Science.gov

Sample records for silica composite nanoparticles

  1. A Pd/silica composite with highly uniform Pd nanoparticles on silica lamella via layered silicate

    NASA Astrophysics Data System (ADS)

    Hao, Jing; Cui, Zhi-Min; Cao, Chang-Yan; Song, Weiguo

    2016-08-01

    Pd nanoparticles was loaded on silica lamella via layered silicate through a simple ion-exchange and in situ reduction method. The obtained Pd/silica composite has Pd nanoparticles with highly uniform size dispersed well on the silica lamella. The Pd/silica composite is active and recoverable catalyst for the hydrogenation reaction and the reaction can be completed in a short time of 2 h at room temperature and 1 atm H2 pressure.

  2. Enhanced stab resistance of armor composites with functionalized silica nanoparticles

    NASA Astrophysics Data System (ADS)

    Mahfuz, Hassan; Clements, Floria; Rangari, Vijaya; Dhanak, Vinod; Beamson, Graham

    2009-03-01

    Traditionally shear thickening fluid (STF) reinforced with Kevlar has been used to develop flexible armor. At the core of the STF-Kevlar composites is a mixture of polyethylene glycol (PEG) and silica particles. This mixture is often known as STF and is consisted of approximately 45 wt % PEG and 55 wt % silica. During rheological tests, STF shows instantaneous spike in viscosity above a critical shear rate. Fabrication of STF-Kevlar composites requires preparation of STF, dilution with ethanol, and then impregnation with Kevlar. In the current approach, nanoscale silica particles were dispersed directly into a mixture of PEG and ethanol through a sonic cavitation process. Two types of silica nanoparticles were used in the investigation: 30 nm crystalline silica and 7 nm amorphous silica. The admixture was then reinforced with Kevlar fabric to produce flexible armor composites. In the next step, silica particles are functionalized with a silane coupling agent to enhance bonding between silica and PEG. The performance of the resulting armor composites improved significantly. As evidenced by National Institute of Justice spike tests, the energy required for zero-layer penetration (i.e., no penetration) jumped twofold: from 12 to 25 J cm2/g. The source of this improvement has been traced to the formation of siloxane (Si-O-Si) bonds between silica and PEG and superior coating of Kevlar filaments with particles. Fourier transform infrared, x-ray photoemission spectroscopy, and scanning electron microscopy studies were performed to examine chemical bonds, elemental composition, and particle dispersion responsible for such improvement. In summary, our experiments have demonstrated that functionalization of silica particles followed by direct dispersion into PEG resulted in superior Kevlar composites having much higher spike resistance.

  3. Synthesis of Polystyrene-Silica Composite Particles via One-Step Nanoparticle-Stabilized Emulsion Polymerization

    NASA Astrophysics Data System (ADS)

    Dai, Lenore; Ma, Huan

    2009-03-01

    Polystyrene-silica core-shell composite particles are prepared by one-step emulsion polymerization with a nonionic initiator VA-086, solely stabilized by silica nanoparticles. The silica nanoparticles are successfully incorporated into as the shell, likely due to the fact that the nanoparticles are thermodynamically favorable to self-assemble and remain at the liquid-liquid interfaces during the emulsion polymerization. The silica content, determined by thermogravimetric analysis, is approximately 20 wt% in the composite particles. In addition, we further explore the polymerization mechanism by studying the particle growth as a function of initiator concentration and reaction time: when the silica/monomer ratio is increased from 0.83 wt% to 2.5 wt%, the particle size at 24 hour reaction time decreases for a fixed monomer amount, probably due to a larger number of nuclei at the initial stage of polymerization. Further increasing the initiator/monomer ratio to 4.2 wt% does not continually decrease the particle size, which may be limited by the stabilization provided by a fixed concentration of silica nanoparticles. The surface coverage also changes with initiator concentration and reaction time although the underlying mechanism is not fully understood.

  4. Highly Loaded Mesoporous Silica/Nanoparticle Composites and Patterned Mesoporous Silica Films

    NASA Astrophysics Data System (ADS)

    Kothari, Rohit; Hendricks, Nicholas R.; Wang, Xinyu; Watkins, James J.

    2014-03-01

    Novel approaches for the preparation of highly filled mesoporous silica/nanoparticle (MS/NP) composites and for the fabrication of patterned MS films are described. The incorporation of iron platinum NPs within the walls of MS is achieved at high NP loadings by doping amphiphilic poly(ethylene oxide-b-propylene oxide-b-ethylene oxide) (Pluronic®) copolymer templates via selective hydrogen bonding between the pre-synthesized NPs and the hydrophilic portion of the block copolymer. The MS is then synthesized by means of phase selective condensation of tetraethylorthosilicate (TEOS) within the NP loaded block copolymer templates dilated with supercritical carbon dioxide (scCO2) followed by calcination. For patterned films, microphase separated block copolymer/small molecule additive blends are patterned using UV-assisted nanoimprint lithography. Infusion and condensation of a TEOS within template films using ScCO2 as a processing medium followed by calcination yields the patterned MS films. Scanning electron microscopy is used characterize pattern fidelity and transmission electron microscopy analysis confirms the presence of the mesopores. Long range order in nanocomposites is confirmed by low angle x-ray diffraction.

  5. Composites of Eu(3+)-doped calcium apatite nanoparticles and silica particles: comparative study of two preparation methods.

    PubMed

    Isobe, Ayumu; Takeshita, Satoru; Isobe, Tetsuhiko

    2015-02-10

    We synthesized composites of Eu(3+)-doped calcium apatite (CaAp:Eu(3+)) nanoparticles and silica particles via two methods: (i) in situ synthesis of CaAp:Eu(3+) in the presence of silica particles and (ii) electrostatic adsorption of CaAp:Eu(3+) nanoparticles on silica particle surfaces. In both methods, submicrometer spherical silica particles were covered with CaAp:Eu(3+) nanoparticles without forming any impurity phases, as confirmed by X-ray diffractometry, Fourier-transform infrared spectroscopy, and scanning electron microscopy. In method i, part of the silica surface acted as a nucleation site for apatite crystals and silica particles were inhomogeneously covered with CaAp:Eu(3+) nanoparticles. In method ii, positively charged CaAp:Eu(3+) nanoparticles were homogeneously adsorbed on the negatively charged silica surface through electrostatic interactions. The bonds between the silica surface and CaAp:Eu(3+) nanoparticles are strong enough not to break under ultrasonic irradiation, irrespective of the synthetic method used. The composite particles showed red photoluminescence corresponding to 4f → 4f transitions of Eu(3+) under near-UV irradiation. Although the absorption coefficient of the forbidden 4f → 4f transitions of Eu(3+) was small, the red emission was detectable with a commercial fluorescence microscope because the CaAp:Eu(3+) nanoparticles accumulated on the silica particle surfaces. PMID:25616077

  6. Effect of Silica Nanoparticles on Compressive Strength of Leaves-Waste Composite

    NASA Astrophysics Data System (ADS)

    Masturi, Masturi; Aliah, Hasniah; Aji, Mahardika Prasetya; Sagita, Adi Ardian; Bukit, Minsyahril; Sustini, Euis; Khairurrijal, Khairurrijal; Abdullah, Mikrajuddin

    2011-12-01

    The utilization of solid-waste, especially leaves-waste is one of interesting research of environmental field. One of them is making a composite using polyvinyl acetate (PVAc) polymer as binder (matrix) and silica nanoparticles as reinforcement (filler) to improve the strength of composite-produced. Those raw materials preliminary were mixed by simple mixing with varied compositions and then hot-pressed at 36 MPa and 100 °C for 20 minutes. From compressive strength test, it was found that composite with composition 7:8 of PVAc and leaves-waste had maximum compressive strength, i.e. 57.60 MPa. It was also that the enhancement of strength due to PVAc fraction (w/w) increasing is a percolation behavior, even though its mathematical explanation has not been performed. Into composition of maximum strength above, silica with average size is 74 nm then was added to improve the strength and found that at silica weight fraction of 0.79 (%w/w), the composite had optimum compressive strength, i.e. 70.5 MPa, or increased up to 22.4% of that without silica. The final compressive strength was very comparable to some building goods such as sandstones and bricks. The composite density was also measured and obtained that it was about 0.9 g/cm3 that is very close to some usual woods.

