly process. In order to introduce additional functionality, CNMC has been used to stabilize gold nanoparticles with three different concentrations by wet impregnation. These materials are stable in water and can potentially function in sensors, tissue engineering or functional membranes. PMID:25972020

  20. Gated Silica Mesoporous Materials in Sensing Applications.

    PubMed

    Sancenón, Félix; Pascual, Lluís; Oroval, Mar; Aznar, Elena; Martínez-Máñez, Ramón

    2015-08-01

    Silica mesoporous supports (SMSs) have a large specific surface area and volume and are particularly exciting vehicles for delivery applications. Such container-like structures can be loaded with numerous different chemical substances, such as drugs and reporters. Gated systems also contain addressable functions at openings of voids, and cargo delivery can be controlled on-command using chemical, biochemical or physical stimuli. Many of these gated SMSs have been applied for drug delivery. However, fewer examples of their use in sensing protocols have been reported. The approach of applying SMSs in sensing uses another concept-that of loading pores with a reporter and designing a capping mechanism that is selectively opened in the presence of a target analyte, which results in the delivery of the reporter. According to this concept, we provide herein a complete compilation of published examples of probes based on the use of capped SMSs for sensing. Examples for the detection of anions, cations, small molecules and biomolecules are provided. The diverse range of gated silica mesoporous materials presented here highlights their usefulness in recognition protocols. PMID:26491626

  1. Enzyme catalytic membrane based on a hybrid mesoporous membrane.

    PubMed

    Fu, Wensheng; Yamaguchi, Akira; Kaneda, Hideaki; Teramae, Norio

    2008-02-21

    Immobilization of glucose oxidase (GOD) within a hybrid mesoporous membrane with 12 nm pore diameter was successfully achieved, resulting in catalytically high efficiency during flow of a glucose solution across the membrane. PMID:18253526

  2. Mesoporous carbon incorporated metal oxide nanomaterials as supercapacitor electrodes.

    PubMed

    Jiang, Hao; Ma, Jan; Li, Chunzhong

    2012-08-01

    Supercapacitors have attracted huge attention in recent years as they have the potential to satisfy the demand of both huge energy and power density in many advanced technologies. However, poor conductivity and cycling stability remains to be the major challenge for its widespread application. Various strategies have been developed for meeting the ever-increasing energy and power demands in supercapacitors. This Research News article aims to review recent progress in the development of mesoporous carbon incorporated metal oxide nanomaterials, especially metal oxide nanoparticles confined in ordered mesoporous carbon and 1D metal oxides coated with a layer of mesoporous carbon for high-performance supercapacitor applications. In addition, a recent trend in supercapacitor development - hierarchical porous graphitic carbons (HPGC) combining macroporous cores, mesoporous walls, and micropores as an excellent support for metal oxides - is also discussed. PMID:23030034

  3. Thermally stable crystalline mesoporous metal oxides with substantially uniform pores

    SciTech Connect

    Wiesner, Ulrich; Orilall, Mahendra Christopher; Lee, Jinwoo; DiSalvo, Jr., Francis J

    2015-01-27

    Highly crystalline metal oxide-carbon composites, as precursors to thermally stable mesoporous metal oxides, are coated with a layer of amorphous carbon. Using a `one-pot` method, highly crystalline metal oxide-carbon composites are converted to thermally stable mesoporous metal oxides, having highly crystalline mesopore walls, without causing the concomitant collapse of the mesostructure. The `one-pot` method uses block copolymers with an sp or sp 2 hybridized carbon containing hydrophobic block as structure directing agents which converts to a sturdy, amorphous carbon material under appropriate heating conditions, providing an in-situ rigid support which maintains the pores of the oxides intact while crystallizing at temperatures as high as 1000 deg C. A highly crystalline metal oxide-carbon composite can be heated to produce a thermally stable mesoporous metal oxide consisting of a single polymorph.

  4. Mesoporous silica magnetite nanocomposite synthesized by using a neutral surfactant

    NASA Astrophysics Data System (ADS)

    Souza, K. C.; Salazar-Alvarez, G.; Ardisson, J. D.; Macedo, W. A. A.; Sousa, E. M. B.

    2008-05-01

    Magnetite nanoparticles coated by mesoporous silica were synthesized by an alternative chemical route using a neutral surfactant and without the application of any functionalization method. The magnetite (Fe3O4) nanoparticles were prepared by precipitation from aqueous media, and then coated with mesoporous silica by using nonionic block copolymer surfactants as the structure-directing agents. The mesoporous SiO2-coated Fe3O4 samples were characterized by x-ray diffraction, Fourier-transform infrared spectroscopy, N2 adsorption-desorption isotherms, transmission electron microscopy, 57Fe Mössbauer spectroscopy, and vibrating sample magnetometry. Our results revealed that the magnetite nanoparticles are completely coated by well-ordered mesoporous silica with free pores and stable (~8 nm thick) pore walls, and that the structural and magnetic properties of the Fe3O4 nanoparticles are preserved in the applied synthesis route.

  5. Novel method to incorporate Si into monodispersed mesoporous carbon spheres.

    PubMed

    Yano, Kazuhisa; Tatsuda, Narihito; Masuda, Takashi; Shimoda, Tatsuya

    2016-10-01

    Liquid silicon precursor is used as a silicon source and very simple and easy method for the incorporation of Si into mesoporous carbon spheres is presented. By using capillary condensation, the liquid precursor, Cyclopentasilane, penetrates into mesopores of carbon spheres homogeneously and subsequent heating brings the decomposition of the precursor and the formation of silicon inside meso-channels of carbon even though the decomposition is done much higher than the boiling point of the precursor. The homogeneous distribution of silicon is verified by EDX mapping of the composite as well as SEM observation of the calcined one. More than 45wt% of Si can be incorporated into mesopores by just one operation. The Si@mesoporous carbon composite works as an anode for a Lithium ion battery. PMID:27344486

  6. Synthesis of mesoporous nano-hydroxyapatite by using zwitterions surfactant

    EPA Science Inventory

    Mesoporous nano-hydroxyapatite (mn-HAP) was successfully synthesized via a novel micelle-templating method using lauryl dimethylaminoacetic acid as zwitterionic surfactant. The systematic use of such a surfactant in combination with microwave energy inputenables the precise contr...

  7. Preparation, characterization, and electrochemical application of mesoporous copper oxide

    SciTech Connect

    Cheng, Liang; Shao, Mingwang; Chen, Dayan; Zhang, Yuzhong

    2010-02-15

    Mesoporous CuO was successfully synthesized via thermal decomposition of CuC{sub 2}O{sub 4} precursors. These products had ring-like morphology, which was made up of nanoparticles with the average diameter of 40 nm. The electrochemical experiments showed that the mesoporous CuO decreased the overvoltage of the electrode and increased electron transference in the measurement of dopamine.

  8. In-situ immobilization of enzymes in mesoporous silicas

    NASA Astrophysics Data System (ADS)

    Santalla, Esther; Serra, Elías; Mayoral, Alvaro; Losada, José; Blanco, Rosa M.; Díaz, Isabel

    2011-04-01

    Lipase from Candida antarctica B, horseradish peroxidase and laccase have been entrapped in silica cages rising mesoporous structures. Lipase and laccase yielded the highest structured mesoporous material whereas horseradish peroxidase may have altered the symmetry giving as a result mesocelullar foam (MCF) type of cages. The possible effect in the final structure of the material of the nature, size and surface structure of the proteins as well as the presence of various additives in the enzyme extracts is currently under investigations.

