Science.gov

Sample records for seed weight variation

  1. The Natural Variation of Seed Weight Is Mainly Controlled by Maternal Genotype in Rapeseed (Brassica napus L.)

    PubMed Central

    Shi, Jiaqin; Wang, Xinfa; Liu, Guihua; Wang, Hanzhong

    2015-01-01

    Seed weight is a very important and complex trait in rapeseed (Brassica napus L.). The seed weight of rapeseed shows great variation in its natural germplasm resources; however, the morphological, cytological and genetic causes of this variation have remained unclear. In the present study, nine highly pure inbred rapeseed lines with large seed weight variation and different genetic backgrounds were selected for morphological, cytological and genetic studies on seed weight. The results showed the following: (1) Seed weight showed an extremely significant correlation and coordinated variation with seed size (including seed diameter, seed surface area and seed volume), but it showed no significant correlation with bulk density, which suggests that seed weight is determined by size rather than bulk density. (2) Seed weight showed a higher correlation with the cell numbers of seed coats and cotyledons than the cell sizes of seed coats and cotyledons, which suggests that cell number is more tightly correlated with final seed weight. (3) Seed weight was mainly controlled by the maternal genotype, with little or no xenia and cytoplasmic effects. This is the first report on the morphological and cytological causes of seed weight natural variation in rapeseed. We concluded that the natural variation of seed weight is mainly controlled by maternal genotype. This finding lays a foundation for genetic and breeding studies of seed weight in rapeseed and opens a new field of research on the regulation of seed traits in plants. PMID:25915862

  2. Variation of hairy vetch seed weight alters germination and seedling growth response to an allelochemical

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The inhibition of seed germination by an allelochemical is generally greater in small seeds than in large seeds. This response may have significant impact on weed control by allelopathic cover crops where the small-seeded weeds would be controlled more effectively than large-seeded species. In our...

  3. Natural variation in ARF18 gene simultaneously affects seed weight and silique length in polyploid rapeseed

    PubMed Central

    Liu, Jing; Hua, Wei; Hu, Zhiyong; Yang, Hongli; Zhang, Liang; Li, Rongjun; Deng, Linbin; Sun, Xingchao; Wang, Xinfa; Wang, Hanzhong

    2015-01-01

    Seed weight (SW), which is one of the three major factors influencing grain yield, has been widely accepted as a complex trait that is controlled by polygenes, particularly in polyploid crops. Brassica napus L., which is the second leading crop source for vegetable oil around the world, is a tetraploid (4×) species. In the present study, we identified a major quantitative trait locus (QTL) on chromosome A9 of rapeseed in which the genes for SW and silique length (SL) were colocated. By fine mapping and association analysis, we uncovered a 165-bp deletion in the auxin-response factor 18 (ARF18) gene associated with increased SW and SL. ARF18 encodes an auxin-response factor and shows inhibitory activity on downstream auxin genes. This 55-aa deletion prevents ARF18 from forming homodimers, in turn resulting in the loss of binding activity. Furthermore, reciprocal crossing has shown that this QTL affects SW by maternal effects. Transcription analysis has shown that ARF18 regulates cell growth in the silique wall by acting via an auxin-response pathway. Together, our results suggest that ARF18 regulates silique wall development and determines SW via maternal regulation. In addition, our study reveals the first (to our knowledge) QTL in rapeseed and may provide insights into gene cloning involving polyploid crops. PMID:26324896

  4. Natural variation in ARF18 gene simultaneously affects seed weight and silique length in polyploid rapeseed.

    PubMed

    Liu, Jing; Hua, Wei; Hu, Zhiyong; Yang, Hongli; Zhang, Liang; Li, Rongjun; Deng, Linbin; Sun, Xingchao; Wang, Xinfa; Wang, Hanzhong

    2015-09-15

    Seed weight (SW), which is one of the three major factors influencing grain yield, has been widely accepted as a complex trait that is controlled by polygenes, particularly in polyploid crops. Brassica napus L., which is the second leading crop source for vegetable oil around the world, is a tetraploid (4×) species. In the present study, we identified a major quantitative trait locus (QTL) on chromosome A9 of rapeseed in which the genes for SW and silique length (SL) were colocated. By fine mapping and association analysis, we uncovered a 165-bp deletion in the auxin-response factor 18 (ARF18) gene associated with increased SW and SL. ARF18 encodes an auxin-response factor and shows inhibitory activity on downstream auxin genes. This 55-aa deletion prevents ARF18 from forming homodimers, in turn resulting in the loss of binding activity. Furthermore, reciprocal crossing has shown that this QTL affects SW by maternal effects. Transcription analysis has shown that ARF18 regulates cell growth in the silique wall by acting via an auxin-response pathway. Together, our results suggest that ARF18 regulates silique wall development and determines SW via maternal regulation. In addition, our study reveals the first (to our knowledge) QTL in rapeseed and may provide insights into gene cloning involving polyploid crops. PMID:26324896

  5. Seed coat color and seed weight contribute differential responses of targeted metabolites in soybean seeds.

    PubMed

    Lee, Jinwook; Hwang, Young-Sun; Kim, Sun Tae; Yoon, Won-Byong; Han, Won Young; Kang, In-Kyu; Choung, Myoung-Gun

    2017-01-01

    The distribution and variation of targeted metabolites in soybean seeds are affected by genetic and environmental factors. In this study, we used 192 soybean germplasm accessions collected from two provinces of Korea to elucidate the effects of seed coat color and seeds dry weight on the metabolic variation and responses of targeted metabolites. The effects of seed coat color and seeds dry weight were present in sucrose, total oligosaccharides, total carbohydrates and all measured fatty acids. The targeted metabolites were clustered within three groups. These metabolites were not only differently related to seeds dry weight, but also responded differentially to seed coat color. The inter-relationship between the targeted metabolites was highly present in the result of correlation analysis. Overall, results revealed that the targeted metabolites were diverged in relation to seed coat color and seeds dry weight within locally collected soybean seed germplasm accessions. PMID:27507473

  6. Endozoochorous seed dispersal by Japanese macaques (Macaca fuscata): Effects of temporal variation in ranging and seed characteristics on seed shadows.

    PubMed

    Tsuji, Yamato; Morimoto, Mayumi

    2016-02-01

    Variation in seed shadows generated by frugivores is caused by daily, seasonal, and inter-annual variation in ranging, as well as inter-specific variability in gut passage times according to seed characteristics. We studied the extent to which seed weight, specific gravity, and daily (morning, afternoon, and evening) and inter-annual (2004 vs. 2005) variation in ranging affected seed shadows generated by wild Japanese macaques (Macaca fuscata) in northern Japan. The macaques ingested fleshy fruits of 11 species during the two year study period; Viburnum dilatatum (Caprifoliaceae: heavier seeds with higher specific gravity) and Rosa multiflora (Rosaceae: lighter seeds with lower specific gravity) were eaten frequently in both years. The travel distances of macaques after feeding on V. dilatatum and R. multiflora fruits were estimated by combining feeding locations and ranging patterns measured in the field with gut passage times of model seeds in captive animals. Median travel distances after fruit feeding were 431 (quantile range: 277-654) and 478 m (265-646), respectively, with a maximum of 1,261 m. Neither year nor time of day affected travel distances. The gut passage time of model V. dilatatum seeds was longer than that of model R. multiflora seed, but this did not affect dispersal distances. Seed shadows for both species over 2 years showed unimodal distribution (peak: 101-500 m) and more than 90%, 20%, and 3% of ingested seeds were estimated to be dispersed >100, >500, and >1000 m, respectively, the longest known distances among macaque species. R. multiflora seeds tended to be dispersed further in 2004 than 2005, but V. dilatatum seeds were not, implying that inter-annual variations in ranging pattern due to the distribution and abundance of nut fruiting could affect dispersal distance. PMID:26469699

  7. Seed weight and germination behavior of the submerged plant Potamogeton pectinatus in the arid zone of northwest China

    PubMed Central

    Li, Zhongqiang; Lu, Wei; Yang, Lei; Kong, Xianghong; Deng, Xuwei

    2015-01-01

    Variation in seed weight is common within and among plant species, but few studies have attempted to document the pattern of seed weight and germination attributes for aquatic macrophytes at a large scale. This study examined within-species variation in seed weight and germination attributes and the effects of environmental factors on seed traits of the submerged plant Potamogeton pectinatus in the arid zone of northwest China. Our results showed that the average seed weight was 0.24 g per 100 seeds with a coefficient of variation (CV) of 28.4% among the eight P. pectinatus populations. The total germination fraction of seeds of P. pectinatus was relatively poor, less than 35% in seven P. pectinatus populations, and the lowest germination percentage found was only 2%. There were significant differences in seed weight, time to onset of germination, and total germination fraction among the eight different populations. Hierarchical partitioning analysis showed a strongly positive correlation between seed weight and water temperature and pH. Seed weight and the maternal environmental factors significantly affected both time to initiation of germination and total germination fraction. Our results suggest that (1) seed weight variation in P. pectinatus primarily is the result of temperature variation during fruit development; (2) relatively poor germination fraction suggests that seeds are relatively unimportant in the short-term survival of populations and that it may be another adaptive trait allowing plants to take place in the right place and at the right time, especially in harsh environment; and (3) variation in seed germination traits should be determined by local environmental and intrinsic factors that interact in a complex fashion. PMID:25897389

  8. Florivory Modulates the Seed Number-Seed Weight Relationship in Halenia elliptica (Gentianaceae)

    PubMed Central

    Wang, Linlin; Meng, Lihua; Luo, Jian

    2015-01-01

    Generally, plant reproductive success might be affected negatively by florivory, and the effects may vary depending on the timing and intensity of florivory. To clarify the impacts of florivory by the sawfly larvae (Tenthredinidae) on seed production of Halenia elliptica D. Don, we simulated florivory by removing different proportion of flowers at three reproductive stages in this alpine herb and then examined the seed number per fruit, the seed weight, and the seed mass per fruit of the remaining flowers. Seed number per fruit reduced significantly when flowers were removed at flowering and fruiting stages or when 15% and 60% of flowers were removed. However, seed weight increased significantly after flowers were removed, independent of treatments of reproductive stage and proportion. There was a similar seed mass per fruit between the plants subjected to simulation of florivory and control. The results indicated that florivory modulated the seed number-seed weight relationship in this alpine species. Our study suggested that selective seed abortion and resource reallocation within fruits may ensure fewer but larger seeds, which were expected to be adaptive in the harsh environments. PMID:26495428

  9. Seed predators exert selection on the subindividual variation of seed size.

    PubMed

    Sobral, M; Guitián, J; Guitián, P; Larrinaga, A R

    2014-07-01

    Subindividual variation among repeated organs in plants constitutes an overlooked level of variation in phenotypic selection studies, despite being a major component of phenotypic variation. Animals that interact with plants could be selective agents on subindividual variation. This study examines selective pressures exerted during post-dispersal seed predation and germination on the subindividual variation of seed size in hawthorn (Crataegus monogyna). With a seed offering experiment and a germination test, we estimated phenotypic selection differentials for average and subindividual variation of seed size due to seed predation and germination. Seed size affects germination, growth rate and the probability of an individual seed of escaping predation. Longer seeds showed higher germination rates, but this did not result in significant selection on phenotypes of the maternal trees. On the other hand, seed predators avoided wider seeds, and by doing so exerted phenotypic selection on adult average and subindividual variation of seed size. The detected selection on subindividual variation suggests that the levels of phenotypic variation within individual plants may be, at least partly, the adaptive consequence of animal-mediated selection. PMID:24176051

  10. Evidence for Orthologous Seed Weight Genes in Cowpea and Mung Bean Based on RFLP Mapping

    PubMed Central

    Fatokun, C. A.; Menancio-Hautea, D. I.; Danesh, D.; Young, N. D.

    1992-01-01

    A well saturated genomic map is a necessity for a breeding program based on marker assisted selection. To this end, we are developing genomic maps for cowpea (Vigna unguiculata 2N=22) and mung bean (Vigna radiata 2N=22) based on restriction fragment length polymorphism (RFLP) markers. Using these maps, we have located major quantitative trait loci (QTLs) for seed weight in both species. Two unlinked genomic regions in cowpea contained QTLs accounting for 52.7% of the variation for seed weight. In mung bean there were four unlinked genomic regions accounting for 49.7% of the variation for seed weight. In both cowpea and mung bean the genomic region with the greatest effect on seed weight spanned the same RFLP markers in the same linkage order. This suggests that the QTLs in this genomic region have remained conserved through evolution. This inference is supported by the observation that a significant interaction (i.e., epistasis) was detected between the QTL(s) in the conserved region and an unlinked RFLP marker locus in both species. PMID:1361476

  11. Variation for seed phytosterols in sunflower germplasm

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Sunflower (Helianthus annuus L.) seeds and oils are rich sources of phytosterols, which are important compounds for human nutrition. There is limited information on variability for seed phytosterols in sunflower germplasm. The objective of the present research was to evaluate kernel phytosterol cont...

  12. Exploring the Natural Variation for Seedling Traits and Their Link with Seed Dimensions in Tomato

    PubMed Central

    Willems, Leo A. J.; van Heusden, Adriaan W.; Ligterink, Wilco; Hilhorst, Henk W. M.

    2012-01-01

    The success of germination, growth and final yield of every crop depends to a large extent on the quality of the seeds used to grow the crop. Seed quality is defined as the viability and vigor attribute of a seed that enables the emergence and establishment of normal seedlings under a wide range of environments. We attempt to dissect the mechanisms involved in the acquisition of seed quality, through a combined approach of physiology and genetics. To achieve this goal we explored the genetic variation found in a RIL population of Solanum lycopersicum (cv. Moneymaker) x Solanum pimpinellifolium through extensive phenotyping of seed and seedling traits under both normal and nutrient stress conditions and root system architecture (RSA) traits under optimal conditions. We have identified 62 major QTLs on 21 different positions for seed, seedling and RSA traits in this population. We identified QTLs that were common across both conditions, as well as specific to stress conditions. Most of the QTLs identified for seedling traits co-located with seed size and seed weight QTLs and the positive alleles were mostly contributed by the S. lycopersicum parent. Co-location of QTLs for different traits might suggest that the same locus has pleiotropic effects on multiple traits due to a common mechanistic basis. We show that seed weight has a strong effect on seedling vigor and these results are of great importance for the isolation of the corresponding genes and elucidation of the underlying mechanisms. PMID:22952841

  13. Exploring the natural variation for seedling traits and their link with seed dimensions in tomato.

    PubMed

    Khan, Noorullah; Kazmi, Rashid H; Willems, Leo A J; van Heusden, Adriaan W; Ligterink, Wilco; Hilhorst, Henk W M

    2012-01-01

    The success of germination, growth and final yield of every crop depends to a large extent on the quality of the seeds used to grow the crop. Seed quality is defined as the viability and vigor attribute of a seed that enables the emergence and establishment of normal seedlings under a wide range of environments. We attempt to dissect the mechanisms involved in the acquisition of seed quality, through a combined approach of physiology and genetics. To achieve this goal we explored the genetic variation found in a RIL population of Solanum lycopersicum (cv. Moneymaker) x Solanum pimpinellifolium through extensive phenotyping of seed and seedling traits under both normal and nutrient stress conditions and root system architecture (RSA) traits under optimal conditions. We have identified 62 major QTLs on 21 different positions for seed, seedling and RSA traits in this population. We identified QTLs that were common across both conditions, as well as specific to stress conditions. Most of the QTLs identified for seedling traits co-located with seed size and seed weight QTLs and the positive alleles were mostly contributed by the S. lycopersicum parent. Co-location of QTLs for different traits might suggest that the same locus has pleiotropic effects on multiple traits due to a common mechanistic basis. We show that seed weight has a strong effect on seedling vigor and these results are of great importance for the isolation of the corresponding genes and elucidation of the underlying mechanisms. PMID:22952841

  14. A single gene mutation that increases maize seed weight

    SciTech Connect

    Giroux, M.J.; Shaw, J.; Hannah, L.C. |

    1996-06-11

    The maize endosperm-specific gene shrunken2 (Sh2) encodes the large subunit of the heterotetrameric starch synthetic enzyme adenosine diphosphoglucose pyrophosphorylase (AGP; EC 2.7.7.27). Here we exploit an in vivo, site-specific mutagenesis system to create short insertion mutations in a region of the gene known to be involved in the allosteric regulation of AGP. The site-specific mutagen is the transposable element dissociation (Ds). Approximately one-third (8 of 23) of the germinal revertants sequenced restored the wild-type sequence, whereas the remaining revertants contained insertions of 3 or 6 bp. All revertants retained the original reading frame 3 feet to the insertion site and involved the addition of tyrosine and/or serine. Each insertion revertant reduced total AGP activity and the amount of the SH2 protein. The revertant containing additional tyrosine and serine residues increased seed weight 11-18% without increasing or decreasing the percentage of starch. Other insertion revertants lacking an additional serine reduced seed weight. Reduced sensitivity to phosphate, a long-known inhibitor of AGP, was found in the high seed-weight revertant. This alteration is likely universally important since insertion of tyrosine and serine in the potato large subunit of AGP at the comparable position and expression in Escherichia coli also led to a phosphate-insensitive enzyme. These results show that single gene mutations giving rise to increased seed weight, and therefore perhaps yield, are clearly possible in a plant with a long history of intensive and successful breeding efforts. 20 refs., 5 figs., 5 tabs.

  15. Analysis of interspecies physicochemical variation of grain legume seeds

    NASA Astrophysics Data System (ADS)

    Rybiński, Wojciech; Rusinek, Robert; Szot, Bogusław; Bocianowski, Jan; Starzycki, Michał

    2014-10-01

    The paper presents an attempt to assess the reaction of seeds to mechanical loads taking into account their geometry expressed as seed thickness and 1000 seed weight. The initial material comprised 33 genotypes of grain legume plants and included cultivars registered in the country and breeding lines that are subject to pre-registration trials. The analysis of variance revealed significant diversity of the cultivars and lines of the species studied in terms of each of the analysed trait. The highest weight of 1000 seeds were obtained for white lupine seeds and peas, the lowest for andean lupine seeds. The maximum deformation and energy were obtained for white lupine seeds, the lowest for pea seeds, the maximum force and module the lowest values were determined for narrow-leafed lupine and pea. The highest values of protein were obtained for andean and yellow lupine, a fat content for andean and white lupine. The fatty acid profile as much as 70% or more were linoleic and oleic acids. Against the background of all the species are distinguished by white lupine seeds with a high content of oleic acid and the lowest of linoleic acid, for yellow lupine were obtained the inverse ratio of the two acids.

  16. Genotypic variation in fatty acid content of blackcurrant seeds.

    PubMed

    Ruiz del Castillo, M L; Dobson, G; Brennan, R; Gordon, S

    2002-01-16

    The fatty acid composition and total fatty acid content of seeds from 36 blackcurrant genotypes developed at the Scottish Crop Research Institute were examined. A rapid small-scale procedure, involving homogenization of seeds in toluene followed by sodium methoxide transesterification and gas chromatography, was used. There was considerable variation between genotypes. The gamma-linolenic acid content generally varied from 11 to 19% of the total fatty acids, but three genotypes had higher values of 22-24%, levels previously not reported for blackcurrant seed and similar to those for borage seed. Other nutritionally important fatty acids, stearidonic acid and alpha-linolenic acid, varied from 2 to 4% and 10-19%, respectively. The mean total fatty acid contents ranged from 14 to 23% of the seed, but repeatability was poor. The results are discussed. Blackcurrant seeds are mainly byproducts from juice production, and the study shows the potential for developing blackcurrant genotypes with optimal added value. PMID:11782203

  17. Variation in seed lipids in Calendula germplasm

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Calendula officinalis (pot marigold) has considerable promise as an industrial crop, with a long history as an ornamental and medicinal plant. It is also marketed as an ingredient in cosmetics and a colorant. It produces unusual seed lipids, which can provide an additional market for commercial Ca...

  18. Air temperature variation across the seed cotton dryer mixpoint

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Eighteen tests were conducted in six gins in the fall of 2008 to measure air temperature variation within various heated air seed cotton drying systems with the purpose of: checking validation of recommendations by a professional engineering society and measuring air temperature variation across the...

  19. Seed size variation in the palm Euterpe edulis and the effects of seed predators on germination and seedling survival

    NASA Astrophysics Data System (ADS)

    Pizo, Marco A.; Von Allmen, Christiane; Morellato, L. Patricia C.

    2006-05-01

    Intraspecific variation in seed size is common in wild plant populations and has important consequences for the reproductive success of individual plants. Multiple, often conflicting evolutionary forces mediated by biotic as well as abiotic agents may maintain such a variation. In this paper we assessed seed size variation in a population of the threatened, commercially important palm Euterpe edulis in southeast Brazil. We investigated (i) how this variation affects the probability of attack by vertebrate and invertebrate post-dispersal seed predators, and (ii) if seed size influences the outcome of seeds damaged by beetles in terms of seed germination and early survival of seedlings. Euterpe edulis seeds varied in diameter from 8.3 to 14.1 mm. Neither insects nor rodents selected the seeds they preyed upon based on seed size. Seed germination and total, shoot and root biomasses of one-year seedlings were significantly and positively affected by seed size. Root biomass and seedling survival were negatively affected by seed damage caused by a scolytid beetle ( Coccotrypes palmarum) whose adults bore into seeds to consume part of the endosperm, but do not oviposit on them. Seed size had a marginally significant effect on seedling survival. Therefore, if any advantage is accrued by E. edulis individuals producing large seeds, this is because of greater seed germination success and seedling vigor. If this is so, even a relatively narrow range of variation in seed size as observed in the E. edulis population studied may translate into differential success of individual plants.

  20. Exploring nitrogen remobilization for seed filling using natural variation in Arabidopsis thaliana

    PubMed Central

    Masclaux-Daubresse, Céline; Chardon, Fabien

    2011-01-01

    Nineteen Arabidopsis accessions grown at low (LOW N) and high (HIGH N) nitrate supplies were labelled using 15N to trace nitrogen remobilization to the seeds. Effects of genotype and nutrition were examined. Nitrate availability affected biomass and yield, and highly modified the nitrogen concentration in the dry remains. Surprisingly, variations of one-seed dry weight (DW1S) and harvest index (HI) were poorly affected by nutrition. Nitrogen harvest index (NHI) was highly correlated with HI and showed that nitrogen use efficiency (NUE) was increased at LOW N. Nitrogen remobilization efficiency (NRE), as 15N partitioning in seeds (15NHI), was also higher at LOW N. The relative specific abundance (RSA) in seeds and whole plants indicated that the 14NO3 absorbed post-labelling was mainly allocated to the seeds (SEEDS) at LOW N, but to the dry remains (DR) at HIGH N. Nitrogen concentration (N%) in the DR was then 4-fold higher at HIGH N compared with LOW N, whilst N% in seeds was poorly modified. Although NHI and 15NHI were highly correlated to HI, significant variations in NUE and NRE were identified using normalization to HI. New insights provided in this report are helpful for the comprehension of NUE and NRE concepts in Arabidopsis as well as in crops and especially in Brassica napus. PMID:21273332

  1. Exploring nitrogen remobilization for seed filling using natural variation in Arabidopsis thaliana.

    PubMed

    Masclaux-Daubresse, Céline; Chardon, Fabien

    2011-03-01

    Nineteen Arabidopsis accessions grown at low (LOW N) and high (HIGH N) nitrate supplies were labelled using (15)N to trace nitrogen remobilization to the seeds. Effects of genotype and nutrition were examined. Nitrate availability affected biomass and yield, and highly modified the nitrogen concentration in the dry remains. Surprisingly, variations of one-seed dry weight (DW(1S)) and harvest index (HI) were poorly affected by nutrition. Nitrogen harvest index (NHI) was highly correlated with HI and showed that nitrogen use efficiency (NUE) was increased at LOW N. Nitrogen remobilization efficiency (NRE), as (15)N partitioning in seeds ((15)NHI), was also higher at LOW N. The relative specific abundance (RSA) in seeds and whole plants indicated that the (14)NO(3) absorbed post-labelling was mainly allocated to the seeds (SEEDS) at LOW N, but to the dry remains (DR) at HIGH N. Nitrogen concentration (N%) in the DR was then 4-fold higher at HIGH N compared with LOW N, whilst N% in seeds was poorly modified. Although NHI and (15)NHI were highly correlated to HI, significant variations in NUE and NRE were identified using normalization to HI. New insights provided in this report are helpful for the comprehension of NUE and NRE concepts in Arabidopsis as well as in crops and especially in Brassica napus. PMID:21273332

  2. Seasonal Variation in Seed Dispersal by Tamarins Alters Seed Rain in a Secondary Rain Forest

    PubMed Central

    Muñoz Lazo, Fernando Julio João; Huynen, Marie-Claude; Poncin, Pascal; Heymann, Eckhard W.

    2010-01-01

    Reduced dispersal of large seeds into degraded areas is one of the major factors limiting rain forest regeneration, as many seed dispersers capable of transporting large seeds avoid these sites with a limited forest cover. However, the small size of tamarins allows them to use small trees, and hence to disperse seeds into young secondary forests. Seasonal variations in diet and home range use might modify their contribution to forest regeneration through an impact on the seed rain. For a 2-yr period, we followed a mixed-species group of tamarins in Peru to determine how their role as seed dispersers in a 9-yr-old secondary-growth forest varied across seasons. These tamarins dispersed small to large seeds of 166 tree species, 63 of which were into a degraded area. Tamarins’ efficiency in dispersing seeds from primary to secondary forest varied across seasons. During the late wet season, high dietary diversity and long forays in secondary forest allowed them to disperse large seeds involved in later stages of regeneration. This occurred precisely when tamarins spent a more equal amount of time eating a high diversity of fruit species in primary forest and pioneer species in secondary forest. We hypothesized that well-balanced fruit availability induced the movement of seed dispersers between these 2 habitats. The noteworthy number of large-seeded plant species dispersed by such small primates suggests that tamarins play an important, but previously neglected, role in the regeneration and maintenance of forest structure. Electronic supplementary material The online version of this article (doi:10.1007/s10764-010-9413-7) contains supplementary material, which is available to authorized users. PMID:20651905

  3. Seed-specific silencing of OsMRP5 reduces seed phytic acid and weight in rice.

    PubMed

    Li, Wen-Xu; Zhao, Hai-Jun; Pang, Wei-Qin; Cui, Hai-Rui; Poirier, Yves; Shu, Qing-Yao

    2014-08-01

    Phytic acid (PA) is poorly digested by humans and monogastric animals and negatively affects human/animal nutrition and the environment. Rice mutants with reduced PA content have been developed but are often associated with reduced seed weight and viability, lacking breeding value. In the present study, a new approach was explored to reduce seed PA while attaining competitive yield. The OsMRP5 gene, of which mutations are known to reduce seed PA as well as seed yield and viability, was down-regulated specifically in rice seeds by using an artificial microRNA driven by the rice seed specific promoter Ole18. Seed PA contents were reduced by 35.8-71.9% in brown rice grains of transgenic plants compared to their respective null plants (non-transgenic plants derived from the same event). No consistent significant differences of plant height or number of tillers per plant were observed, but significantly lower seed weights (up to 17.8% reduction) were detected in all transgenic lines compared to null plants, accompanied by reductions of seed germination and seedling emergence. It was observed that the silencing of the OsMRP5 gene increased the inorganic P (Pi) levels (up to 7.5 times) in amounts more than the reduction of PA-P in brown rice. This indicates a reduction in P content in other cellular compounds, such as lipids and nucleic acids, which may affect overall seed development. Put together, the present study demonstrated that seed specific silencing of OsMRP5 could significantly reduce the PA content and increase Pi levels in seeds; however, it also significantly lowers seed weight in rice. Discussions were made regarding future directions towards producing agronomically competitive and nutritionally valuable low PA rice. PMID:24648215

  4. Genetic mapping and confirmation of quantitative trait loci for seed protein and oil contents and seed weight in soybean

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Demand for soybean [Glycine max (L.) Merr.] meal has increased worldwide and soybean importers often offer premiums for soybean containing higher contents of protein and oil. Objectives were to detect quantitative trait loci (QTL) associated with soybean seed protein, oil, and seed weight in a soyb...

  5. Heritability of seed weight in Maritime pine, a relevant trait in the transmission of environmental maternal effects

    PubMed Central

    Zas, R; Sampedro, L

    2015-01-01

    Quantitative seed provisioning is an important life-history trait with strong effects on offspring phenotype and fitness. As for any other trait, heritability estimates are vital for understanding its evolutionary dynamics. However, being a trait in between two generations, estimating additive genetic variation of seed provisioning requires complex quantitative genetic approaches for distinguishing between true genetic and environmental maternal effects. Here, using Maritime pine as a long-lived plant model, we quantified additive genetic variation of cone and seed weight (SW) mean and SW within-individual variation. We used a powerful approach combining both half-sib analysis and parent–offspring regression using several common garden tests established in contrasting environments to separate G, E and G × E effects. Both cone weight and SW mean showed significant genetic variation but were also influenced by the maternal environment. Most of the large variation in SW mean was attributable to additive genetic effects (h2=0.55–0.74). SW showed no apparent G × E interaction, particularly when accounting for cone weight covariation, suggesting that the maternal genotypes actively control the SW mean irrespective of the amount of resources allocated to cones. Within-individual variation in SW was low (12%) relative to between-individual variation (88%), and showed no genetic variation but was largely affected by the maternal environment, with greater variation in the less favourable sites for pine growth. In summary, results were very consistent between the parental and the offspring common garden tests, and clearly indicated heritable genetic variation for SW mean but not for within-individual variation in SW. PMID:25160045

  6. Geographic variations in seed dispersal by ants: are plant and seed traits decisive?

    PubMed

    Boulay, R; Coll-Toledano, J; Manzaneda, A J; Cerdá, X

    2007-03-01

    The effect of local ant species on the dispersal success of a myrmecochorous plant, Helleborus foetidus, was analyzed in two populations of the Iberian Peninsula (Caurel and Cazorla, respectively). The contribution of the various local ant species to dispersal was very unequal. While 5 and 19 ant taxa visited the plants of Caurel and Cazorla, respectively, most removal activity (67 and 80%) was performed by two species only (Formica lugubris and Camponotus cruentatus, respectively). Visits by dispersers were also unequally distributed between neighboring plants. While some plants were always visited during the period of seed release, others were never visited. A regression model indicated that this pattern might be explained by two plant traits: ants preferred to visit plants that released more seeds and whose elaiosomes were richer in oleic acid. Although it has long been known that this compound triggers removal by ants, it is the first demonstration that quantitative variations in elaiosome traits contribute to variation in dispersal success. Finally, other variables being equal, morphological traits (seed size, elaiosome size, and elaiosome/seed size ratio) did not affect ant behavior. Although myrmecochory has long been considered a diffuse interaction, our results support the idea that, at local scale, a limited number of ant species may be decisive to its evolution. PMID:17119907

  7. Geographic variations in seed dispersal by ants: are plant and seed traits decisive?

    NASA Astrophysics Data System (ADS)

    Boulay, R.; Coll-Toledano, J.; Manzaneda, A. J.; Cerdá, X.

    2007-03-01

    The effect of local ant species on the dispersal success of a myrmecochorous plant, Helleborus foetidus, was analyzed in two populations of the Iberian Peninsula (Caurel and Cazorla, respectively). The contribution of the various local ant species to dispersal was very unequal. While 5 and 19 ant taxa visited the plants of Caurel and Cazorla, respectively, most removal activity (67 and 80%) was performed by two species only (Formica lugubris and Camponotus cruentatus, respectively). Visits by dispersers were also unequally distributed between neighboring plants. While some plants were always visited during the period of seed release, others were never visited. A regression model indicated that this pattern might be explained by two plant traits: ants preferred to visit plants that released more seeds and whose elaiosomes were richer in oleic acid. Although it has long been known that this compound triggers removal by ants, it is the first demonstration that quantitative variations in elaiosome traits contribute to variation in dispersal success. Finally, other variables being equal, morphological traits (seed size, elaiosome size, and elaiosome/seed size ratio) did not affect ant behavior. Although myrmecochory has long been considered a diffuse interaction, our results support the idea that, at local scale, a limited number of ant species may be decisive to its evolution.

  8. Sequence variations in the FAD2 gene in seeded pumpkins.

    PubMed

    Ge, Y; Chang, Y; Xu, W L; Cui, C S; Qu, S P

    2015-01-01

    Seeded pumpkins are important economic crops; the seeds contain various unsaturated fatty acids, such as oleic acid and linoleic acid, which are crucial for human and animal nutrition. The fatty acid desaturase-2 (FAD2) gene encodes delta-12 desaturase, which converts oleic acid to linoleic acid. However, little is known about sequence variations in FAD2 in seeded pumpkins. Twenty-seven FAD2 clones from 27 accessions of Cucurbita moschata, Cucurbita maxima, Cucurbita pepo, and Cucurbita ficifolia were obtained (totally 1152 bp; a single gene without introns). More than 90% nucleotide identities were detected among the 27 FAD2 clones. Nucleotide substitution, rather than nucleotide insertion and deletion, led to sequence polymorphism in the 27 FAD2 clones. Furthermore, the 27 FAD2 selected clones all encoded the FAD2 enzyme (delta-12 desaturase) with amino acid sequence identities from 91.7 to 100% for 384 amino acids. The same main-function domain between 47 and 329 amino acids was identified. The four species clustered separately based on differences in the sequences that were identified using the unweighted pair group method with arithmetic mean. Geographic origin and species were found to be closely related to sequence variation in FAD2. PMID:26782391

  9. An automated intensity-weighted brachytherapy seed localization algorithm

    SciTech Connect

    Whitehead, Gregory; Chang Zheng; Ji, Jim

    2008-03-15

    Brachytherapy has proven to be an effective treatment for various forms of cancer, whereby radioactive material is inserted directly into the body to maximize dosage to malignant tumors while preserving healthy tissue. In order to validate the preoperative or intraoperative dosimetric model, a postimplant evaluation procedure is needed to ensure that the locations of the implanted seeds are consistent with the planning stage. Moreover, development of an automated algorithm for seed detection and localization is necessary to expedite the postimplant evaluation process and reduce human error. Most previously reported algorithms have performed binary transforms on images before attempting to localize seeds. Furthermore, traditional approaches based upon three-dimensional seed shape parameterization and matching require high resolution imaging. The authors propose a new computationally efficient algorithm for automatic seed localization for full three-dimensional, low-resolution data sets that directly applies voxel intensity to the estimation of both seed centroid location and angular seed orientation. Computer simulations, phantom studies, and in vivo computed tomography prostate seed imaging results show that the proposed algorithm can produce reliable results even for low-resolution images.

  10. Assessment of Variation in Seed Longevity within Rye, Wheat and the Intergeneric Hybrid Triticale

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Understanding the mechanisms by which seeds deteriorate in storage and the genetic and environmental factors that modify seed aging rates require reliable measurement of the seed longevity phenotype and good estimates of within-species variation. To that end, this study compares seed longevity amo...

  11. Seed predation and climate impacts on reproductive variation in temperate forests of the southeastern USA.

    PubMed

    Bell, David M; Clark, James S

    2016-04-01

    Climatic effects on tree recruitment will be determined by the interactive effects of fecundity and seed predation. Evaluating how insect and vertebrate seed predators mediate tree reproductive responses to climate depends on long-term studies of seed production, development, and predation. In this study, our objectives were to (1) assess the effects of interannual climate variation on seed abortion rates, (2) assess the impact of seed density on predation rates, and (3) examine the degree to which density-dependent seed predation would amplify or dampen interannual variation in fecundity associated with seed abortion. We used a 19-year study of seed abortion and pre-dispersal predation rates by insects and vertebrates (birds and rodents) for five temperate tree species across forest plots from the North Carolina Piedmont to the Southern Appalachian Mountains in the southeastern USA. We found that rates of seed abortion and predation increased reproductive variation for oaks (Quercus species). Probability of seed abortion was greatest during years with cool, dry springs. Responses of seed predation on Quercus species to current year's seed density varied by species, but exhibited positive density-dependence to previous year's seed density consistent with numerical responses of seed predators. Seed abortion and predation rates for two drupe species responded little to variation in climate or seed density, respectively. Given that predation increased interannual variation in seed availability and the negative density-dependence to previous year's seed density, our results indicate that consistent numerical responses of oak seed predators may amplify interannual variation due to climate-mediated processes like seed abortion. PMID:26747267

  12. Wide genetic variation in phenolic compound content of seed coats among black soybean cultivars

    PubMed Central

    Phommalath, Siviengkhek; Teraishi, Masayoshi; Yoshikawa, Takanori; Saito, Hiroki; Tsukiyama, Takuji; Nakazaki, Tetsuya; Tanisaka, Takatoshi; Okumoto, Yutaka

    2014-01-01

    Black soybeans have been used as a food source and also in traditional medicine because their seed coats contain natural phenolic compounds such as proanthocyanidin and anthocyanin. The objective of this research is to reveal the genetic variation in the phenolic compound contents (PCCs) of seed coats in 227 black soybean cultivars, most of which were Japanese landraces and cultivars. Total phenolics were extracted from seed coats using an acidic acetone reagent and the proanthocyanidin content, monomeric anthocyanin content, total flavonoids content, total phenolics content, and radical scavenging activity were measured. The cultivars showed wide genetic variation in PCCs. Each of the contents was highly correlated with one another, and was closely associated with radical scavenging activity. PCCs were also moderately associated by flowering date but not associated by seed weight. Cultivars with purple flowers had a tendency to produce higher PCCs compared with cultivars with white flowers, suggesting that the W1 locus for flower color can affect phenolic compound composition and content. Our results suggest that developing black soybean cultivars with high functional phenolic compounds activity is feasible. PMID:25914597

  13. Do key dimensions of seed and seedling functional trait variation capture variation in recruitment probability?

    PubMed

    Larson, Julie E; Sheley, Roger L; Hardegree, Stuart P; Doescher, Paul S; James, Jeremy J

    2016-05-01

    Seedling recruitment is a critical driver of population dynamics and community assembly, yet we know little about functional traits that define different recruitment strategies. For the first time, we examined whether trait relatedness across germination and seedling stages allows the identification of general recruitment strategies which share core functional attributes and also correspond to recruitment outcomes in applied settings. We measured six seed and eight seedling traits (lab- and field-collected, respectively) for 47 varieties of dryland grasses and used principal component analysis (PCA) and cluster analysis to identify major dimensions of trait variation and to isolate trait-based recruitment groups, respectively. PCA highlighted some links between seed and seedling traits, suggesting that relative growth rate and root elongation rate are simultaneously but independently associated with seed mass and initial root mass (first axis), and with leaf dry matter content, specific leaf area, coleoptile tissue density and germination rate (second axis). Third and fourth axes captured separate tradeoffs between hydrothermal time and base water potential for germination, and between specific root length and root mass ratio, respectively. Cluster analysis separated six recruitment types along dimensions of germination and growth rates, but classifications did not correspond to patterns of germination, emergence or recruitment in the field under either of two watering treatments. Thus, while we have begun to identify major threads of functional variation across seed and seedling stages, our understanding of how this variation influences demographic processes-particularly germination and emergence-remains a key gap in functional ecology. PMID:26337610

  14. Genetic variation and seed transfer guidelines for lodgepole pine in Central Oregon. Forest Service research paper

    SciTech Connect

    Sorensen, F.C.