  7. Doxorubicin-loaded mesoporous silica nanoparticle composite nanofibers for long-term adjustments of tumor apoptosis

    NASA Astrophysics Data System (ADS)

    Yuan, Ziming; Pan, Yue; Cheng, Ruoyu; Sheng, Lulu; Wu, Wei; Pan, Guoqing; Feng, Qiming; Cui, Wenguo

    2016-06-01

    There is a high local recurrence (LR) rate in breast-conserving therapy (BCT) and enhancement of the local treatment is promising as a way to improve this. Thus we propose a drug delivery system using doxorubicin (DOX)-loaded mesoporous silica nanoparticle composite nanofibers which can release anti-tumor drugs in two phases—burst release in the early stage and sustained release at a later stage—to reduce the LR of BCT. In the present study, we designed a novel composite nanofibrous scaffold to realize the efficient release of drugs by loading both DOX and DOX-loaded mesoporous silica nanoparticles into an electrospun PLLA nanofibrous scaffold. In vitro results demonstrated that this kind of nanomaterial can release DOX in two phases, and the results of in vivo experiments showed that this hybrid nanomaterial significantly inhibited the tumor growth in a solid tumor model. Histopathological examination demonstrated that the apoptosis of tumor cells in the treated group over a 10 week period was significant. The anti-cancer effects were also accompanied with decreased expression of Bcl-2 and TNF-α, along with up-regulation of Bax, Fas and the activation of caspase-3 levels. The present study illustrates that the mesoporous silica nanoparticle composite nanofibrous scaffold could have anti-tumor properties and could be further developed as adjuvant therapeutic protocols for the treatment of cancer.

  8. Composite silica coated gold nanosphere and quantum dots nanoparticles for X-ray CT and fluorescence bimodal imaging.

    PubMed

    Song, Ji-Tao; Yang, Xiao-Quan; Zhang, Xiao-Shuai; Yan, Dong-Mei; Yao, Ming-Hao; Qin, Meng-Yao; Zhao, Yuan-Di

    2015-07-01

    In this study, silica coated Au nanospheres (Au@SiO2) were prepared by a reverse microemulsion method; subsequently, a layer of fluorescent quantum dots (QDs) were adsorbed onto it and then it was coated with silica again. After modifying with PVP, the composite silica coated gold nanosphere and quantum dots nanoparticle (Au@SiO2-QDs/SiO2-PVP) was obtained. This composite structure contained Au and QDs, and it could be used for contrast-enhanced X-ray CT imaging and fluorescence imaging. Characterization showed that the composite nanoparticle had good dispersity, a high fluorescence intensity and a good effect of X-ray absorption, and it was suitable for using as a bimodal imaging probe. PMID:26008798

  9. The effect of silica nanoparticles on the mechanical properties of fiber-reinforced composite resins

    PubMed Central

    Rezvani, Mohammad Bagher; Atai, Mohammad; Hamze, Faeze; Hajrezai, Reihane

    2016-01-01

    Background. Nanotechnology has introduced many nanoparticles in recent years, which can be incorporated for mechanical improvement of dental materials. However, the existing data are widely sparse. This study investigated the reinforcing effect of silica nanoparticles when incorporated into the matrix phase of an experimental dental fiber-reinforced compositeresin (FRC) through evaluation of its flexural properties. Methods. In this experimental study FRC samples were divided into two main groups (containing two or three bundles),either of whic consisted of five subgroups with 0, 0.2, 0.5, 2 and 5 wt% of silica nanoparticles in the matrix resin (n=10 in each subgroup); a commercial FRC (Angelus, Brazil) was used as the control group (n=10). Three-point bending test was performed to evaluate the flexural strength and modulus. Thereafter, the microstructure of the fractured samples was evalu-ated using scanning electron microscopy (SEM). The results were analyzed with one-way ANOVA and HSD Tukey tests (α = 0.05). Results. The results revealed that the silica nanoparticles had a significant and positive effect on the flexural strength and modulus of FRCs (P<0.05), with no significant differences from 0.2 to 5 wt% of nanoparticles (P > 0.05) in either group with two or three bundles of fibers. Conclusion. Incorporating silica nanoparticles into the FRC resin phase resulted in improved flexural strength and modulus of the final product. PMID:27429728

  10. The effect of silica nanoparticles on the mechanical properties of fiber-reinforced composite resins.

    PubMed

    Rezvani, Mohammad Bagher; Atai, Mohammad; Hamze, Faeze; Hajrezai, Reihane

    2016-01-01

    Background. Nanotechnology has introduced many nanoparticles in recent years, which can be incorporated for mechanical improvement of dental materials. However, the existing data are widely sparse. This study investigated the reinforcing effect of silica nanoparticles when incorporated into the matrix phase of an experimental dental fiber-reinforced compositeresin (FRC) through evaluation of its flexural properties. Methods. In this experimental study FRC samples were divided into two main groups (containing two or three bundles),either of whic consisted of five subgroups with 0, 0.2, 0.5, 2 and 5 wt% of silica nanoparticles in the matrix resin (n=10 in each subgroup); a commercial FRC (Angelus, Brazil) was used as the control group (n=10). Three-point bending test was performed to evaluate the flexural strength and modulus. Thereafter, the microstructure of the fractured samples was evalu-ated using scanning electron microscopy (SEM). The results were analyzed with one-way ANOVA and HSD Tukey tests (α = 0.05). Results. The results revealed that the silica nanoparticles had a significant and positive effect on the flexural strength and modulus of FRCs (P<0.05), with no significant differences from 0.2 to 5 wt% of nanoparticles (P > 0.05) in either group with two or three bundles of fibers. Conclusion. Incorporating silica nanoparticles into the FRC resin phase resulted in improved flexural strength and modulus of the final product. PMID:27429728

  11. Preparation of composite with silica-coated nanoparticles of iron oxide spinels for applications based on magnetically induced hyperthermia

    NASA Astrophysics Data System (ADS)

    Andrade, Angela L.; Fabris, José D.; Pereira, Márcio C.; Domingues, Rosana Z.; Ardisson, José D.

    2013-04-01

    It is reported a novel method to prepare magnetic core (iron oxide spinels)-shell (silica) composites containing well-dispersed magnetic nanoparticles in aqueous solution. The synthetic process consists of two steps. In a first step, iron oxide nanoparticles obtained through co-precipitation are dispersed in an aqueous solution containing tetramethylammonium hydroxide; in a second step, particles of this sample are coated with silica, through hydrolyzation of tetraethyl orthosilicate. The intrinsic atomic structure and essential properties of the core-shell system were assessed with powder X-ray diffraction, Fourier transform infrared spectrometry, Mössbauer spectroscopy and transmission electron microscopy. The heat released by this ferrofluid under an AC-generated magnetic field was evaluated by following the temperature evolution under increasing magnetic field strengths. Results strongly indicate that this ferrofluid based on silica-coated iron oxide spinels is technologically a very promising material to be used in medical practices, in oncology.

  12. Gold nanoparticle decorated graphene oxide/silica composite stationary phase for high-performance liquid chromatography.

    PubMed

    Liang, Xiaojing; Wang, Xusheng; Ren, Haixia; Jiang, Shengxiang; Wang, Licheng; Liu, Shujuan

    2014-06-01

    In the initial phase of this study, graphene oxide (GO)/silica was fabricated by assembling GO onto the silica particles, and then gold nanoparticles (GNPs) were used to modify the GO/silica to prepare a novel stationary phase for high-performance liquid chromatography. The new stationary phase could be used in both reversed-phase chromatography and hydrophilic interaction liquid chromatography modes. Good separations of alkylbenzenes, isomerides, amino acids, nucleosides, and nucleobases were achieved in both modes. Compared with the GO/silica phase and GNPs/silica phase, it is found that except for hydrophilicity, large π-electron systems, hydrophobicity, and coordination functions, this new stationary phase also exhibited special separation performance due to the combination of 2D GO with zero-dimensional GNPs. PMID:24723561

  13. Bone cement based on vancomycin loaded mesoporous silica nanoparticle and calcium sulfate composites.

    PubMed

    Li, Hanwen; Gu, Jisheng; Shah, Luqman Ali; Siddiq, Mohammad; Hu, Jianhua; Cai, Xiaobing; Yang, Dong

    2015-04-01

    A novel bone cement pellet, with sustained release of vancomycin (VAN), was prepared by mixing VAN loaded mesoporous silica nanoparticle (MSN) and calcium sulfate α-hemihydrate (CS) together. To improve the VAN loading ability, MSN was functionalized with aminopropyltriethoxysilane (APS) to give APS-MSN. The VAN loading content and entrapment efficiency of APS-MSN could reach up to 45.91±0.81% and 84.88±1.52%, respectively, much higher than those of MSN, which were only 3.91% and 4.07%, respectively. The nitrogen adsorption-desorption measurement results demonstrated that most of the VAN were in the pores of APS-MSN. The CS/VAN@APS-MSN composite pellet showed a strongly drug sustained release effect in comparison with CS control pellet. The in vitro cell assays demonstrated that CS/APS-MSN composite was highly biocompatible and suitable to use as bone cement. Furthermore, CS/VAN@APS-MSN pellet showed no pyrogenic effect and meet the clinical requirements on hemolytic reaction. These results imply that CS/VAN@APS-MSN was an ideal candidate to replace CS bone cement in the treatment of open fractures. PMID:25686941

  14. Dynamic development of the protein corona on silica nanoparticles: composition and role in toxicity

    NASA Astrophysics Data System (ADS)

    Mortensen, Ninell P.; Hurst, Gregory B.; Wang, Wei; Foster, Carmen M.; Nallathamby, Prakash D.; Retterer, Scott T.