  9. Near-infrared emission from mesoporous crystalline germanium

    SciTech Connect

    Boucherif, Abderraouf; Aimez, Vincent; Arès, Richard; Korinek, Andreas

    2014-10-15

    Mesoporous crystalline germanium was fabricated by bipolar electrochemical etching of Ge wafer in HF-based electrolyte. It yields uniform mesoporous germanium layers composed of high density of crystallites with an average size 5-7 nm. Subsequent extended chemical etching allows tuning of crystallites size while preserving the same chemical composition. This highly controllable nanostructure exhibits photoluminescence emission above the bulk Ge bandgap, in the near-infrared range (1095-1360nm) with strong evidence of quantum confinement within the crystallites.

  10. Near-infrared emission from mesoporous crystalline germanium

    NASA Astrophysics Data System (ADS)

    Boucherif, Abderraouf; Korinek, Andreas; Aimez, Vincent; Arès, Richard

    2014-10-01

    Mesoporous crystalline germanium was fabricated by bipolar electrochemical etching of Ge wafer in HF-based electrolyte. It yields uniform mesoporous germanium layers composed of high density of crystallites with an average size 5-7 nm. Subsequent extended chemical etching allows tuning of crystallites size while preserving the same chemical composition. This highly controllable nanostructure exhibits photoluminescence emission above the bulk Ge bandgap, in the near-infrared range (1095-1360nm) with strong evidence of quantum confinement within the crystallites.

  11. Simple synthesis of mesoporous boron nitride with strong cathodoluminescence emission

    SciTech Connect

    Meng, Xiang-Lin; Lun, Ning; Qi, Yong-Xin; Zhu, Hui-Ling; Han, Fu-Dong; Yin, Long-Wei; Fan, Run-Hua; Bai, Yu-Jun; Bi, Jian-Qiang

    2011-04-15

    Mesoporous BN was prepared at 550 {sup o}C for 10 h or so via a simple reaction between NaBH{sub 4} and CO(NH{sub 2}){sub 2}. X-ray diffraction demonstrates the formation of t-BN with lattice constants a=2.46 and c=6.67 A. High-resolution transmission electron microscopy displays a lot of porous films in the product, which possesses a high surface area of 219 m{sup 2} g{sup -1} and a pore size primarily around 3.8 nm tested by nitrogen adsorption-desorption method. The mesoporous BN exhibits a strong luminescence emission around 3.41 eV in the cathodoluminescence spectra, a high stability in both morphology and structure, and good oxidation resistance up to 800 {sup o}C. The byproducts generated during the reaction are responsible for the formation of the mesoporous BN. -- Graphical abstract: The mesoporous BN with a high specific surface area of 219 m{sup 2} g{sup -1} exhibits a strong luminescence emission around 3.41 eV in the CL spectra, high thermal stability in both morphology and structure, and good oxidation resistance up to 800 {sup o}C. Display Omitted Research highlights: Mesoporous BN was prepared by a simple reaction between NaBH{sub 4} and CO(NH{sub 2}){sub 2} at 550 {sup o}C. The mesoporous BN possesses a high surface area of 219 m{sup 2} g{sup -1}. The mesoporous BN exhibits a strong luminescence emission around 3.41 eV. The mesoporous BN has high stability and good oxidation resistance up to 800 {sup o}C.

  12. Multifluorescently traceable nanoparticle by a single-wavelength excitation with color-related drug release performance.

    PubMed

    Lu, Deli; Lei, Juying; Wang, Lingzhi; Zhang, Jinlong

    2012-05-30

    Monodisperse and nanometer-sized periodic mesoporous organosilicas co-doped with fluorescence resonance energy transfer cascades composed of triple fluorophores at various ratios were prepared. These nanoparticles exhibit multifluorescent emissions by a single-wavelength excitation and were designed for the application as multichannelly traceable drug carriers. Different from the hydrophilic framework of inorganic mesoporous silica and hydrophobic framework of mesoporous carbon, these multifluorescent nanoparticles have intrinsically different and finely tunable pore surface polarities governed by the type and amount of fluorophore inside the framework. When applied as drug carriers, they can achieve synchronous or asynchronous release of different drugs by simply choosing different colored nanoparticles. These colorful mesoporous composites with finely tunable color-related drug release performance provide a strong barcoding system for the potential applications of fluorescent nanoparticles in effective screening of drugs and therapeutic protocols for diseases. PMID:22591275

  13. Antibacterial mesoporous molecular sieves modified with polymeric N-halamine.

    PubMed

    Wang, Yingfeng; Li, Lin; Liu, Ying; Ren, Xuehong; Liang, Jie

    2016-12-01

    In this research, a new kind of porous N-halamine material with high antibacterial efficacies was prepared. Poly [5,5-dimethyl-3-(3'-triethoxysilylpropyl)-hydantoin] (PSPH), an N-halamine precursor, was synthesized and grafted onto the surface of mesoporous molecular sieves (SBA-15). The mesoporous molecular sieves modified with the N-halamine polymer could be rendered biocidal upon exposure to dilute household bleach. The modified mesoporous molecular sieves were characterized by SEM, TEM, FTIR, XPS, TGA, XRD and BET analysis. It was found that the PSPH has been successfully grafted on the surface of mesoporous molecular sieves, and the morphology and structure of the modified mesoporous molecular sieves were slightly affected. The N-halamine modified mesoporous molecular sieves showed excellent antibacterial property, and inactivated 100% of S. aureus and E. coli O157:H7 with 8.05 and 7.92 log reductions within 1min of contact, respectively. The modified SBA-15 with high-antibacterial efficiency has potential application in water treatment and biomaterials areas. PMID:27612805

  14. Visible Light Enabled Photocatalytic Splitting of Water over Spatially Isolated Semiconductors Supported Mesoporous Materials

    NASA Astrophysics Data System (ADS)

    Peng, Rui

    Hydrogen generation from photocatalytic splitting of water is an ideal scenario that possesses promise for the sustainable development of human society and the establishment of the ultimate "green," infinitely renewable energy system. This work contains a series of novel photocatalytic systems in which the photoactive chromophores and/or the co-catalysts were incorporated into highly periodically cubic-phased MCM-48 mesoporous materials to achieve significantly higher photocatalytic efficiencies compared with conventional semiconductor photocatalysts. Cubic-phased MCM-48 mesoporous materials were chosen as supports to accommodate the photoactive species throughout the entire work. Several unique and iconic properties of these materials, such as large surface area, highly uniform mesoscale pores arrayed in a long-range periodicity, and an interconnected network of three-dimensional sets of pores that were recognized as positive parameters facilitated the photogenerated charge transfer and promoted the photocatalytic performance of the encapsulated photoactive species. It was validated that in the CdS/TiO2-incorporated MCM-48 photocatalytic system, the solar hydrogen conversion efficiency was prevalently governed by the photogenerated electron injection efficiency from the CdS conduction band to that of TiO2. The use of MCM-48 mesoporous host materials enabled the high and even dispersion of both CdS and TiO 2 so that the intimate and sufficient contact between CdS and TiO 2 was realized. In addition, with the presence of both TiO2 and MCM-48 mesoporous support, the photostability of CdS species was dramatically enhanced compared with that of bare CdS or CdS-incorporated MCM-48 photocatalysts. In advance, by loading the RuO2 co-catalyst into the CdS/TiO 2-incorporated MCM-48 photocatalytic system, the photocatalytic splitting of pure water to generate both hydrogen and oxygen under visible light illumination was achieved. In the various Pd-assisted, TiO2-incorporated