    1992-09-01

    Pine cones were collected from 272 trees at 189 locations uniformly distributed over the east slopes of the Oregon Cascade Range and Warner Mountains. Variation in seed and seedling traits was related to (1) seed source latitude, distance from the Cascade crest, elevation, slope, and aspect in multiple regression analyses; and (2) seed zone and elevation band in classification analyses. Provisional seed transfer guidelines are presented. These include a regression equation for guiding seed transfer and estimating transfer risk, and a new outline of fixed seed zones.

  15. Genetic variation and seed transfer guidelines for ponderosa pine in central Oregon. Forest Service research paper

    SciTech Connect

    Sorensen, F.C.

    1994-07-01

    The report includes an adaptive genetic variation in seed and seedling traits for ponderosa pine from the east slopes of the Cascade Range in Oregon which was analyzed by using 307 families from 227 locations. Factor scores from three principal components based on seed and seedling traits were related by multiple regression to latitude, distance from the Cascade crest, elevation, slope, and aspect of the seed sources and by classification analysis to seed zone and 300-meter elevation band within zone. A provisional transfer risk equation and tentative new seed zones were delineated to guide seed transfer in artificial regeneration.

  16. Progress on screening the USDA cultivated peanut germplasm collection for variability in seed weight, seed-coat color, oil content and fatty acid composition

    Technology Transfer Automated Retrieval System (TEKTRAN)

    There are over 10,000 accessions in the USDA peanut germplasm collection. Among them, 8,913 accessions are cultivated peanuts. To determine the variability of seed traits, we initiated a study to observe seed-coat color, measure seed weight, and quantify oil content and fatty acid composition by nuc...

  17. Patterns of Cross-Continental Variation in Tree Seed Mass in the Canadian Boreal Forest

    PubMed Central

    Liu, Jushan; Bai, Yuguang; Lamb, Eric G.; Simpson, Dale; Liu, Guofang; Wei, Yongsheng; Wang, Deli; McKenney, Daniel W.; Papadopol, Pia

    2013-01-01

    Seed mass is an adaptive trait affecting species distribution, population dynamics and community structure. In widely distributed species, variation in seed mass may reflect both genetic adaptation to local environments and adaptive phenotypic plasticity. Acknowledging the difficulty in separating these two aspects, we examined the causal relationships determining seed mass variation to better understand adaptability and/or plasticity of selected tree species to spatial/climatic variation. A total of 504, 481 and 454 seed collections of black spruce (Picea mariana (Mill.) B.S.P.), white spruce (Picea glauca (Moench) Voss) and jack pine (Pinus banksiana Lamb) across the Canadian Boreal Forest, respectively, were selected. Correlation analyses were used to determine how seed mass vary with latitude, longitude, and altitude. Structural Equation Modeling was used to examine how geographic and climatic variables influence seed mass. Climatic factors explained a large portion of the variation in seed mass (34, 14 and 29%, for black spruce, white spruce and jack pine, respectively), indicating species-specific adaptation to long term climate conditions. Higher annual mean temperature and winter precipitation caused greater seed mass in black spruce, but annual precipitation was the controlling factor for white spruce. The combination of factors such as growing season temperature and evapotranspiration, temperature seasonality and annual precipitation together determined seed mass of jack pine. Overall, sites with higher winter temperatures were correlated with larger seeds. Thus, long-term climatic conditions, at least in part, determined spatial variation in seed mass. Black spruce and Jack pine, species with relatively more specific habitat requirements and less plasticity, had more variation in seed mass explained by climate than did the more plastic species white spruce. As traits such as seed mass are related to seedling growth and survival, they potentially

  18. Quantitative Genetics of Transgenic Mice: Components of Phenotypic Variation in Body Weights and Weight Gains

    PubMed Central

    Clutter, A. C.; Pomp, D.; Murray, J. D.

    1996-01-01

    Transgenic mice possessing an ovine growth hormone gene were used to study the effects of elevated growth hormone on quantitative genetic variation. Males hemizygous for the transgene were mated to wild-type females to produce half- and full-sib families in which approximately half the progeny were transgenic and half were wild type. Analyses of body weights at 3-10 weeks, and weight gains from 3 to 6, and 6 to 10 weeks produced estimates of the proportion of total variance due to additive genetic effects (h(2)) and common litter effects (c(2)), and the genetic correlation between transgenic and wild-type expression of each trait. At 10 weeks, body weight of transgenics exceeded that of wild types by 26 and 49% in males and females, respectively. Estimated genetic variances in the transgenic group were significantly greater than zero for body weights at most ages and for both measurements of gain. Common litter effects accounted for a similar proportion of variation in the wild-type and transgenic groups. Additive genetic correlations between wild-type and transgenic expression of body weights tended to decline with age, indicating that a partially different array of genes may have begun to affect body weight in the transgenic group. PMID:8844161

  19. Extensive Natural Variation in Arabidopsis Seed Mucilage Structure

    PubMed Central

    Voiniciuc, Cătălin; Zimmermann, Eva; Schmidt, Maximilian Heinrich-Wilhelm; Günl, Markus; Fu, Lanbao; North, Helen M.; Usadel, Björn

    2016-01-01

    Hydrated Arabidopsis thaliana seeds are coated by a gelatinous layer called mucilage, which is mainly composed of cell wall polysaccharides. Since mucilage is rich in pectin, its architecture can be visualized with the ruthenium red (RR) dye. We screened the seeds of around 280 Arabidopsis natural accessions for variation in mucilage structure, and identified a large number of novel variants that differed from the Col-0 wild-type. Most of the accessions released smaller RR-stained capsules compared to the Col-0 reference. By biochemically characterizing the phenotypes of 25 of these accessions in greater detail, we discovered that distinct changes in polysaccharide structure resulted in gelatinous coatings with a deceptively similar appearance. Monosaccharide composition analysis of total mucilage extracts revealed a remarkable variation (from 50 to 200% of Col-0 levels) in the content of galactose and mannose, which are important subunits of heteromannan. In addition, most of the natural variants had altered Pontamine Fast Scarlet 4B staining of cellulose and significantly reduced birefringence of crystalline structures. This indicates that the production or organization of cellulose may be affected by the presence of different amounts of hemicellulose. Although, the accessions described in this study were primarily collected from Western Europe, they form five different phenotypic classes based on the combined results of our experiments. This suggests that polymorphisms at multiple loci are likely responsible for the observed mucilage structure. The transcription of MUCILAGE-RELATED10 (MUCI10), which encodes a key enzyme for galactoglucomannan synthesis, was severely reduced in multiple variants that phenocopied the muci10-1 insertion mutant. Although, we could not pinpoint any causal polymorphisms in this gene, constitutive expression of fluorescently-tagged MUCI10 proteins complemented the mucilage defects of a muci10-like accession. This leads us to

  20. Variation in semi-arid soil seed banks

    SciTech Connect

    Boudell-Flanary, J.A.; Link, S.O. |

    1995-09-01

    Seeds recovered from soils in the semi-arid shrub-steppe were compared to test for differences between the seed banks found beneath and cryptogamic crust and the crevices in the crust. Seed quantity found within the crevices was 56% higher than that under the cryptogamic crust. Pseudoroegneria spicata, Poa sandbergii, Bromus tectorum, and Artemisia tridentata are the common species found at the research site. Seeds of Bromus tectorum, Erigeron spp., and Poa spp. were found in the crevices of the crust. Seeds of Artemisia tridentata were not found in the seed banks of either the cryptogamic crust or the crevices in the crust. The higher amount of seeds found in the crevices of the cryptogamic crust suggests that the crevices play a significant role in determining the distributional pattern of shrub-steppe vegetation.

  1. Seed weight increases with altitude in the Swiss Alps between related species but not among populations of individual species.

    PubMed

    Pluess, Andrea R; Schütz, Wolfgang; Stöcklin, Jürg

    2005-06-01

    Seed weight is a crucial plant life history trait, determining establishment success and dispersal ability. Especially in stressful environments, larger seeds may be selected at the expense of seed number, because larger seeds have a better chance of giving rise to an established offspring. We tested the hypotheses that between related species-pairs and among populations of single species a similar trend for increasing seed weight with increasing altitude should be present. Firstly, we measured seed weights from 29 species-pairs, with one species occurring in lowland areas and a congeneric species from high altitudes. Seeds of the alpine species were 28+/-8% larger than seeds from lowland species (P < 0.01). Compared to the related lowland species, 55% of the alpine species had heavier seeds, 3% (one species) had lighter, and 41% had seeds of approximately equal weight. Secondly, we compared seed weights among populations of four species from different habitats and with different life histories. Seeds from between 11 and 34 populations per species were sampled along altitudinal gradients of 800-1,500 m (ca. 800 m in Scabiosa lucida, ca. 1,000 m in Saxifraga oppositifolia, ca. 1,000 m in Epilobium fleischeri, and ca. 1,500 m in Carex flacca). In all the four species, we found no indication for heavier seeds at higher altitudes. Our results indicate a selection pressure for species with heavier seeds at higher altitude, but the trend does not seem to operate across all cases. Phylogenetic constraints may limit the correlation among altitude and seed weight, operating particularly against selection for larger seed size, the closer populations and species are related to each other. PMID:15800741

  2. Low molecular weight squash trypsin inhibitors from Sechium edule seeds.

    PubMed

    Laure, Hélen J; Faça, Vítor M; Izumi, Clarice; Padovan, Júlio C; Greene, Lewis J

    2006-02-01

    Nine chromatographic components containing trypsin inhibitor activity were isolated from Sechium edule seeds by acetone fractionation, gel filtration, affinity chromatography and RP-HPLC in an overall yield of 46% of activity and 0.05% of protein. The components obtained with highest yield of total activity and highest specific activity were sequenced by Edman degradation and their molecular masses determined by mass spectrometry. The inhibitors contained 31, 32 and 27 residues per molecule and their sequences were: SETI-IIa, EDRKCPKILMRCKRDSDCLAKCTCQESGYCG; SETI-IIb, EEDRKCPKILMRCKRDSDCLAKCTCQESGYCG and SETI-V, CPRILMKCKLDTDCFPTCTCRPSGFCG. SETI-IIa and SETI-IIb, which differed by an amino-terminal E in the IIb form, were not separable under the conditions employed. The sequences are consistent with consensus sequences obtained from 37 other inhibitors: CPriI1meCk_DSDCla_C_C_G_CG, where capital letters are invariant amino acid residues and lower case letters are the most preserved in this position. SETI-II and SETI-V form complexes with trypsin with a 1:1 stoichiometry and have dissociation constants of 5.4x10(-11)M and 1.1x10(-9)M, respectively. PMID:16406091

  3. Mating system and seed variation of Acacia hybrid (A. mangium x A. auriculiformis).

    PubMed

    Ng, Chin-Hong; Lee, Soon-Leong; Ng, Kevin Kit-Siong; Muhammad, Norwati; Ratnam, Wickneswari

    2009-04-01

    The mating system and seed variation of Acacia hybrid (A. mangium x A. auriculiformis) were studied using allozymes and random amplified polymorphic DNA (RAPD) markers, respectively. Multi-locus outcrossing rate estimations indicated that the hybrid was predominantly outcrossed (mean+/- s.e. t(m) = 0.86+/-0.01). Seed variation was investigated using 35 polymorphic RAPD fragments. An analysis of molecular variance (AMOVA) revealed the highest genetic variation among seeds within a pod (66%-70%), followed by among pods within inflorescence (29%-37%), and the least variation among inflorescences within tree (1%). In addition, two to four RAPD profiles could be detected among seeds within pod. Therefore, the results suggest that a maximum of four seeds per pod could be sampled for the establishment of a mapping population for further studies. PMID:19417541

  4. Evolution and association analysis of GmCYP78A10 gene with seed size/weight and pod number in soybean.

    PubMed

    Wang, Xiaobo; Li, Yinhui; Zhang, Haowei; Sun, Genlou; Zhang, Wenming; Qiu, Lijuan

    2015-02-01

    Seed-size/weight traits, controlled by multiple genes in soybean, play an important role in determining seed yield. However, the molecular mechanisms controlling the seed size and weight in soybean remain unclear. In Arabidopsis, P450/CYP78A gene family has been proved extremely relevant to seed size (such as AtCYP78A5, AtCYP78A6 and AtCYP78A9). We found that a soybean GmCYP78A10 gene underwent artificial selection during soybean breeding. The GmCYP78A10a allele mainly distributed in wild soybean (Glycine soja), but has been eliminated in the cultivars during early stage of soybean breeding, while the GmCYP78A10b allele has been accumulated and become the predominant allele in cultivated soybean (G. max). ANOVA analysis showed that the mean seed weight, seed width and seed thickness of soybean varieties with GmCYP78A10b allele was significantly heavier/bigger than those with GmCYP78A10a allele (P < 0.01). The allele could explain 7.2 % variation in seed weight. The pod number of the soybeans with GmCYP78A10b allele significantly decreased compared to those with GmCYP78A10a allele (P < 0.01, R(2) = 5.8 %), while other agronomic traits including seed weight/plant were not significantly affected by these two alleles. We speculated that during the early stage of soybean breeding, breeders selected big seed carrying GmCYP78A10b allele, but lowered pod number simultaneously. Overall, the selection did not cause the significantly change in soybean seed yield. Our results suggests that the soybean GmCYP78A10 gene may have a similar function to those genes belonging to P450/CYP78A subfamily in Arabidopsis and provides new information for the genetic control of seed size in soybean. PMID:25324172

  5. Effects of seed traits variation on seedling performance of the invasive weed, Ambrosia artemisiifolia L.

    NASA Astrophysics Data System (ADS)

    Ortmans, William; Mahy, Grégory; Monty, Arnaud

    2016-02-01

    Seedling performance can determine the survival of a juvenile plant and impact adult plant performance. Understanding the factors that may impact seedling performance is thus critical, especially for annuals, opportunists or invasive plant species. Seedling performance can vary among mothers or populations in response to environmental conditions or under the influence of seed traits. However, very few studies have investigated seed traits variations and their consequences on seedling performance. Specifically, the following questions have been addressed by this work: 1) How the seed traits of the invasive Ambrosia artemisiifolia L. vary among mothers and populations, as well as along the latitude; 2) How do seed traits influence seedling performance; 3) Is the influence on seedlings temperature dependent. With seeds from nine Western Europe ruderal populations, seed traits that can influence seedling development were measured. The seeds were sown into growth chambers with warmer or colder temperature treatments. During seedling growth, performance-related traits were measured. A high variability in seed traits was highlighted. Variation was determined by the mother identity and population, but not latitude. Together, the temperature, population and the identity of the mother had an effect on seedling performance. Seed traits had a relative impact on seedling performance, but this did not appear to be temperature dependent. Seedling performance exhibited a strong plastic response to the temperature, was shaped by the identity of the mother and the population, and was influenced by a number of seed traits.

  6. Variations of Weight Loss Following Gastric Bypass and Gastric Band

    PubMed Central

    Puzziferri, Nancy; Nakonezny, Paul A.; Livingston, Edward H.; Carmody, Thomas J.; Provost, David A.; Rush, A. John

    2016-01-01

    Objective To compare and describe the weight loss outcomes from gastric bypass and gastric band so as to define the variation of excess weight loss (EWL) among individual patients, the time to onset of effect, and the durability of weight loss in severely obese adults. Summary Background Data Gastric bypass and gastric band are the most common operations for obesity performed in the United States, but few reports have compared these 2 procedures. Methods Patients (N = 1733, aged 18–65 years) met National Institutes of Health criteria for obesity surgery and underwent either gastric bypass or gastric band between March 1997 and November 2006. The selection of bypass versus band was based on patient/surgeon discussion. The evaluable sample consisted of 1518 patients. The percentage of EWL was assessed over 2 years. Successful weight loss was defined a priori as ≥40% EWL in each of four 6-month postoperative measurement periods. The analyses included a mixed model and generalized estimating equation (GEE) model with repeated measures. Odds ratios and descriptive analyses were also provided. Results Gastric bypass was associated with less individual variation in weight loss than gastric band. Both procedures were associated with a significant EWL benefit (Treatment Group effect P < 0.0001), but they differed in terms of time to effect (Treatment Group × Period interaction effect P < 0.0001). The mean EWL for gastric bypass was greater at each measurement period (6, 12, 18, 24 months) compared with gastric band (P < 0.0001). Furthermore, at each of the postoperative measurement periods within each treatment group (bypass and band), the mean EWL was greater for those who had preoperative body mass index (BMI) ≤50 kg/m2 than for those who had preoperative BMI >50 kg/m2 (P < 0.0001). Gastric bypass was consistently associated with a greater likelihood of at least a 40% EWL in each of the 6-month postoperative measurement periods (GEE, P < 0.0001). The odds ratio

  7. Hierarchical Levels of Seed Predation Variation by Introduced Beetles on an Endemic Mediterranean Palm

    PubMed Central

    Rodríguez, Marta; Delibes, Miguel; Fedriani, José Mª.

    2014-01-01

    Seed predators can limit plant recruitment and thus profoundly impinge the dynamics of plant populations, especially when diverse seed predators (e.g., native and introduced) attack particular plant populations. Surprisingly, however, we know little concerning the potential hierarchy of spatial scales (e.g., region, population, patch) and coupled ecological correlates governing variation in the overall impact that native and introduced seed predators have on plant populations. We investigated several spatial scales and ecological correlates of pre-dispersal seed predation by invasive borer beetles in Chamaerops humilis (Arecaceae), a charismatic endemic palm of the Mediteranean basin. To this end, we considered 13 palm populations (115 palms) within four geographical regions of the Iberian Peninsula. The observed interregional differences in percentages of seed predation by invasive beetles were not significant likely because of considerable variation among populations within regions. Among population variation in seed predation was largely related to level of human impact. In general, levels of seed predation were several folds higher in human-altered populations than in natural populations. Within populations, seed predation declined significantly with the increase in amount of persisting fruit pulp, which acted as a barrier against seed predators. Our results revealed that a native species (a palm) is affected by the introduction of related species because of the concurrent introduction of seed predators that feed on both the introduced and native palms. We also show how the impact of invasive seed predators on plants can vary across a hierarchy of levels ranging from variation among individuals within local populations to large scale regional divergences. PMID:25340462

  8. Variation in Weed Seed Fate Fed to Different Holstein Cattle Groups

    PubMed Central

    Mesgaran, Mohsen Beheshtian

    2016-01-01

    Weed seeds may maintain their viability when passing through the digestive tract of cattle and can be therefore dispersed by animal movement or the application of manure. Whether different cattle types of the same species can cause differential weed seed fate is largely unknown to us particularly under non-grazed systems similar to Holstein-Friesian dairy farming. We investigated the effect on the seed survival of four weed species in the digestive tracts of four groups of Holstein cattle: lactating cows, feedlot male calves, dry cows and growing heifers. The weed species used were Cuscuta campestris, Polygonum aviculare, Rumex crispus and Sorghum halepense. Cattle excretion was sampled for recovery and viability of seeds at four 24 hourly intervals after seed intake. The highest seed recovery occurred two days after seed intake in all cattle groups. Averaged over weed species, dry and lactating cows had the lowest and highest seed recovery of 36.4% and 74.4% respectively. No significant differences were observed in seed recovery of the four weed species when their seeds were fed to dry cows. Based on a power model fitted to seed viability data, the estimated time to 50% viability loss after seed intake, over all cattle groups ranged from 65 h (R. crispus) to 76 h (P. aviculare). Recovered seeds from the dung of feedlot male calves showed the highest mortality among cattle groups. Significant correlation was found between seed viability and ruminal pH (r = 0.86; P<0.05). This study shows that management programs aiming to minimize weed infestation caused by livestock should account for the variation amongst cattle groups in seed persistence. Our findings can be used as a guideline for evaluating the potential risk of the spread of weeds via the application of cattle manure. PMID:27104783

  9. Variation in Weed Seed Fate Fed to Different Holstein Cattle Groups.

    PubMed

    Rahimi, Salman; Mashhadi, Hamid Rahimian; Banadaky, Mehdi Dehghan; Mesgaran, Mohsen Beheshtian

    2016-01-01

    Weed seeds may maintain their viability when passing through the digestive tract of cattle and can be therefore dispersed by animal movement or the application of manure. Whether different cattle types of the same species can cause differential weed seed fate is largely unknown to us particularly under non-grazed systems similar to Holstein-Friesian dairy farming. We investigated the effect on the seed survival of four weed species in the digestive tracts of four groups of Holstein cattle: lactating cows, feedlot male calves, dry cows and growing heifers. The weed species used were Cuscuta campestris, Polygonum aviculare, Rumex crispus and Sorghum halepense. Cattle excretion was sampled for recovery and viability of seeds at four 24 hourly intervals after seed intake. The highest seed recovery occurred two days after seed intake in all cattle groups. Averaged over weed species, dry and lactating cows had the lowest and highest seed recovery of 36.4% and 74.4% respectively. No significant differences were observed in seed recovery of the four weed species when their seeds were fed to dry cows. Based on a power model fitted to seed viability data, the estimated time to 50% viability loss after seed intake, over all cattle groups ranged from 65 h (R. crispus) to 76 h (P. aviculare). Recovered seeds from the dung of feedlot male calves showed the highest mortality among cattle groups. Significant correlation was found between seed viability and ruminal pH (r = 0.86; P<0.05). This study shows that management programs aiming to minimize weed infestation caused by livestock should account for the variation amongst cattle groups in seed persistence. Our findings can be used as a guideline for evaluating the potential risk of the spread of weeds via the application of cattle manure. PMID:27104783

  10. Cytometrical evidence that the lossof seed weight in the minature 1 seed mutant of maize associated with reduced mitotic activity in the developing endosperm

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The miniature1 (mn1) seed mutant is the most drastic nonlethal single gene mutation wherein the mutants loose >70% of the seed weight relative to the wild type. The causal basis of it is the loss of the Mn1-encoded cell wall invertase in developing endosperm (Plant Cell 4:297-305 and 8:971-83). We r...

  11. Seed yield, development, and variation in diverse poa pratensis accessions

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Post harvest residue removal is critical for continued high seed production of Kentucky bluegrass (Poa pratensis L.). Previous work showed some accessions have little or no yield reduction with mechanical residue removal compared with the controversial practice of open field burning. Using 10 of t...

  12. Construction of a Genetic Linkage Map and Identification of QTLs for Seed Weight and Seed Size Traits in Lentil (Lens culinaris Medik.).

    PubMed

    Verma, Priyanka; Goyal, Richa; Chahota, R K; Sharma, Tilak R; Abdin, M Z; Bhatia, Sabhyata

    2015-01-01

    Seed weight and seed size both are quantitative traits and have been considered as important components of grain yield, thus identification of quantitative trait loci (QTL) for seed traits in lentil (Lens culinaris) would be beneficial for the improvement of grain yield. Hence the main objective of this study was to identify QTLs for seed traits using an intraspecific mapping population derived from a cross between L. culinaris cv. Precoz (seed weight-5.1g, seed size-5.7mm) and L. culinaris cv. L830 (seed weight-2.2g, seed size-4mm) comprising 126 F8-RILs. For this, two microsatellite genomic libraries enriched for (GA/CT) and (GAA/CTT) motif were constructed which resulted in the development of 501 new genomic SSR markers. Six hundred forty seven SSR markers (including 146 previously published) were screened for parental polymorphism and 219 (33.8%) were found to be polymorphic among the parents. Of these 216 were mapped on seven linkage groups at LOD4.0 spanning 1183.7cM with an average marker density of 5.48cM. Phenotypic data from the RILs was used to identify QTLs for the seed weight and seed size traits by single marker analysis (SMA) followed by composite interval mapping (CIM) which resulted in one QTL each for the 2 traits (qSW and qSS) that were co-localized on LG4 and explained 48.4% and 27.5% of phenotypic variance respectively. The current study would serve as a strong foundation for further validation and fine mapping for utilization in lentil breeding programs. PMID:26436554

  13. Variation in ovule and seed size and associated size-number trade-offs in angiosperms.

    PubMed

    Greenway, Carly A; Harder, Lawrence D

    2007-05-01

    Unlike pollen and seed size, the extent and causes of variation in ovule size remain unexplored. Based on 45 angiosperm species, we assessed whether intra- and interspecific variation in ovule size is consistent with cost minimization during ovule production or allows maternal plants to dominate conflict with their seeds concerning resource investment. Despite considerable intraspecific variation in ovule volume (mean CV = 0.356), ovule production by few species was subject to a size-number trade-off. Among the sampled species, ovule volume varied two orders of magnitude, whereas seed volume varied four orders of magnitude. Ovule volume varied positively among species with flower mass and negatively with ovule number. Tenuinucellate ovules were generally larger that crassinucellate ovules, and species with apical placentation (which mostly have uniovulate ovaries) had smaller ovules than those with other placentation types. Seed volume varied positively among species with fruit mass and seed development time, but negatively with seed number. Seeds grew a median 93-fold larger than the ovules from which they originated. Our results provide equivocal evidence that selection minimizes ovule size to allow efficient resource allocation after fertilization, but stronger evidence that ovule size affords maternal plants an advantage in parent-offspring conflict. PMID:21636453

  14. Quantitative Genetics Identifies Cryptic Genetic Variation Involved in the Paternal Regulation of Seed Development

    PubMed Central

    Pires, Nuno D.; Bemer, Marian; Müller, Lena M.; Baroux, Célia; Spillane, Charles; Grossniklaus, Ueli

    2016-01-01

    Embryonic development requires a correct balancing of maternal and paternal genetic information. This balance is mediated by genomic imprinting, an epigenetic mechanism that leads to parent-of-origin-dependent gene expression. The parental conflict (or kinship) theory proposes that imprinting can evolve due to a conflict between maternal and paternal alleles over resource allocation during seed development. One assumption of this theory is that paternal alleles can regulate seed growth; however, paternal effects on seed size are often very low or non-existent. We demonstrate that there is a pool of cryptic genetic variation in the paternal control of Arabidopsis thaliana seed development. Such cryptic variation can be exposed in seeds that maternally inherit a medea mutation, suggesting that MEA acts as a maternal buffer of paternal effects. Genetic mapping using recombinant inbred lines, and a novel method for the mapping of parent-of-origin effects using whole-genome sequencing of segregant bulks, indicate that there are at least six loci with small, paternal effects on seed development. Together, our analyses reveal the existence of a pool of hidden genetic variation on the paternal control of seed development that is likely shaped by parental conflict. PMID:26811909

  15. Quantitative Genetics Identifies Cryptic Genetic Variation Involved in the Paternal Regulation of Seed Development.

    PubMed

    Pires, Nuno D; Bemer, Marian; Müller, Lena M; Baroux, Célia; Spillane, Charles; Grossniklaus, Ueli

    2016-01-01

    Embryonic development requires a correct balancing of maternal and paternal genetic information. This balance is mediated by genomic imprinting, an epigenetic mechanism that leads to parent-of-origin-dependent gene expression. The parental conflict (or kinship) theory proposes that imprinting can evolve due to a conflict between maternal and paternal alleles over resource allocation during seed development. One assumption of this theory is that paternal alleles can regulate seed growth; however, paternal effects on seed size are often very low or non-existent. We demonstrate that there is a pool of cryptic genetic variation in the paternal control of Arabidopsis thaliana seed development. Such cryptic variation can be exposed in seeds that maternally inherit a medea mutation, suggesting that MEA acts as a maternal buffer of paternal effects. Genetic mapping using recombinant inbred lines, and a novel method for the mapping of parent-of-origin effects using whole-genome sequencing of segregant bulks, indicate that there are at least six loci with small, paternal effects on seed development. Together, our analyses reveal the existence of a pool of hidden genetic variation on the paternal control of seed development that is likely shaped by parental conflict. PMID:26811909

  16. Variation in phenolic compounds and antioxidant activity in apple seeds of seven cultivars.

    PubMed

    Xu, Ying; Fan, Mingtao; Ran, Junjian; Zhang, Tingjing; Sun, Huiye; Dong, Mei; Zhang, Zhe; Zheng, Haiyan

    2016-05-01

    Polyphenols are the predominant ingredients in apple seeds. However, few data are available on the phenolic profile or antioxidant activity in apple seeds in previous researches. In this study, low-molecular-weight phenolic compounds and antioxidant activity in seeds, peels, and flesh of seven apple cultivars grown in northwest China were measured and analyzed using HPLC and FRAP, DPPH, ABTS assays, respectively. HPLC analysis revealed phloridzin as the dominant phenolic compound in the seeds with its contents being 240.45-864.42 mg/100 gDW. Total phenolic content (TPC) measured by the Folin-Ciocalteu assay in apple seed extracts of seven cultivars ranged from 5.74 (Golden Delicious) to 17.44 (Honeycrisp) mgGAE/gDW. Apple seeds showed higher antioxidant activity than peels or flesh; antioxidant activity in seeds varied from 57.59 to 397.70 μM Trolox equivalents (TE)/g FW for FRAP, from 37.56 to 64.31 μM TE/g FW for DPPH, and from 220.52 to 708.02 μM TE/g FW for ABTS. TPC in apple seeds was significantly correlated with all three assays. Principal component analysis (PCA) indicated that Honeycrisp was characterized with high contents of total polyphenols and phloridzin. Our findings suggest that phenolic extracts from apple seeds have good commercial potential as a promising antioxidant for use in food or cosmetics. PMID:27081364

  17. [Anticoagulant activity of low-molecular-weight sulfated derivatives of galactomannan from Cyamopsis tetragonoloba (L.) seeds].

    PubMed

    Mestechkina, N M; Shcherbukhin, V D; Bannikova, G E; Varlamov, V P; Drozd, N N; Tolstenkov, A S; Makarov, V A; Tikhonov, V E

    2008-01-01

    Galactomannan from seeds of Cyamopsis tetragonoloba (L.) Taub. (guar) was depolymerized using immobilized enzymatic preparation celloviridin. A set of fragments whose molecular weights varied from 12.6 to 245.6 kDa was obtained. Sulfated derivatives of components of all fractions were synthesized, in which the content of HSO3(-) groups was 48.05% +/- 2.31. All preparations exhibited anticoagulant activity, which was recorded in vitro in two tests--aIIa and aXa. The antithrombin activity (aIIa) was high (up to 65-87 U/mg) and did not depend on the molecular weight of a sulfated derivative; in the second test (aXa), the effect of molecular weight was observed. Biospecific electrophoresis allowed us to detect the ability of galactomannan sulfates to form complexes with protamine sulfate, a classic antidote to heparin. PMID:18491607

  18. Characteristics and bioactivities of different molecular weight polysaccharides from camellia seed cake.

    PubMed

    Xu, Zhou; Li, Xu; Feng, Shiling; Liu, Jing; Zhou, Lijun; Yuan, Ming; Ding, Chunbang

    2016-10-01

    Four polysaccharides, namely COP-1, COP-2, COP-3 and COP-4, were ultrafiltrated from crud Camellia oleifera seed cake polysaccharides (COP-c), purified, and characterized, including the determination of antioxidant and antiproliferative activities. Their molecular weights were 7.9, 36, 83 and 225kDa, respectively. All COPs showed the similar FT-IR spectrums, but significant differentials in monosaccharide components. COP-2 exhibited the highest radical scavenging abilities. COP-1 has the strongest metal chelating capabilities. Although with higher molecular weight, COP-4 showed the poorest antioxidant abilities. These results suggested appreciate molecular weight COP possessed a better antioxidant activities. Additionally, all COPs had non-significant antiproliferative abilities in HaLa and HepG2 cells. PMID:27341780

  19. Flowering, Capsule and Seed Characteristics in Cuphea

    Technology Transfer Automated Retrieval System (TEKTRAN)

    We modeled the flowering and capsule set dynamics, quantified the level of variation in seed characteristics, elucidated the inter-relationships among seed and capsule physical dimensions, and quantified their impact on single seed weight as the main determinant of seed yield in the indeterminate, p...

  20. Relationships Between Seed Weight, Germination Potential and Biochemical Reserves of Maritime Pine in Morocco: Elements for Tree Seedlings Improvement

    NASA Technical Reports Server (NTRS)

    Wahid, Nadya; Bounoua, Lahouari

    2011-01-01

    Selection of quality seeds in breeding programs can significantly improve seedling productivity. Germination and biochemical analyses on seeds from ten natural populations of maritime pine (Pinus pinaster Ait.) in Morocco reveals significant differences among populations in seed weight, germination characters and protein content in both dry seeds and megagametophytes. During germination, the mobilization of protein content in megagametophyte is significantly different among populations than sugar content. A strong positive correlation between the germination capacity and the protein content in both dry seeds and megagametophytes indicates that the best populations in term of germination capacity may also be the richest in protein content. The present study finds that seed weight is not a good indicator for quality seed selection, nor is it recommended to increase the degree of germinability. Our results suggest that the pine population in southern Morocco might have adapted to drought conditions as it is characterized by heavy seed weight and lower speed of protein content mobilization in megagametophyte compared to northern populations growing in temperate climate.

  1. Drivers of Spatial Variation in the Role of Ants as Secondary Seed Dispersers.

    PubMed

    Bottcher, C; Peixoto, P E C; Silva, W R; Pizo, M A

    2016-08-01

    The spatial variation in the outcome of the interaction between secondary dispersers and seeds is superimposed upon the variation produced by primary dispersers. Investigating the factors that drive the outcome of the interactions with secondary seed dispersers thus represents an essential refinement to our understanding of the complete seed dispersal process. We studied the interactions between two ponerine ants (Pachycondyla striata Smith, 1858 and Odontomachus chelifer (Latreille, 1802)) with fruits experimentally set on the ground, and estimated the effects of ants on seedling establishment in three areas distributed along a 2-km stretch of a Brazilian Atlantic rainforest that differ in soil properties and vegetation physiognomies. We tested the hypothesis that interactions are more frequent, resulting in greater seedling establishment at the site with harsher abiotic and biotic conditions. Both ant species removed fruits frequently and have a positive effect on seedling establishment in all study areas, but fruit removal did not differ among areas, while seedling establishment was more pronounced at the site with stressful abiotic conditions. The two ant species differed in important aspects of their seed dispersal services, including the propensity to interact with seeds. As a result, both the species of ant and abiotic conditions interact at the scale of 2 km to determine the fate of seeds interacting with ants, thus creating a mosaic of outcomes with variable benefits to plants. PMID:27298391

  2. Extraction, Characterization, and Molecular Weight Determination of Senna tora (L.) Seed Polysaccharide

    PubMed Central

    Pawar, Harshal A.; Lalitha, K. G.

    2015-01-01

    The objective of the present work was extraction of polysaccharide from Senna tora L. seed and its characterization as a pharmaceutical excipient. Polysaccharide extraction was based on mechanical separation of the endosperm of seeds of Senna tora, water dissolution, centrifugation, and precipitation with acetone. Standard procedures were used to study the viscosity, micromeritic properties, and microbial bioburden. Accelerated stability study was carried out on isolated polysaccharide for six months at 40°C/75 RH as per ICH guidelines. The gum obtained from S. tora seeds was an amorphous free flowing odourless powder with dull brown colour (yield = 35% w/w). The bulk density, tapped density, and angle of repose data reveal that S. tora gum possesses good flow property. The intrinsic viscosity obtained was 1.568 dL/g. The average molecular weight of purified S. tora gum was found to be 198 kDa by intrinsic viscosity method. The results indicated that viscosity of gum solution increases with increase in temperature. FTIR study revealed the absence of degradation or decomposition of polysaccharide at accelerated stability conditions for six months. It has been concluded that extracted polysaccharide can be used as pharmaceutical excipient in terms of flow behavior, microbial properties, and stability. PMID:26640490

  3. Extraction, Characterization, and Molecular Weight Determination of Senna tora (L.) Seed Polysaccharide.

    PubMed

    Pawar, Harshal A; Lalitha, K G

    2015-01-01

    The objective of the present work was extraction of polysaccharide from Senna tora L. seed and its characterization as a pharmaceutical excipient. Polysaccharide extraction was based on mechanical separation of the endosperm of seeds of Senna tora, water dissolution, centrifugation, and precipitation with acetone. Standard procedures were used to study the viscosity, micromeritic properties, and microbial bioburden. Accelerated stability study was carried out on isolated polysaccharide for six months at 40°C/75 RH as per ICH guidelines. The gum obtained from S. tora seeds was an amorphous free flowing odourless powder with dull brown colour (yield = 35% w/w). The bulk density, tapped density, and angle of repose data reveal that S. tora gum possesses good flow property. The intrinsic viscosity obtained was 1.568 dL/g. The average molecular weight of purified S. tora gum was found to be 198 kDa by intrinsic viscosity method. The results indicated that viscosity of gum solution increases with increase in temperature. FTIR study revealed the absence of degradation or decomposition of polysaccharide at accelerated stability conditions for six months. It has been concluded that extracted polysaccharide can be used as pharmaceutical excipient in terms of flow behavior, microbial properties, and stability. PMID:26640490

  4. Chia seed does not promote weight loss or alter disease risk factors in overweight adults.

    PubMed

    Nieman, David C; Cayea, Erin J; Austin, Melanie D; Henson, Dru A; McAnulty, Steven R; Jin, Fuxia

    2009-06-01

    The objective of this study was to assess the effectiveness of chia seed (Salvia hispanica L) in promoting weight loss and altering disease risk factors in overweight adults. The hypothesis was that the high dietary fiber and alpha-linolenic (ALA) contents of chia seed would induce a small but significant decrease in body weight and fat and improve disease risk factors. Subjects were randomized to chia seed (CS) and placebo (P) groups, and under single-blinded procedures, ingested 25 g CS or P supplements mixed in 0.25 L water twice daily before the first and last meal for 12 weeks. Ninety nondiseased, overweight/obese men and women between the ages of 20 and 70 years were recruited into the study, with 76 subjects (n = 39 CS, n = 37 P) completing all phases of the study. Pre- and poststudy measures included body mass and composition (dual energy x-ray absorptiometry), inflammation markers from fasting blood samples (C-reactive protein, interleukin 6, monocyte chemoattractant protein 1, and tumor necrosis factor alpha), oxidative stress markers (trolox equivalent antioxidant capacity and plasma nitrite), blood pressure, and a serum lipid profile. Plasma ALA increased 24.4% compared to a 2.8% decrease in CS and P, respectively (interaction effect, P = .012). No group differences were measured for changes in plasma eicosapentaenoic acid and docosahexaenoic acid (interaction effects, P = .420 and .980, respectively). Pre-to-post measures of body composition, inflammation, oxidative stress, blood pressure, and lipoproteins did not differ between CS and P for both sexes. In conclusion, ingestion of 50 g/d CS vs P for 12 weeks by overweight/obese men and women had no influence on body mass or composition, or various disease risk factor measures. PMID:19628108

  5. Assessment of the natural variation of low abundant metabolic proteins in soybean seeds using proteomics

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Using two-dimensional polyacrylamide gel electrophoresis and mass spectrometry, we investigated the distribution of the low abundant proteins that are involved in soybean seed development in four wild and twelve cultivated soybean genotypes. We found proteomic variation of these proteins within and...

  6. Free volume variation with molecular weight of polymers

    NASA Technical Reports Server (NTRS)

    Singh, Jag J.; Eftekhari, Abe; Hinkley, Jeffrey A.; St.clair, Terry L.; Jensen, Brian J.