    2013-06-01

    The formation and composition of the protein corona on silica (SiO2) nanoparticles (NP) with different surface chemistries was evaluated over time. Native SiO2, amine (-NH2) and carboxy (-COO-) modified NP were examined following incubation in mammalian growth media containing fetal bovine serum (FBS) for 1, 4, 24 and 48 hours. The protein corona transition from its early dynamic state to the later more stable corona was evaluated using mass spectrometry. The NP diameter was 22.4 +/- 2.2 nm measured by scanning transmission electron microscopy (STEM). Changes in hydrodynamic diameter and agglomeration kinetics were studied using dynamic light scattering (DLS). The initial surface chemistry of the NP played an important role in the development and final composition of the protein corona, impacting agglomeration kinetics and NP toxicity. Particle toxicity, indicated by changes in membrane integrity and mitochondrial activity, was measured by lactate dehydrogenase (LDH) release and tetrazolium reduction (MTT), respectively, in mouse alveolar macrophages (RAW264.7) and mouse lung epithelial cells (C10). SiO2-COO- NP had a slower agglomeration rate, formed smaller aggregates, and exhibited lower cytotoxicity compared to SiO2 and SiO2-NH2. Composition of the protein corona for each of the three NP was unique, indicating a strong dependence of corona development on NP surface chemistry. This work underscores the need to understand all aspects of NP toxicity, particularly the influence of agglomeration on effective dose and particle size. Furthermore, the interplay between materials and local biological environment is emphasized and highlights the need to conduct toxicity profiling under physiologically relevant conditions that provide an appropriate estimation of material modifications that occur during exposure in natural environments.The formation and composition of the protein corona on silica (SiO2) nanoparticles (NP) with different surface chemistries was evaluated

  15. Biocompatibility of artificial bone based on vancomycin loaded mesoporous silica nanoparticles and calcium sulfate composites.

    PubMed

    Gu, Jisheng; Wang, Teng; Fan, Guoxin; Ma, Junhua; Hu, Wei; Cai, Xiaobing

    2016-04-01

    The aim of this study was to evaluate the in vitro and in vivo biocompatibility of artificial bone based on vancomycin loaded mesoporous silica nanoparticles and calcium sulfate composites. In vitro cytotoxicity tests by cholecystokinin octapeptide (CCK-8) assay showed that the 5 %Van-MSN-CaSO4 and Van-CaSO4 bone cements were cytocompatible for mouse osteoblastic cell line MC3T3-E1. The microscopic observation confirmed that MC3T3-E1cells incubated with Van-CaSO4 group and 5 %Van-MSN-CaSO4 group exhibited clear spindle-shaped changes, volume increase and maturation, showing that these cements supported adhesion of osteoblastic cells on their surfaces. In addition, the measurement of alkaline phosphatase activity revealed the osteoconductive property of these biomaterials. In order to assess in vivo biocompatibility, synthesized cements were implanted into the distal femur of twelve adult male and female New Zealand rabbits. After implantation in artificial defects of the distal femur, 5 %Van-MSN-CaSO4 and Van-CaSO4 bone cements did not damage the function of main organs of rabbits. In addition, the Van-MSN-CaSO4 composite allowed complete repair of bone defects with new bone formation 3 months after implantation. These results show potential application of Van-MSN-CaSO4 composites as bone graft materials for the treatment of open fracture in human due to its mechanical, osteoconductive and potential sustained drug release characteristics and the absence of adverse effects on the body. PMID:26883948

  16. Improved optical properties of silica/UV-cured polymer composite films made of hollow silica nanoparticles with a hierarchical structure for light diffuser film applications.

    PubMed

    Suthabanditpong, W; Takai, C; Fuji, M; Buntem, R; Shirai, T

    2016-06-28

    This study successfully improved the optical properties of silica/UV-cured polymer composite films made of hollow silica nanoparticles having a hierarchical structure. The particles were synthesized by an inorganic particle method, which involves two steps of sol-gel silica coating around the template and acid dissolution removal of the template. The pH of the acid was varied to achieve different hierarchical structures of the particles. The morphologies and surface properties of the obtained particles were characterized before dispersing in a UV-curable acrylate monomer solution to prepare dispersions for fabricating light diffuser films. The optical properties and the light diffusing ability of the fabricated films were studied. The results revealed that the increased pH of the acid provides the particles with a thinner shell, a larger hollow interior and a higher specific surface area. Moreover, the films with these particles exhibit a better light diffusing ability and a higher diffuse transmittance value when compared to those without particles. Therefore, the composite films can be used as light diffuser films, which is an essential part of optical diffusers in the back-light unit of LCDs. In addition, utilizing the hierarchical particles probably reduces the number of back-light units in the LCDs leading to energy-savings and subsequently lightweight LCDs. PMID:27254769

  17. Investigation of laundering and dispersion approaches for silica and calcium phosphosilicate composite nanoparticles synthesized in reverse micelles

    NASA Astrophysics Data System (ADS)

    Tabakovic, Amra

    Nanotechnology, the science and engineering of materials at the nanoscale, is a booming research area with numerous applications in electronic, cosmetic, automotive and sporting goods industries, as well as in biomedicine. Composite nanoparticles (NPs) are of special interest since the use of two or more materials in NP design imparts multifunctionality on the final NP constructs. This is especially relevant for applications in areas of human healthcare, where the use of dye or drug doped composite NPs is expected to improve the diagnosis and treatment of cancer and other serious illnesses. Since the physicochemical properties of NP suspensions dictate the success of these systems in biomedical applications, especially drug delivery of chemotherapeutics, synthetic routes which offer precise control of NP properties, especially particle diameter and colloidal stability, are utilized to form a variety of composite NPs. Formation of NPs in reverse, or water-in-oil, micelles is one such synthetic approach. However, while the use of reverse micelles to form composite NPs offers precise control over NP size and shape, the post-synthesis laundering and dispersion of synthesized NP suspensions can still be a challenge. Reverse micelle synthetic approaches require the use of surfactants and low dielectric constant solvents, like hexane and cyclohexane, as the oil phase, which can compromise the biocompatibility and colloidal stability of the final composite NP suspensions. Therefore, appropriate dispersants and solvents must be used during laundering and dispersion to remove surfactant and ensure stability of synthesized NPs. In the work presented in this dissertation, two laundering and dispersion approaches, including packed column high performance liquid chromatography (HPLC) and centrifugation (sedimentation and redispersion), are investigated for silver core silica (Ag-SiO2) and calcium phosphosilicate (Caw(HxPO4)y(Si(OH)zOa) b · cH2O, CPS) composite NP suspensions

  18. Application of silica nanoparticles for increased silica availability in maize

    NASA Astrophysics Data System (ADS)

    Suriyaprabha, R.; Karunakaran, G.; Yuvakkumar, R.; Prabu, P.; Rajendran, V.; Kannan, N.

    2013-02-01

    Silica nanoparticles were extracted from rice husk and characterised comprehensively. The synthesised silica powders were amorphous in size with 99.7% purity (20-40 nm). Nanosilica was amended with red soil at 15 kg ha-1 along with micron silica. The influence of nanoscale on silica uptake, accumulation and nutritional variations in maize roots were evaluated through the studies such as root sectioning, elemental analysis and physiological parameters (root length and silica content) and compared with micron silica and control. Nanosilica treated soil reveals enhanced silica uptake and elongated roots which make the plant to resist in stress conditions like drought.

  19. Surface modification of silica nanoparticles

    NASA Astrophysics Data System (ADS)

    Ranjan, Rajesh

    Surface modification of nanosized silica particles by polymer grafting is gaining attention. This can be attributed to the fact that it provides a unique opportunity to engineer the interfacial properties of these modified particles; at the same time the mechanical and thermal properties of the polymers can be improved. Controlled free radical polymerization is a versatile technique which affords control over molecular weight, molecular weight distribution, architecture and functionalities of the resulting polymer. Three commonly used controlled free radical polymerizations include nitroxide-mediated polymerization (NMP), atom transfer radical polymerization (ATRP) and reversible addition fragmentation transfer (RAFT) polymerization. ATRP and RAFT polymerization were explored in order to modify the silica surface with well-defined polymer brushes. A novel click-functionalized RAFT chain transfer agent (RAFT CTA) was synthesized which opened up the possibility of using RAFT polymerization and click chemistry together in surface modification. Using this RAFT CTA, the surface of silica nanoparticles was modified with polystyrene and polyacrylamide brushes via the "grafting to" approach. Both tethered polystyrene and polyacrylamide chains were found in the brush regime. The combination of ATRP and click chemistry was also explored for surface modification. A combination of RAFT polymerization and click chemistry was also studied to modify the surface via the "grafting from" approach. Our strategy included the (1) "grafting from" approach for brush formation (2) facile click reaction to immobilize the RAFT agent (3) synthesis of R-supported chain transfer agent and (4) use of the more active trithiocarbonate RAFT agent. Grafting density obtained by this method was significantly higher than reported values in the literature. Polystyrene (PS) grafted silica nanoparticles were also prepared by a tandem process that simultaneously employs reversible addition fragmentation

  20. Non-seeded synthesis and characterization of superparamagnetic iron oxide nanoparticles incorporated into silica nanoparticles via ultrasound.