  15. Grafting Sulfated Zirconia on Mesoporous Silica

    SciTech Connect

    Wang, Yong; Lee, Kwan Young; Choi, Saemin; Liu, Jun; Wang, Li Q.; Peden, Charles HF

    2007-06-01

    Sulfated zirconia has received considerable attention as a potential solid acid catalyst in recent years. In this paper, the preparation and properties of acid catalysts obtained by grafting ziconia with atomic precision on MCM-41 mesoporous silica were studied. TEM and potential titration characterizations revealed that ZrO2/MCM-41 with monolayer coverage can be obtained using this grafting technique. Sulfated ZrO2/MCM-41 exhibits improved thermal stability than that of bulk sulfated zirconia, as evidenced by temperature programmed characterizations and XRD analysis. Temperature programmed reaction of isopropanol was used to evaluate the acidity of sulfated ZrO2/MCM-41. It was found that the acid strength of sulfated ZrO2/MCM-41 with monolayer coverage is weaker than bulk sulfated zirconia but stronger than SiO2-Al2O3, a common strong acid catalyst.

  16. Enantioselective recognition at mesoporous chiral metal surfaces

    PubMed Central

    Wattanakit, Chularat; Côme, Yémima Bon Saint; Lapeyre, Veronique; Bopp, Philippe A.; Heim, Matthias; Yadnum, Sudarat; Nokbin, Somkiat; Warakulwit, Chompunuch; Limtrakul, Jumras; Kuhn, Alexander

    2014-01-01

    Chirality is widespread in natural systems, and artificial reproduction of chiral recognition is a major scientific challenge, especially owing to various potential applications ranging from catalysis to sensing and separation science. In this context, molecular imprinting is a well-known approach for generating materials with enantioselective properties, and it has been successfully employed using polymers. However, it is particularly difficult to synthesize chiral metal matrices by this method. Here we report the fabrication of a chirally imprinted mesoporous metal, obtained by the electrochemical reduction of platinum salts in the presence of a liquid crystal phase and chiral template molecules. The porous platinum retains a chiral character after removal of the template molecules. A matrix obtained in this way exhibits a large active surface area due to its mesoporosity, and also shows a significant discrimination between two enantiomers, when they are probed using such materials as electrodes. PMID:24548992

  17. Mesoporous titanium dioxide coating for metallic implants.

    PubMed

    Xia, Wei; Grandfield, Kathryn; Hoess, Andreas; Ballo, Ahmed; Cai, Yanling; Engqvist, Håkan

    2012-01-01

    A bioactive mesoporous titanium dioxide (MT) coating for surface drug delivery has been investigated to develop a multifunctional implant coating, offering quick bone bonding and biological stability. An evaporation induced self-assembly (EISA) method was used to prepare a mesoporous titanium dioxide coating of the anatase phase with BET surface area of 172 m(2)/g and average pore diameter of 4.3 nm. Adhesion tests using the scratch method and an in situ screw-in/screw-out technique confirm that the MT coating bonds tightly with the metallic substrate, even after removal from bone. Because of its high surface area, the bioactivity of the MT coating is much better than that of a dense TiO(2) coating of the same composition. Quick formation of hydroxyapatite (HA) in vitro can be related to enhance bonding with bone. The uptake of antibiotics by the MT coating reached 13.4 mg/cm(3) within a 24 h loading process. A sustained release behavior has been obtained with a weak initial burst. By using Cephalothin as a model drug, drug loaded MT coating exhibits a sufficient antibacterial effect on the material surface, and within millimeters from material surface, against E.coli. Additionally, the coated and drug loaded surfaces showed no cytotoxic effect on cell cultures of the osteoblastic cell line MG-63. In conclusion, this study describes a novel, biocompatiblemesoporous implant coating, which has the ability to induce HA formation and could be used as a surface drug-delivery system. PMID:21954047

  18. Single crystal particles of a mesoporous mixed transition metal oxide with a wormhole structure.

    PubMed

    Lee, B; Lu, D; Kondo, J N; Domen, K

    2001-10-21

    A new type of mesoporous mixed transition metal oxide of Nb and Ta (NbTa-TIT-1) has been prepared through a two-step calcination, which consists of single crystal particles with wormhole mesoporous structure. PMID:12240191

  19. Enhanced retention of aqueous transition metals in mesoporous silica

    NASA Astrophysics Data System (ADS)

    Nelson, J.; Bargar, J.; Brown, G. E.; Maher, K.

    2013-12-01

    Mesoporosity (2-50 nm diameter pores) is abundant within grain coatings and primary silicate minerals in natural environments. Mesopores often contribute significantly to total specific surface area and act as gateways for the transport of subsurface solutes, including nutrients and contaminants, between mineral surfaces and ambient fluids. However, the physiochemical mechanisms of sorption and transport within mesopores cannot be assumed to be the same as for macropores (>50 nm), because of confinement-induced changes in water properties, the structure of electrical double layers, solvation shells and dehydration rates of aquo ions, and the charge and reactive site densities of mineral surfaces. Despite the ubiquity of confined spaces in natural and industrial porous media, few studies have examined the molecular-scale mechanisms and geochemical reactions controlling meso-confinement phenomena in environmentally relevant materials. We conducted batch Zn sorption experiments using synthetic, controlled pore-size (i.e., 7.5-300 nm), metal-oxide beads as model geologic substrates. Comparison of Zn adsorbed onto macroporous and mesoporous silica beads indicates Zn adsorption capacity is increased in mesopores when normalized to surface area. In the presence of a background electrolyte (i.e., NaCl), Zn sorption capacity to macroporous silica is reduced; however, no significant difference in Zn sorption capacity on mesoporous silica was observed between the presence and absence of a background electrolyte. The effect of competing cations is indirect evidence that mesopores promote inner-sphere complexation and reduce outer-sphere complexation. EXAFS characterization of adsorbed zinc to macroporous silica matches that reported for low Zn coverages on silica (Roberts et al., JCIS, 2003), whereas a different spectrum is observed for the mesoporous case. Shell-by-shell fitting indicates that Zn is dominantly in octahedral coordination in macropores, as opposed to

  20. The Synthesis of Ag-Doped Mesoporous TiO2

    SciTech Connect

    Li, Xiaohong S.; Fryxell, Glen E.; Wang, Chong M.; Engelhard, Mark H.

    2008-04-15

    Ag-doped mesoporous titanium oxide was prepared using non-ionic surfactants and easily handled titanium precursors, under mild reaction conditions. In contrast to the stabilizing effect of Cd-doping on mesoporous TiO2, Ag-doping was found to significantly destabilize the mesoporous structure.