    1992-01-01

    Free volume measurements were made in several molecular weight fractions of two different geometries of poly(arylene ether ketone)s. Free volumes were measured using positron lifetime spectroscopy. It has been observed that the free volume cell size V(sub f) varies with the molecular weight M of the test samples according to an equation of the form V(sub f) = AM(B), where A and B are constants. The molecular weights computed from the free volume cell sizes are in good agreement with the values measured by gel permeation chromatography.

  7. Genetic and Sequence Analysis of Genes Controlling Natural Variation of Seed-Coat and Flower Colors in Soybean

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The soybean exhibits natural variation in flower and seed-coat colors via the deposition of various anthocyanin pigments in the respective tissues. Although pigmentation in seeds or flowers has been well dissected at molecular level in several plant species, the genes controlling natural variation ...

  8. Seed metabolomic study reveals significant metabolite variations and correlations among different soybean cultivars.

    PubMed

    Lin, Hong; Rao, Jun; Shi, Jianxin; Hu, Chaoyang; Cheng, Fang; Wilson, Zoe A; Zhang, Dabing; Quan, Sheng

    2014-09-01

    Soybean [Glycine max (L.) Merr.] is one of the world's major crops, and soybean seeds are a rich and important resource for proteins and oils. While "omics" studies, such as genomics, transcriptomics, and proteomics, have been widely applied in soybean molecular research, fewer metabolomic studies have been conducted for large-scale detection of low molecular weight metabolites, especially in soybean seeds. In this study, we investigated the seed metabolomes of 29 common soybean cultivars through combined gas chromatography-mass spectrometry and ultra-performance liquid chromatography-tandem mass spectrometry. One hundred sixty-nine named metabolites were identified and subsequently used to construct a metabolic network of mature soybean seed. Among the 169 detected metabolites, 104 were found to be significantly variable in their levels across tested cultivars. Metabolite markers that could be used to distinguish genetically related soybean cultivars were also identified, and metabolite-metabolite correlation analysis revealed some significant associations within the same or among different metabolite groups. Findings from this work may potentially provide the basis for further studies on both soybean seed metabolism and metabolic engineering to improve soybean seed quality and yield. PMID:24942044

  9. Changes due to cooking and sterilization in low molecular weight carbohydrates in immature seeds of five cultivars of common bean.

    PubMed

    Słupski, Jacek; Gębczyński, Piotr

    2014-06-01

    Immature seeds of five bean cultivars (flageolet-type and those intended for dry-seed production) were assessed for changes in water-soluble carbohydrates including raffinose family oligosaccharides (RFOs) due to boiling, sterilization, and storage of the sterilized product. About 100 g fresh weight of edible portion of fresh bean seeds contained 2449.3-3182.6 mg total soluble sugars, of which RFOs comprised 44-49%. The highest amounts of these compounds were found in the seeds of the cultivars Laponia and Mona. The dominant oligosaccharide was stachyose. Boiling fresh seeds to consumption consistency reduced total soluble sugars and RFOs: average values were 57% and 55%, respectively. Sterilization in cans resulted in 65% reductions of both total soluble sugars and RFOs. In general, there were no changes in the content of soluble sugars in canned and sterilized products stored for 12 months. PMID:24392956

  10. New stable QTLs for berry weight do not colocalize with QTLs for seed traits in cultivated grapevine (Vitis vinifera L.)

    PubMed Central

    2013-01-01

    Background In grapevine, as in other fruit crops, fruit size and seed content are key components of yield and quality; however, very few Quantitative Trait Loci (QTLs) for berry weight and seed content (number, weight, and dry matter percentage) have been discovered so far. To identify new stable QTLs for marker-assisted selection and candidate gene identification, we performed simultaneous QTL detection in four mapping populations (seeded or seedless) with various genetic backgrounds. Results For berry weight, we identified five new QTLs, on linkage groups (LGs) 1, 8, 11, 17 and 18, in addition to the known major QTL on LG 18. The QTL with the largest effect explained up to 31% of total variance and was found in two genetically distant populations on LG 17, where it colocalized with a published putative domestication locus. For seed traits, besides the major QTLs on LG 18 previously reported, we found four new QTLs explaining up to 51% of total variance, on LGs 4, 5, 12 and 14. The previously published QTL for seed number on LG 2 was found related in fact to sex. We found colocalizations between seed and berry weight QTLs only for the major QTL on LG 18 in a seedless background, and on LGs 1 and 13 in a seeded background. Candidate genes belonging to the cell number regulator CNR or cytochrome P450 families were found under the berry weight QTLs on LGs 1, 8, and 17. The involvement of these gene families in fruit weight was first described in tomato using a QTL-cloning approach. Several other interesting candidate genes related to cell wall modifications, water import, auxin and ethylene signalling, transcription control, or organ identity were also found under berry weight QTLs. Conclusion We discovered a total of nine new QTLs for berry weight or seed traits in grapevine, thereby increasing more than twofold the number of reliable QTLs for these traits available for marker assisted selection or candidate gene studies. The lack of colocalization between berry and

  11. Rapid Identification of Candidate Genes for Seed Weight Using the SLAF-Seq Method in Brassica napus.

    PubMed

    Geng, Xinxin; Jiang, Chenghong; Yang, Jie; Wang, Lijun; Wu, Xiaoming; Wei, Wenhui

    2016-01-01

    Seed weight is a critical and direct trait for oilseed crop seed yield. Understanding its genetic mechanism is of great importance for yield improvement in Brassica napus breeding. Two hundred and fifty doubled haploid lines derived by microspore culture were developed from a cross between a large-seed line G-42 and a small-seed line 7-9. According to the 1000-seed weight (TSW) data, the individual DNA of the heaviest 46 lines and the lightest 47 lines were respectively selected to establish two bulked DNA pools. A new high-throughput sequencing technology, Specific Locus Amplified Fragment Sequencing (SLAF-seq), was used to identify candidate genes of TSW in association analysis combined with bulked segregant analysis (BSA). A total of 1,933 high quality polymorphic SLAF markers were developed and 4 associated markers of TSW were procured. A hot region of ~0.58 Mb at nucleotides 25,401,885-25,985,931 on ChrA09 containing 91 candidate genes was identified as tightly associated with the TSW trait. From annotation information, four genes (GSBRNA2T00037136001, GSBRNA2T00037157001, GSBRNA2T00037129001 and GSBRNA2T00069389001) might be interesting candidate genes that are highly related to seed weight. PMID:26824525

  12. Rapid Identification of Candidate Genes for Seed Weight Using the SLAF-Seq Method in Brassica napus

    PubMed Central

    Geng, Xinxin; Jiang, Chenghong; Yang, Jie; Wang, Lijun; Wu, Xiaoming; Wei, Wenhui

    2016-01-01

    Seed weight is a critical and direct trait for oilseed crop seed yield. Understanding its genetic mechanism is of great importance for yield improvement in Brassica napus breeding. Two hundred and fifty doubled haploid lines derived by microspore culture were developed from a cross between a large-seed line G-42 and a small-seed line 7–9. According to the 1000-seed weight (TSW) data, the individual DNA of the heaviest 46 lines and the lightest 47 lines were respectively selected to establish two bulked DNA pools. A new high-throughput sequencing technology, Specific Locus Amplified Fragment Sequencing (SLAF-seq), was used to identify candidate genes of TSW in association analysis combined with bulked segregant analysis (BSA). A total of 1,933 high quality polymorphic SLAF markers were developed and 4 associated markers of TSW were procured. A hot region of ~0.58 Mb at nucleotides 25,401,885–25,985,931 on ChrA09 containing 91 candidate genes was identified as tightly associated with the TSW trait. From annotation information, four genes (GSBRNA2T00037136001, GSBRNA2T00037157001, GSBRNA2T00037129001 and GSBRNA2T00069389001) might be interesting candidate genes that are highly related to seed weight. PMID:26824525

  13. Glucose, stem dry weight variation, principal component and cluster analysis for some agronomic traits among 16 regenerated Crotalaria juncea accessions for potential cellulosic ethanol.

    PubMed

    Morris, J Bradley; Antonious, George F

    2013-01-01

    The objectives of this research were to identify candidate sunn hemp accessions having high concentrations of cellulose for use as parents in breeding for cellulose and to determine variability for glucose content and some important agronomic traits among sunn hemp accessions. Since sunn hemp is an under-utilized species, glucose content and agronomic trait variation is essential for the identification of superior sunn hemp accessions for use as potential ethanol for biofuel. Sixteen sunn hemp accessions including the following plant introductions (expressed as glucose concentration) and stem dry weights were studied. "Sixteen sunn hemp accessions including the following plant introductions (expressed as glucose concentration) and stem dry weights were studied." In addition, to verify variability, these traits plus morphological, phenological, and seed reproductive traits were analyzed using multivariate and cluster analysis. The accessions, PI 250487, PI 337080, and PI 219717 produced the highest glucose concentrations (859, 809, and 770 mg g(-1) stem dry weight, respectively), however PI 468956 produced the highest stem dry weight (258 g). Branching significantly correlated with foliage (r(2) = 0.67**) and relative maturity (r(2) = 0.60*), while maturity had a significantly negative correlation with seed number (r(2) = -0.67**) and plant width (r(2) = -0.53*) as well. Seed number significantly correlated with plant width (r(2) = 0.57*). Average linkage cluster analysis grouped the 16 sunn hemp accessions into well-defined phenotypes with four distinct seed-producing groups and one outlier. Based on multivariate and cluster analysis, sufficient variation among these16 sunn hemp accessions exists to support the development of cellulosic ethanol producing cultivars with improved architecture, early maturity, seed yield, glucose concentrations, and stem dry weights. PMID:23356343

  14. Coffee seeds isotopic composition as a potential proxy to evaluate Minas Gerais, Brazil seasonal variations during seed maturation

    NASA Astrophysics Data System (ADS)

    Rodrigues, Carla; Maia, Rodrigo; Brunner, Marion; Carvalho, Eduardo; Prohaska, Thomas; Máguas, Cristina

    2010-05-01

    Plant seeds incorporate the prevailing climate conditions and the physiological response to those conditions (Rodrigues et al., 2009; Rodrigues et al., submitted). During coffee seed maturation the biochemical compounds may either result from accumulated material in other organs such as leafs and/or from new synthesis. Accordingly, plant seeds develop in different stages along a particular part of the year, integrating the plant physiology and seasonal climatic conditions. Coffee bean is an extremely complex matrix, rich in many products derived from both primary and secondary metabolism during bean maturation. Other studies (De Castro and Marraccini, 2006) have revealed the importance of different coffee plant organs during coffee bean development as transfer tissues able to provide compounds (i.e. sugars, organic acids, etc) to the endosperm where several enzymatic activities and expressed genes have been reported. Moreover, it has been proved earlier on that green coffee bean is a particularly suitable case-study (Rodrigues et al., 2009; Rodrigues et al., submitted), not only due to the large southern hemispheric distribution but also because of this product high economic interest. The aim of our work was to evaluate the potential use of green coffee seeds as a proxy to seasonal climatic conditions during coffee bean maturation, through an array of isotopic composition determinations. We have determined carbon, nitrogen, oxygen and sulfur isotopic composition (by IRMS - Isotope Ratio Mass Spectrometry) as well as strontium isotope abundance (by MC-ICP-MS; Multicollector Inductively Coupled Plasma Mass Spectrometry), of green coffee beans harvested at different times at Minas Gerais, Brazil. The isotopic composition data were combined with air temperature and relative humidity data registered during the coffee bean developmental period, and with the parent rock strontium isotopic composition. Results indicate that coffee seeds indeed integrate the interactions

  15. Using soil seed banks to assess temporal patterns of genetic variation in invasive plant populations

    PubMed Central

    Fennell, Mark; Gallagher, Tommy; Vintro, Luis Leon; Osborne, Bruce

    2014-01-01

    Most research on the genetics of invasive plant species has focused on analyzing spatial differences among existing populations. Using a long-established Gunnera tinctoria population from Ireland, we evaluated the potential of using plants derived from seeds associated with different soil layers to track genetic variation through time. This species and site were chosen because (1) G. tinctoria produces a large and persistent seed bank; (2) it has been present in this locality, Sraheens, for ∼90 years; (3) the soil is largely undisturbed; and (4) the soil's age can be reliably determined radiometrically at different depths. Amplified fragment length polymorphic markers (AFLPs) were used to assess differences in the genetic structure of 75 individuals sampled from both the standing population and from four soil layers, which spanned 18 cm (estimated at ∼90 years based on 210Pb and 137Cs dating). While there are difficulties in interpreting such data, including accounting for the effects of selection, seed loss, and seed migration, a clear pattern of lower total allele counts, percentage polymorphic loci, and genetic diversity was observed in deeper soils. The greatest percentage increase in the measured genetic variables occurred prior to the shift from the lag to the exponential range expansion phases and may be of adaptive significance. These findings highlight that seed banks in areas with long-established invasive populations can contain valuable genetic information relating to invasion processes and as such, should not be overlooked. PMID:24967082

  16. Multiple loci and epistases control genetic variation for seed dormancy in weedy rice (Oryza sativa).

    PubMed Central

    Gu, Xing-You; Kianian, Shahryar F; Foley, Michael E

    2004-01-01

    Weedy rice has much stronger seed dormancy than cultivated rice. A wild-like weedy strain SS18-2 was selected to investigate the genetic architecture underlying seed dormancy, a critical adaptive trait in plants. A framework genetic map covering the rice genome was constructed on the basis of 156 BC(1) [EM93-1 (nondormant breeding line)//EM93-1/SS18-2] individuals. The mapping population was replicated using a split-tiller technique to control and better estimate the environmental variation. Dormancy was determined by germination of seeds after 1, 11, and 21 days of after-ripening (DAR). Six dormancy QTL, designated as qSD(S)-4, -6, -7-1, -7-2, -8, and -12, were identified. The locus qSD(S)-7-1 was tightly linked to the red pericarp color gene Rc. A QTL x DAR interaction was detected for qSD(S)-12, the locus with the largest main effect at 1, 11, and 21 DAR (R(2) = 0.14, 0.24, and 0.20, respectively). Two, three, and four orders of epistases were detected with four, six, and six QTL, respectively. The higher-order epistases strongly suggest the presence of genetically complex networks in the regulation of variation for seed dormancy in natural populations and make it critical to select for a favorable combination of alleles at multiple loci in positional cloning of a target dormancy gene. PMID:15082564

  17. Selecting sagebrush seed sources for restoration in a variable climate: ecophysiological variation among genotypes

    USGS Publications Warehouse

    Germino, Matthew J.

    2012-01-01

    Big sagebrush (Artemisia tridentata) communities dominate a large fraction of the United States and provide critical habitat for a number of wildlife species of concern. Loss of big sagebrush due to fire followed by poor restoration success continues to reduce ecological potential of this ecosystem type, particularly in the Great Basin. Choice of appropriate seed sources for restoration efforts is currently unguided due to knowledge gaps on genetic variation and local adaptation as they relate to a changing landscape. We are assessing ecophysiological responses of big sagebrush to climate variation, comparing plants that germinated from ~20 geographically distinct populations of each of the three subspecies of big sagebrush. Seedlings were previously planted into common gardens by US Forest Service collaborators Drs. B. Richardson and N. Shaw, (USFS Rocky Mountain Research Station, Provo, Utah and Boise, Idaho) as part of the Great Basin Native Plant Selection and Increase Project. Seed sources spanned all states in the conterminous Western United States. Germination, establishment, growth and ecophysiological responses are being linked to genomics and foliar palatability. New information is being produced to aid choice of appropriate seed sources by Bureau of Land Management and USFS field offices when they are planning seed acquisitions for emergency post-fire rehabilitation projects while considering climate variability and wildlife needs.

  18. Weight variation before and after surgery in Parkinson's disease: a noradrenergic modulation?

    PubMed

    Guimarães, Joana; Moura, Eduardo; Vieira-Coelho, Maria Augusta; Garrett, Carolina

    2012-08-01

    Changes in the nutritional profile of patients with Parkinson's disease have been reported before and after deep brain stimulation surgery. The major determinants of the weight variation in Parkinson's disease are not yet understood, and the mechanism seems complex. Based on the influence of the sympathetic nervous system in metabolic syndrome obesity, the intent of the present review is to consider the role of noradrenergic modulation on weight variations in Parkinson's disease. In this review the authors raise the following hypothesis: weight variation in Parkinson's disease before and after deep brain stimulation of the subthalamic nucleus could be influenced by noradrenergic interaction between the locus coeruleus, subthalamic nucleus, and hypothalamic nucleus. PMID:22700383

  19. Do key dimensions of seed and seedling functional trait variation capture variation in recruitment probability?

    Technology Transfer Automated Retrieval System (TEKTRAN)

    1. Plant functional traits provide a mechanistic basis for understanding ecological variation among plant species and the implications of this variation for species distribution, community assembly and restoration. 2. The bulk of our functional trait understanding, however, is centered on traits rel...

  20. Fermi energy 5f spectral weight variation in uranium alloys

    SciTech Connect

    Denlinger, J.D.; Clack, J.; Allen, J.W.

    1997-04-01

    Uranium materials display a wide range of thermal, electrical and magnetic properties, often exotic. For more than a decade there have been efforts to use photoemission spectroscopy to develop a systematic and unified understanding of the 5f electron states giving rise to this behavior. These efforts have been hampered by a paucity of systems where changes in transport properties are accompanied by substantial spectral changes, so as to allow an attempt to correlate the two kinds of properties within some model. The authors have made resonant photoemission measurements to extract the 5f spectral weight in three systems which show varying degrees of promise of permitting such an attempt, Y{sub 1{minus}x}U{sub x}Pd{sub 3}, U(Pd{sub x}Pt{sub 1{minus}x}){sub 3} and U(Pd{sub x}Cu{sub 1{minus}x}){sub 5}. They have also measured U 4f core level spectra. The 4f spectra can be modeled with some success by the impurity Anderson model (IAM), and the 5f spectra are currently being analyzed in that framework. The IAM characterizes the 5f-electrons of a single site by an f binding energy {epsilon}{sub f}, an f Coulomb interaction and a hybridization V to conduction electrons. Latent in the model are the phenomena of 5f mixed valence and the Kondo effect.

  1. 48 CFR 245.7309-8 - Variations in quantity or weight.

    Code of Federal Regulations, 2010 CFR

    2010-10-01

    ... weight. 245.7309-8 Section 245.7309-8 Federal Acquisition Regulations System DEFENSE ACQUISITION REGULATIONS SYSTEM, DEPARTMENT OF DEFENSE CONTRACT MANAGEMENT GOVERNMENT PROPERTY Sale of Surplus Contractor Inventory 245.7309-8 Variations in quantity or weight. When property is sold on a “unit price” basis,...

  2. The atomic weight and isotopic composition of boron and their variation in nature

    SciTech Connect

    Holden, N.E.

    1993-08-01

    The boron isotopic composition and atomic weight value and their variation in nature are reviewed. Questions are raised about the previously recommended value and the uncertainty for the atomic weight. The problem of what constitutes an acceptable range for normal material and what should then be considered geologically exceptional is discussed. Recent measurements make some previous decisions in need of re-evaluation.

  3. Phenotypic and genetic variation in leptin as determinants of weight regain

    PubMed Central

    Rudich, A; Meiner, V; Schwarzfuchs, D; Sharon, N; Shpitzen, S; Blüher, M; Stumvoll, M; Thiery, J; Fiedler, GM; Friedlander, Y; Leiterstdorf, E; Shai, I

    2016-01-01

    Aims Over 75% of obese subjects fail to maintain their weight following weight loss interventions. We aimed to identify phenotypic and genetic markers associated with weight maintenance/regain following a dietary intervention. Subjects and methods In the 2-year Dietary Intervention Randomized Controlled Trial, we assessed potential predictors for weight changes during the ‘weight loss phase’ (0–6 months) and the ‘weight maintenance/regain phase’ (7–24 months). Genetic variation between study participants was studied using single-nucleotide polymorphisms in the leptin gene (LEP). Results Mean weight reduction was −5.5% after 6 months, with a mean weight regain of 1.2% of baseline weight during the subsequent 7–24 months. In a multivariate regression model, higher baseline high-molecular-weight adiponectin was the only biomarker predictor of greater success in 0- to 6-month weight loss (β = −0.222, P-value = 0.044). In a multivariate regression model adjusted for 6-month changes in weight and various biomarkers, 6-month plasma leptin reduction exhibited the strongest positive association with 6-month weight loss (β = 0.505, P-value<0.001). Conversely, 6-month plasma leptin reduction independently predicted weight regain during the following 18 months (β = −0.131, P-value<.013). Weight regain was higher among participants who had a greater (top tertiles) 6-month decrease in both weight and leptin (+ 3.4% (95% confidence interval 2.1–4.8)) as compared with those in the lowest combined tertiles (+ 0.2% (95% confidence interval −1.1 to 1.4)); P-value<0.001. Weight regain was further significantly and independently associated with genetic variations in LEP (P = 0.006 for both rs4731426 and rs2071045). Adding genetic data to the phenotypic multivariate model increased its predictive value for weight regain by 34%. Conclusion Although greater reduction in leptin concentrations during the initial phase of a dietary intervention is associated with

  4. The Tracking Study: Description of a randomized controlled trial of variations on weight tracking frequency in a behavioral weight loss program

    PubMed Central

    Linde, Jennifer A.; Jeffery, Robert W.; Crow, Scott J.; Brelje, Kerrin L.; Pacanowski, Carly R.; Gavin, Kara L.; Smolenski, Derek J.

    2014-01-01

    Observational evidence from behavioral weight control trials and community studies suggests that greater frequency of weighing oneself, or tracking weight, is associated with better weight outcomes. Conversely, it has also been suggested that frequent weight tracking may have a negative impact on mental health and outcomes during weight loss, but there are minimal experimental data that address this concern in the context of an active weight loss program. To achieve the long-term goal of strengthening behavioral weight loss programs, the purpose of this randomized controlled trial (the Tracking Study) is to test variations on frequency of self-weighing during a behavioral weight loss program, and to examine psychosocial and mental health correlates of weight tracking and weight loss outcomes. Three hundred thirty-nine overweight and obese adults were recruited and randomized to one of three variations on weight tracking frequency during a 12-month weight loss program with a 12-month follow-up: daily weight tracking, weekly weight tracking, or no weight tracking. The primary outcome is weight in kilograms at 24 months. The weight loss program integrates each weight tracking instruction with standard behavioral weight loss techniques (goal setting, self-monitoring, stimulus control, dietary and physical activity enhancements, lifestyle modifications); participants in weight tracking conditions were provided with wireless Internet technology (Wi-Fi-enabled digital scales and touchscreen personal devices) to facilitate weight tracking during the study. This paper describes the study design, intervention features, recruitment, and baseline characteristics of participants enrolled in the Tracking Study. PMID:25533727

  5. Within-litter variation in birth weight: impact of nutritional status in the sow*

    PubMed Central

    Yuan, Tao-lin; Zhu, Yu-hua; Shi, Meng; Li, Tian-tian; Li, Na; Wu, Guo-yao; Bazer, Fuller W.; Zang, Jian-jun; Wang, Feng-lai; Wang, Jun-jun

    2015-01-01

    Accompanying the beneficial improvement in litter size from genetic selection for high-prolificacy sows, within-litter variation in birth weight has increased with detrimental effects on post-natal growth and survival due to an increase in the proportion of piglets with low birth-weight. Causes of within-litter variation in birth weight include breed characteristics that affect uterine space, ovulation rate, degree of maturation of oocytes, duration of time required for ovulation, interval between ovulation and fertilization, uterine capacity for implantation and placentation, size and efficiency of placental transport of nutrients, communication between conceptus/fetus and maternal systems, as well as nutritional status and environmental influences during gestation. Because these factors contribute to within-litter variation in birth weight, nutritional status of the sow to improve fetal-placental development must focus on the following three important stages in the reproductive cycle: pre-mating or weaning to estrus, early gestation and late gestation. The goal is to increase the homogeneity of development of oocytes and conceptuses, decrease variations in conceptus development during implantation and placentation, and improve birth weights of newborn piglets. Though some progress has been made in nutritional regulation of within-litter variation in the birth weight of piglets, additional studies, with a focus on and insights into molecular mechanisms of reproductive physiology from the aspects of maternal growth and offspring development, as well as their regulation by nutrients provided to the sow, are urgently needed. PMID:26055904

  6. Purification and partial characterization of low molecular weight vicilin-like glycoprotein from the seeds of Citrullus lanatus.

    PubMed

    Yadav, Sushila; Tomar, Anil Kumar; Jithesh, O; Khan, Meraj Alam; Yadav, R N; Srinivasan, A; Singh, Tej P; Yadav, Savita

    2011-12-01

    The watermelon (Citrullus lanatus) seeds are highly nutritive and contain large amount of proteins and many beneficial minerals such as magnesium, calcium, potassium, iron, phosphorous, zinc etc. In various parts of the world, C. lanatus seed extracts are used to cure cancer, cardiovascular diseases, hypertension, and blood pressure. C. lanatus seed extracts are also used as home remedy for edema and urinary tract problems. In this study, we isolated protein fraction of C. lanatus seeds using various protein separation methods. We successfully purified a low molecular weight vicilin-like glycoprotein using chromatographic methods followed by SDS-PAGE and MALDI-TOF/MS identification. This is the first report of purification of a vicilin like polypeptide from C. lanatus seeds. In next step, we extracted mRNA from immature seeds and reverse transcribed it using suitable forward and reverse primers for purified glycoprotein. The PCR product was analysed on 1% agarose gel and was subsequently sequenced by Dideoxy DNA sequencing method. An amino acid translation of the gene is in agreement with amino acid sequences of the identified peptides. PMID:21989589

  7. Seed size and nutrient content variation for twenty-one invasive and native California and Oregon taxa of the tribe Cynareae (Asteraceae)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Seed characteristics are important for seed dispersal, seedling growth, and seedling survival, but there is little information on seed characteristics for several taxa of the tribe Cynareae (Family: Asteraceae). We determined seed characteristics and their variation from natural populations of twen...

  8. Statistical studies on high molecular weight pullulan production in solid state fermentation using jack fruit seed.

    PubMed

    Sugumaran, K R; Sindhu, R V; Sukanya, S; Aiswarya, N; Ponnusami, V

    2013-10-15

    The purpose of the work was to optimize the medium variables for maximizing pullulan production using jack fruit seed as a low cost substrate by Aureobasidium pullulans in solid state fermentation. Effects of K2HPO4, KH2PO4, ZnSO4·5H2O, MgSO4·7H2O, NaCl, (NH4)2SO4·5H2O, yeast extract, moisture content (%, w/w) in the production medium on pullulan production were studied using Plackett-Burman design. Production of pullulan was significantly affected by the medium variables namely KH2PO4, ZnSO4·5H2O, NaCl and moisture content (%, w/w). Then screened variables were optimized by Box Behnken experiment design. The pullulan obtained was characterized and confirmed by FTIR, (1)H NMR and (13)C NMR. Molecular weight of pullulan was found to be 1.733×10(6) g/mol by gel permeation chromatography (GPC). PMID:23987421

  9. Rapid Development of Adaptive, Climate-Driven Clinal Variation in Seed Mass in the Invasive Annual Forb Echium plantagineum L.

    PubMed Central

    Konarzewski, Tara K.; Murray, Brad R.; Godfree, Robert C.

    2012-01-01

    We examined adaptive clinal variation in seed mass among populations of an invasive annual species, Echium plantagineum, in response to climatic selection. We collected seeds from 34 field populations from a 1,000 km long temperature and rainfall gradient across the species' introduced range in south-eastern Australia. Seeds were germinated, grown to reproductive age under common glasshouse conditions, and progeny seeds were harvested and weighed. Analyses showed that seed mass was significantly related to climatic factors, with populations sourced from hotter, more arid sites producing heavier seeds than populations from cooler and wetter sites. Seed mass was not related to edaphic factors. We also found that seed mass was significantly related to both longitude and latitude with each degree of longitude west and latitude north increasing seed mass by around 2.5% and 4% on average. There was little evidence that within-population or between-population variation in seed mass varied in a systematic manner across the study region. Our findings provide compelling evidence for development of a strong cline in seed mass across the geographic range of a widespread and highly successful invasive annual forb. Since large seed mass is known to provide reproductive assurance for plants in arid environments, our results support the hypothesis that the fitness and range potential of invasive species can increase as a result of genetic divergence of populations along broad climatic gradients. In E. plantagineum population-level differentiation has occurred in 150 years or less, indicating that the adaptation process can be rapid. PMID:23284621

  10. Plant-Species Diversity Correlates with Genetic Variation of an Oligophagous Seed Predator

    PubMed Central

    Laukkanen, Liisa; Mutikainen, Pia; Muola, Anne; Leimu, Roosa

    2014-01-01

    Several characteristics of habitats of herbivores and their food-plant communities, such as plant-species composition and plant quality, influence population genetics of both herbivores and their host plants. We investigated how different ecological and geographic factors affect genetic variation in and differentiation of 23 populations of the oligophagous seed predator Lygaeus equestris (Heteroptera) in southwestern Finland and in eastern Sweden. We tested whether genetic differentiation of the L. equestris populations was related to the similarity of vegetation, and whether there was more within-population genetic variation in habitats with a high number of plant species or in those with a large population of the primary food plant, Vincetoxicum hirundinaria. We also tested whether genetic differentiation of the populations was related to the geographic distance, and whether location of the populations on islands or on mainland, island size, or population size affected within-population genetic variation. Pairwise FST ranged from 0 to 0.1 indicating low to moderate genetic differentiation of populations. Differentiation increased with geographic distance between the populations, but was not related to the similarity of vegetation between the habitats. Genetic variation within the L. equestris populations did not increase with the population size of the primary food plant. However, the more diverse the plant community the higher was the level of genetic variation within the L. equestris population. Furthermore, the level of genetic variation did not vary significantly between island and mainland populations. The effect of the population size on within-population genetic variation was related to island size. Usually small populations are susceptible to loss of genetic variation, but small L. equestris populations on large islands seemed to maintain a relatively high level of within-population genetic variation. Our findings suggest that, in addition to geographic

  11. Contribution of low-molecular-weight antioxidants to the antioxidant capacity of raw and processed lentil seeds.

    PubMed

    Fernandez-Orozco, Rebeca; Zieliński, Henryk; Piskuła, Mariusz K

    2003-10-01

    In this study four cultivars of lentil originating from Spain were examined: cv Paula, cv Agueda, cv Almar and cv Alcor. Since consumption of these seeds after heat treatment and as sprouts has been popularised, the impact of cooking (up to 30 min) and germination process (in dark, at 25 degrees C, for up to 4 days) on peroxyl radical-trapping capacity (PRTC) and Trolox-equivalent antioxidant capacity (TEAC) of the processed seeds was addressed. Also, changes in the content of low-molecular-weight antioxidants (LMWA) and soluble proteins in the course of cooking and germination were studied. The analyzed LMWAwere: total phenolics, tocopherols (alpha-T, beta-T, gamma-T, delta-T), reduced glutathione, and L-ascorbic acid. On the basis of the results obtained, the contribution of LMWA and soluble proteins to the PRTC and TEAC of raw, cooked, and germinated lentil seeds was calculated by multiple mean values for the content of investigated compounds and their relative potential with respect to Trolox. The results showed avery high molar percentage contribution of phenolic compounds and low contribution of tocopherols, glutathione, soluble proteins, and ascorbate (only in germinated seeds) to the total TEAC and total PRTC calculated as a sum of data provided for phosphate-buffered and 80% methanolic extracts of raw and processed lentil seeds. PMID:14609082

  12. Assessment of Genetically Modified Soybean in Relation to Natural Variation in the Soybean Seed Metabolome

    PubMed Central

    Clarke, Joseph D.; Alexander, Danny C.; Ward, Dennis P.; Ryals, John A.; Mitchell, Matthew W.; Wulff, Jacob E.; Guo, Lining

    2013-01-01

    Genetically modified (GM) crops currently constitute a significant and growing part of agriculture. An important aspect of GM crop adoption is to demonstrate safety and equivalence with respect to conventional crops. Untargeted metabolomics has the ability to profile diverse classes of metabolites and thus could be an adjunct for GM crop substantial equivalence assessment. To account for environmental effects and introgression of GM traits into diverse genetic backgrounds, we propose that the assessment for GM crop metabolic composition should be understood within the context of the natural variation for the crop. Using a non-targeted metabolomics platform, we profiled 169 metabolites and established their dynamic ranges from the seeds of 49 conventional soybean lines representing the current commercial genetic diversity. We further demonstrated that the metabolome of a GM line had no significant deviation from natural variation within the soybean metabolome, with the exception of changes in the targeted engineered pathway. PMID:24170158

  13. Variation of form and dimension for minimum weight design of continuous structures

    NASA Astrophysics Data System (ADS)

    Berkes, Uwe-Laszlo

    1987-01-01

    A method for minimum weight design of arbitrary loaded continuous structures is outlined. The optimization algorithm is controlled by a fast fully stressed design procedure and the structure stress-strain behavior is computed by the finite element code. Both are completed by pre and postprocessors. To reach the minimum weight design two tasks are carried out: dimension variation in general elementwise thickness adaption to the stress limits; and form variation by element reduction in the finite element set. For comparison of the convergence behavior and accuracy of this code, results are compared with Michell reference structures and their analytic solutions. The method shows fast convergence and reaches the theoretical optimum efficiently.

  14. Genetic variation of jointed goatgrass (Aegilops cylindrica Host.) from Iran using RAPD-PCR and SDS-PAGE of seed proteins.

    PubMed

    Farkhari, M; Naghavi, M R; Pyghambari, S A; Sabokdast

    2007-09-01

    Genetic variation of 28 populations of jointed goatgrass (Aegilops cylindrica Host.), collected from different parts of Iran, were evaluated using both RAPD-PCR and SDS-PAGE of seed proteins. The diversity within and between populations for the three-band High Molecular Weight (HMW) subunits of glutenin pattern were extremely low. Out of 15 screened primers of RAPD, 14 primers generated 133 reproducible fragments which among them 92 fragments were polymorphic (69%). Genetic similarity calculated from the RAPD data ranged from 0.64 to 0.98. A dendrogram was prepared on the basis of a similarity matrix using the UPGMA algorithm and separated the 28 populations into two groups. Confusion can happen between populations with the same origin as well as between populations of very diverse geographical origins. Our results show that compare to seed storage protein, RAPD is suitable for genetic diversity assessment in Ae. cylindrica populations. PMID:19090190

  15. Variation and inheritance pattern in cone and seed characteristics of Scots pine (Pinus sylvestris L.) for evaluation of genetic diversity.

    PubMed

    Sevik, Hakan; Topaçoğlu, Osman

    2015-09-01

    Scots pine (Pinus sylvestris L.) is one of the most common and important forest tree species in Turkey due to usefulness of its wood to many commercial uses. This species is classified as one of the economically important tree species for Turkish Forestry in the "National Tree Breeding and Seed Production Program". The objective of the present study was to investigate variation and inheritance pattern in cone and seed characteristics of Scots pine and to evaluate variation in cone and seed characters within and among clones and grafts. The results showed that maximum CV among the clones was found for SWe (21.95), FS (16.99) and CWe (16.88). According to the results of SAS, variation between the clones is averaged at 19.2% and variation within the clones is averaged at 24.4 %. Variation between the clones ranged from 3.6% (SW) to 34.5% (TC) and variation within the clones ranged from 12.3% (SW) to 38.1% (WL). For CW, AL, AW, WW and TC, genetic variation among clones was higher than within clones. When the results of study like compared with results obtained from natural populations, it was seen that genetic variability in seed orchard which was subjected to study was quite low. This case may have dangerous results for the future of forests. PMID:26521555

  16. Variation in body weight and total length among families of fingerling white bass after communal rearing

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Variation in body weight and total length among 15 families of Phase I white bass Morone chrysops was evaluated in a communal pond. Family pedigrees were determined a posteriori using microsatellite molecular markers and trait heritabilities (h2) were estimated. Fingerlings averaged 36.7 (+ or - 2...