    PubMed

    Sodipo, Bashiru Kayode; Abdul Aziz, Azlan

    2015-03-01

    A non-seeded method of incorporating superparamagnetic iron oxide nanoparticles (SPION) into silica nanoparticles is presented. Mixture of both SPION and silica nanoparticles was ultrasonically irradiated. The collapsed bubbles and shockwave generated from the ultrasonic irradiation produce tremendous force that caused inelastic collision and incorporation of SPION into the silica. Physicochemical analyses using transmission electron microscope (TEM), electronic spectroscopic imaging (ESI), X-ray diffraction (XRD) and Fourier transform infrared (FTIR) spectroscopy demonstrated the formation of SPION/silica composite nanoparticles. The prepared composite nanoparticles exhibited superparamagnetic behaviour and nearly 70% of the initial saturation magnetization (Ms) of the SPION was retained. The presence and reactivity of the silica were demonstrated via assembling decanethiol monolayer on the composite nanoparticles. The silanol group of the silica provided the binding site for the alkyl group in the decanethiol molecules. Therefore, the thiol moiety became the terminal and functional group on the magnetic composite nanoparticles. PMID:25315418

  1. Antioxidative and antiinflammatory activities of quercetin-loaded silica nanoparticles.

    PubMed

    Lee, Ga Hyun; Lee, Sung June; Jeong, Sang Won; Kim, Hyun-Chul; Park, Ga Young; Lee, Se Geun; Choi, Jin Hyun

    2016-07-01

    Utilizing the biological activities of compounds by encapsulating natural components in stable nanoparticles is an important strategy for a variety of biomedical and healthcare applications. In this study, quercetin-loaded silica nanoparticles were synthesized using an oil-in-water microemulsion method, which is a suitable system for producing functional nanoparticles of controlled size and shape. The resulting quercetin-loaded silica nanoparticles were spherical, highly monodispersed, and stable in an aqueous system. Superoxide radical scavenging effects were found for the quercetin-loaded silica nanoparticles as well as free quercetin. The quercetin-loaded silica nanoparticles showed cell viability comparable to that of the controls. The amounts of proinflammatory cytokines produced by macrophages, such as interleukin 1 beta, interleukin 6, and tumor necrosis factor alpha, were reduced significantly for the quercetin-loaded silica nanoparticles. These results suggest that the antioxidative and antiinflammatory activities of quercetin are maintained after encapsulation in silica. Silica nanoparticles can be used for the effective and stable incorporation of biologically active natural components into composite biomaterials. PMID:27038916

  2. Synthesis of mesoporous silica nanoparticles.

    PubMed

    Wu, Si-Han; Mou, Chung-Yuan; Lin, Hong-Ping

    2013-05-01

    Good control of the morphology, particle size, uniformity and dispersity of mesoporous silica nanoparticles (MSNs) is of increasing importance to their use in catalyst, adsorption, polymer filler, optical devices, bio-imaging, drug delivery, and biomedical applications. This review discusses different synthesis methodologies to prepare well-dispersed MSNs and hollow silica nanoparticles (HSNs) with tunable dimensions ranging from a few to hundreds of nanometers of different mesostructures. The methods include fast self-assembly, soft and hard templating, a modified Stöber method, dissolving-reconstruction and modified aerogel approaches. In practical applications, the MSNs prepared by these methods demonstrate good potential for use in high-performance catalysis, antireflection coating, transparent polymer-MSNs nanocomposites, drug-release and theranostic systems. PMID:23403864

  3. Cellular membrane trafficking of mesoporous silica nanoparticles

    SciTech Connect

    Fang, I-Ju

    2012-01-01

    This dissertation mainly focuses on the investigation of the cellular membrane trafficking of mesoporous silica nanoparticles. We are interested in the study of endocytosis and exocytosis behaviors of mesoporous silica nanoparticles with desired surface functionality. The relationship between mesoporous silica nanoparticles and membrane trafficking of cells, either cancerous cells or normal cells was examined. Since mesoporous silica nanoparticles were applied in many drug delivery cases, the endocytotic efficiency of mesoporous silica nanoparticles needs to be investigated in more details in order to design the cellular drug delivery system in the controlled way. It is well known that cells can engulf some molecules outside of the cells through a receptor-ligand associated endocytosis. We are interested to determine if those biomolecules binding to cell surface receptors can be utilized on mesoporous silica nanoparticle materials to improve the uptake efficiency or govern the mechanism of endocytosis of mesoporous silica nanoparticles. Arginine-glycine-aspartate (RGD) is a small peptide recognized by cell integrin receptors and it was reported that avidin internalization was highly promoted by tumor lectin. Both RGD and avidin were linked to the surface of mesoporous silica nanoparticle materials to investigate the effect of receptor-associated biomolecule on cellular endocytosis efficiency. The effect of ligand types, ligand conformation and ligand density were discussed in Chapter 2 and 3. Furthermore, the exocytosis of mesoporous silica nanoparticles is very attractive for biological applications. The cellular protein sequestration study of mesoporous silica nanoparticles was examined for further information of the intracellular pathway of endocytosed mesoporous silica nanoparticle materials. The surface functionality of mesoporous silica nanoparticle materials demonstrated selectivity among the materials and cancer and normal cell lines. We aimed to determine

  4. Ultrasound-triggered dual-drug release from poly(lactic-co-glycolic acid)/mesoporous silica nanoparticles electrospun composite fibers

    PubMed Central

    Song, Botao; Wu, Chengtie; Chang, Jiang

    2015-01-01

    The aim of this study was to achieve on-demand controlled drug release from the dual-drug-loaded poly(lactic-co-glycolic acid)/mesoporous silica nanoparticles electrospun composite fibers by the application of ultrasound irradiation. Two drugs were loaded in different part of the composite fibrous materials, and it was found that ultrasound as an external stimulus was able to control release of drugs due to both its thermal effect and non-thermal effect. With the selective irradiation of ultrasound, the drug carrier enabled to realize controlled release, and because of different location in fibers and sensitivity of two different kinds of drugs to ultrasound irradiation, the release rate of two drugs was different. These results indicated that ultrasound irradiation was a facile method to realize the on-demand controlled release of two drugs from the electrospun fibers. PMID:26816645

  5. Encapsulation of silica nanoparticles by redox-initiated graft polymerization from the surface of silica nanoparticles.

    PubMed

    Wang, Huijun; Peng, Mao; Zheng, Jun; Li, Peng

    2008-10-01

    This study describes a facile and versatile method for preparing polymer-encapsulated silica particles by 'grafting from' polymerization initiated by a redox system comprising ceric ion (Ce(4+)) as an oxidant and an organic reductant immobilized on the surface of silica nanoparticles. The silica nanoparticles were firstly modified by 3-aminopropyltriethoxysilane, then reacted with poly(ethylene glycol) acrylate through the Michael addition reaction, so that hydroxyl-terminated poly(ethylene glycol) (PEG) were covalently attached onto the nanoparticle surface and worked as the reductant. Poly(methyl methacrylate) (PMMA), a common hydrophobic polymer, and poly(N-isopropylacrylamide) (PNIPAAm), a thermosensitive polymer, were successfully grafted onto the surface of silica nanoparticles by 'grafting from' polymerization initiated by the redox reaction of Ce(4+) with PEG on the silica surface in acid aqueous solutions. The polymer-encapsulated silica nanoparticles (referred to as silica@PMMA and silica@PNIPAAm, respectively) were characterized by infrared spectroscopy, thermogravimetric analysis, and transmission electron microscopy. On the contrary, graft polymerization did not occur on bare silica nanoparticles. In addition, during polymerization, sediments were observed for PMMA and for PNIPAAm at a polymerization temperature above its low critical solution temperature (LCST). But the silica@PNIPAAm particles obtained at a polymerization temperature below the LCST can suspend stably in water throughout the polymerization process. PMID:18684468

  6. Superparamagnetic iron oxide nanoparticles incorporated into silica nanoparticles by inelastic collision via ultrasonic field: Role of colloidal stability

    NASA Astrophysics Data System (ADS)

    Sodipo, Bashiru Kayode; Azlan, Abdul Aziz

    2015-04-01

    Superparamagnetic iron oxide nanoparticles (SPION)/Silica composite nanoparticles were prepared by ultrasonically irradiating colloidal suspension of silica and SPION mixture. Both silica and SPION were synthesized independently via co-precipitation and sol-gel method, respectively. Their mixtures were sonicated at different pH between 3 and 5. Electrophoresis measurement and other physicochemical analyses of the products demonstrate that at lower pH SPION was found incorporated into the silica. However, at pH greater than 4, SPION was unstable and unable to withstand the turbulence flow and shock wave from the ultrasonic field. Results suggest that the formation of the SPION/silica composite nanoparticles is strongly related to the inelastic collision induced by ultrasonic irradiation. More so, the formation the composite nanoparticles via the ultrasonic field are dependent on the zeta potential and colloidal stability of the particles.