  1. Application of ordered mesoporous carbon in solid phase microextraction for fast mass transfer and high sensitivity.

    PubMed

    Zheng, Juan; Wang, Kun; Liang, Yeru; Zhu, Fang; Wu, Dingcai; Ouyang, Gangfeng

    2016-05-21

    Due to unique high-surface-area ordered mesoporous channels interconnected with 3D network-like mesopores and π-π interactions between carbon frameworks and analytes, the as-prepared ordered mesoporous carbon-coated fiber exhibited a large adsorption amount, fast mass transport and high sensitivity. PMID:27137527

  2. Direct coating of mesoporous titania on CTAB-capped gold nanorods.

    PubMed

    Zhao, Junwei; Xu, Pengyu; Li, Yue; Wu, Jian; Xue, Junfei; Zhu, Qiannan; Lu, Xuxing; Ni, Weihai

    2016-03-14

    We demonstrate a CTAB-templated approach towards direct coating of mesoporous titania on gold nanorods in aqueous solutions. The formation of the mesoporous shell is found to be closely correlated with CTAB concentration and the amount of the titania precursor. This approach can be readily extended to form mesoporous titania shells on other CTAB-capped nanoparticles. PMID:26585611

  3. Irregular Periods

    MedlinePlus

    ... number of days after the last one. The Menstrual Cycle Most girls get their first period between the ... to skip periods or to have an irregular menstrual cycle. Illness, rapid weight change, or stress can also ...

  4. Oxidative nanopatterning of titanium generates mesoporous surfaces with antimicrobial properties.

    PubMed

    Variola, Fabio; Zalzal, Sylvia Francis; Leduc, Annie; Barbeau, Jean; Nanci, Antonio

    2014-01-01

    Mesoporous surfaces generated by oxidative nanopatterning have the capacity to selectively regulate cell behavior, but their impact on microorganisms has not yet been explored. The main objective of this study was to test the effects of such surfaces on the adherence of two common bacteria and one yeast strain that are responsible for nosocomial infections in clinical settings and biomedical applications. In addition, because surface characteristics are known to affect bacterial adhesion, we further characterized the physicochemical properties of the mesoporous surfaces. Focused ion beam (FIB) was used to generate ultrathin sections for elemental analysis by energy-dispersive X-ray spectroscopy (EDS), nanobeam electron diffraction (NBED), and high-angle annular dark field (HAADF) scanning transmission electron microscopy (STEM) imaging. The adherence of Staphylococcus aureus, Escherichia coli and Candida albicans onto titanium disks with mesoporous and polished surfaces was compared. Disks with the two surfaces side-by-side were also used for direct visual comparison. Qualitative and quantitative results from this study indicate that bacterial adhesion is significantly hindered by the mesoporous surface. In addition, we provide evidence that it alters structural parameters of C. albicans that determine its invasiveness potential, suggesting that microorganisms can sense and respond to the mesoporous surface. Our findings demonstrate the efficiency of a simple chemical oxidative treatment in generating nanotextured surfaces with antimicrobial capacity with potential applications in the implant manufacturing industry and hospital setting. PMID:24872694

  5. Design and functionalization of photocatalytic systems within mesoporous silica.

    PubMed

    Qian, Xufang; Fuku, Kojirou; Kuwahara, Yasutaka; Kamegawa, Takashi; Mori, Kohsuke; Yamashita, Hiromi

    2014-06-01

    In the past decades, various photocatalysts such as TiO2, transition-metal-oxide moieties within cavities and frameworks, or metal complexes have attracted considerable attention in light-excited catalytic processes. Owing to high surface areas, transparency to UV and visible light as well as easily modified surfaces, mesoporous silica-based materials have been widely used as excellent hosts for designing efficient photocatalytic systems under the background of environmental remediation and solar-energy utilization. This Minireview mainly focuses on the surface-chemistry engineering of TiO2/mesoporous silica photocatalytic systems and fabrication of binary oxides and nanocatalysts in mesoporous single-site-photocatalyst frameworks. Recently, metallic nanostructures with localized surface plasmon resonance (LSPR) have been widely studied in catalytic applications harvesting light irradiation. Accordingly, silver and gold nanostructures confined in mesoporous silica and their corresponding catalytic activity enhanced by the LSPR effect will be introduced. In addition, the integration of metal complexes within mesoporous silica materials for the construction of functional inorganic-organic supramolecular photocatalysts will be briefly described. PMID:24828540

  6. Formation of monodisperse mesoporous silica microparticles via spray-drying.

    PubMed

    Waldron, Kathryn; Wu, Winston Duo; Wu, Zhangxiong; Liu, Wenjie; Selomulya, Cordelia; Zhao, Dongyuan; Chen, Xiao Dong

    2014-03-15

    In this work, a protocol to synthesize monodisperse mesoporous silica microparticles via a unique microfluidic jet spray-drying route is reported for the first time. The microparticles demonstrated highly ordered hexagonal mesostructures with surface areas ranging from ~900 up to 1500 m(2)/g and pore volumes from ~0.6 to 0.8 cm(3)/g. The particle size could be easily controlled from ~50 to 100 μm from the same diameter nozzle via changing the initial solute content, or changing the drying temperature. The ratio of the surfactant (CTAB) and silica (TEOS), and the amount of water in the precursor were found to affect the degree of ordering of mesopores by promoting either the self-assembly of the surfactant-silica micelles or the condensation of the silica as two competing processes in evaporation induced self-assembly. The drying rate and the curvature of particles also affected the self-assembly of the mesostructure. The particle mesostructure is not influenced by the inlet drying temperature in the range of 92-160 °C, with even a relatively low temperature of 92 °C producing highly ordered mesoporous microparticles. The spray-drying derived mesoporous silica microparticles, while of larger sizes and more rapidly synthesized, showed a comparable performance with the conventional mesoporous silica MCM-41 in controlled release of a dye, Rhodamine B, indicating that these spray dried microparticles could be used for the immobilisation and controlled release of small molecules. PMID:24461839

  7. Mesoporous silica nanoparticles in target drug delivery system: A review

    PubMed Central

    Bharti, Charu; Nagaich, Upendra; Pal, Ashok Kumar; Gulati, Neha

    2015-01-01

    Due to lack of specification and solubility of drug molecules, patients have to take high doses of the drug to achieve the desired therapeutic effects for the treatment of diseases. To solve these problems, there are various drug carriers present in the pharmaceuticals, which can used to deliver therapeutic agents to the target site in the body. Mesoporous silica materials become known as a promising candidate that can overcome above problems and produce effects in a controllable and sustainable manner. In particular, mesoporous silica nanoparticles (MSNs) are widely used as a delivery reagent because silica possesses favorable chemical properties, thermal stability, and biocompatibility. The unique mesoporous structure of silica facilitates effective loading of drugs and their subsequent controlled release of the target site. The properties of mesoporous, including pore size, high drug loading, and porosity as well as the surface properties, can be altered depending on additives used to prepare MSNs. Active surface enables functionalization to changed surface properties and link therapeutic molecules. They are used as widely in the field of diagnosis, target drug delivery, bio-sensing, cellular uptake, etc., in the bio-medical field. This review aims to present the state of knowledge of silica containing mesoporous nanoparticles and specific application in various biomedical fields. PMID:26258053

  8. Mesoporous materials used in medicine and environmental applications.

    PubMed

    Gunduz, Oguzhan; Yetmez, Mehmet; Sonmez, Maria; Georgescu, Mihai; Alexandrescu, Laura; Ficai, Anton; Ficai, Denisa; Andronescu, Ecaterina