  17. Trypsin inhibitor from tamarindus indica L. seeds reduces weight gain and food consumption and increases plasmatic cholecystokinin levels

    PubMed Central

    do Nascimento Campos Ribeiro, Joycellane Alline; Serquiz, Alexandre Coellho; dos Santos Silva, Priscila Fabíola; Barbosa, Patrícia Batista Barra Medeiros; Sampaio, Tarcísio Bruno Montenegro; de Araújo, Raimundo Fernandes; de Oliveira, Adeliana Silva; Machado, Richele Janaina Araújo; Maciel, Bruna Leal Lima; Uchôa, Adriana Ferreira; dos Santos, Elizeu Antunes; de Araújo Morais, Ana Heloneida

    2015-01-01

    OBJECTIVES: Seeds are excellent sources of proteinase inhibitors, some of which may have satietogenic and slimming actions. We evaluated the effect of a trypsin inhibitor from Tamarindus indica L. seeds on weight gain, food consumption and cholecystokinin levels in Wistar rats. METHODS: A trypsin inhibitor from Tamarindus was isolated using ammonium sulfate (30–60%) following precipitation with acetone and was further isolated with Trypsin-Sepharose affinity chromatography. Analyses were conducted to assess the in vivo digestibility, food intake, body weight evolution and cholecystokinin levels in Wistar rats. Histological analyses of organs and biochemical analyses of sera were performed. RESULTS: The trypsin inhibitor from Tamarindus reduced food consumption, thereby reducing weight gain. The in vivo true digestibility was not significantly different between the control and Tamarindus trypsin inhibitor-treated groups. The trypsin inhibitor from Tamarindus did not cause alterations in biochemical parameters or liver, stomach, intestine or pancreas histology. Rats treated with the trypsin inhibitor showed significantly elevated cholecystokinin levels compared with animals receiving casein or water. CONCLUSION: The results indicate that the isolated trypsin inhibitor from Tamarindus reduces weight gain by reducing food consumption, an effect that may be mediated by increased cholecystokinin. Thus, the potential use of this trypsin inhibitor in obesity prevention and/or treatment should be evaluated. PMID:25789523

  18. Evaluation of between- and within-breed variation in measures of weight-age relationships.

    PubMed

    Jenkins, T G; Kaps, M; Cundiff, L V; Ferrell, C L

    1991-08-01

    Variation between- and within-breeds was evaluated for accretion of weight from birth to 7 yr of age and hip height at 7 yr for 1,577 cows sired by Angus, Brahman, Brown Swiss, Charolais, Chianina, Gelbvieh, Hereford, Jersey, Limousin, Maine Anjou, Pinzgauer, Sahiwal, Simmental, South Devon, and Tarentaise and from either Angus or Hereford dams. Parameters from Wt = A (1 - Be-kt) were estimated by nonlinear regressions and provided estimates of mature body weight (A) and rate of weight accretion relative to change in age (k) for each cow. Actual weight at birth, linear adjusted weights at 200, 365, and 500 d of age, ratios of these weights to mature weight, and height at the hip at 7 yr were analyzed. Beyond 20 mo, weights were adjusted to a constant condition score within breed of sire. Variance and covariance components were derived for breed (sigma 2 b), sires within breed (sigma 2 s), and progeny within sire (sigma 2 w). For all traits, the sigma 2 b estimate of genetic variance ranged from two to four times greater than the variance component for sigma 2 s. Between-breed heritabilities were .91 +/- .27 and .54 +/- .17 for A and k, respectively. Estimates of within-breed heritability for these two traits were .61 +/- .11 and .27 +/- .09. Estimates, both between- and within-breed, of the genetic correlation between A and k were moderate to large and negative; those between A and weights at 200, 365, and 500 d and height at maturity were large and positive. Selection for immediate change in measures of growth would be most effective among breeds. Sufficient direct genetic variation exists between breeds to enhance breed improvement of growth characters through breed substitution. Greater opportunity to alter the shape of the growth curve exists through selection for within-breed selection than through breed substitution. PMID:1894547

  19. Length variations of i-type low-molecular-weight glutenin subunit genes in diploid wheats.

    PubMed

    Long, H; Huang, Z; Wei, Y-M; Yan, Z-H; Ma, Z-C; Zheng, Y-L

    2008-04-01

    Allelic variation of the low-molecular-weight glutenin subunit (LMW-GS) is associated with the significant differences of dough quality in bread and durum wheat, and has been widely evaluated at protein level in wheat and its relatives. In this study, a PCR primer set, targeting the high variable repetitive domains, was employed to assay the length variation of i-type LMW-GS genes in the A-genomes of diploid wheats, the diploid progenitors of tetraploid and hexaploid wheat. A total of 71 accessions of diploid wheats, belonging to two wild and one cultivated species, were investigated. The higher variations of repetitive length in i-type LMW-GS genes were found in diploid wheats with Nei's genetic variation index (H) of 0.834. The two wild species, T. boeoticum and T. urartu, were found to possess the similar degree of variability, with the Nei's genetic variation index of 0.806 and 0.783, respectively. Less variations were detected in T. monococcum (H = 0.680), a cultivated species domesticated from T. boeoticum. The sufficient variations found in this study could be used as valuable sources for the enrichment of the genetic variations and the alteration of flour-processing properties of the cultivated wheat. To our knowledge, it was the first time that an analysis of length variation targeting a particular group of genes of LMW-GS complex multigene families was conducted. PMID:18666554

  20. Inter-individual and seasonal weight variation in rural Nepali women.

    PubMed

    Panter-Brick, C

    1995-04-01

    Changes in body weight were examined for non-pregnant women in rural Nepal, using 183 anthropometric measures between the early winter and monsoon seasons in 1982, 1982-83, 1990-91 and 1993. The women gained weight when work loads decreased after the monsoon, but despite substantial changes in total energy expenditure, which were out of phase with changes in food intake, seasonal changes were small, averaging only up to 2.6% of initial body weight. There were notable differences between individual women, changes in body weight ranging from -5.6 kg to 4.8 kg. Weight change was examined with respect to lactation status, age, body mass index, mid upper arm circumference and skinfolds as well as total energy expenditure and intake. Nonlactating women, very thin women and women aged under 25 years gained more weight than their counterparts, both before and after the monsoon. Data for a sub-sample in 1982-83 indicated that women who maintained high physical activity levels throughout the year were less prone to weight loss than women whose activity fluctuated between seasons. Initial energy reserves, age-related maturation factors, levels of physical activity and energy intake combine to produce the notable inter-individual variation in body weight changes observed in this population. PMID:7738083

  1. The effect of within-year variation in acorn crop size on seed harvesting by avian hoarders.

    PubMed

    Pesendorfer, Mario B; Koenig, Walter D

    2016-05-01

    Spatial and temporal variation in resource distribution affect the movement and foraging behavior of many animals. In the case of animal-dispersed trees, numerous studies have addressed masting-the synchronized variation in seed production between years-but the fitness consequences of spatial variation in seed production within a year are unclear. We investigated the effects of variable acorn production in a population of valley oaks (Quercus lobata) on the composition and behavior of the avian-disperser community. We found that western scrub-jays (Aphelocoma californica), high-quality dispersers that store seeds in the ground, were attracted to, and exhibited increased per capita dispersal rates from, trees with large acorn crops. In contrast, acorn woodpeckers (Melanerpes formicivorus), low-quality dispersers that store acorns in trees where they are unlikely to germinate, increased per capita hoarding rates but did not attend trees with large seed crops in higher numbers, suggesting that the two species responded to resources on different spatial scales. Antagonistic interactions within and between species increased with the number of birds attending a tree, resulting in a potential cost for foraging birds, but did not reduce dispersal rates. Using a simulation model, we estimated that trees with large initial crops experienced a greater proportion (77 %) of high-quality seed dispersal events than trees with small crops (62 %). Our findings provide support for a mechanistic link between seed production and foraging behavior of seed dispersers as predicted by the predator dispersal hypothesis for the functional consequences of variable seed production in hoarder-dispersed trees. PMID:26809620

  2. SEED QUALITY ASSURANCE IN MAIZE BREEDING PROGRAMS: TESTS TO EXPLAIN VARIATIONS IN CORN INBREDS AND POPULATIONS

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Maize (Zea mays L.) breeders are interested in evaluating seed quality of their inbred lines, and seed companies rigorously test the seed quality of the hybrids they produce. Seed quality has a strong relationship to field emergence. There is little information, however, on the influence of the se...

  3. Spatial variations in the associations of term birth weight with ambient air pollution in Georgia, USA.

    PubMed

    Tu, Jun; Tu, Wei; Tedders, Stuart H

    2016-01-01

    Birth weight is an important indicator of overall infant health and a strong predictor of infant morbidity and mortality, and low birth weight (LBW) is a leading cause of infant mortality in the United States. Numerous studies have examined the associations of birth weight with ambient air pollution, but the results were inconsistent. In this study, a spatial statistical technique, geographically weighted regression (GWR) is applied to explore the spatial variations in the associations of birth weight with concentrations of ozone (O3) and fine particulate matter (PM2.5) in the State of Georgia, USA adjusted for gestational age, parity, and six other socioeconomic, behavioral, and land use factors. The results show considerable spatial variations in the associations of birth weight with both pollutants. Significant positive, non-significant, and significant negative relationships between birth weight and concentrations of each air pollutant are all found in different parts of the study area, and the different types of the relationships are affected by the socioeconomic and urban characteristics of the communities where the births are located. The significant negative relationships between birth weight and O3 indicate that O3 is a significant risk factor of LBW and these associations are primarily located in less-urbanized communities. On the other hand, PM2.5 is a significant risk factor of LBW in the more-urbanized communities with higher family income and education attainment. These findings suggest that environmental and health policies should be adjusted to address the different effects of air pollutants on birth outcomes across different types of communities to more effectively and efficiently improve birth outcomes. PMID:27104672

  4. Genetic background and environmental conditions drive metabolic variation in wild type and transgenic soybean (Glycine max) seeds.

    PubMed

    Cohen, Hagai; Shir, Ofer M; Yu, Yang; Hou, Wensheng; Sun, Shi; Han, Tianfu; Amir, Rachel

    2016-08-01

    The metabolic profiles and composition of storage reserves of agricultural crop seeds are strongly regulated by heritable and environmental factors. Yet, very little is known about the genetic and environmental determinants of adaptive metabolic variation amongst wild type as well as transgenic seed populations derived from the same genetic background, grown under natural field conditions. The goal of the current study was to investigate the effects of natural environmental conditions on wild type and transgenic soybean seeds expressing a feedback-insensitive form of cystathionine γ-synthase, a methionine main regulatory enzyme. The seeds were grown in four geographically distinct habitats in China and then assayed for primary metabolic profiles using gas chromatography mass spectrometry, morphological traits and storage reserve accumulation. The analyses revealed changes in the levels of primary metabolites which evidently exhibited high correlation to methionine regardless of changes in environmental conditions. The environment, however, constituted a major determinant of metabolic profiles amongst seeds, as much more metabolites were observed to be affected by this variable, particularly along the north-to-south latitudinal gradient. The observations suggest that metabolic variation amongst seeds grown under natural field conditions depends upon the complex relationships existing amongst their genetic background and the environmental conditions characterizing their cultivation areas. PMID:27038216

  5. Variation in the terrestrial isotopic composition and atomic weight of argon

    USGS Publications Warehouse

    Böhlke, John Karl

    2014-01-01

    The isotopic composition and atomic weight of argon (Ar) are variable in terrestrial materials. Those variations are a source of uncertainty in the assignment of standard properties for Ar, but they provide useful information in many areas of science. Variations in the stable isotopic composition and atomic weight of Ar are caused by several different processes, including (1) isotope production from other elements by radioactive decay (radiogenic isotopes) or other nuclear transformations (e.g., nucleogenic isotopes), and (2) isotopic fractionation by physical-chemical processes such as diffusion or phase equilibria. Physical-chemical processes cause correlated mass-dependent variations in the Ar isotope-amount ratios (40Ar/36Ar, 38Ar/36Ar), whereas nuclear transformation processes cause non-mass-dependent variations. While atmospheric Ar can serve as an abundant and homogeneous isotopic reference, deviations from the atmospheric isotopic ratios in other Ar occurrences limit the precision with which a standard atomic weight can be given for Ar. Published data indicate variation of Ar atomic weights in normal terrestrial materials between about 39.7931 and 39.9624. The upper bound of this interval is given by the atomic mass of 40Ar, as some samples contain almost pure radiogenic 40Ar. The lower bound is derived from analyses of pitchblende (uranium mineral) containing large amounts of nucleogenic 36Ar and 38Ar. Within this interval, measurements of different isotope ratios (40Ar/36Ar or 38Ar/36Ar) at various levels of precision are widely used for studies in geochronology, water–rock interaction, atmospheric evolution, and other fields.

  6. Genetic variation and seed transfer guidelines for ponderosa pine in the Ochoco and Malheur National Forests of central Oregon. Forest Service research paper

    SciTech Connect

    Sorensen, F.C.; Weber, J.C.

    1994-02-01

    Adaptive genetic variation in seed and seedling traits was evaluated for 280 families from 220 locations. Factor scores from three principal components were related by multiple regression to latitude, longitude, elevation, slope, and aspect of the seed source, and by classification analysis to seed zone and elevation band in seed zone. Location variance was significant but not large. Multiple regression equations explained less than 50 percent of location variance. Slope-aspect variables were important.

  7. Conflicting selection from fire and seed predation drives fine-scaled phenotypic variation in a widespread North American conifer

    PubMed Central

    Talluto, Matthew V.; Benkman, Craig W.

    2014-01-01

    Recent work has demonstrated that evolutionary processes shape ecological dynamics on relatively short timescales (eco-evolutionary dynamics), but demonstrating these effects at large spatial scales in natural landscapes has proven difficult. We used empirical studies and modeling to investigate how selective pressures from fire and predispersal seed predation affect the evolution of serotiny, an ecologically important trait. Serotiny is a highly heritable key reproductive trait in Rocky Mountain lodgepole pine (Pinus contorta subsp. latifolia), a conifer that dominates millions of hectares in western North America. In these forests, the frequency of serotiny determines postfire seedling density with corresponding community- and ecosystem-level effects. We found that serotinous individuals have a selective advantage at high fire frequencies and low predation pressure; however, very high seed predation shifted the selective advantage to nonserotinous individuals even at high fire frequencies. Simulation modeling suggests that spatial variation in the frequency of serotiny results from heterogeneity in these two selective agents. These results, combined with previous findings showing a negative association between the density of seed predators and the frequency of serotiny at both landscape and continental scales, demonstrate that contemporary patterns in serotiny reflect an evolutionary response to conflicting selection pressures from fire and seed predation. Thus, we show that variation in the frequency of a heritable polygenic trait depends on spatial variation in two dominant selective agents, and, importantly, the effects of the local trait variation propagate with profound consequences to the structure and function of communities and ecosystems across a large landscape. PMID:24979772

  8. Genome-wide association study of Arabidopsis thaliana identifies determinants of natural variation in seed oil composition

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The renewable source of highly reduced carbon provided by plant triacylglycerols fills an ever increasing demand for food, biodiesel and industrial chemicals. Each of these uses requires different compositions of fatty acid proportions in seed oils. Identifying the genes responsible for variation in...

  9. Conflicting selection from fire and seed predation drives fine-scaled phenotypic variation in a widespread North American conifer.

    PubMed

    Talluto, Matthew V; Benkman, Craig W

    2014-07-01

    Recent work has demonstrated that evolutionary processes shape ecological dynamics on relatively short timescales (eco-evolutionary dynamics), but demonstrating these effects at large spatial scales in natural landscapes has proven difficult. We used empirical studies and modeling to investigate how selective pressures from fire and predispersal seed predation affect the evolution of serotiny, an ecologically important trait. Serotiny is a highly heritable key reproductive trait in Rocky Mountain lodgepole pine (Pinus contorta subsp. latifolia), a conifer that dominates millions of hectares in western North America. In these forests, the frequency of serotiny determines postfire seedling density with corresponding community- and ecosystem-level effects. We found that serotinous individuals have a selective advantage at high fire frequencies and low predation pressure; however, very high seed predation shifted the selective advantage to nonserotinous individuals even at high fire frequencies. Simulation modeling suggests that spatial variation in the frequency of serotiny results from heterogeneity in these two selective agents. These results, combined with previous findings showing a negative association between the density of seed predators and the frequency of serotiny at both landscape and continental scales, demonstrate that contemporary patterns in serotiny reflect an evolutionary response to conflicting selection pressures from fire and seed predation. Thus, we show that variation in the frequency of a heritable polygenic trait depends on spatial variation in two dominant selective agents, and, importantly, the effects of the local trait variation propagate with profound consequences to the structure and function of communities and ecosystems across a large landscape. PMID:24979772

  10. Seasonal Variation in the Fate of Seeds under Contrasting Logging Regimes

    PubMed Central

    Fleury, Marina; Rodrigues, Ricardo R.; do Couto, Hilton T. Z.; Galetti, Mauro

    2014-01-01

    Seed predators and dispersers may drive the speed and structure of forest regeneration in natural ecosystems. Rodents and ants prey upon and disperse seeds, yet empirical studies on the magnitude of these effects are lacking. Here, we examined the role of ants and rodents on seed predation in 4 plant species in a successional gradient on a tropical rainforest island. We found that (1) seeds are mostly consumed rather than dispersed; (2) rates of seed predation vary by habitat, season, and species; (3) seed size, shape, and hardness do not affect the probability of being depredated. Rodents were responsible for 70% of seed predation and were negligible (0.14%) seed dispersers, whereas ants were responsible for only 2% of seed predation and for no dispersal. We detected seasonal and habitat effects on seed loss, with higher seed predation occurring during the wet season and in old-growth forests. In the absence of predators regulating seed-consumer populations, the densities of these resilient animals explode to the detriment of natural regeneration and may reduce diversity and carrying capacity for consumers and eventually lead to ecological meltdown. PMID:24614500

  11. Seed set, berry weight, and yield interactions in highbush blueberry cultivars (Vaccinium corymbosum L.) ‘Bluecrop’ and ‘Duke’

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Yields and berry weights of two widely grown, commercial, highbush blueberry cultivars, ‘Bluecrop’ and ‘Duke’, were evaluated for 3 or more harvests every season over ten years, and seed set was determined at each harvest over the last four. Across 10 years, yield and berry weight had no significant...

  12. Switchgrass (Panicum virgatum L.) Intraspecific Variation and Thermotolerance Classification Using in Vitro Seed Germination Assay

    DOE PAGESBeta

    Seepaul, Ramdeo; Macoon, Bisoondat; Reddy, K. Raja; Baldwin, Brian

    2011-06-01

    Cardinal temperatures for plant processes have been used for thermotolerance screening of genotypes, geoclimatic adaptability determination and phenological prediction. Current simulation models for switchgrass (Panicum virgatum L.) utilize single cardinal temperatures across genotypes for both vegetative and reproductive processes although in-tra-specific variation exists among genotypes. An experiment was conducted to estimate the cardinal temperatures for seed germination of 14 diverse switchgrass genotypes and to classify genotypes for temperature tolerance. Stratified seeds of each genotype were germinated at eight constant temperatures from 10 °C to 45 °C under a constant light intensity of 35 μmol m-2s-1 for 12 hd-1. Germination wasmore » recorded at 6-h intervals in all treatments. Maximum seed germination (MSG) and germination rate (GR), estimated by fitting Sigmoidal function to germination-time series data, varied among genotypes. Quadratic and bilinear models best described the MSG and GR responses to temperature, respectively. The mean cardinal temperatures, Tmin, Topt, and Tmax, were 8.1, 26.6, and 45.1 °C for MSG and 11.1, 33.1, and 46.0 °C for GR, respectively. Cardinal temperatures for MSG and GR; however, varied significantly among genotypes. Genotypes were classified as sensitive (Cave-in-Rock, Dacotah, Expresso, Forestburg˜, Kanlow, ˜Sunburst, Trailblazer, and ˜Tusca™), intermediate (˜Alamo, Blackwell, Carthage, ˜Shawnee™, and Shelter™) and tolerant (˜Summer) to high temperature based on cumulative temperature response index (CTRI) estimated by summing individual response indices estimated from the MSG and GR cardinal temperatures. Similarly, genotypes were also classified as sensitive (Alamo, Blackwell, Carthage, Dacotah, Shawnee, Shelter and Summer), moderately sensitive (Cave-in-rock, Forestburg, Kanlow, Sunburst, and Tusca), moderately tolerant (Trailblazer), and tolerant (Expresso) to low temperatures. The cardinal

  13. Switchgrass (Panicum virgatum L.) Intraspecific Variation and Thermotolerance Classification Using in Vitro Seed Germination Assay

    SciTech Connect

    Seepaul, Ramdeo; Macoon, Bisoondat; Reddy, K. Raja; Baldwin, Brian

    2011-06-01

    Cardinal temperatures for plant processes have been used for thermotolerance screening of genotypes, geoclimatic adaptability determination and phenological prediction. Current simulation models for switchgrass (Panicum virgatum L.) utilize single cardinal temperatures across genotypes for both vegetative and reproductive processes although in-tra-specific variation exists among genotypes. An experiment was conducted to estimate the cardinal temperatures for seed germination of 14 diverse switchgrass genotypes and to classify genotypes for temperature tolerance. Stratified seeds of each genotype were germinated at eight constant temperatures from 10 °C to 45 °C under a constant light intensity of 35 μmol m-2s-1 for 12 hd-1. Germination was recorded at 6-h intervals in all treatments. Maximum seed germination (MSG) and germination rate (GR), estimated by fitting Sigmoidal function to germination-time series data, varied among genotypes. Quadratic and bilinear models best described the MSG and GR responses to temperature, respectively. The mean cardinal temperatures, Tmin, Topt, and Tmax, were 8.1, 26.6, and 45.1 °C for MSG and 11.1, 33.1, and 46.0 °C for GR, respectively. Cardinal temperatures for MSG and GR; however, varied significantly among genotypes. Genotypes were classified as sensitive (Cave-in-Rock, Dacotah, Expresso, Forestburg˜, Kanlow, ˜Sunburst, Trailblazer, and ˜Tusca™), intermediate (˜Alamo, Blackwell, Carthage, ˜Shawnee™, and Shelter™) and tolerant (˜Summer) to high temperature based on cumulative temperature response index (CTRI) estimated by summing individual response indices estimated from the MSG and GR cardinal temperatures. Similarly, genotypes were also classified as sensitive (Alamo, Blackwell, Carthage, Dacotah, Shawnee, Shelter and Summer), moderately sensitive (Cave-in-rock, Forestburg, Kanlow, Sunburst, and Tusca), moderately tolerant (Trailblazer), and

  14. Genome-Wide Association Study of Arabidopsis thaliana Identifies Determinants of Natural Variation in Seed Oil Composition.

    PubMed

    Branham, Sandra E; Wright, Sara J; Reba, Aaron; Linder, C Randal

    2016-05-01

    The renewable source of highly reduced carbon provided by plant triacylglycerols (TAGs) fills an ever increasing demand for food, biodiesel, and industrial chemicals. Each of these uses requires different compositions of fatty acid proportions in seed oils. Identifying the genes responsible for variation in seed oil composition in nature provides targets for bioengineering fatty acid proportions optimized for various industrial and nutrition goals. Here, we characterized the seed oil composition of 391 world-wide, wild accessions of Arabidopsis thaliana, and performed a genome-wide association study (GWAS) of the 9 major fatty acids in the seed oil and 4 composite measures of the fatty acids. Four to 19 regions of interest were associated with the seed oil composition traits. Thirty-four of the genes in these regions are involved in lipid metabolism or transport, with 14 specific to fatty acid synthesis or breakdown. Eight of the genes encode transcription factors. We have identified genes significantly associated with variation in fatty acid proportions that can be used as a resource across the Brassicaceae. Two-thirds of the regions identified contain candidate genes that have never been implicated in lipid metabolism and represent potential new targets for bioengineering. PMID:26704140

  15. Integration of Experiments across Diverse Environments Identifies the Genetic Determinants of Variation in Sorghum bicolor Seed Element Composition.

    PubMed

    Shakoor, Nadia; Ziegler, Greg; Dilkes, Brian P; Brenton, Zachary; Boyles, Richard; Connolly, Erin L; Kresovich, Stephen; Baxter, Ivan

    2016-04-01

    Seedling establishment and seed nutritional quality require the sequestration of sufficient element nutrients. The identification of genes and alleles that modify element content in the grains of cereals, including sorghum (Sorghum bicolor), is fundamental to developing breeding and selection methods aimed at increasing bioavailable element content and improving crop growth. We have developed a high-throughput work flow for the simultaneous measurement of multiple elements in sorghum seeds. We measured seed element levels in the genotyped Sorghum Association Panel, representing all major cultivated sorghum races from diverse geographic and climatic regions, and mapped alleles contributing to seed element variation across three environments by genome-wide association. We observed significant phenotypic and genetic correlation between several elements across multiple years and diverse environments. The power of combining high-precision measurements with genome-wide association was demonstrated by implementing rank transformation and a multilocus mixed model to map alleles controlling 20 element traits, identifying 255 loci affecting the sorghum seed ionome. Sequence similarity to genes characterized in previous studies identified likely causative genes for the accumulation of zinc, manganese, nickel, calcium, and cadmium in sorghum seeds. In addition to strong candidates for these five elements, we provide a list of candidate loci for several other elements. Our approach enabled the identification of single-nucleotide polymorphisms in strong linkage disequilibrium with causative polymorphisms that can be evaluated in targeted selection strategies for plant breeding and improvement. PMID:26896393

  16. Integration of Experiments across Diverse Environments Identifies the Genetic Determinants of Variation in Sorghum bicolor Seed Element Composition1[OPEN

    PubMed Central

    Connolly, Erin L.

    2016-01-01

    Seedling establishment and seed nutritional quality require the sequestration of sufficient element nutrients. The identification of genes and alleles that modify element content in the grains of cereals, including sorghum (Sorghum bicolor), is fundamental to developing breeding and selection methods aimed at increasing bioavailable element content and improving crop growth. We have developed a high-throughput work flow for the simultaneous measurement of multiple elements in sorghum seeds. We measured seed element levels in the genotyped Sorghum Association Panel, representing all major cultivated sorghum races from diverse geographic and climatic regions, and mapped alleles contributing to seed element variation across three environments by genome-wide association. We observed significant phenotypic and genetic correlation between several elements across multiple years and diverse environments. The power of combining high-precision measurements with genome-wide association was demonstrated by implementing rank transformation and a multilocus mixed model to map alleles controlling 20 element traits, identifying 255 loci affecting the sorghum seed ionome. Sequence similarity to genes characterized in previous studies identified likely causative genes for the accumulation of zinc, manganese, nickel, calcium, and cadmium in sorghum seeds. In addition to strong candidates for these five elements, we provide a list of candidate loci for several other elements. Our approach enabled the identification of single-nucleotide polymorphisms in strong linkage disequilibrium with causative polymorphisms that can be evaluated in targeted selection strategies for plant breeding and improvement. PMID:26896393

  17. Natural variation of fecundity components in a widespread plant with dimorphic seeds

    NASA Astrophysics Data System (ADS)

    Braza, Rita; Arroyo, J.; García, M. B.

    2010-09-01

    The number and size of seeds are the basis of the quantity and quality components of female reproductive fitness in plants, playing a central role in the evolutionary ecology of life history diversification. In this study we show and analyze the natural variability of several fecundity variables (fruit set, seed production per fruit, seed size, total seed production per plant, and proportion of small seeds) in Plantago coronopus, a widespread, short-lived herb with dimorphic seeds. The structure of such variability was examined at the individual, population (eight locations with different environments within the same region), and life history levels (annual vs perennial), and correlated to soil fertility. There was no divergence associated to the life history for any of the variables studied. Total seed production (the quantity component of female fitness) was correlated with maternal resources, while the size of the large mucilaginous, basal seeds, and the proportion of the small apical seeds (quality component) were more associated to environmental resources. Thus, internal and external resources shape different fitness components, maximizing seed production, and fitting the size and proportion of different kind of seeds to local conditions irrespective of life history. P. coronopus illustrates the versatility of short-lived widespread plants to combine fecundity traits in a flexible manner, in order to increase fitness at each of the many possible habitats they occupy over heterogeneous environments.

  18. Intraspecific variation in seed dispersal of a Neotropical tree and its relationship to fruit and tree traits.

    PubMed

    Augspurger, Carol K; Franson, Susan E; Cushman, Katherine C; Muller-Landau, Helene C

    2016-02-01

    The distribution of wind-dispersed seeds around a parent tree depends on diaspore and tree traits, as well as wind conditions and surrounding vegetation. This study of a neotropical canopy tree, Platypodium elegans, explored the extent to which parental variation in diaspore and tree traits explained (1) rate of diaspore descent in still air, (2) distributions of diaspores dispersed from a 40-m tower in the forest, and (3) natural diaspore distributions around the parent tree. The geometric mean rate of descent in still air among 20 parents was highly correlated with geometric mean wing loading(1/2) (r = 0.84). However, diaspore traits and rate of descent predicted less variation in dispersal distance from the tower, although descent rate(-1) consistently correlated with dispersal distance. Measured seed shadows, particularly their distribution edges, differed significantly among six parents (DBH range 62-181 cm) and were best fit by six separate anisotropic dispersal kernels and surveyed fecundities. Measured rate of descent and tree traits, combined in a mechanistic seed dispersal model, did not significantly explain variation among parents in natural seed dispersal distances, perhaps due to the limited power to detect effects with only six trees. Seedling and sapling distributions were at a greater mean distance from the parents than seed distributions; saplings were heavily concentrated at far distances. Variation among parents in the distribution tails so critical for recruitment could not be explained by measured diaspore or tree traits with this sample size, and may be determined more by wind patterns and the timing of abscission in relation to wind conditions. Studies of wind dispersal need to devote greater field efforts at recording the "rare" dispersal events that contribute to far dispersal distances, following their consequences, and in understanding the mechanisms that generate them. PMID:26839686

  19. Variations and controlling factors of the coccolith weight in the Western Pacific Warm Pool over the last 200 ka

    NASA Astrophysics Data System (ADS)

    Liang, Dan; Liu, Chuanlian

    2016-06-01

    Using a coccolith weight analytic software (Particle Analyser), we analyze most abundant coccolith species in a sediment core from the central Western Pacific Warm Pool (WPWP) and calculate coccolith size and weight variations over the last 200 ka. These variations are compared with the trends of sea surface temperature (SST), primary productivity (PP), sea surface salinity (SSS), and insolation. Our results demonstrate that the size and weight of the coccoliths varied in response to variations of these factors, and their average total weight is primarily related to the relative abundance of the dominant species GEO ( Gephyrocapsa oceanica). The variation in weight of EMI ( Emiliania huxleyi) and GEE ( Gephyrocapsa ericsonii) are mainly influenced by nutrients, and the variation of GEM ( G. muellerae conformis) and GEO ( G. oceanica) weight are mainly influenced by SST. For all of the taxa weight, PP and SST present apparent precession or semi-precession cycles, we consider that the mono-coccolith weight of the Equatorial Western Pacific is primarily affected by precession drived thermocline and nutricline variation.

  20. Weighted pseudometric discriminatory power improvement using a Bayesian logistic regression model based on a variational method.

    PubMed

    Ksantini, Riadh; Ziou, Djemel; Colin, Bernard; Dubeau, François

    2008-02-01

    In this paper, we investigate the effectiveness of a Bayesian logistic regression model to compute the weights of a pseudo-metric, in order to improve its discriminatory capacity and thereby increase image retrieval accuracy. In the proposed Bayesian model, the prior knowledge of the observations is incorporated and the posterior distribution is approximated by a tractable Gaussian form using variational transformation and Jensen's inequality, which allow a fast and straightforward computation of the weights. The pseudo-metric makes use of the compressed and quantized versions of wavelet decomposed feature vectors, and in our previous work, the weights were adjusted by classical logistic regression model. A comparative evaluation of the Bayesian and classical logistic regression models is performed for content-based image retrieval as well as for other classification tasks, in a decontextualized evaluation framework. In this same framework, we compare the Bayesian logistic regression model to some relevant state-of-the-art classification algorithms. Experimental results show that the Bayesian logistic regression model outperforms these linear classification algorithms, and is a significantly better tool than the classical logistic regression model to compute the pseudo-metric weights and improve retrieval and classification performance. Finally, we perform a comparison with results obtained by other retrieval methods. PMID:18084057

  1. Interspecific variation in persistence of buried weed seeds follows trade-offs among physiological, chemical and physical seed defences

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Soil seedbanks drive infestations of annual weeds, yet weed management focuses largely on seedling mortality. As weed seedbanks increasingly become reservoirs of herbicide resistance, species-specific seedbank management approaches will be essential. Limited understanding of interspecific variation ...

  2. Toxicity of anthraquinones: differential effects of rumex seed extracts on rat organ weights and biochemical and haematological parameters.

    PubMed

    Islam, Rabigul; Mamat, Yultuz; Ismayil, Ilyar; Yan, Ming; Kadir, Mahsutjan; Abdugheny, Abdujilil; Rapkat, Haximjan; Niyaz, Mardan; Ali, Yusupjan; Abay, Sirapil

    2015-05-01

    The genus Rumex and related species such as Rheum and Polygonum are widely used as medicinal herbs and foods. They contain anthraquinones (AQ) such as emodin and chrysophanol as active ingredients, and there is concern about the toxicity of these compounds. This study evaluated the chronic effects of Rumex patientia seed aqueous and ethanolic extracts, in male and female rats separately, on organ weights and over 30 haematological, biochemical and histological parameters, immediately after 14-week administration and after a further period of 15 days without drug treatment. Adverse changes were associated with long-term AQ administration, and these focussed on the liver, lung and kidney, but after 15-day convalescence, most had reverted to normal. In general, male rats appeared to be more susceptible than female rats at similar doses. The water extract produced no irreversible changes, which may reflect the lower dose of the AQ constituents or the presence of different ancillary compounds, and supports the traditional method of extracting Rumex seeds with water. In conclusion, ethanolic extracts of R. patientia caused irreversible pathological changes at very high doses (4000mg/kg), but lower doses and aqueous extracts produced either non-significant or reversible changes. Long-term administration of high doses of AQ extracts over a long period of time should be avoided until further assurances can be given, and given other existing reports of reproductive toxicity, should be avoided altogether during pregnancy. PMID:25753342

  3. Isoflavones in soybean seeds: Genetic variation and environmental effects in field-grown crops

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Both controlled environment and field studies indicate that isoflavones, a dietary source of a class of bioactive phytochemicals present primarily in soybean seeds, increase greatly when seeds mature under cooler conditions or when plants are well-watered. Environmental effects can be superimposed ...

  4. Tocopherols in soybean seeds: genetic variation and environmental effects in field-grown crops

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The fraction of tocopherol (T) in soybean seeds present as alpha-tocopherol (aT) has been shown to increase several fold as a result of relatively mild increases in temperature or extreme drought during seed maturation, whereas total tocopherols (Ttot) remain approximately constant. These observatio...

  5. Variation in seed oil and protein content among diverse cotton (Gossypium sp.) germplasm

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Cottonseed embryos are comprised of oil and protein reserves that serve as a vital carbon, nitrogen and energy source during seed germination. These storage compounds also are a source of commercial vegetable oil and protein meal. Most historical surveys for quantifying either seed oil and/or prot...

  6. GENETIC VARIATION FOR SEED MINERAL AND PROTEIN CONCENTRATION IN DIVERSE GERMPLASM OF CHICKPEA

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Chickpea (Cicer arietinum) is an important food legume that can provide significant amounts of dietary minerals and protein to humans. In order to better understand the genetic diversity that exists for these nutrients, we have assessed seed mineral concentration and seed protein concentration in 2...

  7. Variation in Yield of Near-isogenic Soybean Lines for High and Low Seed Coat Peroxidase

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Peroxidase is an enzyme present in soybean [Glycine max (L.) Merrill] seed coats and is characterized as either high (dominant allele) or low (recessive allele) activity. Cultivar Cutler 71 is a mixture of high and low seed coat peroxidase genotypes. Mechanical mixtures of 1 high: 1 low peroxidase...

  8. Geographic variation in seed traits within and among forty-two species of Rhododendron (Ericaceae) on the Tibetan plateau: relationships with altitude, habitat, plant height, and phylogeny

    PubMed Central

    Wang, Yongji; Wang, Jianjian; Lai, Liming; Jiang, Lianhe; Zhuang, Ping; Zhang, Lehua; Zheng, Yuanrun; Baskin, Jerry M; Baskin, Carol C

    2014-01-01

    Seed mass and morphology are plant life history traits that influence seed dispersal ability, seeding establishment success, and population distribution pattern. Southeastern Tibet is a diversity center for Rhododendron species, which are distributed from a few hundred meters to 5500 m above sea level. We examined intra- and interspecific variation in seed mass and morphology in relation to altitude, habitat, plant height, and phylogeny. Seed mass decreased significantly with the increasing altitude and increased significantly with increasing plant height among populations of the same species. Seed mass differed significantly among species and subsections, but not among sections and subgenera. Seed length, width, surface area, and wing length were significantly negative correlated with altitude and significantly positive correlated with plant height. Further, these traits differed significantly among habitats and varied among species and subsection, but not among sections and subgenera. Species at low elevation had larger seeds with larger wings, and seeds became smaller and the wings of seeds tended to be smaller with the increasing altitude. Morphology of the seed varied from flat round to long cylindrical with increasing altitude. We suggest that seed mass and morphology have evolved as a result of both long-term adaptation and constraints of the taxonomic group over their long evolutionary history. PMID:24963385

  9. Influence of some sow characteristics on within-litter variation of piglet birth weight.

    PubMed

    Quesnel, H; Brossard, L; Valancogne, A; Quiniou, N

    2008-12-01

    Within-litter variation of piglet birth weight (BW0) is associated with an increased piglet mortality and a high variability in pig weight at weaning and weight or age at slaughter. Data collected in two experimental herds were used to quantify within-litter variability in BW0 and to assess the influence of factors mainly related to the sow. Within 24 h after birth, piglets born alive were individually weighed and stillborn piglets were collectively (first data set) or individually (second data set) weighed. The first data set was restricted to litters with no or only one stillborn piglet (3338 litters). It was used to assess the influence of genetic selection on BW0 variation by comparing litter characteristics before (1994 to 1996) and after (2001 to 2004) the development of hyperprolific sows in this herd. The second data set included all litters (n = 1596) from sows born between 2000 and 2004. For each litter, mean BW0 (mBW0) and its coefficient of variation (CVBW0) were calculated. Then, variance analyses were performed to test the influence of litter size, parity, year of sow birth and season at conception. Prolificacy improvement was associated with an increased CVBW0 in litters from pure Large White (LW) and Landrace × Large White (LR × LW) crossbred sows. The CVBW0 averaged 21% and was significantly influenced by litter size and parity. It increased from 15% to 24% when litter size varied from less than 10 piglets to more than 15 piglets. The proportion of small piglets (i.e. weighing less than 1 kg) increased concomitantly. The CVBW0 was not repeatable from a parity to the following. It was lowest for first and second parities (20%) and thereafter increased progressively. The CVBW0 was positively related to sow's backfat thickness gain during gestation. Taking into account litter size, parity, year of sow birth and season at conception explained 20% of BW0 variation. Thus, major part of heterogeneity is due to other factors, presumably including embryo

  10. A reexamination of age-related variation in body weight and morphometry of Maryland nutria

    USGS Publications Warehouse

    Sherfy, M.H.; Mollett, T.A.; McGowan, K.R.; Daugherty, S.L.

    2006-01-01

    Age-related variation in morphometry has been documented for many species. Knowledge of growth patterns can be useful for modeling energetics, detecting physiological influences on populations, and predicting age. These benefits have shown value in understanding population dynamics of invasive species, particularly in developing efficient control and eradication programs. However, development and evaluation of descriptive and predictive models is a critical initial step in this process. Accordingly, we used data from necropsies of 1,544 nutria (Myocastor coypus) collected in Maryland, USA, to evaluate the accuracy of previously published models for prediction of nutria age from body weight. Published models underestimated body weights of our animals, especially for ages <3. We used cross-validation procedures to develop and evaluate models for describing nutria growth patterns and for predicting nutria age. We derived models from a randomly selected model-building data set (n = 192-193 M, 217-222 F) and evaluated them with the remaining animals (n = 487-488 M, 642-647 F). We used nonlinear regression to develop Gompertz growth-curve models relating morphometric variables to age. Predicted values of morphometric variables fell within the 95% confidence limits of their true values for most age classes. We also developed predictive models for estimating nutria age from morphometry, using linear regression of log-transformed age on morphometric variables. The evaluation data set corresponded with 95% prediction intervals from the new models. Predictive models for body weight and length provided greater accuracy and less bias than models for foot length and axillary girth. Our growth models accurately described age-related variation in nutria morphometry, and our predictive models provided accurate estimates of ages from morphometry that will be useful for live-captured individuals. Our models offer better accuracy and precision than previously published models

  11. Investigation of variation of precipitation by the cloud seeding using WRF-CHEM model

    NASA Astrophysics Data System (ADS)

    Chae, S.; Lee, K.; Lee, C.; Ahn, K.; Choi, Y.

    2012-12-01

    Resent observational and numerical studies demonstrate a significant effect of aerosols on the amount of precipitation and its spatial distribution. Airborne cloud seeding experiments using the AgI particles have been carried out in Korea. The Weather Research Forecast model coupled with chemistry mechanism and aerosol modules (WRF-CHEM) is used to investigate the effects of the airborne cloud seeding on precipitation. The sensitivity tests (EXP 1, 2, and 3) of the WRF-CHEM were performed on the airborne cloud seeding experiments. EXP 1 is a control run from the original WRF model which has no aerosol effect. EXP 2 and EXP 3 are the WRF-CHEM simulations coupled with RADM2/MADE-SORGAM modules and CBMZ/MOSAIC modules, respectively. The AgI seeding was considered as an emission of primary PM2.5 in the simulations. The unspeciated primary PM2.5 are of 10000 μg/(m2s) at 0.5 km about the ground level to simulate the cloud seeding in both cases. The results of sensitivity experiments with the chemistry mechanism and aerosol schemes showed that for the six hours after the seeding, the accumulated amounts of precipitation increased about 14% for EXP 2 and 45% for EXP3, compared to EXP 1. Also, the simulations showed that the seeding brought initial precipitation time forward aerosol by 10 minutes.