  7. Superparamagnetic iron oxide nanoparticles incorporated into silica nanoparticles by inelastic collision via ultrasonic field: Role of colloidal stability

    SciTech Connect

    Sodipo, Bashiru Kayode; Azlan, Abdul Aziz

    2015-04-24

    Superparamagnetic iron oxide nanoparticles (SPION)/Silica composite nanoparticles were prepared by ultrasonically irradiating colloidal suspension of silica and SPION mixture. Both silica and SPION were synthesized independently via co-precipitation and sol-gel method, respectively. Their mixtures were sonicated at different pH between 3 and 5. Electrophoresis measurement and other physicochemical analyses of the products demonstrate that at lower pH SPION was found incorporated into the silica. However, at pH greater than 4, SPION was unstable and unable to withstand the turbulence flow and shock wave from the ultrasonic field. Results suggest that the formation of the SPION/silica composite nanoparticles is strongly related to the inelastic collision induced by ultrasonic irradiation. More so, the formation the composite nanoparticles via the ultrasonic field are dependent on the zeta potential and colloidal stability of the particles.

  8. Silica-titania composite aerogel photocatalysts by chemical liquid deposition of titania onto nanoporous silica scaffolds.

    PubMed

    Zu, Guoqing; Shen, Jun; Wang, Wenqin; Zou, Liping; Lian, Ya; Zhang, Zhihua

    2015-03-11

    Silica-titania composite aerogels were synthesized by chemical liquid deposition of titania onto nanoporous silica scaffolds. This novel deposition process was based on chemisorption of partially hydrolyzed titanium alkoxides from solution onto silica nanoparticle surfaces and subsequent hydrolysis and condensation to afford titania nanoparticles on the silica surface. The titania is homogeneously distributed in the silica-titania composite aerogels, and the titania content can be effectively controlled by regulating the deposition cycles. The resultant composite aerogel with 15 deposition cycles possessed a high specific surface area (SSA) of 425 m(2)/g, a small particle size of 5-14 nm, and a large pore volume and pore size of 2.41 cm(3)/g and 18.1 nm, respectively, after heat treatment at 600 °C and showed high photocatalytic activity in the photodegradation of methylene blue under UV-light irradiation. Its photocatalytic activity highly depends on the deposition cycles and heat treatment. The combination of small particle size, high SSA, and enhanced crystallinity after heat treatment at 600 °C contributes to the excellent photocatalytic property of the silica-titania composite aerogel. The higher SSAs compared to those of the reported titania aerogels (<200 m(2)/g at 600 °C) at high temperatures combined with the simple method makes the silica-titania aerogels promising candidates as photocatalysts. PMID:25664480

  9. Aminosilane-Grafted Zirconia-Titiania-Silica Nanoparticles/Torlon Hollow Fiber Composites for CO2 Capture.

    PubMed

    Rownaghi, Ali A; Kant, Amit; Li, Xin; Thakkar, Harshul; Hajari, Amit; He, Yingxin; Brennan, Patrick J; Hosseini, Hooman; Koros, William J; Rezaei, Fateme

    2016-05-23

    In this work, the development of novel binary and ternary oxide/Torlon hollow fiber composites comprising zirconia, titania, and silica as amine supports was demonstrated. The resulting binary (Zr-Si/PAI-HF, Ti-Si/PAI-HF) and ternary (Zr-Ti-Si/PAI-HF) composites were then functionalized with monoamine-, diamine-, and triamine-substituted trialkoxysilanes and were evaluated in CO2 capture. Although the introduction of both Zr and Ti improved the CO2 adsorption capacity relative to that with Si/PAI-HF sorbents, zirconia was found to have a more favorable effect on the CO2 adsorption performance than titania, as previously demonstrated for amine sorbents in the powder form. The Zr-Ti-Si/PAI-HF sample with an oxide content of 20 wt % was found to exhibit a relatively high CO2 capacity, that is, 1.90 mmol g(-1) at atmospheric pressure under dry conditions, owing to more favorable synergy between the metal oxides and CO2 . The ternary fiber sorbent showed improved sorption kinetics and long-term stability in cyclic adsorption/desorption runs. PMID:27076214

  10. 40 CFR 721.10119 - Siloxane modified silica nanoparticles (generic).

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... 40 Protection of Environment 32 2012-07-01 2012-07-01 false Siloxane modified silica nanoparticles... Specific Chemical Substances § 721.10119 Siloxane modified silica nanoparticles (generic). (a) Chemical... as siloxane modified silica nanoparticles (PMN P-05-673) is subject to reporting under this...

  11. 40 CFR 721.10119 - Siloxane modified silica nanoparticles (generic).

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... 40 Protection of Environment 31 2014-07-01 2014-07-01 false Siloxane modified silica nanoparticles... Specific Chemical Substances § 721.10119 Siloxane modified silica nanoparticles (generic). (a) Chemical... as siloxane modified silica nanoparticles (PMN P-05-673) is subject to reporting under this...

  12. 40 CFR 721.10119 - Siloxane modified silica nanoparticles (generic).

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... 40 Protection of Environment 32 2013-07-01 2013-07-01 false Siloxane modified silica nanoparticles... Specific Chemical Substances § 721.10119 Siloxane modified silica nanoparticles (generic). (a) Chemical... as siloxane modified silica nanoparticles (PMN P-05-673) is subject to reporting under this...

  13. 40 CFR 721.10119 - Siloxane modified silica nanoparticles (generic).

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... 40 Protection of Environment 31 2011-07-01 2011-07-01 false Siloxane modified silica nanoparticles... Specific Chemical Substances § 721.10119 Siloxane modified silica nanoparticles (generic). (a) Chemical... as siloxane modified silica nanoparticles (PMN P-05-673) is subject to reporting under this...

  14. 40 CFR 721.10119 - Siloxane modified silica nanoparticles (generic).

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Siloxane modified silica nanoparticles... Specific Chemical Substances § 721.10119 Siloxane modified silica nanoparticles (generic). (a) Chemical... as siloxane modified silica nanoparticles (PMN P-05-673) is subject to reporting under this...

  15. Nonporous Silica Nanoparticles for Nanomedicine Application

    PubMed Central

    Tang, Li; Cheng, Jianjun

    2013-01-01

    Summary Nanomedicine, the use of nanotechnology for biomedical applications, has potential to change the landscape of the diagnosis and therapy of many diseases. In the past several decades, the advancement in nanotechnology and material science has resulted in a large number of organic and inorganic nanomedicine platforms. Silica nanoparticles (NPs), which exhibit many unique properties, offer a promising drug delivery platform to realize the potential of nanomedicine. Mesoporous silica NPs have been extensively reviewed previously. Here we review the current state of the development and application of nonporous silica NPs for drug delivery and molecular imaging. PMID:23997809

  16. Growth of hydroxyapatite nanoparticles on silica gels.

    PubMed

    Rivera-Muñoz, E M; Huirache-Acuña, R; Velázquez, R; Alonso-Núñez, G; Eguía-Eguía, S

    2011-06-01

    Synthetic, hydroxyapatite nanoparticles were grown on the surface of silica gels. The synthesis of those nanoparticles was obtained by immersing silica gels in a simulated body fluid (SBF) at 37 degrees C. The SBF was replaced every week to keep constant the Ca and P ion concentration and subsequent growth of hydroxyapatite was evaluated after 1-6 weeks of total soaking time in SBF. Hydroxyapatite nanoparticles were observed by scanning electron microscopy (SEM) on the surface of silica gel samples and confirmed by energy dispersive X-ray spectroscopy (EDS), Fourier Transform Infra Red Spectroscopy (FTIR) and powder X-ray Diffractometry (XRD) analysis. These particles show a regular shape and uniform size every week, keeping within the nanoscale always. Both the size and morphology of hydroxyapatite nanoparticles obtained are the result of the use of different chemical additives in the synthesis of silica gels, since they affect the liquid-to-solid interface, and the growth could correspond to a diffusion limited aggregation (DLA) process. A more detailed analysis, with higher magnifications, showed that hydroxyapatite nanoparticles are not solid spheres, showing a branched texture and their size depends on the scale and resolution of the measure instrument. PMID:21770224

  17. Electrophoretic deposition of composite hydroxyapatite-silica-chitosan coatings

    SciTech Connect

    Grandfield, K.; Zhitomirsky, I.