    2015-01-01

    Mesoporous materials synthesized in the presence of templates, are commonly used for environment and medical applications. Due to the properties it holds, mesoporous silica nanoparticles is an excellent material for use in medical field, biomaterials, active principles delivery systems, enzyme immobilization and imaging. Their structure allows embedding large and small molecules, DNA adsorption and genetic transfer. Using mesoporous silica nanoparticles for delivery of bioactive molecules can protect them against degradation under physiological conditions, allow controlled drugs release and minimize side effects on healthy tissues. Cellular tests performed on mesoporous silica nanoparticles demonstrate that MSN's cytotoxicity is dependent on the size and concentration and suggests the use of larger size nanoparticles is optimal for medical applications. Mesoporous materials possess high biological compatibility, are non-toxic and can be easily modified by functionalizing the surface or inside the pores by grafting or co-condensation method. The structure, composition and pores size of this material can be optimized during synthesis by varying the stoichiometric reactants, reaction conditions, nature of the template's molecules or by functionalization method. PMID:25877095

  9. DEVELOPMENT OF MESOPOROUS MEMBRANE MATERIALS FOR CO2 SEPARATION

    SciTech Connect

    Wei-Heng Shih; Qiang Zhao; Nanlin Wang

    2002-05-01

    Mesoporous and precipitated alumina were synthesized as the base material for CO{sub 2} adsorbent. The porous alumina is doped with Ba to enhance it CO{sub 2} affinity due to the basicity of Ba. it is shown by gas chromatograph (GC) that the addition of Ba enhances the separation CO{sub 2} from N{sub 2}. It was found that mesoporous alumina has larger specific surface area and better selectivity of CO{sub 2} than precipitated alumina. Ba improves the affinity of mesoporous alumina with CO{sub 2}. Phase may play an important role in selective adsorption of CO{sub 2}. It is speculated that mesoporous alumina is more reactive than precipitated alumina creating the xBaO {center_dot} Al{sub 2}O{sub 3} phase that may be more affinity to CO{sub 2} than N{sub 2}. On the other hand, the barium aluminate phase (Ba{sub 3}Al{sub 2}O{sub 6}) in the mesoporous sample does not help the adsorption of CO{sub 2}.

  10. Photocatalytic activity of a hierarchically macro/mesoporous titania.

    PubMed

    Wang, Xinchen; Yu, Jimmy C; Ho, Chunman; Hou, Yidong; Fu, Xianzhi

    2005-03-15

    Light-harvesting macroporous channels have been successfully incorporated into a mesoporous TiO(2) framework to increase its photocatalytic activity. This bimodal porous material was characterized by X-ray diffractometry in both low-angle and wide-angle ranges, N(2) adsorption-desorption analysis, scanning and transmission electron microscopy, FT-IR, and diffuse reflectance spectroscopy. Ethylene photodegradation in gas-phase medium was employed as a probe reaction to evaluate the photocatalytic reactivity of the catalysts. The results reveal that sintering temperature significantly affects the structural stability and photocatalytic activity of titania. The catalyst which calcined at 350 degrees C possessed an intact macro/mesoporous structure and showed photocatalytic reactivity about 60% higher than that of commercial P25 titania. When the sample was calcined at 500 degrees C, the macroporous structure was retained but the mesoporous structure was partly destroyed. Further heating at temperatures above 600 degrees C destroyed both macro- and mesoporous structures, accompanied by a loss in photocatalytic activity. The high photocatalytic performance of the intact macro/mesoporous TiO(2) may be explained by the existence of macrochannels that increase photoabsorption efficiency and allow efficient diffusion of gaseous molecules. PMID:15752052

  11. Organized thiol functional groups in mesoporous core shell colloids

    SciTech Connect

    Marchena, Martin H.; Granada, Mara; Bordoni, Andrea V.; Joselevich, Maria; Troiani, Horacio; Williams, Federico J.; Wolosiuk, Alejandro

    2012-03-15

    The co-condensation in situ of tetraethoxysilane (TEOS) and mercaptopropyltrimethoxysilane (MPTMS) using cetyltrimethylammonium bromide (CTAB) as a template results in the synthesis of multilayered mesoporous structured SiO{sub 2} colloids with 'onion-like' chemical environments. Thiol groups were anchored to an inner selected SiO{sub 2} porous layer in a bilayered core shell particle producing different chemical regions inside the colloidal layered structure. X-Ray Photoelectron Spectroscopy (XPS) shows a preferential anchoring of the -SH groups in the double layer shell system, while porosimetry and simple chemical modifications confirm that pores are accessible. We can envision the synthesis of interesting colloidal objects with defined chemical environments with highly controlled properties. - Graphical abstract: Mesoporous core shell SiO{sub 2} colloids with organized thiol groups. Highlights: Black-Right-Pointing-Pointer Double shell mesoporous silica colloids templated with CTAB. Black-Right-Pointing-Pointer Sequential deposition of mesoporous SiO{sub 2} layers with different chemistries. Black-Right-Pointing-Pointer XPS shows the selective functionalization of mesoporous layers with thiol groups.

  12. Oxidative nanopatterning of titanium generates mesoporous surfaces with antimicrobial properties

    PubMed Central

    Variola, Fabio; Zalzal, Sylvia Francis; Leduc, Annie; Barbeau, Jean; Nanci, Antonio

    2014-01-01

    Mesoporous surfaces generated by oxidative nanopatterning have the capacity to selectively regulate cell behavior, but their impact on microorganisms has not yet been explored. The main objective of this study was to test the effects of such surfaces on the adherence of two common bacteria and one yeast strain that are responsible for nosocomial infections in clinical settings and biomedical applications. In addition, because surface characteristics are known to affect bacterial adhesion, we further characterized the physicochemical properties of the mesoporous surfaces. Focused ion beam (FIB) was used to generate ultrathin sections for elemental analysis by energy-dispersive X-ray spectroscopy (EDS), nanobeam electron diffraction (NBED), and high-angle annular dark field (HAADF) scanning transmission electron microscopy (STEM) imaging. The adherence of Staphylococcus aureus, Escherichia coli and Candida albicans onto titanium disks with mesoporous and polished surfaces was compared. Disks with the two surfaces side-by-side were also used for direct visual comparison. Qualitative and quantitative results from this study indicate that bacterial adhesion is significantly hindered by the mesoporous surface. In addition, we provide evidence that it alters structural parameters of C. albicans that determine its invasiveness potential, suggesting that microorganisms can sense and respond to the mesoporous surface. Our findings demonstrate the efficiency of a simple chemical oxidative treatment in generating nanotextured surfaces with antimicrobial capacity with potential applications in the implant manufacturing industry and hospital setting. PMID:24872694

  13. Synthesis of highly ordered mesoporous alumina thin films and their framework crystallization to γ-alumina phase.

    PubMed

    Jiang, Xiangfen; Oveisi, Hamid; Nemoto, Yoshihiro; Suzuki, Norihiro; Wu, Kevin C-W; Yamauchi, Yusuke