  12. Interspecific and annual variation in pre-dispersal seed predation by a granivorous bird in two East Asian hackberries, Celtis biondii and Celtis sinensis.

    PubMed

    Yoshikawa, T; Masaki, T; Isagi, Y; Kikuzawa, K

    2012-05-01

    Pre-dispersal seed predation by granivorous birds has potential to limit fruit removal and subsequent seed dispersal by legitimate avian seed dispersers in bird-dispersed plants, especially when the birds form flocks. We monitored pre-dispersal seed predation by the Japanese grosbeak, Eophona personata, of two bird-dispersed hackberry species (Cannabaceae), Celtis biondii (four trees) and Celtis sinensis (10 trees), for 3 years (2005, 2007 and 2008) in a fragmented forest in temperate Japan. Throughout the 3 years, predation was more intense on C. biondii, which, as a consequence, lost a larger part of its fruit crop. Grosbeaks preferred C. biondii seeds that had a comparatively lower energy content and lower hardness than C. sinensis, suggesting an association between seed hardness and selective foraging by grosbeaks. In C. biondii, intensive predation markedly reduced fruit duration and strongly limited fruit removal by seed dispersers, especially in 2007 and 2008. In C. sinensis, seed dispersers consumed fruits throughout the fruiting seasons in all 3 years. In C. biondii, variation in the timing of grosbeak migration among years was associated with annual variation in this bird's effects on fruit removal. Our results demonstrate that seed predation by flocks of granivorous birds can dramatically disrupt seed dispersal in fleshy-fruited plants and suggest the importance of understanding their flocking behaviour. PMID:22136589

  13. Evapotranspiration partitioning and variation of sap flow in female and male parents of maize for hybrid seed production in arid region

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Understanding the variation of sap flow in female and male parents of maize for hybrid seed production and evapotranspiration (ET) partitioning is useful in accurately determining water use of the female and male parents and improving irrigation management of maize for hybrid seed production. Sap fl...

  14. Image deblurring associated with shearlet sparsity and weighted anisotropic total variation

    NASA Astrophysics Data System (ADS)

    Qiaohong, Liu; Bin, Li; Min, Lin

    2015-03-01

    Image deblurring is one of the classical problems in image processing. The main purpose of image deblurring is to restore the images corrupted by blur and additive noise while preserving edges and details. We focus on the nonblind image deblurring (NBID) problem. In order to obtain good deblurred images, we propose an NBID method based on a compound regularization model associated with the shearlet-based sparsity and the weighted anisotropic total variation. Based on this model, we present an alternative iterative scheme which consists of the operator splitting and penalty techniques. The split Bregman-based multivariable minimization iteration is introduced to optimize the proposed NBID inverse problem. Compared with some previous methods, the experiments demonstrate the efficiency and viability of the proposed method for preserving sharp edges and structural details of the image while mitigating the artifacts.

  15. Total variation-regularized weighted nuclear norm minimization for hyperspectral image mixed denoising

    NASA Astrophysics Data System (ADS)

    Wu, Zhaojun; Wang, Qiang; Wu, Zhenghua; Shen, Yi

    2016-01-01

    Many nuclear norm minimization (NNM)-based methods have been proposed for hyperspectral image (HSI) mixed denoising due to the low-rank (LR) characteristics of clean HSI. However, the NNM-based methods regularize each eigenvalue equally, which is unsuitable for the denoising problem, where each eigenvalue stands for special physical meaning and should be regularized differently. However, the NNM-based methods only exploit the high spectral correlation, while ignoring the local structure of HSI and resulting in spatial distortions. To address these problems, a total variation (TV)-regularized weighted nuclear norm minimization (TWNNM) method is proposed. To obtain the desired denoising performance, two issues are included. First, to exploit the high spectral correlation, the HSI is restricted to be LR, and different eigenvalues are minimized with different weights based on the WNNM. Second, to preserve the local structure of HSI, the TV regularization is incorporated, and the alternating direction method of multipliers is used to solve the resulting optimization problem. Both simulated and real data experiments demonstrate that the proposed TWNNM approach produces superior denoising results for the mixed noise case in comparison with several state-of-the-art denoising methods.

  16. QTL Location and Epistatic Effect Analysis of 100-Seed Weight Using Wild Soybean (Glycine soja Sieb. & Zucc.) Chromosome Segment Substitution Lines

    PubMed Central

    Zhu, Rongsheng; Hu, Jiahui; Han, Heyu; Hu, Guohua; Liu, Chunyan; Chen, Qingshan

    2016-01-01

    Increasing the yield of soybean (Glycine max L. Merrill) is a main aim of soybean breeding. The 100-seed weight is a critical factor for soybean yield. To facilitate genetic analysis of quantitative traits and to improve the accuracy of marker-assisted breeding in soybean, a valuable mapping population consisting of 194 chromosome segment substitution lines (CSSLs) was developed. In these lines, different chromosomal segments of the Chinese cultivar Suinong 14 were substituted into the genetic background of wild soybean (Glycine soja Sieb. & Zucc.) ZYD00006. Based on these CSSLs, a genetic map covering the full genome was generated using 121 simple sequence repeat (SSR) markers. In the quantitative trait loci (QTL) analysis, twelve main effect QTLs (qSW-B1-1/2/3, qSW-D1b-1/2, qSW-D2-1/2, qSW-G-1/2/3, qSW-M-2 and qSW-N-2) underlying 100-seed weight were identified in 2011 and 2012. The epistatic effects of pairwise interactions between markers were analyzed in 2011 and 2012. The results clearly demonstrated that these CSSLs could be used to identify QTLs, and that an epistatic analysis was able to detect several sites with important epistatic effects on 100-seed weight. Thus, we identified loci that will be valuable for improving soybean 100-seed weight. These results provide a valuable foundation for identifying the precise location of genes of interest, and for designing cloning and marker-assisted selection breeding strategies targeting the 100-seed weight of soybean. PMID:26934088

  17. Genetic variation of the weaning weight of beef cattle as a function of accumulated heat stress.

    PubMed

    Santana, M L; Bignardi, A B; Eler, J P; Ferraz, J B S

    2016-04-01

    The objective of this study was to identify the genetic variation in the weaning weight (WW) of beef cattle as a function of heat stress. The WWs were recorded at approximately 205 days of age in three Brazilian beef cattle populations: Nelore (93,616), Brangus (18,906) and Tropical Composite (62,679). In view of the cumulative nature of WW, the effect of heat stress was considered as the accumulation of temperature and humidity index units (ACTHI) from the animal's birth to weaning. A reaction norm model was used to estimate the (co)variance components of WW across the ACTHI scale. The accumulation of THI units from birth to weaning negatively affected the WW. The definition of accumulated THI units as an environmental descriptor permitted to identify important genetic variation in the WW as a function of heat stress. As evidence of genotype by environment interaction, substantial heterogeneity was observed in the (co)variance components for WW across the environmental gradient. In this respect, the best animals in less stressful environments are not necessarily the best animals in more stressful environments. Furthermore, the response to selection for WW is expected to be lower in more stressful environments. PMID:26061790

  18. Energy-weighted Amplitude Variation with Offset: A new AVO attribute for low impedance gas sands

    NASA Astrophysics Data System (ADS)

    Farfour, Mohammed; Yoon, Wang Jung; Jang, SeongHyung

    2016-06-01

    Amplitude Variation with Offset (AVO) is a technique that has been widely used as a reliable indicator of hydrocarbon expressions in seismic data. The technique uses mathematical approximations and approaches in order to estimate variations in seismic amplitude as a function of incidence angle, and related them to lithology and pore-fluids. In this study, a new AVO attribute is presented. The Energy-weighted AVO attribute uses Zoeppritz approximations and exploits the fact that hydrocarbon-bearing sediments show anomalous seismic responses relative to their backgrounds. The new AVO attribute emphasizes this hydrocarbon-associated effect and attenuates the background signal. In addition, the fact that the attribute integrates the signatures of conventional AVO attributes (intercept × gradient) with seismic data makes the discrimination of hydrocarbon anomalies from other anomalies caused by anomalous lithologies such as coal, carbonates or salt, straightforward. More interestingly, the new attribute can be applied to both prestack and poststack data. This indeed would solve several problems and difficulties encountered with prestack data, as prestack data are generally less readily available, and have a much lower signal to noise ratio. The process has been examined using synthetic data generated from Zoeppritz equations, and then applied to real prestack and poststack data. At all stages, promising results have been derived and the hydrocarbon effect and extent could be successfully predicted, also the AVO effect of hydrocarbons could be investigated even in the poststack data.

  19. Robust dynamic myocardial perfusion CT deconvolution using adaptive-weighted tensor total variation regularization

    NASA Astrophysics Data System (ADS)

    Gong, Changfei; Zeng, Dong; Bian, Zhaoying; Huang, Jing; Zhang, Xinyu; Zhang, Hua; Lu, Lijun; Feng, Qianjin; Liang, Zhengrong; Ma, Jianhua

    2016-03-01

    Dynamic myocardial perfusion computed tomography (MPCT) is a promising technique for diagnosis and risk stratification of coronary artery disease by assessing the myocardial perfusion hemodynamic maps (MPHM). Meanwhile, the repeated scanning of the same region results in a relatively large radiation dose to patients potentially. In this work, we present a robust MPCT deconvolution algorithm with adaptive-weighted tensor total variation regularization to estimate residue function accurately under the low-dose context, which is termed `MPD-AwTTV'. More specifically, the AwTTV regularization takes into account the anisotropic edge property of the MPCT images compared with the conventional total variation (TV) regularization, which can mitigate the drawbacks of TV regularization. Subsequently, an effective iterative algorithm was adopted to minimize the associative objective function. Experimental results on a modified XCAT phantom demonstrated that the present MPD-AwTTV algorithm outperforms and is superior to other existing deconvolution algorithms in terms of noise-induced artifacts suppression, edge details preservation and accurate MPHM estimation.

  20. Spatial variation in post-dispersal seed removal in an Atlantic forest: Effects of habitat, location and guilds of seed predators

    NASA Astrophysics Data System (ADS)

    Christianini, Alexander V.; Galetti, Mauro

    2007-11-01

    Studies of post-dispersal seed removal in the Neotropics have rarely examined the magnitude of seed removal by different types of granivores. The relative impact of invertebrates, small rodents, and birds on seed removal was investigated in a 2,178 ha Atlantic forest fragment in southeastern Brazil. We used popcorn kernels ( Zea mays—Poaceae) to investigate seed removal in a series of selective exclosure treatments in a replicated, paired design experiment that included forest understory, gaps, and forest edge sites. We recorded the vegetation around the experimental seed stations in detail in order to evaluate the influence of microhabitat traits on seed removal. Vertebrate granivores (rodents and birds) were surveyed to determine whether granivore abundance was correlated with seed removal levels. Seed removal varied spatially and in unpredictable ways at the study site. Seed encounter and seed use varied with treatments, but not with habitat type. However, seed removal by invertebrates was negatively correlated with gap-related traits, which suggested an avoidance of large gaps by granivorous ants. The abundance of small mammals was remarkably low, but granivorous birds (tinamous and doves) were abundant at the study site. Birds were the main seed consumers in open treatments, but there was no correlation between local granivorous bird abundance and seed removal. These results emphasize the stochastic spatial pattern of seed removal, and, contrary to previous studies, highlight the importance of birds as seed predators in forest habitats.

  1. Geographic variation in speed of seed germination in central Oregon ponderosa pine ( pinus ponderosa' dougl. ex laws). Forest Service research paper

    SciTech Connect

    Weber, J.C.; Sorensen, F.C.

    1992-03-01

    Variation in speed of seed germination was investigated among ponderosa pine trees representing 225 locations in central Oregon. Results suggested that at least some of the geographic variation is related to the severity of summer drought. In general, germination speed was greater in locations with short, drought-limited growing seasons. Levels of geographic variation were highest in the region having the steepest precipitation gradients. Most of the variation occurred, however, within locations.

  2. Genetic variation and seed zones of douglas-fir in the Siskiyou National Forest. Forest Service research paper

    SciTech Connect

    Campbell, R.K.; Sugano, A.I.

    1993-07-01

    The provisional seed zones and breeding zones were developed for Douglas-fir (Pseudotsuga menziesii (Mirb.) Franco) in the Siskiyou National Forest in southwestern Oregon. Zones were based on maps of genetic variation patterns obtained by evaluating genotypes of trees from 260 locations in the region. Genotypes controlling growth vigor and growth rhythm were assessed in the common garden. Within the Forest, three breeding blocks were recommended, with different numbers of elevational bands in each block: from 0 to 610 meters, from 611 to 838 meters, and then a series of bands 152 meters wide at higher elevations.

  3. Variation for seed minerals and protein concentrations in diverse germplasm of lentil

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Lentil (Lens culinaris) is an important food legume that can provide significant amounts of dietary minerals and other essential nutrients to humans. To understand the nutritional diversity that exists within this species, we measured seed mineral and protein concentrations in 350 diverse accessions...

  4. Genetic Variation of Seed Dormancy in Synthetic Hexaploid Wheat-Derived Populations

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Aegilops tauschii, the D-genome donor of wheat (Triticum aestivum), has very strong seed dormancy and genes controlling the trait may be used in breeding programs to manipulate germinability of improved cultivars. Thus, this research was conducted to initiate a project to identify dormancy genes fro...

  5. Emergence timing and fitness consequences of variation in seed oil composition in Arabidopsis thaliana

    PubMed Central

    Pelc, Sandra E; Linder, C Randal

    2015-01-01

    Early seedling emergence can increase plant fitness under competition. Seed oil composition (the types and relative amounts of fatty acids in the oils) may play an important role in determining emergence timing and early growth rate in oilseeds. Saturated fatty acids provide more energy per carbon atom than unsaturated fatty acids but have substantially higher melting points (when chain length is held constant). This characteristic forms the basis of an adaptive hypothesis that lower melting point seeds (lower proportion of saturated fatty acids) should be favored under colder germination temperatures due to earlier germination and faster growth before photosynthesis, while at warmer germination temperatures, seeds with a higher amount of energy (higher proportion of saturated fatty acids) should be favored. To assess the effects of seed oil melting point on timing of seedling emergence and fitness, high- and low-melting point lines from a recombinant inbred cross of Arabidopsis thaliana were competed in a fully factorial experiment at warm and cold temperatures with two different density treatments. Emergence timing between these lines was not significantly different at either temperature, which aligned with warm temperature predictions, but not cold temperature predictions. Under all conditions, plants competing against high-melting point lines had lower fitness relative to those against low-melting point lines, which matched expectations for undifferentiated emergence times. PMID:25628873

  6. Emergence timing and fitness consequences of variation in seed oil composition in Arabidopsis thaliana

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Early seedling emergence can increase plant fitness under competition. Seed oil composition (the types and relative amounts of fatty acids in the oils) may play an important role in determining emergence timing in oilseeds. Saturated fatty acids provide more energy per carbon atom than unsaturated...

  7. Variation in Seed Oil Content of the USDA Lesquerella fendleri Germplasm Collection

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Lesquerella is considered as an important industrial crop due to hydroxy fatty acid (HFA) content in the seeds. The HFA such as lesquerolic, densipolic and auricolic acids may be used in plastics, surfactants, cosmetics and biolubricants. Lesquerella (Brassicaceae) species are native to North and So...

  8. Susceptibility-Weighted Imaging of the Anatomic Variation of Thalamostriate Vein and Its Tributaries

    PubMed Central

    Zhang, Xiao-fen; Li, Jian-ce; Wen, Xin-dong; Ren, Chuan-gen; Cai, Ming; Chen, Cheng-chun

    2015-01-01

    Background and Purpose Thalamostriate vein (TSV) is an important tributary of the internal cerebral vein, which mainly drains the basal ganglia and deep medulla. The purpose of this study was to explore the anatomic variation and quality of TSV and its smaller tributaries using susceptibility-weighted imaging (SWI). Methods We acquired SWI images in 40 volunteers on a 3.0T MR system using an 8-channel high-resolution phased array coil. The frequencies of the TSV and its tributaries were evaluated. We classified TSV into types I (forming a venous angle) and II (forming a false venous angle). We classified anterior caudate vein (ACV)into types 1 (1 trunk) and 2 (2 trunks) as well as into types A (joiningTSV), B (joining anterior septal vein), and C (joining the angle of both veins). Results The TSV drains the areas of caudate nucleus, internal capsule,lentiform nucleus, external capsule, claustrum, extreme capsule and the white matter of the frontoparietal lobes,except thalamus. The frequencies of the TSV, ACV and transverse caudate vein (ACV) were 92.5%, 87.5% and 63.8%, respectively. We found TSV types I and II in 79.7%, and 20.3% with significantly different constitution ratios (P< 0.05). The most common types of ACV were type 1 (90.0%) and type A (64.3%). Conclusion The complex three-dimensional (3D) venous architecture of TSV and its small tributaries manifests great variation, with significant and practical implications for neurosurgery. PMID:26506095

  9. [Quality classification criteria of Paeonia suffruticosa seeds].

    PubMed

    Cao, Ya-yue; Zhu, Zai-biao; Guo, Qiao-sheng; Liu, Li; Wang, Chang-lin

    2015-02-01

    In order to establish the quality classification criteria of Paeonia suffruticosa seeds, thirty-one batches of P. suffruticosa seeds from different provenances were selected. The seed rooting rate, seed germination rate, seed purity, seed viability, 1,000-seed weight and moisture content were determined and analyzed through SPSS 20.0 software. Seed rooting rate, seed germination rate and seed purity were selected as the main index for classification, while 1,000-seed weight, seed viability and moisture content could be used as important references. The seed quality grading of P. suffruticosa was set as three grades. The seed quality of each grade should meet following requirements: For the first grade seeds, seed rooting rate ≥ 80%, seed germination rate ≥ 80%, seed purity ≥ 90%, seed viability ≥ 80%, 1,000-seed weight ≥ 250 g, moisture content, ≤ 10. For the second grade seeds, seed rooting rate ≥ 50%, seed germination rate ≥ 60%, seed purity ≥ 70%, seed viability ≥ 75%, 1,000-seed weight ≥ 225 g, moisture content ≤ 10. For the third grade seeds, seed rooting rate ≥ 20%, seed germination rate ≥ 45%, seed purity ≥ 60%, seed viability ≥ 45%, 1,000-seed weight ≥ 205 g, moisture content ≤ 10. The quality classification criteria of P. suffruticosa seeds have been initially established. PMID:26137680

  10. Seed size variability: from carob to carats

    PubMed Central

    Turnbull, Lindsay A; Santamaria, Luis; Martorell, Toni; Rallo, Joan; Hector, Andy

    2006-01-01

    The seeds of various plants were used as weights because their mass reputedly varies so little. Carob (Ceratonia siliqua), which has given its name to the carat, is particularly famous in this regard. But are carob seeds unusually constant in weight and, if not, how did the myth arise? The variability of seeds sampled from a collection of carob trees (CV=23%) was close to the average of 63 species reviewed from the literature (CV=25%). However, in a perception experiment observers could discriminate differences in carob seed weight of around 5% by eye demonstrating the potential for humans to greatly reduce natural variation. Interestingly, the variability of pre-metrication carat weight standards is also around 5% suggesting that human rather than natural selection gave rise to the carob myth. PMID:17148413

  11. Historic Variations in Winter Indoor Domestic Temperatures and Potential Implications for Body Weight Gain

    PubMed Central

    Johnson, F.; Ucci, M.; Marmot, A.; Wardle, J.; Oreszczyn, T.; Summerfield, A.

    2013-01-01

    It has been argued that the amount of time spent by humans in thermoneutral environments has increased in recent decades. This paper examines evidence of historic changes in winter domestic temperatures in industrialised countries. Future trajectories for indoor thermal comfort are also explored. Whilst methodological differences across studies make it difficult to compare data and accurately estimate the absolute size of historic changes in indoor domestic temperatures, data analysis does suggest an upward trend, particularly in bedrooms. The variations in indoor winter residential temperatures might have been further exacerbated in some countries by a temporary drop in demand temperatures due to the 1970s energy crisis, as well as by recent changes in the building stock. In the United Kingdom, for example, spot measurement data indicate that an increase of up to 1.3°C per decade in mean dwelling winter indoor temperatures may have occurred from 1978 to 1996. The findings of this review paper are also discussed in the context of their significance for human health and well-being. In particular, historic indoor domestic temperature trends are discussed in conjunction with evidence on the links between low ambient temperatures, body energy expenditure and weight gain. PMID:26321874

  12. Genetic variation in adaptive traits and seed transfer zones for Pseudoroegneria spicata (bluebunch wheatgrass) in the northwestern United States

    PubMed Central

    Bradley St. Clair, John; Kilkenny, Francis F; Johnson, Richard C; Shaw, Nancy L; Weaver, George

    2013-01-01

    A genecological approach was used to explore genetic variation in adaptive traits in Pseudoroegneria spicata, a key restoration grass, in the intermountain western United States. Common garden experiments were established at three contrasting sites with seedlings from two maternal parents from each of 114 populations along with five commercial releases commonly used in restoration. Traits associated with size, flowering phenology, and leaf width varied considerably among populations and were moderately correlated with the climates of the seed sources. Pseudoroegneria spicata populations from warm, arid source environments were smaller with earlier phenology and had relatively narrow leaves than those from mild climates with cool summers, warm winters, low seasonal temperature differentials, high precipitation, and low aridity. Later phenology was generally associated with populations from colder climates. Releases were larger and more fecund than most of the native ecotypes, but were similar to native populations near their source of origin. Differences among native populations associated with source climates that are logical for survival, growth, and reproduction indicate that genetic variation across the landscape is adaptive and should be considered during restoration. Results were used to delineate seed transfer zones and population movement guidelines to ensure adapted plant materials for restoration activities. PMID:24062802

  13. Variation in a single protoplast- and seed-derived population of Lotus corniculatus L.

    PubMed

    Niizeki, M; Ishikawa, R; Saito, K

    1990-12-01

    Lotus comiculatus L. is a widely cultivated, outbreeding, leguminous forage crop. Seventy-one plants, most of which were tetraploid, were regenerated from calli derived from a single protoplast. Their morphological and agronomic traits were evaluated and compared with those of the seed-produced population. The variances of most of the traits in the protoplast-derived (protoclonal) population were smaller than those of the seed-produced population. Mean values of all the traits of the protoclonal population shifted significantly towards lower values. However, new phenotypic variants with higher values than those of the plant initially used for protoplast isolation were also observed. Plants with less hydrocyanic acid (which has a toxic effect on cattle) than the initial plant were obtained in the protoclones. Generally, the pollen fertility of protoclones was significantly low compared with the seed-produced plants. This seems to be partly due to the occurrence of abnormalities in chromosome structure during protoplast and/or callus culture, as suggested by the formation of univalents, lagging, and fragment chromosomes and bridges at metaphase I and anaphase I and II of the regenerants. The changes in chromosome structure, however, did not induce any malformed morphologies. PMID:24221102

  14. Over-Expression of a Tobacco Nitrate Reductase Gene in Wheat (Triticum aestivum L.) Increases Seed Protein Content and Weight without Augmenting Nitrogen Supplying

    PubMed Central

    Zhao, Xiao-Qiang; Nie, Xuan-Li; Xiao, Xing-Guo

    2013-01-01

    Heavy nitrogen (N) application to gain higher yield of wheat (Triticum aestivum L.) resulted in increased production cost and environment pollution. How to diminish the N supply without losing yield and/or quality remains a challenge. To meet the challenge, we integrated and expressed a tobacco nitrate reductase gene (NR) in transgenic wheat. The 35S-NR gene was transferred into two winter cultivars, “Nongda146” and “Jimai6358”, by Agrobacterium-mediation. Over-expression of the transgene remarkably enhanced T1 foliar NR activity and significantly augmented T2 seed protein content and 1000-grain weight in 63.8% and 68.1% of T1 offspring (total 67 individuals analyzed), respectively. Our results suggest that constitutive expression of foreign nitrate reductase gene(s) in wheat might improve nitrogen use efficiency and thus make it possible to increase seed protein content and weight without augmenting N supplying. PMID:24040315

  15. A survey of the castor oil content, seed weight and seed-coat colour on the United States Department of Agriculture germplasm collection.

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Castor bean is an important non-edible oilseed crop that can potentially be used as feedstock for biodiesel production. Cultivars with a high percentage of oil content in seeds are preferred for biodiesel production. There are 1033 accessions in the USDA castor bean germplasm collection. The range o...

  16. The Effect of Flax Seed (Linum Usitatissimum) Hydroalcoholic Extract on Brain, Weight and Plasma Sexual Hormone Levels in Aged and Young Mice

    PubMed Central

    Bahmanpour, Soghra; Kamali, Mahsa

    2016-01-01

    Background: Flax is a food and fiber crop that is grown in some regions of the world. Its value will account for its great popularity as a food, medical and cosmetic applications. Flax fibers are taken from the stem of the plant and are two to three times as strong as cotton. In this study, we compared brain weight and plasma sex hormone levels in young and aged mice after the administration of Linum usitatissimum (flax seed) hydro alcoholic extract. Methods: In this study, 32 aged and 32 young mice were divided into 4 groups. Controls remained untreated and experimental groups were fed with flax seed hydroalcoholic extract by oral gavages during 3 weeks. After 3 weeks, the brain was removed and blood samples were collected to measure sex hormone levels by ELISA. Data analysis was done by statistical ANOVA test using SPSS version 18 (P<0.05). Results: The results of this study shows that the brain weight of mice did not change significantly, but the sex hormone levels in the experimental groups in comparison with the control groups increased significantly (P<0.05). Conclusion: The hydroalcoholic extract of flax seed had no effect on the brain weight, but this extract improved the sexual hormone levels. PMID:27516647

  17. Coexistence in tropical forests through asynchronous variation in annual seed production.

    PubMed

    Usinowicz, Jacob; Wright, S Joseph; Ives, Anthony R

    2012-09-01

    The storage effect is a mechanism that can facilitate the coexistence of competing species through temporal fluctuations in reproductive output. Numerous natural systems have the prerequisites for the storage effect, yet it has rarely been quantitatively assessed. Here, we investigate the possible importance of the storage effect in explaining the coexistence of tree species in the diverse tropical forest on Barro Colorado Island, Panama. This tropical forest has been monitored for more than 20 years, and annual seed production is asynchronous among species, a primary requirement for the storage effect. We constructed a model of forest regeneration that includes species-specific recruitment through seed, sapling, and adult stages, and we parameterized the model using data for 28 species for which information is known about seedling germination and survival. Simulations of the model demonstrated that the storage effect alone can be a strong mechanism allowing long-term persistence of species. We also developed a metric to quantify the strength of the storage effect in a way comparable to classical resource partitioning. Applying this metric to seed production data from 108 species, the storage effect reduces the strength of pairwise interspecific competition to 11-43% of the strength of intraspecific competition, thereby demonstrating strong potential to facilitate coexistence. Finally, for a subset of 51 species whose phylogenetic relationships are known, we compared the strength of the storage effect between pairs of species to their phylogenetic similarity. The strength of the storage effect between closely related species was on average no different from distantly related species, implying that the storage effect can be important in promoting the coexistence of even closely related species. PMID:23094379

  18. Genome-Wide Association Study in Arabidopsis thaliana of Natural Variation in Seed Oil Melting Point: A Widespread Adaptive Trait in Plants.

    PubMed

    Branham, Sandra E; Wright, Sara J; Reba, Aaron; Morrison, Ginnie D; Linder, C Randal

    2016-05-01

    Seed oil melting point is an adaptive, quantitative trait determined by the relative proportions of the fatty acids that compose the oil. Micro- and macro-evolutionary evidence suggests selection has changed the melting point of seed oils to covary with germination temperatures because of a trade-off between total energy stores and the rate of energy acquisition during germination under competition. The seed oil compositions of 391 natural accessions of Arabidopsis thaliana, grown under common-garden conditions, were used to assess whether seed oil melting point within a species varied with germination temperature. In support of the adaptive explanation, long-term monthly spring and fall field temperatures of the accession collection sites significantly predicted their seed oil melting points. In addition, a genome-wide association study (GWAS) was performed to determine which genes were most likely responsible for the natural variation in seed oil melting point. The GWAS found a single highly significant association within the coding region of FAD2, which encodes a fatty acid desaturase central to the oil biosynthesis pathway. In a separate analysis of 15 a priori oil synthesis candidate genes, 2 (FAD2 and FATB) were located near significant SNPs associated with seed oil melting point. These results comport with others' molecular work showing that lines with alterations in these genes affect seed oil melting point as expected. Our results suggest natural selection has acted on a small number of loci to alter a quantitative trait in response to local environmental conditions. PMID:26865732

  19. Oleosin Isoforms of High and Low Molecular Weights Are Present in the Oil Bodies of Diverse Seed Species 1

    PubMed Central

    Tzen, Jason T. C.; Lai, Yiu-Kay; Chan, Kwai-Lan; Huang, Anthony H. C.

    1990-01-01

    Oleosins are unique and major proteins localized on the surface of oil bodies in diverse seed species. We purified five different oleosins (maize [Zea mays L.] KD 16 and KD 18, soybean [Glycine max L.] KD 18 and KD 24, and rapeseed [Brassica campestris L.] KD 20), and raised chicken antibodies against them. These antibodies were used to test for immunological cross-reactivity among oleosins from diverse seed species. Within the same seed species, antibodies raised against one oleosin isoform did not cross-react with the other oleosin isoform (i.e. between maize oleosins KD 16 and KD 18, and between soybean oleosins KD 18 and KD 24). However, the respective antibodies were able to recognize oleosins from other seed species. Where interspecies cross-reactivity occurred, the results suggest that there are at least two immunologically distinct isoforms of oleosins present in diverse seed species, one of lower Mr, and another one of higher Mr. This suggestion is also supported by the relative similarities between the amino acid sequence of a small portion of rapeseed oleosin KD 20 and those of maize oleosins KD 16 and KD 18. In maize kernel, there was a tissue-specific differential presentation of the three oleosins, KD 16, KD 18, and KD 19, in the oil-storing scutellum, embryonic axis, and aleurone layer. The phylogenetic relationship between the high and low Mr isoforms within the same, and among diverse, seed species is discussed. Images Figure 1 Figure 2 Figure 4 PMID:16667830

  20. Natural Genetic Variation of Seed Micronutrients of Arabidopsis thaliana Grown in Zinc-Deficient and Zinc-Amended Soil

    PubMed Central

    Chen, Xiaochao; Yuan, Lixing; Ludewig, Uwe

    2016-01-01

    The quality of edible seeds for human and animal nutrition is crucially dependent on high zinc (Zn) and iron (Fe) seed concentrations. The micronutrient bioavailability is strongly reduced by seed phytate that forms complexes with seed cations. Superior genotypes with increased seed Zn concentrations had been identified, but low micronutrient seed levels often prevail when the plants are grown in Zn-deficient soils, which are globally widespread and correlate with human Zn-deficiency. Here, seed Zn concentrations of Arabidopsis accessions grown in Zn-deficient and Zn-amended conditions were measured together with seed Fe and manganese (Mn), in a panel of 108 accessions. By applying genome-wide association, de novo candidate genes potentially involved in the seed micronutrient accumulation were identified. However, a candidate inositol 1,3,4-trisphosphate 5/6-kinase 3 gene (ITPK3), located close to a significant nucleotide polymorphism associated with relative Zn seed concentrations, was dispensable for seed micronutrients accumulation in Col-0. Loss of this gene in itpk3-1 did neither affect phytate seed levels, nor seed Zn, Fe, and Mn. It is concluded that large natural variance of micronutrient seed levels is identified in the population and several accessions maintain high seed Zn despite growth in Zn-deficient conditions. PMID:27507976

  1. Natural Genetic Variation of Seed Micronutrients of Arabidopsis thaliana Grown in Zinc-Deficient and Zinc-Amended Soil.

    PubMed

    Chen, Xiaochao; Yuan, Lixing; Ludewig, Uwe

    2016-01-01

    The quality of edible seeds for human and animal nutrition is crucially dependent on high zinc (Zn) and iron (Fe) seed concentrations. The micronutrient bioavailability is strongly reduced by seed phytate that forms complexes with seed cations. Superior genotypes with increased seed Zn concentrations had been identified, but low micronutrient seed levels often prevail when the plants are grown in Zn-deficient soils, which are globally widespread and correlate with human Zn-deficiency. Here, seed Zn concentrations of Arabidopsis accessions grown in Zn-deficient and Zn-amended conditions were measured together with seed Fe and manganese (Mn), in a panel of 108 accessions. By applying genome-wide association, de novo candidate genes potentially involved in the seed micronutrient accumulation were identified. However, a candidate inositol 1,3,4-trisphosphate 5/6-kinase 3 gene (ITPK3), located close to a significant nucleotide polymorphism associated with relative Zn seed concentrations, was dispensable for seed micronutrients accumulation in Col-0. Loss of this gene in itpk3-1 did neither affect phytate seed levels, nor seed Zn, Fe, and Mn. It is concluded that large natural variance of micronutrient seed levels is identified in the population and several accessions maintain high seed Zn despite growth in Zn-deficient conditions. PMID:27507976

  2. Insulin sensitivity regulates autonomic control of heart rate variation independent of body weight in normal subjects.

    PubMed

    Bergholm, R; Westerbacka, J; Vehkavaara, S; Seppälä-Lindroos, A; Goto, T; Yki-Järvinen, H

    2001-03-01

    It is unclear whether insulin sensitivity independent of body weight regulates control of heart rate variation (HRV) by the autonomic nervous system. Insulin action on whole-body glucose uptake (M-value) and heart rate variability were measured in 21 normal men. The subjects were divided into 2 groups [normally insulin sensitive (IS, 8.0 +/- 0.4 mg/kg.min) and less insulin sensitive (IR, 5.1 +/- 0.3 mg/kg.min)] based on their median M-value (6.2 mg/kg x min). Spectral power analysis of heart rate variability was performed in the basal state and every 30 min during the insulin infusion. The IS and IR groups were comparable, with respect to age (27 +/- 2 vs. 26 +/- 2 yr), body mass index (22 +/- 1 vs. 23 +/- 1 kg/m(2)), body fat (13 +/- 1 vs. 13 +/- 1%), systolic (121 +/- 16 vs. 117 +/- 14 mm Hg) and diastolic (74 +/- 11 vs. 73 +/- 11 mm Hg) blood pressures, and fasting plasma glucose (5.4 +/- 0.1 vs. 5.5 +/- 0.1 mmol/L) concentrations. Fasting plasma insulin was significantly higher in the IR (30 +/- 4 pmol/L) than in the IS (17 +/- 3 pmol/L, P < 0.05) group. In the IS group, insulin significantly increased the normalized low-frequency (LFn) component, a measure of predominantly sympathetic nervous system activity, from 36 +/- 5 to 48 +/- 4 normalized units (nu; 0 vs. 30-120 min, P < 0.001); whereas the normalized high-frequency (HFn) component, a measure of vagal control of HRV, decreased from 66 +/- 9 to 48 +/- 5 nu (P < 0.001). No changes were observed in either the normalized LF component [35 +/- 5 vs. 36 +/- 2 nu, not significant (NS)] or the normalized HF component (52 +/- 6 vs. 51 +/- 4 nu, NS) in the IR group. The ratio LF/HF, a measure of sympathovagal balance, increased significantly in the IS group (0.92 +/- 0.04 vs. 1.01 +/- 0.04, P < 0.01) but remained unchanged in the IR group (0.91 +/- 0.04 vs. 0.92 +/- 0.03, NS). Heart rate and systolic and diastolic blood pressures remained unchanged during the insulin infusion in both groups. We conclude that

  3. Induction of a germination specific, low molecular weight, acid phosphatase isozyme with specific phosphotyrosine phosphatase activity in lentil (Lens esculenta) seeds.

    PubMed

    Bose, S K; Taneja, V

    1998-09-29

    A germination specific isozyme of acid phosphatase (EC 3.1.3.2) hydrolysing O-phospho-L-Tyrosine, pH optima 5.5 is induced in lentil seeds. When seeds at 0 h, 24 h and 36 h of germination are electrophorezed, native PAGE on specific enzyme staining shows several constitutive isozymes of acid phosphatases. At 48 h, an isozyme is induced which gradually decreases and then disappears at 108 h of germination. The short lived, induced isozyme is present in the embryo and seed-coat but not in the plumule and the radical. Induction of this isozyme is inhibited by cycloheximide and actinomycin-D and increased by plant growth regulators such as heteroauxin and gibbrellic acid treatment during germination. The induced isozyme is a single 30 kD polypeptide, with subunit molecular mass of 25 kD, shows activity for O-phospho-L-Tyrosine. It is strongly inhibited by vanadate (microM), molybdate, tungustate as also by iodoacetate, p-chloromercuribenzoate and diethylpyrocarbonate. This study shows for the first time that the germination induced low molecular weight Acid phosphatase is a Tyrosine phosphatase super family class IV enzyme, having a role in cellular differentiation and development during seed germination. PMID:9784397

  4. A combinatorial approach of comprehensive QTL-based comparative genome mapping and transcript profiling identified a seed weight-regulating candidate gene in chickpea.

    PubMed

    Bajaj, Deepak; Upadhyaya, Hari D; Khan, Yusuf; Das, Shouvik; Badoni, Saurabh; Shree, Tanima; Kumar, Vinod; Tripathi, Shailesh; Gowda, C L L; Singh, Sube; Sharma, Shivali; Tyagi, Akhilesh K; Chattopdhyay, Debasis; Parida, Swarup K

    2015-01-01

    High experimental validation/genotyping success rate (94-96%) and intra-specific polymorphic potential (82-96%) of 1536 SNP and 472 SSR markers showing in silico polymorphism between desi ICC 4958 and kabuli ICC 12968 chickpea was obtained in a 190 mapping population (ICC 4958 × ICC 12968) and 92 diverse desi and kabuli genotypes. A high-density 2001 marker-based intra-specific genetic linkage map comprising of eight LGs constructed is comparatively much saturated (mean map-density: 0.94 cM) in contrast to existing intra-specific genetic maps in chickpea. Fifteen robust QTLs (PVE: 8.8-25.8% with LOD: 7.0-13.8) associated with pod and seed number/plant (PN and SN) and 100 seed weight (SW) were identified and mapped on 10 major genomic regions of eight LGs. One of 126.8 kb major genomic region harbouring a strong SW-associated robust QTL (Caq'SW1.1: 169.1-171.3 cM) has been delineated by integrating high-resolution QTL mapping with comprehensive marker-based comparative genome mapping and differential expression profiling. This identified one potential regulatory SNP (G/A) in the cis-acting element of candidate ERF (ethylene responsive factor) TF (transcription factor) gene governing seed weight in chickpea. The functionally relevant molecular tags identified have potential to be utilized for marker-assisted genetic improvement of chickpea. PMID:25786576

  5. Climatic variation and seed persistence: freeze-thaw cycles lower survival via the joint action of abiotic stress and fungal pathogens.