    2008-01-15

    Electrophoretic deposition (EPD) method has been developed for the fabrication of nanocomposite silica-chitosan coatings. Cathodic deposits were obtained on various conductive substrates using suspensions of silica nanoparticles in a mixed ethanol-water solvent, containing dissolved chitosan. Co-deposition of silica and hydroxyapatite (HA) nanoparticles resulted in the fabrication of HA-silica-chitosan coatings. The deposition yield has been studied at a constant voltage mode at various deposition durations. The method enabled the formation of coatings of different thickness in the range of up to 100 {mu}m. Deposit composition, microstructure and porosity can be varied by variation of HA and silica concentration in the suspensions. It was demonstrated that EPD can be used for the fabrication of HA-silica-chitosan coatings of graded composition and laminates. The method enabled the deposition of coatings containing layers of silica-chitosan and HA-chitosan nanocomposites using suspensions with different HA and silica content. Obtained coatings were studied by X-ray diffraction, thermogravimetric and differential thermal analysis, scanning electron microscopy and energy dispersive spectroscopy. The mechanism of deposition is discussed.

  18. Bright photoluminescent hybrid mesostructured silica nanoparticles.

    PubMed

    Miletto, Ivana; Bottinelli, Emanuela; Caputo, Giuseppe; Coluccia, Salvatore; Gianotti, Enrica

    2012-07-28

    Bright photoluminescent mesostructured silica nanoparticles were synthesized by the incorporation of fluorescent cyanine dyes into the channels of MCM-41 mesoporous silica. Cyanine molecules were introduced into MCM-41 nanoparticles by physical adsorption and covalent grafting. Several photoluminescent nanoparticles with different organic loadings have been synthesized and characterized by X-ray powder diffraction, high resolution transmission electron microscopy and nitrogen physisorption porosimetry. A detailed photoluminescence study with the analysis of fluorescence lifetimes was carried out to elucidate the cyanine molecules distribution within the pores of MCM-41 nanoparticles and the influence of the encapsulation on the photoemission properties of the guests. The results show that highly stable photoluminescent hybrid materials with interesting potential applications as photoluminescent probes for diagnostics and imaging can be prepared by both methods. PMID:22706523

  19. The properties of silica-gelatin composites

    NASA Astrophysics Data System (ADS)

    Stavinskaya, O. N.; Laguta, I. V.

    2010-06-01

    Silica-gelatin composites with various silica-to-gelatin ratios were obtained. The influence of high-dispersity silica on the swelling of composites in water and desorption of pyridoxine and thiamine vitamins incorporated into the material was studied. The addition of silica to gelatin was shown to increase the time of the dissolution of the materials in aqueous medium and decelerate the desorption of vitamins.

  20. Composition-dependent morphostructural properties of Ni-Cu oxide nanoparticles confined within the channels of ordered mesoporous SBA-15 silica.

    PubMed

    Ungureanu, Adrian; Dragoi, Brindusa; Chirieac, Alexandru; Ciotonea, Carmen; Royer, Sébastien; Duprez, Daniel; Mamede, Anne Sophie; Dumitriu, Emil

    2013-04-24

    NiO and NiO-CuO polycrystalline rodlike nanoparticles were confined and stabilized within the channels of ordered mesoporous SBA-15 silica by a simple and viable approach consisting in incipient wetness impregnation of the calcined support with aqueous solutions of metal nitrates followed by a mild drying step at 25 °C and calcination. As revealed by low- and high-angle XRD, N2 adsorption/desorption, HRTEM/EDXS and H2 TPR analyses, the morphostructural properties of NiO-CuO nanoparticles can be controlled by adjusting their chemical composition, creating the prerequisites to obtain high performance bimetallic catalysts. Experimental evidence by in situ XRD monitoring during the thermoprogrammed reduction indicates that the confined NiO-CuO nanoparticles evolve into thermostable and well-dispersed Ni-Cu heterostructures. The strong Cu-Ni and Ni-support interactions demonstrated by TPR and XPS were put forward to explain the formation of these new bimetallic structures. The optimal Ni-Cu/SBA-15 catalyst (i.e., Cu/(Cu+Ni) atomic ratio of 0.2) proved a greatly enhanced reducibility and H2 chemisorption capacity, and an improved activity in the hydrogenation of cinnamaldehyde, as compared with the monometallic Ni/SBA-15 or Cu/SBA-15 counterparts, which can be associated with the synergism between nickel and copper and high dispersion of active components on the SBA-15 host. The unique structure and controllable properties of both oxidic and metallic forms of Ni-Cu/SBA-15 materials make them very attractive for both fundamental research and practical catalytic applications. PMID:23496429

  1. Metal Nanoparticle Aerogel Composites

    NASA Technical Reports Server (NTRS)

    Smith, David D.; Sibille, Laurent; Ignont, Erica; Snow, Lanee; Rose, M. Franklin (Technical Monitor)

    2000-01-01

    We have fabricated sol-gels containing gold and silver nanoparticles. Formation of an aerogel produces a blue shift in the surface plasmon resonance as a result of the decrease in the dielectric constant of the matrix upon supercritical extraction of the solvent. However, as a result of chemical interface damping this blue shift does not obey effective medium theories. Annealing the samples in a reducing atmosphere at 400 C eliminates this discrepancy and results in narrowing and further blue shifting of the plasmon resonance. Metal particle aggregation also results in a deviation from the predictions of effective medium theories, but can be controlled through careful handling and by avoiding the use of alcohol. By applying effective medium theories to the heterogeneous interlayer surrounding each metal particle, we extend the technique of immersion spectroscopy to inhomogeneous materials characterized by spatially dependent dielectric constants, such as aerogels. We demonstrate that the shift in the surface plasmon wavelength provides the average fractional composition of each component (air and silica) in this inhomogeneous layer, i.e. the porosity of the aerogel or equivalently, for these materials, the catalytic dispersion. Additionally, the kinetics suggest that collective particle interactions in coagulated metal clusters are perturbed during silica gelation resulting in a change in the aggregate geometry.

  2. Nanoparticle-doped radioluminescent silica optical fibers

    NASA Astrophysics Data System (ADS)

    Mrazek, J.; Nikl, M.; Kasik, I.; Podrazky, O.; Aubrecht, J.; Beitlerova, A.

    2014-05-01

    This contribution deals with the preparation and characterization of the silica optical fibers doped by nanocrystalline zinc silicate. The sol-gel approach was employed to prepare colloidal solution of zinc silicate precursors. Prepared sol was thermally treated to form nanocrystalline zinc silicate disperzed inside amorphous silica matrix or soaked inside the porous silica frit deposed inside the silica substrate tube which was collapsed into preform and drawn into optical fiber. Single mode optical fiber with the core diameter 15 μm and outer diamer 125 μm was prepared. Optical and waveguiding properties of the fiber were analyzed. Concentration of the zinc silicate in the fiber was 0.93 at. %. Radioluminescence properties of nanocrystalline zinc silicate powder and of the prepared optical fiber were investigated. The nanoparticle doped samples appear a emission maximum at 390 nm.

  3. Carbothermal transformation of a graphitic carbon nanofiber/silica aerogel composite to a SiC/silica nanocomposite.

    PubMed

    Lu, Weijie; Steigerwalt, Eve S; Moore, Joshua T; Sullivan, Lisa M; Collins, W Eugene; Lukehart, C M

    2004-09-01

    Carbon nanofiber/silica aerogel composites are prepared by sol-gel processing of surface-enhanced herringbone graphitic carbon nanofibers (GCNF) and Si(OMe)4, followed by supercritical CO2 drying. Heating the resulting GCNF/silica aerogel composites to 1650 degrees C under a partial pressure of Ar gas initiates carbothermal reaction between the silica aerogel matrix and the carbon nanofiber component to form SiC/silica nanocomposites. The SiC phase is present as nearly spherical nanoparticles, having an average diameter of ca. 8 nm. Formation of SiC is confirmed by powder XRD and by Raman spectroscopy. PMID:15570963

  4. Electrophoretic Deposition of Dexamethasone-Loaded Mesoporous Silica Nanoparticles onto Poly(L-Lactic Acid)/Poly(ε-Caprolactone) Composite Scaffold for Bone Tissue Engineering.