    2011-11-01

    Here we report the preparation of highly ordered mesoporous alumina films existing both as P6(3)/mmc and Fm-3m mesostructures by using triblock copolymer Pluronic P123 as the structure-directing agent. 2D grazing-incidence small-angle X-ray scattering (GI-SAXS) completely proves the existence of two different mesopore structures (i.e., [001]-oriented P6(3)/mmc and [111]-oriented Fm-3m symmetries). After calcination at 1000 °C, the amorphous alumina framework is successfully converted to γ-alumina crystals. During the crystallization process, large uniaxial shrinkage occurs along the direction perpendicular to the substrate with the retention of horizontal mesoscale periodicity, thereby resulting in formation of partially vertical mesoporosity in the film. Through detailed electron microscopic study, we discuss the formation mechanism for the vertical mesoporosity upon calcination. The obtained mesoporous γ-alumina film shows high thermal stability up to 1000 °C, which is highly useful in wide research areas such as catalyst supports and separators. PMID:21603720

  14. Organically functionalized mesoporous silica as a support for synthesis and catalysis

    NASA Astrophysics Data System (ADS)

    McEleney, Kevin Andrew

    Mesoporous silicates are excellent materials for supported catalysis due to their ease of functionalization, tunable pore size and high surface areas. Mesoporous silicates have been utilized in a variety of applications such as drug delivery scaffolds and catalyst supports. Functionalization of the surface can be achieved by either grafting of alkoxy silanes or co-condensation of the organosilane with the inorganic silica source. My research in this area can be divided into two components. In the first, we address the significant issue of metal contamination after reactions that are catalyzed by transition metals. In the second, we examine the design of new catalysts based on organic/inorganic composites. Ruthenium catalyzed processes such as olefin metathesis or asymmetric hydrogenation, are often underutilized due to the difficulty of removing the ruthenium by-products. Attempts to remove ruthenium involve treating the solution with a scavenging reagent followed by silica chromatography. Often these scavenging agents are expensive phosphines or toxic agents like lead tetra-acetate. SBA-15 functionalized with aminopropyl triethoxysilane displays a high affinity for ruthenium. Furthermore, it can be utilized to remove ruthenium by-products from olefin metathesis or hydrogenation reactions without the need for silica chromatography. We have also prepared sulfur-functionalized mesoporous silicates that have a high affinity for palladium. The materials after loading prove to be active catalysts for a variety of palladium catalyzed processes such as Suzuki-Miyaura and Sonogashira couplings. The catalysts are recyclable with moderate loss of activity and structure, depending on the method of incorporation of the thiol. We have characterized the as-synthesized and used catalysts by nitrogen sorption, TEM, X-ray photoelectron spectroscopy (XPS) and a variety of homogeneity tests were performed on the catalysts. Periodic mesoporous organosilicates (PMOs) are a well known

  15. Synthesis of continuous mesoporous alumina films with large-sized cage-type mesopores by using diblock copolymers.

    PubMed

    Jiang, Xiangfen; Suzuki, Norihiro; Bastakoti, Bishnu Prasad; Wu, Kevin C-W; Yamauchi, Yusuke

    2012-06-01

    Mesoporous alumina films with large-sized cage-type mesopores were prepared by using commercially available diblock copolymer (PS-b-PEO) and economic inorganic salt (AlCl(3)) as aluminum source. The obtained mesopore sizes drastically expand from 35 nm to 80 nm when the amount of ethanol in the precursor solutions were controlled. More interestingly, under an optimized amount of ethanol as co-solvent, there was no significant change of micelle morphology on the substrate, even though the relative amount of PS-b-PEO to alumina source was dramatically varied. When the amount of alumina precursor was decreased, the pore walls gradually became thinner, thereby improving pore connectivity. The ordered mesoporous alumina films obtained in this study exhibit high thermal stability up to 1000 °C, and their frameworks are successfully crystallized to γ-alumina phase. This technique could also be applicable for creating other metal oxide thin films with large mesopores. PMID:22556035

  16. Highly Loaded Mesoporous Silica/Nanoparticle Composites and Patterned Mesoporous Silica Films

    NASA Astrophysics Data System (ADS)

    Kothari, Rohit; Hendricks, Nicholas R.; Wang, Xinyu; Watkins, James J.

    2014-03-01

    Novel approaches for the preparation of highly filled mesoporous silica/nanoparticle (MS/NP) composites and for the fabrication of patterned MS films are described. The incorporation of iron platinum NPs within the walls of MS is achieved at high NP loadings by doping amphiphilic poly(ethylene oxide-b-propylene oxide-b-ethylene oxide) (Pluronic®) copolymer templates via selective hydrogen bonding between the pre-synthesized NPs and the hydrophilic portion of the block copolymer. The MS is then synthesized by means of phase selective condensation of tetraethylorthosilicate (TEOS) within the NP loaded block copolymer templates dilated with supercritical carbon dioxide (scCO2) followed by calcination. For patterned films, microphase separated block copolymer/small molecule additive blends are patterned using UV-assisted nanoimprint lithography. Infusion and condensation of a TEOS within template films using ScCO2 as a processing medium followed by calcination yields the patterned MS films. Scanning electron microscopy is used characterize pattern fidelity and transmission electron microscopy analysis confirms the presence of the mesopores. Long range order in nanocomposites is confirmed by low angle x-ray diffraction.

  17. Diffusion-Controlled Drug Release From the Mesoporous Magnesium Carbonate Upsalite(®).

    PubMed

    Zhang, Peng; Zardán Gómez de la Torre, Teresa; Forsgren, Johan; Bergström, Christel A S; Strømme, Maria

    2016-02-01

    In vitro drug release from well-defined particle-size fractions of the mesoporous magnesium carbonate material Upsalite(®) was investigated in detail using ibuprofen, a biopharmaceutics classification system class II drug, as the model compound. The weight of loaded drug corresponded to 30% of the weight of the carrier and the pores were filled to approximately 80%. The incorporated ibuprofen was found to be in an amorphous state and was physisorbed, rather than chemisorbed, to the surfaces of the pore walls. In contrast to ibuprofen in mesoporous silica, there was no detectable drug on the outer surface of the carrier particles. Two ibuprofen doses were loaded into Upsalite(®) particles with size fractions ranging from 25 μm to more than 200 μm. The initial release rate was controlled by the particle size; the dissolution rate of the loaded ibuprofen during this period was more than four times faster than that of the crystalline drug. An extended-release period of about 24 h followed the initial rapid-release period. The features of this extended-release period were dependent on the total drug concentration in the release medium. Detailed analysis of the diffusion of ibuprofen in Upsalite(®) provided the ibuprofen diffusion coefficient (9.8 × 10(-8) cm(2)/s), the constrictivity of the diffusion process (0.47) and the tortuosity of the carrier (15). This relatively high tortuosity value indicates that Upsalite(®) can be used not only to enhance the dissolution rate of poorly soluble drugs but also as a carrier in sustained-release applications by using larger particle sizes or even pellets of the material. PMID:26087956

  18. One-pot synthesis of mesoporous structured ratiometric fluorescence molecularly imprinted sensor for highly sensitive detection of melamine from milk samples.