    PubMed

    Connolly, Brian M; Orrock, John L

    2015-10-01

    Global climate change is altering thermal cycles in soils during late winter, a transition that may directly threaten seed survival via abiotic stress, facilitate infection by soil-borne pathogens, or both. Using field-collected soil and seeds of the perennial bunchgrass Elymus canadensis, we tested the hypothesis that soil freeze-thaw events limit survival within the soil through direct effects on seed persistence and amplification of soil pathogen attack using a factorial experiment that manipulated freeze-thaw cycles (constant freeze vs. freeze-thaw) and fungicide addition. Freeze-thaw treatment resulted in lower seedling emergence and delayed emergence time relative to constant-freeze controls. Fungicide-treated soils had greater emergence relative to untreated soils; the lowest seedling emergence was observed in no-fungicide, freeze-thaw-treated soils (<1 %). The strong effects of thermal variability and fungi on seeds were mitigated through interactions at the seed-soil interface, as subsequent experiments showed that fungicide and freeze-thaw treatments alone do not influence dormancy. Our work demonstrates that changes in freeze-thaw events directly limit seedling emergence, delay seedling phenology, and provide opportunities for fungal pathogens to limit seed persistence. As recruitment from seeds is a key determinant of plant population dynamics, these results suggest that climatic variation may generate unique consequences for populations under changing climate regimes. PMID:26078006

  6. Variation in spectral-shape discrimination weighting functions at different stimulus levels and signal strengths.

    PubMed

    Lentz, Jennifer J

    2007-09-01

    This study evaluated whether weights for spectral-shape discrimination depend on overall stimulus level and signal strength (the degree of spectral-shape change between two stimuli). Five listeners discriminated between standard stimuli that were the sum of six equal-amplitude tones and signal stimuli created by decreasing the amplitudes of three low-frequency components and increasing the amplitudes of three high-frequency components. Weighting functions were influenced by stimulus level in that the relative contribution of the low-frequency (decremented) components to the high-frequency (incremented) components decreased with increasing stimulus level. Although individual variability was present, a follow-up experiment suggested that the level dependence was due to greater reliance on high-frequency components rather than incremented components. Excitation-pattern analyses indicated that the level dependence is primarily, but not solely, driven by cochlear factors. In general, different signal strengths had no effect on the weighting functions (when normalized), but two of the five listeners showed variability in the shape of the weighting function across signal strengths. Results suggest that the effects of stimulus level on weighting functions and individual variability in the shapes of the weighting functions should be considered when comparing weighting functions across conditions and groups that might require different stimulus levels and signal strengths. PMID:17927430

  7. a Study on Variations of Shoreline Changes and Temporal-Spatial Potentiality for Cloud Seeding at Urumia Lake

    NASA Astrophysics Data System (ADS)

    Agha Taher, R.; Jafari, M.; Fallah, M.; Alavi, A.

    2015-12-01

    time period has been used. In order to reach better results, images from MODIS satellite has been used as auxiliary data for the images that are with an error margin. Initial classification on the images was conducted to distinguish water and non water applications. Neural network classification was applied with specific scales on the images and the two major applications were thereby extracted. Then, in order to authenticate the proceedings, Error matrix and Kappa coefficient has been applied on the classified images. Base pixel method of neural network was used for the purpose of information extraction while authenticity of that was evaluated too. The outcomes display the trend of Urmia shoreline has been approximately constant between the years of 1976 to 1995 and has experienced very low variations. In 1998 the lake experienced increase of water and therefore advancement of the shoreline of the lake due to increase of precipitation and the volume of inflowing water to the basin. During 2000 to 20125, however, the lake's shoreline has experienced a downward trend, which was intensified in 2007 and reached to its most critical level ever since, that is decreasing to about one third. Further, temporal and spatial potentiality evaluation of clouds seeding in Urmia lake zone has been studied as a solution for improvement and recovery of the current status of the lake, and an algorithm was proposed for optimized temporal- spatial study on could seeding. Ecological, meteorological and synoptic data were used for timing study of the cloud's seeding plan, which upon study; it is easy to evaluate precipitation potential and quality of the system. At the next step, the rate of humidity and also stability of the precipitating system can be analyzed using radar acquired data. Whereas extracted date from MODIS images are expressing the spatial position, therefore in order to study the location of the cloud's seeding, MODIS images of the selected time intervals along with

  8. In situ adaptive response to climate and habitat quality variation: spatial and temporal variation in European badger (Meles meles) body weight.

    PubMed

    Byrne, Andrew W; Fogarty, Ursula; O'Keeffe, James; Newman, Chris

    2015-09-01

    Variation in climatic and habitat conditions can affect populations through a variety of mechanisms, and these relationships can act at different temporal and spatial scales. Using post-mortem badger body weight records from 15 878 individuals captured across the Republic of Ireland (7224 setts across ca. 15 000 km(2) ; 2009-2012), we employed a hierarchical multilevel mixed model to evaluate the effects of climate (rainfall and temperature) and habitat quality (landscape suitability), while controlling for local abundance (unique badgers caught/sett/year). Body weight was affected strongly by temperature across a number of temporal scales (preceding month or season), with badgers being heavier if preceding temperatures (particularly during winter/spring) were warmer than the long-term seasonal mean. There was less support for rainfall across different temporal scales, although badgers did exhibit heavier weights when greater rainfall occurred one or 2 months prior to capture. Badgers were also heavier in areas with higher landscape habitat quality, modulated by the number of individuals captured per sett, consistent with density-dependent effects reducing weights. Overall, the mean badger body weight of culled individuals rose during the study period (2009-2012), more so for males than for females. With predicted increases in temperature, and rainfall, augmented by ongoing agricultural land conversion in this region, we project heavier individual badger body weights in the future. Increased body weight has been associated with higher fecundity, recruitment and survival rates in badgers, due to improved food availability and energetic budgets. We thus predict that climate change could increase the badger population across the Republic of Ireland. Nevertheless, we emphasize that, locally, populations could still be vulnerable to extreme weather variability coupled with detrimental agricultural practice, including population management. PMID:25846328

  9. Temperature thresholds of physically dormant seeds and plant functional response to fire: variation among species and relative impact of climate change.

    PubMed

    Ooi, Mark K J; Denham, Andrew J; Santana, Victor M; Auld, Tony D

    2014-03-01

    Variation in dormancy thresholds among species is rarely studied but may provide a basis to better understand the mechanisms controlling population persistence. Incorporating dormancy-breaking temperature thresholds into existing trait frameworks could improve predictions regarding seed bank persistence, and subsequently species resilience in response to fire, climate change and anthropogenic management. A key ecological strategy for many species from fire-prone ecosystems is the possession of a long-lived seed bank, ensuring recovery after fire. Physical dormancy is dominant in these ecosystems and maintaining this dormancy is directly linked to seed bank persistence. We identified a suite of seed-related factors relevant to maintaining populations in fire-prone regions for 14 co-occurring physically dormant species. We measured variation in initial levels of dormancy and then applied experimental heating treatments, based on current seasonal temperatures and those occurring during fires, to seeds of all study species. Additionally, higher seasonal temperature treatments were applied to assess response of seeds to temperatures projected under future climate scenarios. Levels of germination response and mortality were determined to assess how tightly germination response was bound to either fire or seasonal cues. Six species were found to have dormancy cues bound to temperatures that only occur during fires (80°C and above) and were grouped as having obligate pyrogenic dormancy release. The remaining species, classified as having facultative pyrogenic dormancy, had lower temperature dormancy thresholds and committed at least 30% of seeds to germinate after summer-temperature treatments. Evidence from this study supports including dormancy-breaking temperature thresholds as an attribute for identifying functional types. High temperature thresholds for breaking dormancy, found in our obligate pyrogenic group, appear to be a fire-adapted trait, while we predict that

  10. A CT reconstruction approach from sparse projection with adaptive-weighted diagonal total-variation in biomedical application.

    PubMed

    Deng, Luzhen; Mi, Deling; He, Peng; Feng, Peng; Yu, Pengwei; Chen, Mianyi; Li, Zhichao; Wang, Jian; Wei, Biao

    2015-01-01

    For lack of directivity in Total Variation (TV) which only uses x-coordinate and y-coordinate gradient transform as its sparse representation approach during the iteration process, this paper brought in Adaptive-weighted Diagonal Total Variation (AwDTV) that uses the diagonal direction gradient to constraint reconstructed image and adds associated weights which are expressed as an exponential function and can be adaptively adjusted by the local image-intensity diagonal gradient for the purpose of preserving the edge details, then using the steepest descent method to solve the optimization problem. Finally, we did two sets of numerical simulation and the results show that the proposed algorithm can reconstruct high-quality CT images from few-views projection, which has lower Root Mean Square Error (RMSE) and higher Universal Quality Index (UQI) than Algebraic Reconstruction Technique (ART) and TV-based reconstruction method. PMID:26405935

  11. Prostate Postbrachytherapy Seed Distribution: Comparison of High-Resolution, Contrast-Enhanced, T1- and T2-Weighted Endorectal Magnetic Resonance Imaging Versus Computed Tomography: Initial Experience

    SciTech Connect

    Bloch, B. Nicolas Lenkinski, Robert E.; Helbich, Thomas H.; Ngo, Long; Oismueller, Renee; Jaromi, Silvia; Kubin, Klaus; Hawliczek, Robert; Kaplan, Irving D.; Rofsky, Neil M.

    2007-09-01

    Purpose: To compare contrast-enhanced, T1-weighted, three-dimensional magnetic resonance imaging (CEMR) and T2-weighted magnetic resonance imaging (T2MR) with computed tomography (CT) for prostate brachytherapy seed location for dosimetric calculations. Methods and Materials: Postbrachytherapy prostate MRI was performed on a 1.5 Tesla unit with combined surface and endorectal coils in 13 patients. Both CEMR and T2MR used a section thickness of 3 mm. Spiral CT used a section thickness of 5 mm with a pitch factor of 1.5. All images were obtained in the transverse plane. Two readers using CT and MR imaging assessed brachytherapy seed distribution independently. The dependency of data read by both readers for a specific subject was assessed with a linear mixed effects model. Results: The mean percentage ({+-} standard deviation) values of the readers for seed detection and location are presented. Of 1205 implanted seeds, CEMR, T2MR, and CT detected 91.5% {+-} 4.8%, 78.5% {+-} 8.5%, and 96.1% {+-} 2.3%, respectively, with 11.8% {+-} 4.5%, 8.5% {+-} 3.5%, 1.9% {+-} 1.0% extracapsular, respectively. Assignment to periprostatic structures was not possible with CT. Periprostatic seed assignments for CEMR and T2MR, respectively, were as follows: neurovascular bundle, 3.5% {+-} 1.6% and 2.1% {+-} 0.9%; seminal vesicles, 0.9% {+-} 1.8% and 0.3% {+-} 0.7%; periurethral, 7.1% {+-} 3.3% and 5.8% {+-} 2.9%; penile bulb, 0.6% {+-} 0.8% and 0.3% {+-} 0.6%; Denonvillier's Fascia/rectal wall, 0.5% {+-} 0.6% and 0%; and urinary bladder, 0.1% {+-} 0.3% and 0%. Data dependency analysis showed statistical significance for the type of imaging but not for reader identification. Conclusion: Both enumeration and localization of implanted seeds are readily accomplished with CEMR. Calculations with MRI dosimetry do not require CT data. Dose determinations to specific extracapsular sites can be obtained with MRI but not with CT.

  12. Variations of Weight of Prostate Gland in Different Age Groups of Bangladeshi Cadaver.

    PubMed

    Epsi, E Z; Khalil, M; Mannan, S; Azam, M S; Ahmed, Z; Farjan, S; Kabir, A; Ara, I; Ajmery, S; Zaman, U K; Amin, S

    2016-07-01

    Now a days, benign prostatic hyperplasia and carcinoma of the prostate are the most common disorders in men. A cross sectional descriptive study was conducted in Department of Anatomy, Mymensingh Medical College, Mymensingh to find out the difference in weight of the prostate gland of Bangladeshi people in relation to age. The present study was performed on 67 postmortem human prostate gland collected from the morgue in the Department of Forensic Medicine, Mymensingh Medical College by non random purposive sampling technique. The specimens were collected from Bangladeshi cadaver of age ranging from 10 to 80 years. All the specimens were grouped into three categories - Group A (upto 18 years), Group B (19 to 45 years) and Group C (above 45 years) according to age. Dissection was performed according to standard autopsy techniques. The weight of the prostate gland were measured and recorded. The mean weight of the prostate gland was 10.13gm in Group A, 17.27gm in Group B and 22.50gm in Group C. Variance analysis shows that mean differences of weight of the prostate were highly significant among all age groups. The weight of prostate gland was found to increase with increased age. For statistical analysis, differences between age groups were analyzed by using students unpaired 't' test. The present study will help to increase the information pool on the weight of prostate gland of Bangladeshi people. PMID:27612887

  13. Normal birth weight variation and children's neuropsychological functioning: links between language, executive functioning, and theory of mind.

    PubMed

    Wade, M; Browne, D T; Madigan, S; Plamondon, A; Jenkins, J M

    2014-10-01

    The effect of low birth weight on children's development has been documented for a range of neurocognitive outcomes. However, few previous studies have examined the effect of birth weight variability within the normal range on children's neuropsychological development. The current study examined birth weight variation amongst children weighing ≥2500 g in relation to their language, executive functioning (EF), and theory of mind (ToM), and specified a developmental pathway in which birth weight was hypothesized to be associated with children's EF and ToM through their intermediary language skills. The current study used a prospective community birth cohort of 468 children. Families were recruited when children were newborns and followed up every 18 months until children were age 4.5. Language was assessed at age 3 using a standardized measure of receptive vocabulary (PPVT), and EF and ToM were measured at age 4.5 using previously validated and developmentally appropriate tasks. After controlling for potential confounding variables (family income, parent education, gestational age), birth weight within the normal range was associated with language ability at age 3 (β=.17; p=.012); and the effect of birth weight on both EF (z=2.09; p=.03) and ToM (z=2.07; p=.03) at age 4.5 operated indirectly through their language ability at age 3. Our findings indicate that the effects of birth weight on child neurocognition extend into the normal range of birth weight, and specific developmental mechanisms may link these skills over time. PMID:25171131

  14. Modeling seed weight under environmental resource limitations as a function of C, N, and C:N allocation

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The carbon (C) and nitrogen (N) contents and C:N ratio in seed of two genotypes each of five crops with different resource allocation patterns were assessed under normal growing degree days (GDD) and normal population density (NN) for each crop; normal GDD and 25%>normal population density (NL); sho...

  15. A re-examination of cremains weight: sex and age variation in a Northern California sample.

    PubMed

    Van Deest, Traci L; Murad, Turhon A; Bartelink, Eric J

    2011-03-01

    The reduction of modern commercially cremated remains into a fine powder negates the use of traditional methods of skeletal analysis. The literature on the use of cremains weight for estimating aspects of the biologic profile is limited, often with conflicting results. This study re-evaluates the value of weight in the assessment of biologic parameters from modern cremated remains. A sample of adults was collected in northern California (n = 756), with a cremains weight averaging 2737.1 g. Males were significantly heavier than females (mean = 3233.2 g versus mean = 2238.3 g, respectively; p<0.001). Comparison of this sample with other previously reported samples from southern California, Florida, and Tennessee indicates a consistent sex difference, with the most similar mean values to the Tennessee study. Although cremains weight decreases with age as expected, the relationship is weak; thus, cremains weight cannot accurately predict age-at-death. While sex estimation shows considerable accuracy (86.3% for males and 80.9% for females), sectioning points may be population specific. PMID:21265835

  16. Variation in seed viability and dormancy of 17 weed species after 24.7 years of burial: the concept of buried seed safe sites

    Technology Transfer Automated Retrieval System (TEKTRAN)

    A 50-year study at Fairbanks, AK was started in 1984 to determine soil seed longevity of 17 weed species. Seeds were buried in mesh bags 2 and 15 cm deep and were recovered 0.7, 1.7, 2.7, 3.7, 4.7, 6.7, 9.7,19.7 and 24.7 yr later. Viability was determined using germination and tetrazolium tests. By ...

  17. Genetic variations of body weight and GCRV resistance in a random mating population of grass carp

    PubMed Central

    Huang, Rong; Sun, Jiaxian; Luo, Qing; He, Libo; Liao, Lanjie; Li, Yongming; Guo, Fuhua; Zhu, Zuoyan; Wang, Yaping

    2015-01-01

    The grass carp (Ctenopharyngodon idellus) is an important species in freshwater aquaculture both in China and on a global scale. Variety degeneration and frequent diseases have limited the further development of grass carp aquaculture. Thus, new and improved varieties are required. Here, we identified and assessed the body weight and disease resistance in a random mating population of 19 ♀ × 22 ♂ grass carp, which were derived from different water systems. In both the growth experimental group of 10,245 fish and grass carp reovirus (GCRV)-infected group with 10,000 fish, 78 full-sib families were statistically analyzed for body weight and GCRV resistance. The findings showed that body weight traits had low heritability (0.11 ± 0.04, 0.10 ± 0.03 and 0.12 ± 0.05), GCRV resistance traits had high heritability (0.63 ± 0.11); body weight was higher in 3 families, whereas GCRV resistance was significantly greater in 11 families. Our results confirmed that the natural germplasm resources of wild grass carp were genetically diverse. Breeding of GCRV resistant varieties of grass carp have better genetic basis. This study provides the basis for constructing basal populations for grass carp selective breeding, quantitative trait loci (QTL) and genome-wide association studies (GWAS) analysis. PMID:26439690

  18. Child Health in Peru: Importance of Regional Variation and Community Effects on Children's Height and Weight

    ERIC Educational Resources Information Center

    Shin, Heeju

    2007-01-01

    In developing countries, height and weight are good indicators of children's health and nutritional status. Maternal education has been accepted as one of the most important influences on child health. Using the 2000 Demographic and Health Survey of Peru, however, I find that the effect of maternal education varies as a function of region. In the…

  19. Seasonal Variation in Pigeon Body Weight and Delayed Matching-to-Sample Performance

    ERIC Educational Resources Information Center

    Sargisson, Rebecca J.; McLean, Ian G.; Brown, Glenn S.; White, K. Geoffrey

    2007-01-01

    The weights of 5 pigeons with free access to food, monitored over 3 calendar years in the laboratory, were found to fluctuate with season. All pigeons were at their heaviest in the winter and were lightest in the summer. Five different pigeons performed a standard delayed matching-to-sample task for 44 weeks from January to November. Their weights…

  20. Modulation of the intestinal microbiota is associated with lower plasma cholesterol and weight gain in hamsters fed chardonnay grape seed flour.

    PubMed

    Kim, Hyunsook; Kim, Dong-Hyeon; Seo, Kun-Ho; Chon, Jung-Whan; Nah, Seung-Yeol; Bartley, Glenn E; Arvik, Torey; Lipson, Rebecca; Yokoyama, Wallace

    2015-02-11

    The relationship between the intestinal microbiota and the hypocholesterolemic and antiobesity effects of whole grape seed flour from white and red winemaking was evaluated. Male Golden Syrian hamsters were fed a high-fat (HF) control diet or a HF diet supplemented with 10% partially defatted grape seed flours from either Chardonnay (ChrSd) or Cabernet Sauvignon (CabSd) grapes for 3 weeks. The numbers of total bacteria and relative abundances of Bifidobacterium spp., Lactobacillus spp., and Firmicutes in feces were significantly lower, while the relative abundance of Bacteroides fragilis was greater than the control from feeding the ChrSd diet. The ratio of Firmicutes/Bacteroidetes (F/B) was lower in the ChrSd diet. There were significantly positive correlations between Lactobacillus spp., ratio of F/B, and plasma total- and LDL-cholesterol and liver weight. The reduction of Lactobacillus spp. by the ChrSd diet was accompanied by inhibition of Farnesoid X receptor (FXR) signaling in the intestine as expression of intestinal fibrablast growth factor (FGF)15, positively regulated by FXR, was decreased. Expression of CYP7A1, negatively regulated by FGF15, was up-regulated in the liver, which indicates that alteration of the intestinal microbiota may regulate bile acid and lipid metabolism. These findings suggest that beneficial health effects of Chardonnay grape seed flour on HF-induced metabolic disease relate in part to modulation of intestinal microbiota and their metabolic processes. PMID:25598538

  1. Allelic Variation of BnaC.TT2.a and Its Association with Seed Coat Color and Fatty Acids in Rapeseed (Brassica napus L.)

    PubMed Central

    Hussain, Nazim; Li, Zhilan; Wu, Dezhi; Jiang, Lixi

    2016-01-01

    Efficient molecular markers for the selection of rapeseed genetic materials with high seed oil content and ideal fatty acid (FA) composition are preferred by rapeseed breeders. Recently, we reported the molecular mechanism of TRANSPARENT TESTA 2 (TT2) in inhibiting seed FA biosynthesis in Arabidopsis. However, evidence showing the association of rapeseed TT2 homologs and seed FA production are still insufficient. In this study, we collected 83 rapeseed (Brassica napus L.) landraces from different geographical backgrounds to conduct association mapping of BnaC.TT2.a in relation to seed coat color and FA biosynthesis. Population background was corrected by 84 pairs of SSR markers that were uniformly distributed among the linkage groups of the Tapidor-Ningyou-7 DH population. A single copy of BnaC.TT2.a for single nucleotide polymorphism (SNP) assay was cloned by a pair of previously reported specific primers. From the analysis of BnaC.TT2.a allelic variations using GLM+Q model, four SNPs on intron 1 of BnaC.TT2.a that were associated with seed FA were discovered. Moreover, an InDel at position 738 on exon 3 of BnaC.TT2.a indicated a change of protein function that was significantly associated with seed coat color, linoleic acid (C18:2), and total FA content. These findings revealed the role of BnaC.TT2.a in regulating the seed color formation and seed FA biosynthesis in rapeseed, thereby suggesting effective molecular markers for rapeseed breeding. PMID:26752200

  2. Reproductive habitus, psychosocial health, and birth weight variation in Mexican immigrant and Mexican American women in south Texas.

    PubMed

    Fleuriet, K Jill; Sunil, T S

    2015-08-01

    The Latina Paradox, or persistent, unexplained variation in low birth weight rates in recently immigrated Mexican women and the trend toward higher rates in subsequent generations of Mexican American women, is most often attributed to unidentified sociocultural causes. We suggest herein that different disciplinary approaches can be synthesized under the constructs of reproductive habitus and subjective social status to identify influences of sociocultural processes on birth weight. Reproductive habitus are "modes of living the reproductive body, bodily practices, and the creation of new subjects through interactions between people and structures" (Smith-Oka, 2012: 2276). Subjective social status infers comparison of self to others based on community definitions of status or socioeconomic status (Adler 2007). We present results from a prospective study of low-income Mexican immigrant and Mexican American women from south Texas that tested the ability of reproductive habitus and subjective social status to elucidate the Latina Paradox. We hypothesized that reproductive habitus between Mexican immigrant women and Mexican American women inform different subjective social statuses during pregnancy, and different subjective social statuses mediate responses to psychosocial stressors known to correlate with low birth weight. Six hundred thirty-one women were surveyed for psychosocial health, subjective social status, and reproductive histories between 2011 and 2013. Eighty-three women were interviewed between 2012 and 2013 for status during pregnancy, prenatal care practices, and pregnancy narratives and associations. Birth weight was extracted from medical records. Results were mixed. Subjective social status and pregnancy-related anxiety predicted low birth weight in Mexican immigrant but not Mexican American women. Mexican immigrant women had significantly lower subjective social status scores but a distinct reproductive habitus that could explain improved psychosocial

  3. Natural Variation in the Degree of Autonomous Endosperm Formation Reveals Independence and Constraints of Embryo Growth During Seed Development in Arabidopsis thaliana

    PubMed Central

    Ungru, Alexander; Nowack, Moritz K.; Reymond, Matthieu; Shirzadi, Reza; Kumar, Manoj; Biewers, Sandra; Grini, Paul E.; Schnittger, Arp

    2008-01-01

    Seed development in flowering plants is a paradigm for the coordination of different tissues during organ growth. It requires a tight interplay between the two typically sexually produced structures: the embryo, developing from the fertilized egg cell, and the endosperm, originating from a fertilized central cell, along with the surrounding maternal tissues. Little is known about the presumptive signal transduction pathways administering and coordinating these different tissues during seed growth and development. Recently, a new signal has been identified emanating from the fertilization of the egg cell that triggers central cell proliferation without prior fertilization. Here, we demonstrate that there exists a large natural genetic variation with respect to the outcome of this signaling process in the model plant Arabidopsis thaliana. By using a recombinant inbred line population between the two Arabidopsis accessions Bayreuth-0 and Shahdara, we have identified two genetic components that influence the development of unfertilized endosperm. Exploiting this natural variation, we could further dissect the interdependence of embryo and endosperm growth during early seed development. Our data show an unexpectedly large degree of independence in embryo growth, but also reveal the embryo's developmental restrictions with respect to endosperm size. This work provides a genetic framework for dissection of the interplay between embryo and endosperm during seed growth in plants. PMID:18505878

  4. Knee Joint Laxity and Its Cyclic Variation Influence Tibiofemoral Motion during Weight Acceptance

    PubMed Central

    Shultz, Sandra J.; Schmitz, Randy J.; Nguyen, Anh-Dung; Levine, Beverly; Kim, Hyunsoo; Montgomery, Melissa M.; Shimokochi, Yohei; Beynnon, Bruce D.; Perrin, David H.

    2010-01-01

    Purpose To better understand how sex differences in anterior knee joint laxity (AKL) impact knee joint biomechanics, we examined the consequence of greater absolute baseline (males and females) and cyclic increases in AKL during the menstrual cycle (females) on anterior tibial translation (ATT) as the knee transitioned from non-weight bearing (NWB) to weight bearing (WB) conditions, while also controlling for genu recurvatum (GR). Methods Males and females (71F,48M;18-30 years) were measured for AKL and GR, and underwent measurement of ATT. Females were tested on the days of their cycle when AKL was at its minimum (T1) and maximum (T2); males were matched in time to a female with similar AKL. Linear regressions examined relationships between absolute baseline (AKLT1, GRT1) and cyclic changes (Δ=T2-T1; AKLΔ, GRΔ)(females only) in knee laxity with ATT as measured at T1 and T2, and Δ (T2-T1) (females only). Results AKL and GR increased in females, but not males, from T1 to T2. Greater AKLT1 and GRT1 predicted greater ATTT1 and ATTT2 in males (R2=21.0, P<.007). The combination of greater AKLT1, AKLΔ and less GRΔ predicted greater ATTT1 and ATTT2 in females (R2=12.5-13.1, P<.05), with AKLΔ being a stronger predictor (coefficient, P-value) of ATTT2 (0.864, P=.027) compared to ATTT1 (0.333, P=.370). AKLΔ was the sole predictor of ATTΔ (R2=.104; 0.740, P=.042). Conclusions Greater absolute baseline and cyclic increases in AKL were consistently associated with greater ATT produced by transition of the knee from NWB to WB. As the ACL is the primary restraint to ATT, these findings provide insight into possible mechanisms by which greater AKL may be associated with at risk knee biomechanics during the weight acceptance phase of dynamic tasks. PMID:20581718

  5. The auxin conjugate 1-O-indole-3-acetyl-beta-D-glucose is synthesized in immature legume seeds by IAGlc synthase and may be used for modification of some high molecular weight compounds.

    PubMed

    Jakubowska, Anna; Kowalczyk, Stanislaw

    2004-04-01

    Immature seeds of some dicotyledonous plants contain IAGlc synthase catalysing the synthesis of 1-O-IAGlc. This enzyme activity is comparable with 1-O-IAGlc synthase activity investigated earlier in liquid endosperm of Zea mays. Polyclonal antibodies against maize 1-O-IAGlc synthase cross-react with partially purified 1-O-IAGlc synthase from immature pea and rape seeds. Single immunoreactive bands were observed at a locus corresponding to 45.7 kDa and 43.7 kDa from pea and rape enzyme preparations, respectively, unlike that from the 50 kDa molecular mass of the maize enzyme. It was also observed that some high molecular weight compounds of pea seeds are labelled in vivo by [(14)C] IAA, and unlabelled 1-O-IAGlc inhibits that labelling. In immature pea seeds 43-49.8% of the IAA-modified high molecular weight compounds, obtained after ultracentrifugation, was found in the soluble fraction and 50.1-57% in the insoluble fraction. Ester-linked IAA accounted for about 6-9% and 38-45.6% in soluble and insoluble material, respectively, estimated after hydrolysis in 1 N NaOH. Enzymatic hydrolysis of IAA-labelled high molecular weight compounds gives free IAA and compound(s) corresponding to IAGlc isomers. These results suggest that 1-O-IAGlc synthesized in legume seeds may be used for the modification of some high molecular weight compounds. PMID:14990619

  6. Penalized weighted least-squares approach for multienergy computed tomography image reconstruction via structure tensor total variation regularization.

    PubMed

    Zeng, Dong; Gao, Yuanyuan; Huang, Jing; Bian, Zhaoying; Zhang, Hua; Lu, Lijun; Ma, Jianhua

    2016-10-01

    Multienergy computed tomography (MECT) allows identifying and differentiating different materials through simultaneous capture of multiple sets of energy-selective data belonging to specific energy windows. However, because sufficient photon counts are not available in each energy window compared with that in the whole energy window, the MECT images reconstructed by the analytical approach often suffer from poor signal-to-noise and strong streak artifacts. To address the particular challenge, this work presents a penalized weighted least-squares (PWLS) scheme by incorporating the new concept of structure tensor total variation (STV) regularization, which is henceforth referred to as 'PWLS-STV' for simplicity. Specifically, the STV regularization is derived by penalizing higher-order derivatives of the desired MECT images. Thus it could provide more robust measures of image variation, which can eliminate the patchy artifacts often observed in total variation (TV) regularization. Subsequently, an alternating optimization algorithm was adopted to minimize the objective function. Extensive experiments with a digital XCAT phantom and meat specimen clearly demonstrate that the present PWLS-STV algorithm can achieve more gains than the existing TV-based algorithms and the conventional filtered backpeojection (FBP) algorithm in terms of both quantitative and visual quality evaluations. PMID:27490315

  7. SIRT1 Polymorphisms Associate with Seasonal Weight Variation, Depressive Disorders, and Diastolic Blood Pressure in the General Population

    PubMed Central

    Kovanen, Leena; Donner, Kati; Partonen, Timo

    2015-01-01

    SIRT1 polymorphisms have previously been associated with depressive and anxiety disorders. We aimed at confirming these earlier findings and extending the analyses to seasonal variations in mood and behavior. Three tag single-nucleotide polymorphisms (SNPs) were selected to capture the common variation in the SIRT1 gene. 5910 individuals (with blood sample, diagnostic interview, self-report of on seasonal changes in mood and behavior) were selected from a representative Finnish nationwide population-based sample. Logistic and linear regression models were used to analyze the associations between the SNPs and depressive and anxiety disorders, metabolic syndrome (EGIR criteria) and its components, and health examination measurements, Homeostasis Model Assessments, and diagnoses of type 2 and type 1 diabetes. SIRT1 rs2273773 showed evidence of association with seasonal variation in weight (C-allele, OR = 0.85, 95% CI = 0.76–0.95, p = 0.005). In addition, our study gave further support for the association of SIRT1 gene with depressive disorders (rs3758391) and diastolic blood pressure (rs2273773). PMID:26509718

  8. Seasonal variation in soft tissue weights and trace metal burdens in the bay mussel, Mytilus edulis

    SciTech Connect

    Latouche, Y.D.; Mix, M.C.

    1981-12-01

    Levels of six trace metals were measure in Mytilus edulis during a six month period. Patterns of seasonal variation were established and normal ranges of metal burdens in mussels were determined. Metals measured were vanadium, manganese, nickel, copper, zinc and cadmium. Sexually mature M. edulis, between 50 and 60 mm in size, were sampled in Yaquina Bay, Oregon at regular intervals between October 1979 and June 1980. Tissues were combined in two pools, ''somatic'' and ''gonadal''. Flame atomic absorption was used to determine concentrations of manganese, nickel, copper, and cadmium. Vanadium was determined by neutron activation analysis. With the exception of copper, all gonadal tissue burdens were greatest in late winter or early spring, at the time of gametogenesis. Somatic burdens of nickel, manganese, and zinc were maximal in early spring, while copper, cadmium and vanadium fluctuated without regard to gametogenesis or spawning. Zinc concentrations increased dramatically between days 22 and 80. Such increases may be indicative of the onset of gametogenesis. Results suggest that somatic and gonadal tissue should be considered separately when measuring metal levels. 1 table (JMT)

  9. Emotional Experiences of Obese Women with Adequate Gestational Weight Variation: A Qualitative Study

    PubMed Central

    Faria-Schützer, Débora Bicudo; Surita, Fernanda Garanhani de Castro; Alves, Vera Lucia Pereira; Vieira, Carla Maria; Turato, Egberto Ribeiro

    2015-01-01

    Background As a result of the growth of the obese population, the number of obese women of fertile age has increased in the last few years. Obesity in pregnancy is related to greater levels of anxiety, depression and physical harm. However, pregnancy is an opportune moment for the intervention of health care professionals to address obesity. The objective of this study was to describe how obese pregnant women emotionally experience success in adequate weight control. Methods and Findings Using a qualitative design that seeks to understand content in the field of health, the sample of subjects was deliberated, with thirteen obese pregnant women selected to participate in an individual interview. Data was analysed by inductive content analysis and includes complete transcription of the interviews, re-readings using suspended attention, categorization in discussion topics and the qualitative and inductive analysis of the content. The analysis revealed four categories, three of which show the trajectory of body care that obese women experience during pregnancy: 1) The obese pregnant woman starts to think about her body;2) The challenge of the diet for the obese pregnant woman; 3) The relation of the obese pregnant woman with the team of antenatal professionals. The fourth category reveals the origin of the motivation for the change: 4) The potentializing factors for change: the motivation of the obese woman while pregnant. Conclusions During pregnancy, obese women are more in touch with themselves and with their emotional conflicts. Through the transformations of their bodies, women can start a more refined self-care process and experience of the body-mind unit. The fear for their own and their baby's life, due to the risks posed by obesity, appears to be a great potentializing factor for change. The relationship with the professionals of the health care team plays an important role in the motivational support of the obese pregnant woman. PMID:26529600

  10. Adaptive-weighted total variation minimization for sparse data toward low-dose x-ray computed tomography image reconstruction

    NASA Astrophysics Data System (ADS)

    Liu, Yan; Ma, Jianhua; Fan, Yi; Liang, Zhengrong

    2012-12-01

    Previous studies have shown that by minimizing the total variation (TV) of the to-be-estimated image with some data and other constraints, piecewise-smooth x-ray computed tomography (CT) can be reconstructed from sparse-view projection data without introducing notable artifacts. However, due to the piecewise constant assumption for the image, a conventional TV minimization algorithm often suffers from over-smoothness on the edges of the resulting image. To mitigate this drawback, we present an adaptive-weighted TV (AwTV) minimization algorithm in this paper. The presented AwTV model is derived by considering the anisotropic edge property among neighboring image voxels, where the associated weights are expressed as an exponential function and can be adaptively adjusted by the local image-intensity gradient for the purpose of preserving the edge details. Inspired by the previously reported TV-POCS (projection onto convex sets) implementation, a similar AwTV-POCS implementation was developed to minimize the AwTV subject to data and other constraints for the purpose of sparse-view low-dose CT image reconstruction. To evaluate the presented AwTV-POCS algorithm, both qualitative and quantitative studies were performed by computer simulations and phantom experiments. The results show that the presented AwTV-POCS algorithm can yield images with several notable gains, in terms of noise-resolution tradeoff plots and full-width at half-maximum values, as compared to the corresponding conventional TV-POCS algorithm.

  11. Seed Development and Germination

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Seed is the fertilized and matured ovule of angiosperms and gymnosperms and represents a crucial stage in the life cycle of plants. Seeds of diverse plant species may display differences in size, shape and color. Despite apparent morphological variations, most mature seeds consist of three major com...

  12. Variation in social and sexual behaviour in four species of aposematic seed bugs (Hemiptera: Lygaeidae): the role of toxic and non-toxic food.

    PubMed

    Burdfield-Steel, Emily R; Dougherty, Liam R; Smith, Lynsey A; Collins, Laura A; Shuker, David M

    2013-10-01

    Understanding variation in social behaviour both within and among species continues to be a challenge. Evolutionary or ecological theory typically predicts the optimal behaviour for an animal under a given set of circumstances, yet the real world presents much greater variation in behaviour than predicted. This variation is apparent in many social and sexual interactions, including mate choice, and has led to a renewed focus on individual variation in behaviour. Here we explore within and among species variation in social behaviour in four species of aposematic seed bug (Lygaeidae: Hemiptera). These species are Müllerian mimics, with characteristic warning colouration advertising their chemical toxicity. We examine the role of diet in generating variation in two key behaviours: social aggregation of nymphs and mate choice. We test how behaviour varies with exposure to either milkweed (a source of defensive compounds) or sunflower (that provides no defence). We show that although the four species vary in their food preferences, and diet influences their life-history (as highlighted by body size), social aggregation and mate choice is relatively unaffected by diet. We discuss our findings in terms of the evolution of aposematism, the importance of automimicry, and the role of diet in generating behavioural variation. PMID:23796773

  13. Development of gene-based markers for use in construction of the chickpea (Cicer arietinum L.) genetic linkage map and identification of QTLs associated with seed weight and plant height.

    PubMed

    Gupta, Shefali; Kumar, Tapan; Verma, Subodh; Bharadwaj, Chellapilla; Bhatia, Sabhyata

    2015-11-01

    Seed weight and plant height are important agronomic traits and contribute to seed yield. The objective of this study was to identify QTLs underlying these traits using an intra-specific mapping population of chickpea. A F11 population of 177 recombinant inbred lines derived from a cross between SBD377 (100-seed weight--48 g and plant height--53 cm) and BGD112 (100-seed weight--15 g and plant height--65 cm) was used. A total of 367 novel EST-derived functional markers were developed which included 187 EST-SSRs, 130 potential intron polymorphisms (PIPs) and 50 expressed sequence tag polymorphisms (ESTPs). Along with these, 590 previously published markers including 385 EST-based markers and 205 genomic SSRs were utilized. Of the 957 markers tested for analysis of parental polymorphism between the two parents of the mapping population, 135 (14.64%) were found to be polymorphic. Of these, 131 polymorphic markers could be mapped to the 8 linkage groups. The linkage map had a total length of 1140.54 cM with an average marker density of 8.7 cM. The map was further used for QTL identification using composite interval mapping method (CIM). Two QTLs each for seed weight, qSW-1 and qSW-2 (explaining 11.54 and 19.24% of phenotypic variance, respectively) and plant height, qPH-1 and qPH-2 (explaining 13.98 and 12.17% of phenotypic variance, respectively) were detected. The novel set of genic markers, the intra-specific linkage map and the QTLs identified in the present study will serve as valuable genomic resources in improving the chickpea seed yield using marker-assisted selection (MAS) strategies. PMID:26446030

  14. Toxicity of combined chromium(VI) and phenanthrene pollution on the seed germination, stem lengths, and fresh weights of higher plants.