    PubMed

    Qiu, Kexin; Chen, Bo; Nie, Wei; Zhou, Xiaojun; Feng, Wei; Wang, Weizhong; Chen, Liang; Mo, Xiumei; Wei, Youzhen; He, Chuanglong

    2016-02-17

    The incorporation of microcarriers as drug delivery vehicles into polymeric scaffold for bone regeneration has aroused increasing interest. In this study, the aminated mesoporous silica nanoparticles (MSNs-NH2) were prepared and used as microcarriers for dexamethasone (DEX) loading. Poly(l-lactic acid)/poly(ε-caprolactone) (PLLA/PCL) nanofibrous scaffold was fabricated via thermally induced phase separation (TIPS) and served as template, onto which the drug-loaded MSNs-NH2 nanoparticles were deposited by electrophoretic deposition (EPD). The physicochemical and release properties of the prepared scaffolds (DEX@MSNs-NH2/PLLA/PCL) were examined, and their osteogenic activities were also evaluated through in vitro and in vivo studies. The release of DEX from the scaffolds revealed an initial rapid release followed by a slower and sustained one. The in vitro results indicated that the DEX@MSNs-NH2/PLLA/PCL scaffold exhibited good biocompatibility to rat bone marrow-derived mesenchymal stem cells (BMSCs). Also, BMSCs cultured on the DEX@MSNs-NH2/PLLA/PCL scaffold exhibited a higher degree of osteogenic differentiation than those cultured on PLLA/PCL and MSNs-NH2/PLLA/PCL scaffolds, in terms of alkaline phosphatase (ALP) activity, mineralized matrix formation, and osteocalcin (OCN) expression. Furthermore, the in vivo results in a calvarial defect model of Sprague-Dawley (SD) rats demonstrated that the DEX@MSNs-NH2/PLLA/PCL scaffold could significantly promote calvarial defect healing compared with the PLLA/PCL scaffold. Thus, the EPD technique provides a convenient way to incorporate osteogenic agents-containing microcarriers to polymer scaffold, and thus, prepared composite scaffold could be a potential candidate for bone tissue engineering application due to its capacity for delivery of osteogenic agents. PMID:26736029

  5. Nickel Oxide Nanoparticle-Deposited Silica Composite Solid-Phase Extraction for Benzimidazole Residue Analysis in Milk and Eggs by Liquid Chromatography-Mass Spectrometry.

    PubMed

    Sun, Huan; Yu, Qiong-Wei; He, Hai-Bo; Lu, Qian; Shi, Zhi-Guo; Feng, Yu-Qi

    2016-01-13

    A novel nickel oxide nanoparticle-deposited silica (SiO2@NiO) composite was prepared via liquid-phase deposition (LPD) and then employed as a solid-phase extraction (SPE) sorbent. When the SPE was coupled with liquid chromatography-electrospray ionization mass spectrometry (LC-ESI/MS) analysis, an analytical platform for the sensitive determination of benzimidazole residues in egg and milk was established. The limits of detection of nine benzimidazoles were in the range of 0.8-2.2 ng/mL in milk and 0.3-2.1 ng/g in eggs, respectively, which was 5-10 times superior to the methods with other adsorbents for SPE. The recoveries of nine benzimidazoles spiked in milk and egg ranged from 70.8 to 118.7%, with relative standard deviations (RSDs) being less than 18.9%. This work presented the excellent extraction performance of NiO on benzimidazoles for the first time, and the applicability of the LPD technique used as sorbents for trace analysis in complex matrices was also demonstrated. PMID:26652314

  6. Assembly of functional gold nanoparticle on silica microsphere.

    PubMed

    Wang, Hsuan-Lan; Lee, Fu-Cheng; Tang, Tse-Yu; Zhou, Chenguang; Tsai, De-Hao

    2016-05-01

    We demonstrate a controlled synthesis of silica microsphere with the surface-decorated functional gold nanoparticles. Surface of silica microsphere was modified by 3-aminopropypltriethoxysilane and 3-aminopropyldimethylethoxysilane to generate a positive electric field, by which the gold nanoparticles with the negative charges (unconjugated, thiolated polyethylene glycol functionalized with the traceable packing density and conformation) were able to be attracted to the silica microsphere. Results show that both the molecular conjugation on gold nanoparticle and the uniformity in the amino-silanization of silica microsphere influenced the loading and the homogeneity of gold nanoparticles on silica microsphere. The 3-aminopropyldimethylethoxysilane-functionalized silica microsphere provided an uniform field to attract gold nanoparticles. Increasing the ethanol content in aminosilane solution significantly improved the homogeneity and the loading of gold nanoparticles on the surface of silica microsphere. For the gold nanoparticle, increasing the molecular mass of polyethylene glycol yielded a greater homogeneity but a lower loading on silica microsphere. Bovine serum albumin induced the desorption of gold nanoparticles from silica microsphere, where the extent of desorption was suppressed by the presence of high-molecular mass polyethylene glycol on gold nanoparticles. This work provides the fundamental understanding for the synthesis of gold nanoparticle-silica microsphere constructs useful to the applications in chemo-radioactive therapeutics. PMID:26874272

  7. Electroactive Silica Nanoparticles for Biological Labeling

    SciTech Connect

    Wang, Jun; Liu, Guodong; Lin, Yuehe

    2006-08-29

    A novel electrochemical immuno-biosensor based on poly(guanine)-functionalized silica nanoparticle labels and mediator-generated catalytic reaction was described. The functionalized silica NPs conjugates were characterized by atomic force microscopy, X-ray photoelectron spectroscopy, and electrochemistry. This immunobiosensor is very sensitive and the limit of detection was found to be down to 0.2 ng/ml (4 pM), which was attributed to signal amplification by poly[G] functionalized silica NPs and guanine catalytic oxidation. Attractive feature of this approach is feasible to develop a cheap, sensitive and portable device for multiplexed diagnoses of different proteins. This method is simple, selective and reproducible for trace protein analysis and can be extended to study protein/protein, peptide/protein, and DNA/ protein interactions.

  8. Crystallization of hollow mesoporous silica nanoparticles.

    PubMed

    Drisko, Glenna L; Carretero-Genevrier, Adrian; Perrot, Alexandre; Gich, Martí; Gàzquez, Jaume; Rodriguez-Carvajal, Juan; Favre, Luc; Grosso, David; Boissière, Cédric; Sanchez, Clément

    2015-03-11

    Complex 3D macrostructured nanoparticles are transformed from amorphous silica into pure polycrystalline α-quartz using catalytic quantities of alkaline earth metals as devitrifying agent. Walls as thin as 10 nm could be crystallized without losing the architecture of the particles. The roles of cation size and the mol% of the incorporated devitrifying agent in crystallization behavior are studied, with Mg(2+), Ca(2+), Sr(2+) and Ba(2+) all producing pure α-quartz under certain conditions. PMID:25503642

  9. Cobalt silica magnetic nanoparticles with functional surfaces

    NASA Astrophysics Data System (ADS)

    Vadala, Michael L.; Zalich, Michael A.; Fulks, David B.; St. Pierre, Tim G.; Dailey, James P.; Riffle, Judy S.

    2005-05-01

    Cobalt nanoparticles encased in polysiloxane block copolymers have been heated at 600-700 °C to form protective shells around the particles, which contain crosslinked Si-O structures, and to anneal the cobalt. Methods to functionalize and modify the surfaces of the pyrolyzed/annealed silica-cobalt complexes with amines, isocyanates, poly(ethylene oxide), poly( L-lactide) and polydimethylsiloxane (PDMS) are presented.

  10. Mesoporous silica nanoparticles for active corrosion protection.

    PubMed

    Borisova, Dimitriya; Möhwald, Helmuth; Shchukin, Dmitry G

    2011-03-22

    This work presents the synthesis of monodisperse, mesoporous silica nanoparticles and their application as nanocontainers loaded with corrosion inhibitor (1H-benzotriazole (BTA)) and embedded in hybrid SiOx/ZrOx sol-gel coating for the corrosion protection of aluminum alloy. The developed porous system of mechanically stable silica nanoparticles exhibits high surface area (∼1000 m2·g(-1)), narrow pore size distribution (d∼3 nm), and large pore volume (∼1 mL·g(-1)). As a result, a sufficiently high uptake and storage of the corrosion inhibitor in the mesoporous nanocontainers was achieved. The successful embedding and homogeneous distribution of the BTA-loaded monodisperse silica nanocontainers in the passive anticorrosive SiOx/ZrOx film improve the wet corrosion resistance of the aluminum alloy AA2024 in 0.1 M sodium chloride solution. The enhanced corrosion protection of this newly developed active system in comparison to the passive sol-gel coating was observed during a simulated corrosion process by the scanning vibrating electrode technique (SVET). These results, as well as the controlled pH-dependent release of BTA from the mesoporous silica nanocontainers without additional polyelectrolyte shell, suggest an inhibitor release triggered by the corrosion process leading to a self-healing effect. PMID:21344888

  11. Silver nanoparticles incorporated onto ordered mesoporous silica from Tollen's reagent

    NASA Astrophysics Data System (ADS)

    Zienkiewicz-Strzałka, M.; Pasieczna-Patkowska, S.; Kozak, M.; Pikus, S.