    PubMed

    Xu, Shoufang; Lu, Hongzhi

    2015-11-15

    A facile strategy was developed to prepare mesoporous structured ratiometric fluorescence molecularly imprinted sensor for highly sensitive and selective determination of melamine using CdTe QDs as target sensitive dye and hematoporphyrin as reference dyes. One-pot synthesis method was employed because it could simplify the imprinting process and shorten the experimental period. The as-prepared fluorescence MIPs sensor, which combined ratiometric fluorescence technique with mesoporous silica materials into one system, exhibited excellent selectivity and sensitivity. Under optimum conditions, these mesoporous structured ratiometric fluorescence MIP@QDs sensors showed detection limit as low as 38 nM, which was much lower than those non-mesoporous one. The recycling process was sustainable at least 10 times without obvious efficiency decrease. The feasibility of the developed method in real samples was successfully evaluated through the analysis of melamine in raw milk and milk powder samples with satisfactory recoveries of 92-101%. The developed method proposed in this work proved to be a convenient, rapid, reliable and practical way to prepared high sensitive and selective fluorescence sensors with potentially applicable for trace pollutants analysis in complicated samples. PMID:26057736

  19. Selective SERS Sensing Modulated by Functionalized Mesoporous Films.

    PubMed

    López-Puente, Vanesa; Angelomé, Paula C; Soler-Illia, Galo J A A; Liz-Marzán, Luis M

    2015-11-25

    A hybrid material comprising metal nanoparticles embedded in functionalized mesoporous thin films was constructed, and its use as a selective SERS-based sensor was demonstrated. The presence of specific functional groups in the pore network allows control over the surface chemistry of the pores, tuning the selectivity for specific molecules. Amino-functionalized hybrid mesoporous thin films were used in a proof of concept experiment, to discern the presence of methylene blue (MB) in mixtures with acid blue (AB), with no need for any sample pretreatment step. Selective detection of MB was possible through entrapment of AB in the mesoporous matrix, based on its high affinity for amino groups. The sensor selectivity can be tuned by varying the solution pH, rendering a pH responsive surface and thus, selective SERS-based sensing. The developed sensors allow specific detection of molecules in complex matrixes. PMID:26536368

  20. Plutonium complexation by phosphonate-functionalized mesoporous silica

    SciTech Connect

    Parsons-Moss, T; Schwaiger, L K; Hubaud, A; Hu, Y J; Tuysuz, H; Yang, P; Balasubramanian, K; Nitsche, H

    2010-10-27

    MCM-41-type mesoporous silica functionalized with the CMPO-based 'Ac-Phos' silane has been reported in the literature (1) to show good capacity as an acftinide sorbent material, with potential applications in environmental sequestration, aqueous waste separation and/or vitrification, and chemical sensing of actinides in solution. The study explores the complexation of Pu(IV and VI) and other selected actinides and lanthanides by SBA-15 type mesoporous silica functionalized with Ac-Phos. The Pu binding kinetics and binding capacity were determined for both the Ac-Phos functionalized and unmodified SBA-15. They analyzed the binding geometry and redox behavior of Pu(VI) by X-ray absorption spectroscopy (XAS). They discuss the synthesis and characterization of the functionalized mesoporous material, batch sorption experiments, and the detailed analyses of the actinide complexes that are formed. Structural measurements are paired with high-level quantum mechanical modeling to elucidate the binding mechanisms.

  1. Actinide sequestration using self-assembled monolayers on mesoporous supports.

    PubMed

    Fryxell, Glen E; Lin, Yuehe; Fiskum, Sandy; Birnbaum, Jerome C; Wu, Hong; Kemner, Ken; Kelly, Shelley

    2005-03-01

    Surfactant templated synthesis of mesoporous ceramics provides a versatile foundation upon which to create high efficiency environmental sorbents. These nanoporous ceramic oxides condense a huge amount of surface area into a very small volume. The ceramic oxide interface is receptive to surface functionalization through molecular self-assembly. The marriage of mesoporous ceramics with self-assembled monolayer chemistry creates a powerful new class of environmental sorbent materials called self-assembled monolayers on mesoporous supports (SAMMS). These SAMMS materials are highly efficient sorbents whose interfacial chemistry can be fine-tuned to selectively sequester a specific target species, such as heavy metals, tetrahedral oxometalate anions, and radionuclides. Details addressing the design, synthesis, and characterization of SAMMS materials specifically designed to sequester actinides, of central importance to the environmental cleanup necessary after 40 years of weapons-grade plutonium production, as well as evaluation of their binding affinities and kinetics are presented. PMID:15787373

  2. Mesoporous materials for energy conversion and storage devices

    NASA Astrophysics Data System (ADS)

    Li, Wei; Liu, Jun; Zhao, Dongyuan

    2016-06-01

    To meet the growing energy demands in a low-carbon economy, the development of new materials that improve the efficiency of energy conversion and storage systems is essential. Mesoporous materials offer opportunities in energy conversion and storage applications owing to their extraordinarily high surface areas and large pore volumes. These properties may improve the performance of materials in terms of energy and power density, lifetime and stability. In this Review, we summarize the primary methods for preparing mesoporous materials and discuss their applications as electrodes and/or catalysts in solar cells, solar fuel production, rechargeable batteries, supercapacitors and fuel cells. Finally, we outline the research and development challenges of mesoporous materials that need to be overcome to increase their contribution in renewable energy applications.

  3. Adsorption of vitamin E on mesoporous titania nanocrystals

    SciTech Connect

    Shih, C.J.; Lin, C.T.; Wu, S.M.

    2010-07-15

    Tri-block nonionic surfactant and titanium chloride were used as starting materials for the synthesis of mesoporous titania nanocrystallite powders. The main objective of the present study was to examine the synthesis of mesoporous titania nanocrystals and the adsorption of vitamin E on those nanocrystals using X-ray diffraction (XRD), transmission electron microscopy, and nitrogen adsorption and desorption isotherms. When the calcination temperature was increased to 300 {sup o}C, the reflection peaks in the XRD pattern indicated the presence of an anatase phase. The crystallinity of the nanocrystallites increased from 80% to 98.6% with increasing calcination temperature from 465 {sup o}C to 500 {sup o}C. The N{sub 2} adsorption data and XRD data taken after vitamin E adsorption revealed that the vitamin E molecules were adsorbed in the mesopores of the titania nanocrystals.

  4. Actinide Sequestration Using Self-Assembled Monolayers on Mesoporous Supports

    SciTech Connect

    Fryxell, Glen E.; Lin, Yuehe; Fiskum, Sandra K.; Birnbaum, Jerome C.; Wu, Hong; Kemner, K. M.; Kelly, Shelley

    2005-03-01

    Surfactant templated synthesis of mesoporous ceramics provides a versatile foundation upon which to create high efficiency environmental sorbents. These nanoporous ceramic oxides condense a huge amount of surface area into a very small volume. The ceramic oxide interface is receptive to surface functionalization through molecular self-assembly. The marriage of mesoporous ceramics with self-assembled monolayer chemistry creates a powerful new class of environmental sorbent materials called self-assembled monolayers on mesoporous supports (SAMMS). These SAMMS materials are highly efficient sorbents, whose interfacial chemistry can be fine-tuned to selectively sequester a specific target species, such as heavy metals, tetrahedral oxometallate anions and radionuclides. Details addressing the design, synthesis and characterization of SAMMS materials specifically designed to sequester actinides, of central importance to the environmental clean-up necessary after 40 years of weapons grade plutonium production, as well as evaluation of their binding affinities and kinetics are presented.