    PubMed

    Hu, Shuangqing; Gu, Hairong; Cui, Chunyan; Ji, Rong

    2016-08-01

    Studies of the interaction and toxicity of pollutant combinations such as heavy metals and PAHs are of practical importance in the remediation and monitoring of the industrial soil environment. This study investigated the single and combined toxicity of chromium(VI) and phenanthrene on three important higher plants: mung beans (Phaseolus aureus), pakchoi cabbage (Brassica chinensis), and rice (Oryza sativa). In experiments using artificial soil matrix, the EC10 and EC20 of the two pollutants, alone and in combination, were analyzed with respect to seed germination, stem length, and above-ground fresh weight of these higher plants. The additive index method was used to evaluate the combined biological toxicity of chromium(VI) and phenanthrene. The results showed that the EC20 of chromium(VI) on the stem lengths of mung beans, pakchoi cabbage, and rice was 289, 248, and 550 mg kg(-1), respectively. The corresponding EC20 values for the fresh weights of the three plants were 334, 307, and 551 mg kg(-1). The EC20 of phenanthrene on the stem lengths of mung beans, pakchoi cabbage, and rice was 528, 426, and 628 mg kg(-1), respectively. The corresponding EC20 values for the fresh weights of the three plants were 696, 585, and 768 mg kg(-1). The EC20 of a combination of chromium(VI) and phenanthrene on the stem lengths of mung beans, pakchoi cabbage, and rice was 192, 173, and 279 mg kg(-1), respectively, and 200, 205, and 271 mg kg(-1) for the fresh weights of the three plants. The single and combined exposure of soil to chromium(VI) and phenanthrene had deleterious effects on plants in the early stage of growth. Overall, pakchoi cabbage was more sensitive than mung beans and rice. The two pollutants exerted synergistic effects on the stem lengths and above-ground fresh weights of both mung beans and rice but antagonistic effects on pakchoi cabbage. The results of this study also suggested pakchoi cabbage as a sensitive indicator of soil pollution. PMID

  15. Male fertility versus sterility, cytotype, and DNA quantitative variation in seed production in diploid and tetraploid sea lavenders (Limonium sp., Plumbaginaceae) reveal diversity in reproduction modes.

    PubMed

    Róis, Ana Sofia; Teixeira, Generosa; Sharbel, Timothy F; Fuchs, Jörg; Martins, Sérgio; Espírito-Santo, Dalila; Caperta, Ana D

    2012-12-01

    were present in each seed. Flow cytometric seed screens using such mature seeds showed quantitative variations in seeds ploidy level. It is concluded that male function seems to play an important role in the reproduction modes of Limonium diploids and tetraploids. PMID:23086613

  16. Within-population spatial variation in pollinator visitation rates, pollen limitation on seed set, and flower longevity in an alpine species

    NASA Astrophysics Data System (ADS)

    Lundemo, Sverre; Totland, Ørjan

    2007-11-01

    Pollen limitation through insufficient pollen deposition on stigmas caused by too infrequent pollinator visitation may influence the reproductive outcome of plants. In this study we investigated how pollinator visitation rate, the degree of pollen limitation, and flower longevity varied spatially among three sites at different altitudes within a population of the dwarf shrub Dryas octopetala L. in alpine southern Norway. Significant pollen limitation on seed set only occurred at the mid-elevation site, while seed set at the other sites appeared to be mainly resource limited, thus indicating a spatial variation in pollen limitation. There was no association between the spatial variation in the extent of pollen limitation and pollinator visitation rate to flowers. However, pollinator visitation rates were related to flower longevity of Dryas; sites with low visitation rates had long-lived flowers and vice versa. Thus, our results suggest within-population spatial co-variation between pollinator visitation rates, pollen limitation, and a developmental response to these factors, flower longevity.

  17. Adaptive-weighted total variation minimization for sparse data toward low-dose x-ray computed tomography image reconstruction.

    PubMed

    Liu, Yan; Ma, Jianhua; Fan, Yi; Liang, Zhengrong

    2012-12-01

    Previous studies have shown that by minimizing the total variation (TV) of the to-be-estimated image with some data and other constraints, piecewise-smooth x-ray computed tomography (CT) can be reconstructed from sparse-view projection data without introducing notable artifacts. However, due to the piecewise constant assumption for the image, a conventional TV minimization algorithm often suffers from over-smoothness on the edges of the resulting image. To mitigate this drawback, we present an adaptive-weighted TV (AwTV) minimization algorithm in this paper. The presented AwTV model is derived by considering the anisotropic edge property among neighboring image voxels, where the associated weights are expressed as an exponential function and can be adaptively adjusted by the local image-intensity gradient for the purpose of preserving the edge details. Inspired by the previously reported TV-POCS (projection onto convex sets) implementation, a similar AwTV-POCS implementation was developed to minimize the AwTV subject to data and other constraints for the purpose of sparse-view low-dose CT image reconstruction. To evaluate the presented AwTV-POCS algorithm, both qualitative and quantitative studies were performed by computer simulations and phantom experiments. The results show that the presented AwTV-POCS algorithm can yield images with several notable gains, in terms of noise-resolution tradeoff plots and full-width at half-maximum values, as compared to the corresponding conventional TV-POCS algorithm. PMID:23154621

  18. Identification, expression and variation of the GNPDA2 gene, and its association with body weight and fatness traits in chicken

    PubMed Central

    Ouyang, Hongjia; Zhang, Huan; Li, Weimin; Liang, Sisi; Jebessa, Endashaw; Abdalla, Bahareldin A.

    2016-01-01

    Background. The GNPDA2 (glucosamine-6-phosphate deaminase 2) gene is a member of Glucosamine-6-phosphate (GlcN6P) deaminase subfamily, which encoded an allosteric enzyme of GlcN6P. Genome-wide association studies (GWAS) have shown that variations of human GNPDA2 are associated with body mass index and obesity risk, but its function and metabolic implications remain to be elucidated.The object of this study was to characterize the gene structure, expression, and biological functions of GNPDA2 in chickens. Methods. Variant transcripts of chicken GNPDA2 and their expression were investigated using rapid amplification of cDNA ends (RACE) system and real-time quantitative PCR technology. We detected the GNPDA2 expression in hypothalamic, adipose, and liver tissue of Xinghua chickens with fasting and high-glucose-fat diet treatments, and performed association analysis of variations of GNPDA2 with productive traits in chicken. The function of GNPDA2 was further studied by overexpression and small interfering RNA (siRNA) methods in chicken preadipocytes. Results.Four chicken GNPDA2 transcripts (cGNPDA2-a∼cGNPDA2-d) were identified in this study. The complete transcript GNPDA2-a was predominantly expressed in adipose tissue (subcutaneous fat and abdominal fat), hypothalamus, and duodenum. In fasting chickens, the mRNA level of GNPDA2 was decreased by 58.8% (P < 0.05) in hypothalamus, and returned to normal level after refeeding. Chicken fed a high-glucose-fat diet increased GNPDA2 gene expression about 2-fold higher in adipose tissue (P < 0.05) than that in the control (fed a basal diet), but decreased its expression in hypothalamus. Two single-nucleotide polymorphisms of the GNPDA2 gene were significantly associated with body weight and a number of fatness traits in chicken (P < 0.05). Conclusion. Our findings indicated that the GNPDA2 gene has a potential role in the regulation of body weight, fat and energy metabolism in chickens. PMID:27326383

  19. Identification, expression and variation of the GNPDA2 gene, and its association with body weight and fatness traits in chicken.

    PubMed

    Ouyang, Hongjia; Zhang, Huan; Li, Weimin; Liang, Sisi; Jebessa, Endashaw; Abdalla, Bahareldin A; Nie, Qinghua

    2016-01-01

    Background. The GNPDA2 (glucosamine-6-phosphate deaminase 2) gene is a member of Glucosamine-6-phosphate (GlcN6P) deaminase subfamily, which encoded an allosteric enzyme of GlcN6P. Genome-wide association studies (GWAS) have shown that variations of human GNPDA2 are associated with body mass index and obesity risk, but its function and metabolic implications remain to be elucidated.The object of this study was to characterize the gene structure, expression, and biological functions of GNPDA2 in chickens. Methods. Variant transcripts of chicken GNPDA2 and their expression were investigated using rapid amplification of cDNA ends (RACE) system and real-time quantitative PCR technology. We detected the GNPDA2 expression in hypothalamic, adipose, and liver tissue of Xinghua chickens with fasting and high-glucose-fat diet treatments, and performed association analysis of variations of GNPDA2 with productive traits in chicken. The function of GNPDA2 was further studied by overexpression and small interfering RNA (siRNA) methods in chicken preadipocytes. Results.Four chicken GNPDA2 transcripts (cGNPDA2-a∼cGNPDA2-d) were identified in this study. The complete transcript GNPDA2-a was predominantly expressed in adipose tissue (subcutaneous fat and abdominal fat), hypothalamus, and duodenum. In fasting chickens, the mRNA level of GNPDA2 was decreased by 58.8% (P < 0.05) in hypothalamus, and returned to normal level after refeeding. Chicken fed a high-glucose-fat diet increased GNPDA2 gene expression about 2-fold higher in adipose tissue (P < 0.05) than that in the control (fed a basal diet), but decreased its expression in hypothalamus. Two single-nucleotide polymorphisms of the GNPDA2 gene were significantly associated with body weight and a number of fatness traits in chicken (P < 0.05). Conclusion. Our findings indicated that the GNPDA2 gene has a potential role in the regulation of body weight, fat and energy metabolism in chickens. PMID:27326383

  20. Orthodoxy, recalcitrance and in-between: describing variation in seed storage characteristics using threshold responses to water loss

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Tolerance of desiccation is typically described by a threshold or low-water-content-limit to survival. This convention provides fairly good distinction between orthodox and recalcitrant seeds, which show thresholds of less than about 0.07 and greater than about 0.2 g H2O g dw-1, respectively. Thresh...

  1. VARIATION OF SEED AGING RATES AMONG LINES OF WHEAT, RYE AND TRITICALE IN RESPONSE TO STORAGE HUMIDITY

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Seed deterioration was measured in 50 lines of wheat, rye and triticale that were stored at 35C and a range of relative humidities for over 6 years. Decrease in percent germination and radicle growth with storage time were fit to Avrami kinetics, and longevity of individual lines is expressed as ti...

  2. Differential transcriptional activity of SAD, FAD2 and FAD3 desaturase genes in developing seeds of linseed contributes to varietal variation in α-linolenic acid content.

    PubMed

    Rajwade, Ashwini V; Kadoo, Narendra Y; Borikar, Sanjay P; Harsulkar, Abhay M; Ghorpade, Prakash B; Gupta, Vidya S

    2014-02-01

    Linseed or flax (Linum usitatissimum L.) varieties differ markedly in their seed α-linolenic acid (ALA) levels. Fatty acid desaturases play a key role in accumulating ALA in seed. We performed fatty acid (FA) profiling of various seed developmental stages of ten Indian linseed varieties including one mutant variety. Depending on their ALA contents, these varieties were grouped under high ALA and low ALA groups. Transcript profiling of six microsomal desaturase genes (SAD1, SAD2, FAD2, FAD2-2, FAD3A and FAD3B), which act sequentially in the fatty acid desaturation pathway, was performed using real-time PCR. We observed gene specific as well as temporal expression pattern for all the desaturases and their differential expression profiles corresponded well with the variation in FA accumulation in the two groups. Our study points to efficient conversion of intermediate FAs [stearic (SA), oleic (OA) and linoleic acids (LA)] to the final product, ALA, due to efficient action of all the desaturases in high ALA group. While in the low ALA group, even though the initial conversion up to OA was efficient, later conversions up to ALA seemed to be inefficient, leading to higher accumulation of OA and LA instead of ALA. We sequenced the six desaturase genes from the ten varieties and observed that variation in the amino acid (AA) sequences of desaturases was not responsible for differential ALA accumulation, except in the mutant variety TL23 with very low (<2%) ALA content. In TL23, a point mutation in the FAD3A gene resulted into a premature stop codon generating a truncated protein with 291 AA. PMID:24380374

  3. Bean arcelin : 2. Genetic variation, inheritance and linkage relationships of a novel seed protein of Phaseolus vulgaris L.

    PubMed

    Osborn, T C; Blake, T; Gepts, P; Bliss, F A

    1986-03-01

    Crude proteins from seeds of wild bean accessions of Mexican origin were analyzed by one-dimensional sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS/PAGE). Several accessions had electrophoretic patterns showing unique protein bands. When analyzed by two-dimensional isoelectric focusing (IEF)-SDS/PAGE, four protein variants which had electrophoretic mobilities similar to each other but different from the other major seed proteins, phaseolin and lectin, were observed. All four variants, which have not been described in cultivated beans, were tentatively named arcelin proteins and designated as arcelin 1, 2, 3 and 4. Arcelins 3 and 4 had polypeptides that comigrated on two-dimensional gels and these variants occurred in accessions that were collected in the same location. Analysis of single F2 seeds from crosses among arcelin-containing lines and from crosses between cultivated beans lines without arcelin and arcelin-containing lines revealed that differences in arcelin polypeptide expression were inherited monogenically. The alleles for different arcelin variants were codominant to each other and dominant to the absence of arcelin. The gene(s) controlling arcelin proteins were unlinked to those controlling phaseolin expression and tightly linked to genes controlling the presence of lectin proteins (< 0.30% recombination). The possible origins of arcelin genes and their potential role in bruchid resistance are discussed. PMID:24247713

  4. LMWOA (low molecular weight organic acid) exudation by salt marsh plants: Natural variation and response to Cu contamination

    NASA Astrophysics Data System (ADS)

    Mucha, Ana P.; Almeida, C. Marisa R.; Bordalo, Adriano A.; Vasconcelos, M. Teresa S. D.

    2010-06-01

    This work aimed to evaluate, in vitro, the capability of roots of two salt marsh plants to release low molecular weight organic acids (LMWOAs) and to ascertain whether Cu contamination would stimulate or not organic acids exudation. The sea rush Juncus maritimus and the sea-club rush Scirpus maritimus, both from the lower Douro river estuary (NW Portugal), were used. Plants were collected seasonally, four times a year in 2004, during low tide. After sampling, plant roots were washed for removal of adherent particles and immersed for 2 h in a solution that matched salinity (3) and pH (7.5) of the pore water from the same location to obtain plant exudates. In one of the seasons, similar experiments were carried out but spiking the solution with different amounts of Cu in order to embrace the range between 0 and 1600 nM. In the final solutions as well as in sediment pore water LMWOAs were determined by high performance liquid chromatography. Plants were able to release, in a short period of time, relatively high amounts of LMWOAs (oxalate, citrate, malate, malonate, and succinate). In the sediment pore water oxalate, succinate and acetate were also detected. Therefore, plant roots probably contributed to the presence of some of these organic compounds in pore water. Exudation differed between the plant species and also showed some seasonally variation, particularly for S. maritimus. The release of oxalate by J. maritimus increased with Cu increase in the media. However, exudation of the other LMWOAs did not seem to be stimulated by Cu contamination in the media. This fact is compatible with the existence of alternative internal mechanisms for Cu detoxification, as denoted by the fact that in media contaminated with Cu both plant species accumulated relatively high amounts (29-83%) of the initially dissolved Cu. This study expands our knowledge on the contribution of globally dominant salt marsh plants to the release of LMWOAs into the environment.

  5. The transcriptomic signature of developing soybean seeds reveals the genetic basis of seed trait adaptation during domestication.

    PubMed

    Lu, Xiang; Li, Qing-Tian; Xiong, Qing; Li, Wei; Bi, Ying-Dong; Lai, Yong-Cai; Liu, Xin-Lei; Man, Wei-Qun; Zhang, Wan-Ke; Ma, Biao; Chen, Shou-Yi; Zhang, Jin-Song

    2016-06-01

    Cultivated soybean has undergone many transformations during domestication. In this paper we report a comprehensive assessment of the evolution of gene co-expression networks based on the analysis of 40 transcriptomes from developing soybean seeds in cultivated and wild soybean accessions. We identified 2680 genes that are differentially expressed during seed maturation and established two cultivar-specific gene co-expression networks. Through analysis of the two networks and integration with quantitative trait locus data we identified two potential key drivers for seed trait formation, GA20OX and NFYA. GA20OX encodes an enzyme in a rate-limiting step of gibberellin biosynthesis, and NFYA encodes a transcription factor. Overexpression of GA20OX and NFYA enhanced seed size/weight and oil content, respectively, in seeds of transgenic plants. The two genes showed significantly higher expression in cultivated than in wild soybean, and the increases in expression were associated with genetic variations in the promoter region of each gene. Moreover, the expression of GA20OX and NFYA in seeds of soybean accessions correlated with seed weight and oil content, respectively. Our study reveals transcriptional adaptation during soybean domestication and may identify a mechanism of selection by expression for seed trait formation, providing strategies for future breeding practice. PMID:27062090

  6. Assessment of genetic diversity and variation of Robinia pseudoacacia seeds induced by short-term spaceflight based on two molecular marker systems and morphological traits.

    PubMed

    Yuan, C Q; Li, Y F; Sun, P; Sun, Y H; Zhang, G J; Yang, M S; Zhang, Y Y; Li, Y; Wang, L

    2012-01-01

    The black locust (Robinia pseudoacacia) is a forest legume that is highly valued as a honey plant and for its wood. We explored the effect of short-term spaceflight on development of R. pseudoacacia seedlings derived from seeds that endured a 15-day flight; the genetic diversity and variation of plants sampled from space-mutagenized seeds were compared to plants from parallel ground-based control seeds using molecular markers and morphological traits. In the morphology analysis, the space-mutagenized group had apparent variation compared with the control group in morphological traits, including plant height, basal diameter, number of branches, branch stipular thorn length, branch stipular thorn middle width, leaflet vertex angle, and tippy leaf vertex angle. Simple sequence repeat (SSR) and sequence-related amplified polymorphism (SRAP) molecular marker analyses showed a slightly higher levels of genetic diversity in the space-mutagenized group compared to the control group. In the SRAP analysis, the space-mutagenized group had 115 polymorphic bands vs 98 in the controls; 91.27% polymorphic loci vs 77.78% in the controls; 1.9127 ± 0.2834 alleles vs 1.7778 ± 0.4174 in the controls; Nei's genetic diversity (h) was 0.2930 ± 0.1631 vs 0.2688 ± 0.1862 in the controls, and the Shannon's information index (I) was 0.4452 ± 0.2177 vs 0.4031 ± 0.2596 in the controls. The number of alleles was significantly higher in the space-mutagenized group. In the SSR analysis, the space-mutagenized group also had more polymorphic bands (51 vs 46), a greater percentage of polymorphic loci (89.47% vs 80.70%); h was also higher (0.2534 ± 0.1533 vs 0.2240 ± 0.1743), as was I (0.3980 ± 0.2069 vs 0.3501 ± 0.2412). These results demonstrated that the range of genetic variation in the populations of R. pseudoacacia increased after spaceflight. It also suggested that the SSR and SRAP markers are effective markers for studying mutations and genetic diversity in R. pseudoacacia. The data

  7. Birth weight modifies the association between central-nervous-system gene variation and adult body mass index

    PubMed Central

    Ruiz-Narváez, Edward A.; Haddad, Stephen A.; Rosenberg, Lynn; Palmer, Julie R.

    2015-01-01

    Genome wide association studies (GWAS) have identified approximately 100 loci associated with body mass index (BMI). Persons with low birth-weight have an increased risk of metabolic disorders. We postulate that normal mechanisms of body weight regulation are disrupted in subjects with low birth-weight. The present analyses included 2215 African American women from the Black Women’s Health Study, and were based on genotype data on twenty BMI-associated loci and self-reported data on birth-weight, weight at age 18, and adult weight. We used general linear models to assess the association of individual SNPs with BMI at age 18 and later in adulthood within strata of birth-weight (above and below the median, 3200 g). Three SNPs (rs1320330 near TMEM18, rs261967 near PCSK1, and rs17817964 in FTO), and a genetic score combining these three variants, showed significant interactions with birth-weight in relation to BMI. Among women with birth-weight <3200 g, there was an inverse association between genetic score and BMI; beta-coefficient = −0.045 (95% CI −0.104, 0.013) for BMI at age 18, and −0.055 (95% CI −0.112, 0.002) for adult BMI. Among women with birth-weight ≥3,200 g, genetic score was positively associated with BMI: beta-coefficient = 0.110 (95% CI 0.051, 0.169) for BMI at age 18 (P for interaction = 0.0002), and 0.112 (95% CI 0.054, 0.170) for adult BMI (P for interaction < 0.0001). Because TMEM18, PCSK1, and FTO are highly expressed in the central nervous system (CNS), our results suggest that low birth-weight may disrupt mechanisms of CNS body weight regulation. PMID:26582267

  8. Genetic variation in adaptive traits and seed transfer zones for Pseudoroegneria spicata (bluebunch wheatgrass) in the northwestern United States

    Technology Transfer Automated Retrieval System (TEKTRAN)

    A genecological approach was used to explore genetic variation in adaptive traits in Pseudoroegneria spicata, a key restoration grass, in the intermountain western United States. Common garden experiments were established at three contrasting sites with seedlings from two maternal parents from each ...

  9. Consumption of diets containing raw soya beans (Glycine max), kidney beans (Phaseolus vulgaris), cowpeas (Vigna unguiculata) or lupin seeds (Lupinus angustifolius) by rats for up to 700 days: effects on body composition and organ weights.

    PubMed

    Grant, G; Dorward, P M; Buchan, W C; Armour, J C; Pusztai, A

    1995-01-01

    Feeding trials have been done with rats to assess the effects of long-term (700 d) consumption of diets based on raw cowpeas (Vigna unguiculata; moderate Bowman-Birk inhibitor content, low lectin content), lupin seeds (Lupinus angustifolius; low lectin and protease inhibitor content) or soya beans (Glycine max; high Kunitz inhibitor content, moderate Bowman-Birk inhibitor content, moderate lectin content) or diets containing low levels of raw kidney bean (Phaseolus vulgaris; high lectin content, low Bowman-Birk inhibitor content) on body weight and composition and organ weights. All the legume-based diets reduced feed conversion efficiency and growth rates during the initial 250 d. However, after 250 d the weight gains by rats given legume-based diets were similar to those of controls given the same daily feed intake. Long-term consumption of diets containing low levels of kidney bean significantly altered body composition of rats. The levels of lipid in the body were significantly reduced. As a result, carcasses of these rats contained a higher proportion of muscle/protein than did controls. Small-intestine relative weight was increased by short- and long-term consumption of the kidney-bean-based diet. However, the increase in relative pancreatic weight observed at 30 d did not persist long term. None of the other legume-based diets caused any significant changes in body composition. However, long-term exposure to a soya-bean- or cowpea-based diet induced an extensive increase in the relative and absolute weights of the pancreas and caused an increase in the incidence of macroscopic pancreatic nodules and possibly pancreatic neoplasia. Long-term consumption of the cowpea-, kidney-bean-, lupin-seed- or soya-bean-based diets by rats resulted in a significant increase in the relative weight of the caecum and colon. PMID:7857911

  10. Spatio-Temporal Variation in Length-Weight Relationships and Condition of the Ribbonfish Trichiurus lepturus (Linnaeus, 1758): Implications for Fisheries Management.

    PubMed

    Al Nahdi, Abdullah; Garcia de Leaniz, Carlos; King, Andrew J

    2016-01-01

    Knowledge of length-weight relationships for commercially exploited fish is an important tool for assessing and managing of fish stocks. However, analyses of length-weight relationship fisheries data typically do not consider the inherent differences in length-weight relationships for fish caught from different habitats, seasons, or years, and this can affect the utility of these data for developing condition indices or calculating fisheries biomass. Here, we investigated length-weight relationships for ribbonfish Trichiurus lepturus in the waters of the Arabian Sea off Oman collected during three periods (2001-02, 2007-08, and 2014-15) and showed that a multivariate modelling approach that considers the areas and seasons in which ribbonfish were caught improved estimation of length-weight relationships. We used the outputs of these models to explore spatio-temporal variations in condition indices and relative weights among ribbonfish, revealing fish of 85-125 cm were in the best overall condition. We also found that condition differed according to where and when fish were caught, with condition lowest during spring and pre-south-west monsoon periods and highest during and after the south-west monsoons. We interpret these differences to be a consequence of variability in temperature and food availability. Based on our findings, we suggest fishing during seasons that have the lowest impact on fish condition and which are commercially most viable; such fishery management would enhance fisheries conservation and economic revenue in the region. PMID:27579485

  11. Variation at the Melanocortin 4 Receptor gene and response to weight-loss interventions in the Diabetes Prevention Program

    PubMed Central

    Pan, Qing; Delahanty, Linda M.; Jablonski, Kathleen A.; Knowler, William C.; Kahn, Steven E.; Florez, Jose C.; Franks, Paul W.

    2013-01-01

    Objective To assess associations and genotype × treatment interactions for melanocortin 4 receptor (MC4R) locus variants and obesity-related traits. Design and Methods Diabetes Prevention Program (DPP) participants (N=3,819, of whom 3,356 were genotyped for baseline and 3,234 for longitudinal analyses) were randomized into intensive lifestyle modification (diet, exercise, weight loss), metformin or placebo control. Adiposity was assessed in a subgroup (n=909) using computed tomography. All analyses were adjusted for age, sex, ethnicity and treatment. Results The rs1943218 minor allele was nominally associated with short-term (6 month; P=0.032) and long-term (2 year; P=0.038) weight change. Eight SNPs modified response to treatment on short-term (rs17066856, rs9966412, rs17066859, rs8091237, rs17066866, rs7240064) or long-term (rs12970134, rs17066866) reduction in body weight, or diabetes incidence (rs17066829) (all Pinteraction <0.05). Conclusion This is the first study to comprehensively assess the role of MC4R variants and weight regulation in a weight loss intervention trial. One MC4R variant was directly associated with obesity-related traits or diabetes; numerous other variants appear to influence body weight and diabetes risk by modifying the protective effects of the DPP interventions. PMID:23512951

  12. Copy Number Variation of Cytokinin Oxidase Gene Tackx4 Associated with Grain Weight and Chlorophyll Content of Flag Leaf in Common Wheat

    PubMed Central

    Chang, Cheng; Lu, Jie; Zhang, Hai-Ping; Ma, Chuan-Xi; Sun, Genlou

    2015-01-01

    As the main pigment in photosynthesis, chlorophyll significantly affects grain filling and grain weight of crop. Cytokinin (CTK) can effectively increase chlorophyll content and chloroplast stability, but it is irreversibly inactivated by cytokinin oxidase (CKX). In this study, therefore, twenty-four pairs of primers were designed to identify variations of wheat CKX (Tackx) genes associated with flag leaf chlorophyll content after anthesis, as well as grain weight in 169 recombinant inbred lines (RIL) derived from Triticum aestivum Jing 411 × Hongmangchun 21. Results indicated variation of Tackx4, identified by primer pair T19-20, was proven to significantly associate with chlorophyll content and grain weight in the RIL population. Here, two Tackx4 patterns were identified: one with two co-segregated fragments (Tackx4-1/Tackx4-2) containing 618 bp and 620 bp in size (as in Jing 411), and another with no PCR product. The two genotypes were designated as genotype-A and genotype-B, respectively. Grain weight and leaf chlorophyll content at 5~15 days after anthesis (DAA) were significantly higher in genotype-A lines than those in genotype-B lines. Mapping analysis indicated Tackx4 was closely linked to Xwmc169 on chromosome 3AL, as well as co-segregated with a major quantitative trait locus (QTL) for both grain weight and chlorophyll content of flag leaf at 5~15 DAA. This QTL explained 8.9~22.3% phenotypic variations of the two traits across four cropping seasons. Among 102 wheat varieties, a third genotype of Tackx4 was found and designated as genotype-C, also having two co-segregated fragments, Tackx4-2 and Tackx4-3 (615bp). The sequences of three fragments, Tackx4-1, Tackx4-2, and Tackx4-3, showed high identity (>98%). Therefore, these fragments could be considered as different copies at Tackx4 locus on chromosome 3AL. The effect of copy number variation (CNV) of Tackx4 was further validated. In general, genotype-A contains both significantly higher grain weight

  13. Seed dormancy in Mexican teosinte

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Seed dormancy in wild Zea species may affect fitness and relate to ecological adaptation. The primary objective of this study was to characterize the variation in seed germination of the wild species of the genus Zea that currently grow in Mexico, and to relate this variation to their ecological zon...

  14. Distinguishing disease effects from environmental effects in a mountain ungulate: seasonal variation in body weight, hematology, and serum chemistry among Iberian ibex (Capra pyrenaica) affected by sarcoptic mange.

    PubMed

    Pérez, Jesús M; Serrano, Emmanuel; Soriguer, Ramón C; González, Francisco J; Sarasa, Mathieu; Granados, José E; Cano-Manuel, Francisco J; Cuenca, Rafaela; Fandos, Paulino

    2015-01-01

    Our study focuses on the Iberian ibex (Capra pyrenaica) from the Sierra Nevada Natural Space (southern Spain), where sarcoptic mange is an endemic disease and animals are affected by a highly seasonal environment. Our aim was to distinguish between disease and environmental influences on seasonal variation in body weight, hematology, and serum biochemistry in Iberian ibex. We sampled 136 chemically immobilized male ibexes. The single effect of mange influenced hemoglobin, hematocrit, mean corpuscular volume, leukocytes, band neutrophils, monocytes, cholesterol, urea, creatine, and aspartate aminotransferase. Both mange and the period of the year also affected values of mean corpuscular hemoglobin, mean corpuscular hemoglobin concentration, neutrophils, glucose, and serum proteins. Scabietic animals showed a marked reduction in body weight (21.4 kg on average), which was more pronounced in winter. These results reveal that 1) infested animals are anemic, 2) secondary infections likely occur, and 3) sarcoptic mange is catabolic. PMID:25380360

  15. Cross-cultural variation in blood pressure: a quantitative analysis of the relationships of blood pressure to cultural characteristics, salt consumption and body weight.

    PubMed

    Waldron, I; Nowotarski, M; Freimer, M; Henry, J P; Post, N; Witten, C

    1982-01-01

    This study has analyzed the relationships of cross-cultural variation in blood pressure to cultural characteristics, salt consumption and body weight. The data used were blood pressures for adults in 84 groups, ratings of cultural characteristics (based on anthropological data and made by raters who had no knowledge of the blood pressure data) and, where available, salt consumption and body mass index (weight/height2). Blood pressures were higher and the slopes of blood pressure with age were greater in groups which had greater involvement in a money economy, more economic competition, more contact with people of different culture or beliefs, and more unfulfilled aspirations for a return to traditional beliefs and values. Blood pressures were also higher in groups for which the predominant family type was a nuclear or father-absent family, as opposed to an extended family. For Negroes, groups who were descended from slaves had higher blood pressures than other groups. The correlations between blood pressures and involvement in a money economy were substantial and significant even after controlling for level of salt consumption and, for men, also after controlling for body mass index. For men there were also significant partial correlations between blood pressure and salt consumption, controlling for type of economy. For women there were significant partial correlations between blood pressure and body mass index, controlling for type of economy. In conclusion, cross-cultural variation in blood pressure appears to be due to multiple factors. One contributory factor appears to be psychosocial stress due to cultural disruption, including the disruption of cooperative relationships and traditional cultural patterns which frequently occurs during economic modernization. In addition, both the protective effects of very low salt consumption in some groups and differences in body weight appear to contribute to cross-cultural variation in blood pressure. PMID:7079796

  16. [Allozyme variation of seed embryos and mating system in relict populations of Scots pine (Pinus sylvestris L.) from the Kremenets Hill Ridge and Maloe Poles'e].

    PubMed

    Korshikov, I I; Kalafat, L A; Lisnichuk, A N; Velikorid'ko, T I; Mudrik, E A

    2011-07-01

    Allozyme variation at ten polymorphic loci and mating system was studied in three small isolated relict populations (4.4 to 22 ha) and in three artificial stands of Pinus sylvestris from the Kremenets Hill Ridge and Maloe Poles'e. It was established that the mean heterozygosity of 130 to 140 year-old trees from natural populations (H(O) = 0.288; H(E) = 0.277) was substantially lower, compared to 30 to 40 year-old trees from artificial stands (H(O) = 0.358; H(E) = 0.330). The observed heterozygosity of seed embryos (H(O) = 0.169 and 0.180) was substantially lower than of the mature trees from populations and artificial stands, respectively. In the embryo samples, irrespectively of the forest stand origin, substantial hetedrozygote deficiency was observed (at six to eight loci), compared to the Hardy-Weinberg expectations. The proportion of cross pollination in the populations and artificial stands was low, t(m) = 0.588 to 0.721; and t(m) = 0.455 to 0.837, respectively. PMID:21938957

  17. GWR-PM - Spatial variation relationship analysis with Geographically Weighted Regression (GWR) - An application at Peninsular Malaysia

    NASA Astrophysics Data System (ADS)

    Jamhuri, J.; Azhar, B. M. S.; Puan, C. L.; Norizah, K.

    2016-06-01

    GWR-PM has been developed exclusively for decision makers in Peninsular Malaysia and the purpose is to provide them with additional flexibility in analysing spatial variation. While GWR extension analysis in ArcMap application has a universal coordinate system, GWR-PM is specifically designed with Peninsular Malaysia's coordinate system of Kertau RSO Malaya Meter. This paper presents the development of GWR-PM model by using a model builder, the application of which is to examine the forest fire risk at North Selangor Peat Swamp Forest. This model can be extended and improved by using ArcGIS language of phyton.

  18. Effects of Perilipin (PLIN) Gene Variation on Metabolic Syndrome Risk and Weight Loss in Obese Children and Adolescents

    PubMed Central

    Deram, Sophie; Nicolau, Christiane Y.; Perez-Martinez, Pablo; Guazzelli, Isabel; Halpern, Alfredo; Wajchenberg, Bernardo L.; Ordovas, Jose M.; Villares, Sandra M.

    2008-01-01

    Context: Genetic polymorphisms at the perilipin (PLIN) locus have been investigated for their potential utility as markers for obesity and metabolic syndrome (MS). We examined in obese children and adolescents (OCA) aged 7–14 yr the association of single-nucleotide polymorphisms (SNP) at the PLIN locus with anthropometric, metabolic traits, and weight loss after 20-wk multidisciplinary behavioral and nutritional treatment without medication. Design: A total of 234 OCA [body mass index (BMI = 30.4 ± 4.4 kg/m2; BMI Z-score = 2.31 ± 0.4) were evaluated at baseline and after intervention. We genotyped four SNPs (PLIN1 6209T→C, PLIN4 11482G→A, PLIN5 13041A→G, and PLIN6 14995A→T). Results: Allele frequencies were similar to other populations, PLIN1 and PLIN4 were in linkage disequilibrium (D′ = 0.999; P < 0.001). At baseline, no anthropometric differences were observed, but minor allele A at PLIN4 was associated with higher triglycerides (111 ± 49 vs. 94 ± 42 mg/dl; P = 0.003), lower high-density lipoprotein cholesterol (40 ± 9 vs. 44 ± 10 mg/dl; P = 0.003) and higher homeostasis model assessment for insulin resistance (4.0 ± 2.3 vs. 3.5 ± 2.1; P = 0.015). Minor allele A at PLIN4 was associated with MS risk (age and sex adjusted) hazard ratio 2.4 (95% confidence interval = 1.1–4.9) for genotype GA and 3.5 (95% confidence interval = 1.2–9.9) for AA. After intervention, subjects carrying minor allele T at PLIN6 had increased weight loss (3.3 ± 3.7 vs. 1.9 ± 3.4 kg; P = 0.002) and increased loss of the BMI Z-score (0.23 ± 0.18 vs. 0.18 ± 0.15; P = 0.003). Due to group size, risk of by-chance findings cannot be excluded. Conclusion: The minor A allele at PLIN4 was associated with higher risk of MS at baseline, whereas the PLIN6 SNP was associated with better weight loss, suggesting that these polymorphisms may predict outcome strategies based on multidisciplinary treatment for OCA. PMID:18812483

  19. Differential seed handling by two African primates affects seed fate and establishment of large-seeded trees

    NASA Astrophysics Data System (ADS)

    Gross-Camp, Nicole D.; Kaplin, Beth A.

    2011-11-01

    We examined the influence of seed handling by two semi-terrestrial African forest primates, chimpanzees ( Pan troglodytes) and l'Hoest's monkeys ( Cercopithecus lhoesti), on the fate of large-seeded tree species in an afromontane forest. Chimpanzees and l'Hoest's monkeys dispersed eleven seed species over one year, with quantity and quality of dispersal varying through time. Primates differed in their seed handling behaviors with chimpanzees defecating large seeds (>0.5 cm) significantly more than l'Hoest's. Furthermore, they exhibited different oral-processing techniques with chimpanzees discarding wadges containing many seeds and l'Hoest's monkeys spitting single seeds. A PCA examined the relationship between microhabitat characteristics and the site where primates deposited seeds. The first two components explained almost half of the observed variation. Microhabitat characteristics associated with sites where seeds were defecated had little overlap with those characteristics describing where spit seeds arrived, suggesting that seed handling in part determines the location where seeds are deposited. We monitored a total of 552 seed depositions through time, recording seed persistence, germination, and establishment. Defecations were deposited significantly farther from an adult conspecific than orally-discarded seeds where they experienced the greatest persistence but poorest establishment. In contrast, spit seeds were deposited closest to an adult conspecific but experienced the highest seed establishment rates. We used experimental plots to examine the relationship between seed handling, deposition site, and seed fate. We found a significant difference in seed handling and fate, with undispersed seeds in whole fruits experiencing the lowest establishment rates. Seed germination differed by habitat type with open forest experiencing the highest rates of germination. Our results highlight the relationship between primate seed handling and deposition site and seed

  20. Genome-wide association study in arabidopsis thaliana of natural variation in seed oil melting point, a widespread adaptive trait in plants

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Seed oil melting point is an adaptive, quantitative trait determined by the relative proportions of the fatty acids that compose the oil. Micro- and macro-evolutionary evidence suggests selection has changed the melting point of seed oils to co-vary with germination temperatures because of a trade-o...

  1. Phytochemical Evaluation of Moth Bean (Vigna aconitifolia L.) Seeds and Their Divergence

    PubMed Central

    Gupta, Neha; Shrivastava, Nidhi; Singh, Pramod Kumar; Bhagyawant, Sameer S.

    2016-01-01

    In the present study, phytochemical contents of 25 moth bean (Vigna aconitifolia) seed accessions were evaluated. This includes protease inhibitors, phytic acid, radical scavenging activity, and tannins. The studies revealed significant variation in the contents of theses phytochemicals. Presence of photochemical composition was correlated with seed storage proteins like albumin and globulin. Qualitative identification of total seed storage protein abundance across two related moth bean accessions using two-dimensional gel electrophoresis (2D-GE) was performed. Over 20 individual protein fractions were distributed over the gel as a series of spots in two moth bean accessions. Seed proteome accumulated spots of high intensity over a broad range of pI values of 3–10 in a molecular weight range of 11–170 kDa. In both seed accessions maximum protein spots are seen in the pI range of 6–8. PMID:27239343

  2. Phytochemical Evaluation of Moth Bean (Vigna aconitifolia L.) Seeds and Their Divergence.

    PubMed

    Gupta, Neha; Shrivastava, Nidhi; Singh, Pramod Kumar; Bhagyawant, Sameer S

    2016-01-01

    In the present study, phytochemical contents of 25 moth bean (Vigna aconitifolia) seed accessions were evaluated. This includes protease inhibitors, phytic acid, radical scavenging activity, and tannins. The studies revealed significant variation in the contents of theses phytochemicals. Presence of photochemical composition was correlated with seed storage proteins like albumin and globulin. Qualitative identification of total seed storage protein abundance across two related moth bean accessions using two-dimensional gel electrophoresis (2D-GE) was performed. Over 20 individual protein fractions were distributed over the gel as a series of spots in two moth bean accessions. Seed proteome accumulated spots of high intensity over a broad range of pI values of 3-10 in a molecular weight range of 11-170 kDa. In both seed accessions maximum protein spots are seen in the pI range of 6-8. PMID:27239343

  3. Seed Germination

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Initiation of seed germination is a critical decision for plants. It is important for seed populations under natural conditions to spread the timing of germination of individual seeds to maximize the probability of species survival. Therefore, seeds have evolved the multiple layers of mechanisms tha...