  5. Mesoporous materials for clean energy technologies.

    PubMed

    Linares, Noemi; Silvestre-Albero, Ana M; Serrano, Elena; Silvestre-Albero, Joaquín; García-Martínez, Javier

    2014-11-21

    Alternative energy technologies are greatly hindered by significant limitations in materials science. From low activity to poor stability, and from mineral scarcity to high cost, the current materials are not able to cope with the significant challenges of clean energy technologies. However, recent advances in the preparation of nanomaterials, porous solids, and nanostructured solids are providing hope in the race for a better, cleaner energy production. The present contribution critically reviews the development and role of mesoporosity in a wide range of technologies, as this provides for critical improvements in accessibility, the dispersion of the active phase and a higher surface area. Relevant examples of the development of mesoporosity by a wide range of techniques are provided, including the preparation of hierarchical structures with pore systems in different scale ranges. Mesoporosity plays a significant role in catalysis, especially in the most challenging processes where bulky molecules, like those obtained from biomass or highly unreactive species, such as CO2 should be transformed into most valuable products. Furthermore, mesoporous materials also play a significant role as electrodes in fuel and solar cells and in thermoelectric devices, technologies which are benefiting from improved accessibility and a better dispersion of materials with controlled porosity. PMID:24699503

  6. Enzyme-Powered Hollow Mesoporous Janus Nanomotors.

    PubMed

    Ma, Xing; Jannasch, Anita; Albrecht, Urban-Raphael; Hahn, Kersten; Miguel-López, Albert; Schäffer, Erik; Sánchez, Samuel

    2015-10-14

    The development of synthetic nanomotors for technological applications in particular for life science and nanomedicine is a key focus of current basic research. However, it has been challenging to make active nanosystems based on biocompatible materials consuming nontoxic fuels for providing self-propulsion. Here, we fabricate self-propelled Janus nanomotors based on hollow mesoporous silica nanoparticles (HMSNPs), which are powered by biocatalytic reactions of three different enzymes: catalase, urease, and glucose oxidase (GOx). The active motion is characterized by a mean-square displacement (MSD) analysis of optical video recordings and confirmed by dynamic light scattering (DLS) measurements. We found that the apparent diffusion coefficient was enhanced by up to 83%. In addition, using optical tweezers, we directly measured a holding force of 64 ± 16 fN, which was necessary to counteract the effective self-propulsion force generated by a single nanomotor. The successful demonstration of biocompatible enzyme-powered active nanomotors using biologically benign fuels has a great potential for future biomedical applications. PMID:26437378

  7. Zirconia-silica based mesoporous desulfurization adsorbents

    NASA Astrophysics Data System (ADS)

    Palomino, Jessica M.; Tran, Dat T.; Kareh, Ana R.; Miller, Christopher A.; Gardner, Joshua M. V.; Dong, Hong; Oliver, Scott R. J.

    2015-03-01

    We report a series of mesoporous silicate sorbent materials templated by long-chain primary alkylamines that display record level of desulfurization of the jet fuel JP-8. Pure silica frameworks and those with a Si:Zr synthesis molar ratio ranging from 44:1 to 11:1 were investigated. The optimum sorbent was identified as dodecylamine-templated silica-zirconia synthesized from a gel with Si:Zr molar ratio of 15:1. With an optimized silver loading of 11 wt.%, a saturation adsorption capacity of 39.4 mgS g-1 and a silver efficiency of 1.21 molS mol Ag-1 were observed for JP-8. This sorbent displayed exceptional regenerability, maintaining 86% of its initial capacity in model fuel after solvent regeneration with diethyl ether. Low-cost, portable and reusable sorbents for the desulfurization of JP-8 jet fuel are needed to make solid oxide fuel cells (SOFCs) a reality for military power needs. SOFCs require ultra-low sulfur content fuel, which traditional desulfurization methods cannot achieve.

  8. The synthesis and application of two mesoporous silica nanoparticles as drug delivery system with different shape

    NASA Astrophysics Data System (ADS)

    Wang, Jiayi; Wang, Zhuyuan; Chen, Hui; Zong, Shenfei; Cui, Yiping

    2015-05-01

    Mesoporous silica nanospheres(MSNSs) have been obtained utilizing the conventional reverse micelles synthesis method while the mesoporous silica nanorods(MSNRs) have been acquired by means of changing certain parameters. Afterwards, the prepared mesoporous silica nanospheres and nanorods were used as drug carriers to load and release the classical cancer therapeutic drug—DOX. According to the absorption spectra, the encapsulation efficiency of the mesoporous silica nanospheres is almost as high as that of the nanospheres. Different from the familiar encapsulation efficiency, the release characteristic curves of the mesoporous silica nanospheres and nanorods possessed certain differences during the release process. Finally incellular fluorescence imaging was achieved to observe the endocytosis of the mesoporous silica materials. Our results show that although both of the two kinds of nanoparticles possess favourable properties for loading and releasing drugs, the mesoporous silica nanospheres perform better in dispersity and controlled release than the nanorods, which probably endow them the potential as incellular drug delivery system.

  9. Brick-and-Mortar Self-Assembly Approach to Graphitic Mesoporous Carbon Nanocomposites

    SciTech Connect

    Dai, Sheng; Fulvio, Pasquale F; Mayes, Richard T; Wang, Xiqing; Mahurin, Shannon Mark; Bauer, Christopher; Presser, Volker; Mcdonough, John; Gogotsi, Yury

    2011-01-01

    Mesoporous carbon materials do not have sufficient ordering at the atomic scale to exhibit good electronic conductivity. To date, mesoporous carbons having uniform mesopores and high surface areas have been prepared from partially-graphitizable precursors in the presence of templates. High temperature thermal treatments above 2000 C, which are usually required to increase conductivity, result in a partial or total collapse of the mesoporous structures and reduced surface areas induced by growth of graphitic domains, limiting their applications in electric double layer capacitors and lithium-ion batteries. In this work, we successfully implemented a 'brick-and-mortar' approach to obtain ordered graphitic mesoporous carbon nanocomposites with tunable mesopore sizes below 850 C without using graphitization catalysts or high temperature thermal treatments. Phenolic resin-based mesoporous carbons act as mortar to highly conductive carbon blacks and carbon onions (bricks). The capacitance and resistivity of final materials can be tailored by changing the mortar to brick ratios.

  10. Lower Permittivity Characteristic of Mesoporous-Alumina/Epoxy Composite due to Particle Porosity

    NASA Astrophysics Data System (ADS)

    Kurimoto, Muneaki; Murakami, Yoshinobu; Nagao, Masayuki

    Introduction of metal oxide nanoparticles to polymer composite material is known to have unique dielectric behavior and significant advantage in the electrical insulation performance of electrical power apparatus. This paper presents an attempt to derive the dielectric characteristics of polymer composite filled with the metal oxide particle which has mesoporous structure. Experiments were carried out in the epoxy composites filled with alumina microparticles which have the mesoporous structure (mesoporous-alumina/epoxy composites) with different particle content. Based on the measurement of the specific gravity of mesoporous-alumina/epoxy composites, the porosity of mesoporous-alumina particle in the epoxy matrix was found to be higher than that of nonporous-alumina particle. Furthermore, we evaluated relative permittivity of mesoporous-alumina/epoxy composites by measuring the capacitance of its specimens. As the results, we verified that the permittivity of mesoporous-alumina/epoxy composites was lower than that of nonporous-alumina/epoxy composites due to the particle porosity.