  4. Phenotypic Characteristics as Predictors of Phytosterols in Mature Cycas micronesica Seeds

    PubMed Central

    Marler, Thomas E.; Shaw, Christopher A.

    2010-01-01

    The relationship between mature Cycas micronesica K.D. Hill seed sterol concentration and content and plant or seed phenotypic characteristics was established by multiple regression. Combined models were significant for free but not glycosylated sterols. Reduced models revealed leaf number as the only significant predictor. Free and glycosylated sterol concentrations were unaffected throughout the range of several predictors: tree height (1.7 to 5.8 m), seed fresh weight (48 to 120 g), seed load (one to 76 seeds per plant), and estimated tree age (32 to 110 years). The free and glycosylated sterol phenotypes were also not dependent on the presence/absence of developed embryos in mature seeds. The significant response to leaf number was subtle with an increase of 43 leaves associated with a 0.1-mg increase in free sterol per gram seed fresh weight. This is the first report for any cycad that discusses reproductive or physiological traits in the context of allometric relations. Results indicate a highly constrained phenotypic plasticity of Cycas gametophyte sterol and steryl glucoside concentration and seed content in relation to whole plant and organ size variation. PMID:20174600

  5. Diversity of selected Lupinus angustifolius L. genotypes at the phenotypic and DNA level with respect to microscopic seed coat structure and thickness.

    PubMed

    Clements, Jon; Galek, Renata; Kozak, Bartosz; Michalczyk, Dariusz Jan; Piotrowicz-Cieślak, Agnieszka Iwona; Sawicka-Sienkiewicz, Ewa; Stawiński, Stanislaw; Zalewski, Dariusz

    2014-01-01

    The paper investigates seed coat characteristics (as a percentage of overall seed diameter) in Lupinus angustifolius L., a potential forage crop. In the study ten L. angustifolius genotypes, including three Polish cultivars, two Australian cultivars, three mutants originated from cv. 'Emir', and one Belarusian and one Australian breeding line were evaluated. The highest seed coat percentage was recorded in cultivars 'Sonet' and 'Emir'. The lowest seed coat thickness percentage (below 20%) was noted for breeding lines 11257-19, LAG24 and cultivar 'Zeus' (17.87%, 18.91% 19.60%, respectively). Despite having low seed weight, the Australian line no. 11257-19 was characterized by a desirable proportion of seed coat to the weight of seeds. In general, estimation of the correlation coefficient indicated a tendency that larger seeds had thinner coats. Scanning Electron Microscopy images showed low variation of seed coat sculpture and the top of seeds covered with a cuticle. Most of the studied genotypes were characterized by a cristatepapillate seed coat surface, formed by elongated polygonal cells. Only breeding line no. 11267-19 had a different shape of the cells building the surface layer of the coat. In order to illustrate genetic diversity among the genotypes tested, 24 ISSR primers were used. They generated a total of 161 polymorphic amplification products in 10 evaluated narrow-leaved lupin genotypes. PMID:25119983

  6. Diversity of Selected Lupinus angustifolius L. Genotypes at the Phenotypic and DNA Level with Respect to Microscopic Seed Coat Structure and Thickness

    PubMed Central

    Clements, Jon; Galek, Renata; Kozak, Bartosz; Michalczyk, Dariusz Jan; Piotrowicz-Cieślak, Agnieszka Iwona; Sawicka-Sienkiewicz, Ewa; Stawiński, Stanislaw; Zalewski, Dariusz

    2014-01-01

    The paper investigates seed coat characteristics (as a percentage of overall seed diameter) in Lupinus angustifolius L., a potential forage crop. In the study ten L. angustifolius genotypes, including three Polish cultivars, two Australian cultivars, three mutants originated from cv. ‘Emir’, and one Belarusian and one Australian breeding line were evaluated. The highest seed coat percentage was recorded in cultivars ‘Sonet’ and ‘Emir’. The lowest seed coat thickness percentage (below 20%) was noted for breeding lines 11257-19, LAG24 and cultivar ‘Zeus’ (17.87%, 18.91% 19.60%, respectively). Despite having low seed weight, the Australian line no. 11257-19 was characterized by a desirable proportion of seed coat to the weight of seeds. In general, estimation of the correlation coefficient indicated a tendency that larger seeds had thinner coats. Scanning Electron Microscopy images showed low variation of seed coat sculpture and the top of seeds covered with a cuticle. Most of the studied genotypes were characterized by a cristatepapillate seed coat surface, formed by elongated polygonal cells. Only breeding line no. 11267-19 had a different shape of the cells building the surface layer of the coat. In order to illustrate genetic diversity among the genotypes tested, 24 ISSR primers were used. They generated a total of 161 polymorphic amplification products in 10 evaluated narrow-leaved lupin genotypes. PMID:25119983

  7. Variation of low molecular weight organic acids in precipitation and cloudwater at high elevation in South China

    NASA Astrophysics Data System (ADS)

    Wang, Yan; Sun, Minghu; Li, Penghui; Li, Yuhua; Xue, Likun; Wang, Wenxing

    2011-11-01

    To investigate the sources and chemical behaviors of carboxylic acids in Southern China, precipitation and corresponding cloudwater samples were collected in an acid rain-prone area of Mount Heng. The carboxylic acid levels in the samples were measured, and the concentration patterns were evaluated with respect to temporal and seasonal variations. Formic and acetic acids were predominant among the carboxylic acids identified for both precipitation and cloudwater. Most of the organic acids in the precipitation had a clear seasonal pattern, reaching higher levels during the warm season; these higher levels were attributed to the stronger source strength of biogenic emissions during this season. The cloud-fog samples did not display a similar trend. A distinctive diurnal pattern in carboxylic acids was only observed in the precipitation samples during the warm season. In cloud-fog, the ratio of formic to acetic acid differed considerably with time, with these values varying little in the precipitation samples. This result indicates that the organic acids in precipitation originate consistently from primary sources throughout the entire period, while those in cloud are mainly associated with direct emissions in the earlier stage and with secondary sources in the later period.

  8. Supplying dextrose before insemination and L-arginine during the last third of pregnancy in sow diets: effects on within-litter variation of piglet birth weight.

    PubMed

    Quesnel, H; Quiniou, N; Roy, H; Lottin, A; Boulot, S; Gondret, F

    2014-04-01

    Preweaning piglet mortality is largely attributed to the incidence of low birth weight and birth weight variation within the litter. Therefore, developing strategies to increase within-litter uniformity of piglet birth weight is important. This study investigated the effects of different feeding strategies based on specific nutrient supplies in sow diet on the within-litter variation of piglet birth weight (BW0). Four batches of highly prolific crossbred Landrace × Large White sows were used. Three dietary treatments were compared: supplies of dextrose during the week before insemination (190 g/d) and of L-arginine (25.5 g/d) from d 77 of pregnancy until term (DEXA, n = 26); a dietary supplementation of L-arginine only (25.5 g/d), from d 77 of pregnancy until term (ARGI, n = 24); and no supplementation to a standard gestation diet (CTL; n = 23). Total born piglets (TB), i.e., piglets born alive (BA) and stillborn piglets, were numbered and weighed at birth and at weaning. Data were analyzed by ANOVA using the MIXED procedure in a model that included dietary treatment (ARGI, DEXA, and CTL), initial parity (1, 2 and 3, 4, and more), and backfat thickness (below or above the average value at the onset of the experiment: 15.7 mm) as the main effects and batch as random effect. The treatment did not influence (P > 0.10) the number of piglets at birth (on average 15.6 ± 3.8 and 14.2 ± 3.6 for TB and BA, respectively) or piglet BW0 (on average 1.48 ± 0.26 and 1.50 ± 0.26 kg for TB and BA, respectively). The coefficient of variation of piglet BW0 (CV(BW0)) was less in litters from ARGI sows than in litters from CTL sows and intermediate in litters from DEXA sows (for TB: 21.4, 23.4, and 25.7%, P = 0.08; for BA: 20.6, 22.5, and 25.4%, P = 0.03, in the ARGI, DEXA, and CTL groups, respectively). Irrespective of diet, CV(BW0) was less (P < 0.01) in litters with 16 TB piglets or less than in the largest litters (20.9 vs. 26.5%). Litter growth rate during lactation and

  9. Inheritance of seed color in Capsicum.

    PubMed

    Zewdie, Y; Bosland, P W

    2003-01-01

    The mode of seed color inheritance in Capsicum was studied via an interspecific hybridization between C. pubescens Ruiz and Pav. (black seed color) and C. eximium Hunz. (yellow seed color). Black seed color was dominant over yellow seed color. The F(2) segregation pattern showed continuous variation. The generation means analysis indicated the presence of a significant effect of additive [d], dominance [h], and additive x additive [i] interaction for seed color inheritance. The estimate for a minimum number of effective factors (genes) involved in seed color inheritance was approximately 3. PMID:12920108

  10. Genetic diversity, population structure and marker trait associations for seed quality traits in cotton (Gossypium hirsutum).

    PubMed

    Badigannavar, Ashok; Myers, Gerald O

    2015-03-01

    Cottonseed contains 16% seed oil and 23% seed protein by weight. High levels of palmitic acid provides a degree of stability to the oil, while the presence of bound gossypol in proteins considerably changes their properties, including their biological value. This study uses genetic principles to identify genomic regions associated with seed oil, protein and fibre content in upland cotton cultivars. Cotton association mapping panel representing the US germplasm were genotyped using amplified fragment length polymorphism markers, yielding 234 polymorphic DNA fragments. Phenotypic analysis showed high genetic variability for the seed traits, seed oil range from 6.47-25.16%, protein from 1.85-28.45% and fibre content from 15.88-37.12%. There were negative correlations between seed oil and protein content.With reference to genetic diversity, the average estimate of FST was 8.852 indicating a low level of genetic differentiation among subpopulations. The AMOVA test revealed that variation was 94% within and 6% among subpopulations. Bayesian population structure identified five subpopulations and was in agreement with their geographical distribution. Among the mixed models analysed, mixed linear model (MLM) identified 21 quantitative trait loci for lint percentage and seed quality traits, such as seed protein and oil. Establishing genetic diversity, population structure and marker trait associations for the seed quality traits could be valuable in understanding the genetic relationships and their utilization in breeding programmes. PMID:25846880

  11. Optimum harvest maturity for Leymus chinensis seed

    PubMed Central

    Lin, Jixiang; Wang, Yingnan; Qi, Mingming; Li, Xiaoyu; Yang, Chunxue; Wang, Yongcui

    2016-01-01

    ABSTRACT Timely harvest is critical to achieve maximum seed viability and vigour in agricultural production. However, little information exists concerning how to reap the best quality seeds of Leymus chinensis, which is the dominant and most promising grass species in the Songnen Grassland of Northern China. The objective of this study was to investigate and evaluate possible quality indices of the seeds at different days after peak anthesis. Seed quality at different development stages was assessed by the colours of the seed and lemmas, seed weight, moisture content, electrical conductivity of seed leachate and germination indices. Two consecutive years of experimental results showed that the maximum seed quality was recorded at 39 days after peak anthesis. At this date, the colours of the seed and lemmas reached heavy brown and yellow, respectively. The seed weight was highest and the moisture content and the electrical conductivity of seed leachate were lowest. In addition, the seed also reached its maximum germination percentage and energy at this stage, determined using a standard germination test (SGT) and accelerated ageing test (AAT). Thus, Leymus chinensis can be harvested at 39 days after peak anthesis based on the changes in parameters. Colour identification can be used as an additional indicator to provide a more rapid and reliable measure of optimum seed maturity; approximately 10 days after the colour of the lemmas reached yellow and the colour of the seed reached heavy brown, the seed of this species was suitable for harvest. PMID:27170257

  12. Optimum harvest maturity for Leymus chinensis seed.

    PubMed

    Lin, Jixiang; Wang, Yingnan; Qi, Mingming; Li, Xiaoyu; Yang, Chunxue; Wang, Yongcui; Mu, Chunsheng

    2016-01-01

    Timely harvest is critical to achieve maximum seed viability and vigour in agricultural production. However, little information exists concerning how to reap the best quality seeds of Leymus chinensis, which is the dominant and most promising grass species in the Songnen Grassland of Northern China. The objective of this study was to investigate and evaluate possible quality indices of the seeds at different days after peak anthesis. Seed quality at different development stages was assessed by the colours of the seed and lemmas, seed weight, moisture content, electrical conductivity of seed leachate and germination indices. Two consecutive years of experimental results showed that the maximum seed quality was recorded at 39 days after peak anthesis. At this date, the colours of the seed and lemmas reached heavy brown and yellow, respectively. The seed weight was highest and the moisture content and the electrical conductivity of seed leachate were lowest. In addition, the seed also reached its maximum germination percentage and energy at this stage, determined using a standard germination test (SGT) and accelerated ageing test (AAT). Thus, Leymus chinensis can be harvested at 39 days after peak anthesis based on the changes in parameters. Colour identification can be used as an additional indicator to provide a more rapid and reliable measure of optimum seed maturity; approximately 10 days after the colour of the lemmas reached yellow and the colour of the seed reached heavy brown, the seed of this species was suitable for harvest. PMID:27170257

  13. Geographic Variation in the Association between Ambient Fine Particulate Matter (PM2.5) and Term Low Birth Weight in the United States

    PubMed Central

    Hao, Yongping; Strosnider, Heather; Balluz, Lina; Qualters, Judith R.

    2015-01-01

    Background Studies on the association between prenatal exposure to fine particulate matter ≤ 2.5 μm in aerodynamic diameter (PM2.5) and term low birth weight (LBW) have resulted in inconsistent findings. Most studies were conducted in snapshots of small geographic areas and no national study exists. Objectives We investigated geographic variation in the associations between ambient PM2.5 during pregnancy and term LBW in the contiguous United States. Methods A total of 3,389,450 term singleton births in 2002 (37–44 weeks gestational age and birth weight of 1,000–5,500 g) were linked to daily PM2.5 via imputed birth days. We generated average daily PM2.5 during the entire pregnancy and each trimester. Multi-level logistic regression models with county-level random effects were used to evaluate the associations between term LBW and PM2.5 during pregnancy. Results Without adjusting for covariates, the odds of term LBW increased 2% [odds ratio (OR) = 1.02; 95% CI: 1.00, 1.03] for every 5-μg/m3 increase in PM2.5 exposure during the second trimester only, which remained unchanged after adjusting for county-level poverty (OR = 1.02; 95% CI: 1.01, 1.04). The odds did change to null after adjusting for individual-level predictors (OR = 1.00; 95% CI: 0.99, 1.02). Multi-level analyses, stratified by census division, revealed significant positive associations of term LBW and PM2.5 exposure (during the entire pregnancy or a specific trimester) in three census divisions of the United States: Middle Atlantic, East North Central, and West North Central, and significant negative association in the Mountain division. Conclusions Our study provided additional evidence on the associations between PM2.5 exposure during pregnancy and term LBW from a national perspective. The magnitude and direction of the estimated associations between PM2.5 exposure and term LBW varied by geographic locations in the United States. Citation Hao Y, Strosnider H, Balluz L, Qualters JR. 2016

  14. Brassinosteroid functions in Arabidopsis seed development

    PubMed Central

    Jiang, Wen-Bo; Lin, Wen-Hui

    2013-01-01

    Seed development of flowering plant is a complicated process controlled by a signal network. Double fertilization generates 2 zygotic products (embryo and endosperm). Embryo gives rise to a daughter plant while endosperm provides nutrients for embryo during embryogenesis and germination. Seed coat differentiates from maternally derived integument and encloses embryo and endosperm. Seed size/mass and number comprise final seed yield, and seed shape also contributes to seed development and weight. Seed size is coordinated by communication among endosperm, embryo, and integument. Seed number determination is more complex to investigate and shows differencies between monocot and eudicot. Total seed number depends on sillique number and seed number per sillique in Arabidopsis. Seed comes from fertilized ovule, hence the ovule number per flower determines the maximal seed number per sillique. Early studies reported that engineering BR levels increased the yield of ovule and seed; however the molecular mechanism of BR regulation in seed development still remained unclear. Our recent studies demonstrated that BR regulated seed size, shape, and number by transcriptionally modulating specific seed developmental pathways. This review summarizes roles of BR in Arabidopsis seed development and gives clues for future application of BR in agricultural production. PMID:24270689

  15. Pre-dispersal predation effect on seed packaging strategies and seed viability.

    PubMed

    DeSoto, Lucía; Tutor, David; Torices, Rubén; Rodríguez-Echeverría, Susana; Nabais, Cristina

    2016-01-01

    An increased understanding of intraspecific seed packaging (i.e. seed size/number strategy) variation across different environments may improve current knowledge of the ecological forces that drive seed evolution in plants. In particular, pre-dispersal seed predation may influence seed packaging strategies, triggering a reduction of the resources allocated to undamaged seeds within the preyed fruits. Assessing plant reactions to pre-dispersal seed predation is crucial to a better understanding of predation effects, but the response of plants to arthropod attacks remains unexplored. We have assessed the effect of cone predation on the size and viability of undamaged seeds in populations of Juniperus thurifera with contrasting seed packaging strategies, namely, North African populations with single-large-seeded cones and South European populations with multi-small-seeded cones. Our results show that the incidence of predation was lower on the single-large-seeded African cones than on the multi-small-seeded European ones. Seeds from non-preyed cones were also larger and had a higher germination success than uneaten seeds from preyed cones, but only in populations with multi-seeded cones and in cones attacked by Trisetacus sp., suggesting a differential plastic response to predation. It is possible that pre-dispersal seed predation has been a strong selective pressure in European populations with high cone predation rates, being a process which maintains multi-small-seeded cones and empty seeds as a strategy to save some seeds from predation. Conversely, pre-dispersal predation might not have a strong effect in the African populations with single-large-seeded cones characterized by seed germination and filling rates higher than those in the European populations. Our results indicate that differences in pre-dispersal seed predators and predation levels may affect both selection on and intraspecific variation in seed packaging. PMID:26400794

  16. Seed proteomics

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Seeds comprise a protective covering, a small embryonic plant, and a nutrient-storage organ. Seeds are protein-rich, and have been the subject of many mass spectrometry-based analyses. Seed storage proteins (SSP), which are transient depots for reduced nitrogen, have been studied for decades by cel...

  17. Comprehensive speciation of low-molecular weight selenium metabolites in mustard seeds using HPLC-electrospray linear trap/Orbitrap tandem mass spectrometry.

    PubMed

    Ouerdane, Laurent; Aureli, Federica; Flis, Paulina; Bierla, Katarzyna; Preud'homme, Hugues; Cubadda, Francesco; Szpunar, Joanna

    2013-09-01

    An analytical methodology based on high-resolution high mass accuracy electrospray ionization (ESI) tandem MS assisted by Se-specific detection using inductively coupled plasma mass spectrometry (ICP MS) was developed for speciation of selenium (Se) in seeds of black mustard (Brassica nigra) grown on Se-rich soil. Size-exclusion LC-ICP MS allowed the determination of the Se distribution according to the molecular mass and the control of the species stability during extraction. The optimization of hydrophilic interaction of LC and cation-exchange HPLC resulted in analytical conditions making it possible to detect and characterize over 30 Se species using ESI MS, including a number of minor (<0.5%) metabolites. Selenoglucosinolates were found to be the most important class of species accounting for at least 15% of the total Se present and over 50% of all the metabolites. They were found particularly unstable during aqueous extraction leading to the loss of Se by volatilization as methylselenonitriles and methylselenoisothiocyanates identified using gas chromatography (GC) with the parallel ICP MS and atmospheric pressure chemical ionization (APCI) MS/MS detection. However, selenoglucosinolates could be efficiently recovered by extraction with 70% methanol. Other classes of identified species included selenoamino acids, selenosugars, selenosinapine and selenourea derivatives. The three types of reactions leading to the formation of selenometabolites were: the Se-S substitution in the metabolic pathway, oxidative reactions of -SeH groups with endogenous biomolecules, and chemical reactions, e.g., esterification, of Se-containing molecules and other biomolecules through functional groups not involving Se. PMID:23925428

  18. Surface and Column Variations of CO2 using Weighting Functions for Future Active Remote CO2 sensors and Data from DISCOVER-AQ Field Campaign

    NASA Astrophysics Data System (ADS)

    Yang, M. M.; Choi, Y.; Kooi, S. A.; Browell, E. V.

    2014-12-01

    Fast response (1 Hz) and high precision (< 0.1 ppmv) in situ CO2 measurements were recorded onboard the NASA P-3B during the DISCOVER-AQ (Deriving Information on Surface Conditions from Column and Vertically Resolved Observations Relevant to Air Quality) Field Campaign, to investigate the ability of space-based observations to accurately assess near surface conditions related to air quality. The campaign spanned 4 years and took place over four geographically different locations. These included, Washington DC/Baltimore, MD (July 2011), San Joaquin Valley, CA (January - February 2013), Houston, TX (September 2013), and Denver, CO (July-August 2014). With the objective of obtaining better CO2 column calculations, each of these campaigns consisted of missed approaches and approximately two hundred vertical soundings of CO2 (from the surface to about 5 km). In this study, surface and column-averaged CO2 mixing ratio values from the vertical soundings in the four different urban areas are used to examine the temporal and spatial variability of CO2 within the lower troposphere. Tracers such as CO, CH2O, NOx, and NMHCs will be used to identify the source of variations observed in these urban sites. Additionally, we apply nominal CO2 column weighting functions for potential future active remote CO2 sensors operating in the 1.57-mm and 2.05-mm measurement regions to convert the in situ CO2 vertical mixing ratio profiles to variations in CO2 column optical depths, which is what the active remote sensors actually measure. Using statistics calculated from the optical depths at each urban site measured during the DISCOVER-AQ field campaign and for each nominal weighting function, we compare the natural variability of CO2 columns in the lower troposphere; relate the CO2 column variability to surface emissions; and show the measurement requirements for the future ASCENDS (Active Sensing of CO2 Emissions over Nights, Days, and Seasons) in the continental U.S. urban areas.

  19. Seed coat darkening in Cowpea bean

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Seed coat of cowpea bean (Vigna unguiculata L. Walp) slowly browns to a darker color during storage. High temperature and humidity during storage might contribute to this color change. Variation in browning rate among seeds in a lot leads to a mixture of seed colors creating an unacceptable product...

  20. Factors associated with inter-institutional variations in sepsis rates of very-low-birth-weight infants in 34 Malaysian neonatal intensive care units

    PubMed Central

    Boo, Nem-Yun; Cheah, Irene Guat-Sim

    2016-01-01

    INTRODUCTION This study aimed to determine whether patient loads, infant status on admission and treatment interventions were significantly associated with inter-institutional variations in sepsis rates in very-low-birth-weight (VLBW) infants in the Malaysian National Neonatal Registry (MNNR). METHODS This was a retrospective study of 3,880 VLBW (≤ 1,500 g) infants admitted to 34 neonatal intensive care units (NICUs) in the MNNR. Sepsis was diagnosed in symptomatic infants with positive blood culture. RESULTS Sepsis developed in 623 (16.1%) infants; 61 (9.8%) had early-onset sepsis (EOS) and 562 (90.2%) had late-onset sepsis (LOS). The median EOS rate of all NICUs was 1.0% (interquartile range [IQR] 0%, 2.0%). Compared with NICUs reporting no EOS (n = 14), NICUs reporting EOS (n = 20) had significantly higher patient loads (total live births, admissions, VLBW infants, outborns); more mothers with a history of abortions, and antenatal steroids and intrapartum antibiotic use; more infants requiring resuscitation procedures at birth; higher rates of surfactant therapy, pneumonia and insertion of central venous catheters. The median LOS rate of all NICUs was 14.5% (IQR 7.8%, 19.2%). Compared with NICUs with LOS rates below the first quartile (n = 8), those above the third quartile (n = 8) used less intrapartum antibiotics, and had significantly bigger and more mature infants, more outborns, as well as a higher number of sick infants requiring ventilator support and total parenteral nutrition. CONCLUSION Patient loads, resuscitation at birth, status of infants on admission and treatment interventions were significantly associated with inter-institutional variations in sepsis. PMID:26996633

  1. Genetic variation in salt tolerance during seed germination in a backcross inbred line population and advanced breeding lines derived from upland cotton x pima cotton

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Seed germination is a crucial phase of the plant life cycle that affects its establishment and productivity. However, information on salt tolerance at this phase is limited. Pima cotton (Gossypium barbadense L.) may be more salt tolerant during germination than Upland cotton (G. hirsutum L.) based o...

  2. Updated Methods for Seed Shape Analysis

    PubMed Central

    Cervantes, Emilio; Martín, José Javier; Saadaoui, Ezzeddine

    2016-01-01

    Morphological variation in seed characters includes differences in seed size and shape. Seed shape is an important trait in plant identification and classification. In addition it has agronomic importance because it reflects genetic, physiological, and ecological components and affects yield, quality, and market price. The use of digital technologies, together with development of quantification and modeling methods, allows a better description of seed shape. Image processing systems are used in the automatic determination of seed size and shape, becoming a basic tool in the study of diversity. Seed shape is determined by a variety of indexes (circularity, roundness, and J index). The comparison of the seed images to a geometrical figure (circle, cardioid, ellipse, ellipsoid, etc.) provides a precise quantification of shape. The methods of shape quantification based on these models are useful for an accurate description allowing to compare between genotypes or along developmental phases as well as to establish the level of variation in different sets of seeds. PMID:27190684

  3. Updated Methods for Seed Shape Analysis.

    PubMed

    Cervantes, Emilio; Martín, José Javier; Saadaoui, Ezzeddine

    2016-01-01

    Morphological variation in seed characters includes differences in seed size and shape. Seed shape is an important trait in plant identification and classification. In addition it has agronomic importance because it reflects genetic, physiological, and ecological components and affects yield, quality, and market price. The use of digital technologies, together with development of quantification and modeling methods, allows a better description of seed shape. Image processing systems are used in the automatic determination of seed size and shape, becoming a basic tool in the study of diversity. Seed shape is determined by a variety of indexes (circularity, roundness, and J index). The comparison of the seed images to a geometrical figure (circle, cardioid, ellipse, ellipsoid, etc.) provides a precise quantification of shape. The methods of shape quantification based on these models are useful for an accurate description allowing to compare between genotypes or along developmental phases as well as to establish the level of variation in different sets of seeds. PMID:27190684

  4. Variations and Determinants of Mortality and Length of Stay of Very Low Birth Weight and Very Low for Gestational Age Infants in Seven European Countries.

    PubMed

    Fatttore, Giovanni; Numerato, Dino; Peltola, Mikko; Banks, Helen; Graziani, Rebecca; Heijink, Richard; Over, Eelco; Klitkou, Søren Toksvig; Fletcher, Eilidh; Mihalicza, Péter; Sveréus, Sofia

    2015-12-01

    The EuroHOPE very low birth weight and very low for gestational age infants study aimed to measure and explain variation in mortality and length of stay (LoS) in the populations of seven European nations (Finland, Hungary, Italy (only the province of Rome), the Netherlands, Norway, Scotland and Sweden). Data were linked from birth, hospital discharge and mortality registries. For each infant basic clinical and demographic information, infant mortality and LoS at 1 year were retrieved. In addition, socio-economic variables at the regional level were used. Results based on 16,087 infants confirm that gestational age and Apgar score at 5 min are important determinants of both mortality and LoS. In most countries, infants admitted or transferred to third-level hospitals showed lower probability of death and longer LoS. In the meta-analyses, the combined estimates show that being male, multiple births, presence of malformations, per capita income and low population density are significant risk factors for death. It is essential that national policies improve the quality of administrative datasets and address systemic problems in assigning identification numbers at birth. European policy should aim at improving the comparability of data across jurisdictions. PMID:26633869

  5. Structural stability of beta-globulin, the low molecular weight protein fraction from sesame seed (Sesamum indicum L.) in alkaline solution.

    PubMed

    Rajendran, S; Prakash, V

    1993-02-01

    Beta-globulin, a single polypeptide chain of molecular weight 15,000 +/- 1,000, undergoes denaturation in alkaline pH (7.0-13.0), thereby affecting the hydrodynamic properties of the protein, viz. a decrease in sedimentation coefficient from a value of 2.0s to 1.4s at pH 11.3, an increase in reduced viscosity from 0.042 dl/g to 0.158 dl/g at pH 12.6 and a decrease in partial specific volume resulting in a volume change of 6.3 +/- 1.0 ml/mole residue at pH 11.7. The perturbation of tryptophanyl residues and ionization of tyrosyl residues are preceded by alteration in conformational status of the protein. The fluorescence emission measurements indicate initial unfolding of the protein molecule which exposes the tryptophan and tyrosyl residues to the solvent. The tyrosyl phenolic group ionization is anomalous having a pKint value of 11.2. The reduced viscosity value reaches a plateau region at pH 12.5. PMID:8509122

  6. Variation of the phytotoxicity of municipal solid waste incinerator bottom ash on wheat (Triticum aestivum L.) seed germination with leaching conditions.

    PubMed

    Phoungthong, Khamphe; Zhang, Hua; Shao, Li-Ming; He, Pin-Jing

    2016-03-01

    Municipal solid waste incinerator bottom ash (MSWIBA) has long been regarded as an alternative building material in the construction industry. However, the pollutants contained in the bottom ash could potentially leach out and contaminate the local environment, which presents an obstacle to the reuse of the materials. To evaluate the environmental feasibility of using MSWIBA as a recycled material in construction, the leaching derived ecotoxicity was assessed. The leaching behavior of MSWIBA under various conditions, including the extractant type, leaching time, liquid-to-solid (L/S) ratio, and leachate pH were investigated, and the phytotoxicity of these leachates on wheat (Triticum aestivum L.) seed germination was determined. Moreover, the correlation between the germination index and the concentrations of various chemical constituents in the MSWIBA leachates was assessed using multivariate statistics with principal component analysis and Pearson's correlation analysis. It was found that, heavy metal concentrations in the leachate were pH and L/S ratio dependent, but were less affected by leaching time. Heavy metals were the main pollutants present in wheat seeds. Heavy metals (especially Ba, Cr, Cu and Pb) had a substantial inhibitory effect on wheat seed germination and root elongation. To safely use MSWIBA in construction, the potential risk and ecotoxicity of leached materials must be addressed. PMID:26745383

  7. Genetic Variation for Thermotolerance in Lettuce Seed Germination Is Associated with Temperature-Sensitive Regulation of ETHYLENE RESPONSE FACTOR1 (ERF1)1[OPEN

    PubMed Central

    O’Brien, Laurel K.; Truco, Maria Jose; Huo, Heqiang; Sideman, Rebecca; Hayes, Ryan; Michelmore, Richard W.

    2016-01-01

    Seeds of most lettuce (Lactuca sativa) cultivars are susceptible to thermoinhibition, or failure to germinate at temperatures above approximately 28°C, creating problems for crop establishment in the field. Identifying genes controlling thermoinhibition would enable the development of cultivars lacking this trait and, therefore, being less sensitive to high temperatures during planting. Seeds of a primitive accession (PI251246) of lettuce exhibited high-temperature germination capacity up to 33°C. Screening a recombinant inbred line population developed from PI215246 and cv Salinas identified a major quantitative trait locus (Htg9.1) from PI251246 associated with the high-temperature germination phenotype. Further genetic analyses discovered a tight linkage of the Htg9.1 phenotype with a specific DNA marker (NM4182) located on a single genomic sequence scaffold. Expression analyses of the 44 genes encoded in this genomic region revealed that only a homolog of Arabidopsis (Arabidopsis thaliana) ETHYLENE RESPONSE FACTOR1 (termed LsERF1) was differentially expressed between PI251246 and cv Salinas seeds imbibed at high temperature (30°C). LsERF1 belongs to a large family of transcription factors associated with the ethylene-signaling pathway. Physiological assays of ethylene synthesis, response, and action in parental and near-isogenic Htg9.1 genotypes strongly implicate LsERF1 as the gene responsible for the Htg9.1 phenotype, consistent with the established role for ethylene in germination thermotolerance of Compositae seeds. Expression analyses of genes associated with the abscisic acid and gibberellin biosynthetic pathways and results of biosynthetic inhibitor and hormone response experiments also support the hypothesis that differential regulation of LsERF1 expression in PI251246 seeds elevates their upper temperature limit for germination through interactions among pathways regulated by these hormones. Our results support a model in which LsERF1 acts through

  8. Genetic Variation for Thermotolerance in Lettuce Seed Germination Is Associated with Temperature-Sensitive Regulation of ETHYLENE RESPONSE FACTOR1 (ERF1).

    PubMed

    Yoong, Fei-Yian; O'Brien, Laurel K; Truco, Maria Jose; Huo, Heqiang; Sideman, Rebecca; Hayes, Ryan; Michelmore, Richard W; Bradford, Kent J

    2016-01-01

    Seeds of most lettuce (Lactuca sativa) cultivars are susceptible to thermoinhibition, or failure to germinate at temperatures above approximately 28°C, creating problems for crop establishment in the field. Identifying genes controlling thermoinhibition would enable the development of cultivars lacking this trait and, therefore, being less sensitive to high temperatures during planting. Seeds of a primitive accession (PI251246) of lettuce exhibited high-temperature germination capacity up to 33°C. Screening a recombinant inbred line population developed from PI215246 and cv Salinas identified a major quantitative trait locus (Htg9.1) from PI251246 associated with the high-temperature germination phenotype. Further genetic analyses discovered a tight linkage of the Htg9.1 phenotype with a specific DNA marker (NM4182) located on a single genomic sequence scaffold. Expression analyses of the 44 genes encoded in this genomic region revealed that only a homolog of Arabidopsis (Arabidopsis thaliana) ETHYLENE RESPONSE FACTOR1 (termed LsERF1) was differentially expressed between PI251246 and cv Salinas seeds imbibed at high temperature (30°C). LsERF1 belongs to a large family of transcription factors associated with the ethylene-signaling pathway. Physiological assays of ethylene synthesis, response, and action in parental and near-isogenic Htg9.1 genotypes strongly implicate LsERF1 as the gene responsible for the Htg9.1 phenotype, consistent with the established role for ethylene in germination thermotolerance of Compositae seeds. Expression analyses of genes associated with the abscisic acid and gibberellin biosynthetic pathways and results of biosynthetic inhibitor and hormone response experiments also support the hypothesis that differential regulation of LsERF1 expression in PI251246 seeds elevates their upper temperature limit for germination through interactions among pathways regulated by these hormones. Our results support a model in which LsERF1 acts through

  9. Genetic variation in the 15q25 nicotinic acetylcholine receptor gene cluster (CHRNA5–CHRNA3–CHRNB4) interacts with maternal self-reported smoking status during pregnancy to influence birth weight

    PubMed Central

    Tyrrell, Jessica; Huikari, Ville; Christie, Jennifer T.; Cavadino, Alana; Bakker, Rachel; Brion, Marie-Jo A.; Geller, Frank; Paternoster, Lavinia; Myhre, Ronny; Potter, Catherine; Johnson, Paul C.D.; Ebrahim, Shah; Feenstra, Bjarke; Hartikainen, Anna-Liisa; Hattersley, Andrew T.; Hofman, Albert; Kaakinen, Marika; Lowe, Lynn P.; Magnus, Per; McConnachie, Alex; Melbye, Mads; Ng, Jane W.Y.; Nohr, Ellen A.; Power, Chris; Ring, Susan M.; Sebert, Sylvain P.; Sengpiel, Verena; Taal, H. Rob; Watt, Graham C.M.; Sattar, Naveed; Relton, Caroline L.; Jacobsson, Bo; Frayling, Timothy M.; Sørensen, Thorkild I.A.; Murray, Jeffrey C.; Lawlor, Debbie A.; Pennell, Craig E.; Jaddoe, Vincent W.V.; Hypponen, Elina; Lowe, William L.; Jarvelin, Marjo-Riitta; Davey Smith, George; Freathy, Rachel M.

    2012-01-01

    Maternal smoking during pregnancy is associated with low birth weight. Common variation at rs1051730 is robustly associated with smoking quantity and was recently shown to influence smoking cessation during pregnancy, but its influence on birth weight is not clear. We aimed to investigate the association between this variant and birth weight of term, singleton offspring in a well-powered meta-analysis. We stratified 26 241 European origin study participants by smoking status (women who smoked during pregnancy versus women who did not smoke during pregnancy) and, in each stratum, analysed the association between maternal rs1051730 genotype and offspring birth weight. There was evidence of interaction between genotype and smoking (P = 0.007). In women who smoked during pregnancy, each additional smoking-related T-allele was associated with a 20 g [95% confidence interval (95% CI): 4–36 g] lower birth weight (P = 0.014). However, in women who did not smoke during pregnancy, the effect size estimate was 5 g per T-allele (95% CI: −4 to 14 g; P = 0.268). To conclude, smoking status during pregnancy modifies the association between maternal rs1051730 genotype and offspring birth weight. This strengthens the evidence that smoking during pregnancy is causally related to lower offspring birth weight and suggests that population interventions that effectively reduce smoking in pregnant women would result in a reduced prevalence of low birth weight. PMID:22956269

  10. Growth, seed development and genetic analysis in wild type and Def mutant of Pisum sativum L

    PubMed Central

    2011-01-01

    Background The def mutant pea (Pisum sativum L) showed non-abscission of seeds from the funicule. Here we present data on seed development and growth pattern and their relationship in predicting this particular trait in wild type and mutant lines as well as the inheritance pattern of the def allele in F2 and F3 populations. Findings Pod length and seed fresh weight increase with fruit maturity and this may affect the abscission event in pea seeds. However, the seed position in either the distal and proximal ends of the pod did not show any difference. The growth factors of seed fresh weight (FW), width of funicles (WFN), seed width (SW) and seed height (SH) were highly correlated and their relationships were determined in both wild type and def mutant peas. The coefficient of determination R2 values for the relationship between WFN and FW, SW and SH and their various interactions were higher for the def dwarf type. Stepwise multiple regression analysis showed that variation of WFN was associated with SH and SW. Pearson's chi square analysis revealed that the inheritance and segregation of the Def locus in 3:1 ratio was significant in two F2 populations. Structural analysis of the F3 population was used to confirm the inheritance status of the Def locus in F2 heterozygote plants. Conclusions This study investigated the inheritance of the presence or absence of the Def allele, controlling the presence of an abscission zone (AZ) or an abscission-less zone (ALZ) forming in wild type and mutant lines respectively. The single major gene (Def) controlling this phenotype was monogenic and def mutants were characterized and controlled by the homozygous recessive def allele that showed no palisade layers in the hilum region of the seed coat. PMID:22078070