    2013-02-01

    Noble metal nanostructures supported on mesoporous silica are bridge between traditional silica adsorbents and modern catalysts. In this work the Ag/SBA-15 mesoporous materials were synthesized and characterized. Various forms of nanosilver supported on ordered mesoporous template have been successfully obtained via proposed procedures. In all synthesized materials, Tollen's reagent (diammine silver complex [Ag(NH3)2]+) was used as a silver source. Silver nanoparticles were prepared by reduction of ammoniacal silver complex by formaldehyde in the solution of stabilizer. After reduction, Ag nanoparticles could be deposited on SBA-15, or added during traditional synthesis of SBA-15 giving silver or silver chloride nanoparticles in the combination with porous silica. Silver nanostructures as nanoparticles or nanowires were also embedded onto the SBA-15 by incipient wetness impregnation of silver ions. Absorbed silver ions were next reduced under hydrogen at high temperature. There are many advantages of utilized ammoniacal silver complex as a silver source. Proposed method is capable to synthesis of various metal nanostructures with controlled composition and morphology. The silver ammonia complex is composed of two ions surrounding and protecting the central silver ion, so it is possible to obtain very small nanoparticles using simple approach without any functionalization of external and internal surface of SBA-15. This approach allows obtaining greatly small silver nanoparticles on SBA-15 (4 nm) or nanowires depending on the metal loading amount. Moreover, the colloidal silver solution prepared from Tollen's reagent, in the presence of triblock copolymer, remains stable for a long time. Reduction of Tollen's reagent to silver colloidal solution seems to be efficient, fast and interesting approach for the preparation of supported silver nanostructures Obtained samples were characterized by powder X-ray diffraction, small angle X-ray scattering (SAXS), UV

  12. Luminescent Silica Nanoparticles for cancer diagnosis

    PubMed Central

    Montalti, Marco; Petrizza, Luca; Rampazzo, Enrico; Zaccheroni, Nelsi; Marchiò, Serena

    2015-01-01

    Fluorescence imaging techniques are becoming essential in preclinical investigations, and the research of suitable tools for in vivo measurements is gaining more and more importance and attention. Nanotechnology entered the field to try to find solutions for many limitation at the state of the art, and luminescent nanoparticles (NPs) are one of the most promising materials proposed for future diagnostic implementation. NPs constitute also a versatile platform that can allow facile multi-functionalization to perform multimodal imaging or theranostic (simultaneous diagnosis and therapy). In this contribution we have focussed our attention only on dye doped silica or silica-based NPs conjugated with targeting moieties to enable specific cancer cells imaging and differentiation, even if also a few non targeted systems have been cited and discussed for completeness. We have summarized common synthetic approaches to these materials and then surveyed the most recent imaging applications of silica-based nanoparticles in cancer. The field of theranostic is so important and stimulating that, even if it is not the central topic of this paper, we have included some significant examples. We have then concluded with short hints on systems already in clinical trials and examples of specific applications in children tumours. This review tries to describe and discuss, through focussed examples, the great potentialities of these materials in the medical field, with the aim to encourage further research to implement applications that are still rare. PMID:23458621

  13. Superhydrophobicity of cotton fabrics treated with silica nanoparticles and water-repellent agent.

    PubMed

    Bae, Geun Yeol; Min, Byung Gil; Jeong, Young Gyu; Lee, Sang Cheol; Jang, Jin Ho; Koo, Gwang Hoe

    2009-09-01

    To obtain the superhydrophobic water-repellent cotton fabrics, cotton fabrics were treated with silica nanoparticles and/or a cost-effective water-repellent agent (WR agent). Two different silica nanoparticles were synthesized via a sol-gel process and their shapes, sizes, and compositions were characterized. It was found that silica particles are spherical and have diameters of 143 and 378 nm. For the cotton fabrics treated with the WR agent alone, the water contact angles on the fabric surface remained lower than 20 degrees at the WR agent concentration of 0.3 wt% or less. Silica nanoparticle treatment itself did not change the hydrophilic surface of cotton fabric, indicating that water drops were adsorbed into fabrics due to the hydroxyl groups on both cotton and silica nanoparticle surfaces. However, for the cotton fabrics treated with both silica nanoparticles and the WR agent, a contact angle above 130 degrees can be obtained even at the very low WR agent concentration of 0.1 wt%. Therefore, superhydrophobic cotton fabrics could be obtained via the combined treatment of silica nanoparticle and WR agent, which is cost effective compared with fluorinate silane treatment. PMID:19477460

  14. A bioinspired strategy for surface modification of silica nanoparticles

    NASA Astrophysics Data System (ADS)

    Tian, Jianwen; Zhang, Haoxuan; Liu, Meiying; Deng, Fengjie; Huang, Hongye; Wan, Qing; Li, Zhen; Wang, Ke; He, Xiaohui; Zhang, Xiaoyong; Wei, Yen

    2015-12-01

    Silica nanoparticles have become one of the most promising nanomaterials for a vast of applications. In this work, a novel strategy for surface modification of silica nanoparticles has been developed for the first time via combination of mussel inspired chemistry and Michael addition reaction. In this procedure, thin polydopamine (PDA) films were first coated on the bare silica nanoparticles via self-polymerization of dopamine in alkaline condition. And then amino-containing polymers were introduced onto the PDA coated silica nanoparticles through Michael addition reaction, that are synthesized from free radical polymerization using poly(ethylene glycol) methyl methacrylate (PEGMA) and N-(3-aminopropyl) methacrylamide (NAPAM) as monomers and ammonium persulfate as the initiator. The successful modification of silica nanoparticles was evidenced by a series of characterization techniques. As compared with the bare silica nanoparticles, the polymers modified silica nanoparticles showed remarkable enhanced dispersibility in both aqueous and organic solution. This strategy is rather simple, effective and versatile. Therefore, it should be of specific importance for further applications of silica nanoparticles and will spark great research attention of scientists from different fields.

  15. Reliable methods for silica coating of Au nanoparticles.

    PubMed

    Pastoriza-Santos, Isabel; Liz-Marzán, Luis M

    2013-01-01

    The inherent properties of silica, such as optical transparency, high biocompatibility, chemical and colloidal stability, controllable porosity, and easy surface modification, provide silica materials with a tremendous potential in biomedicine. Therefore, the coating of Au nanoparticles with silica largely contributes to enhance the important applications of metal nanoparticles in biomedicine. We describe in this chapter a number of reliable strategies that have been reported for silica coating of different types of Au nanoparticles. All descriptions are based on tested protocols and are expected to provide a reference for scientists with an interest in this field. PMID:23918330

  16. Synthesis and surface functionalization of silica nanoparticles for nanomedicine

    NASA Astrophysics Data System (ADS)

    Liberman, Alexander; Mendez, Natalie; Trogler, William C.; Kummel, Andrew C.

    2014-09-01

    There are a wide variety of silica nanoformulations being investigated for biomedical applications. Silica nanoparticles can be produced using a wide variety of synthetic techniques with precise control over their physical and chemical characteristics. Inorganic nanoformulations are often criticized or neglected for their poor tolerance; however, extensive studies into silica nanoparticle biodistributions and toxicology have shown that silica nanoparticles may be well tolerated, and in some case are excreted or are biodegradable. Robust synthetic techniques have allowed silica nanoparticles to be developed for applications such as biomedical imaging contrast agents, ablative therapy sensitizers, and drug delivery vehicles. This review explores the synthetic techniques used to create and modify an assortment of silica nanoformulations, as well as several of the diagnostic and therapeutic applications.

  17. Synthesis and surface functionalization of silica nanoparticles for nanomedicine

    PubMed Central

    Liberman, Alexander; Mendez, Natalie; Trogler, William C.; Kummel, Andrew C.

    2014-01-01

    There are a wide variety of silica nanoformulations being investigated for biomedical applications. Silica nanoparticles can be produced using a wide variety of synthetic techniques with precise control over their physical and chemical characteristics. Inorganic nanoformulations are often criticized or neglected for their poor tolerance; however, extensive studies into silica nanoparticle biodistributions and toxicology have shown that silica nanoparticles may be well tolerated, and in some case are excreted or are biodegradable. Robust synthetic techniques have allowed silica nanoparticles to be developed for applications such as biomedical imaging contrast agents, ablative therapy sensitizers, and drug delivery vehicles. This review explores the synthetic techniques used to create and modify an assortment of silica nanoformulations, as well as several of the diagnostic and therapeutic applications. PMID:25364083

  18. Silica/Polymer and Silica/Polymer/Fiber Composite Aerogels

    NASA Technical Reports Server (NTRS)

    Ou, Danny; Stepanian, Christopher J.; Hu, Xiangjun

    2010-01-01

    carboxyl groups of the organic phase. The polymerization process has been adapted to create interpenetrating PMA and silica-gel networks from monomers and prevent any phase separations that could otherwise be caused by an overgrowth of either phase. Typically, the resulting PMA/silica aerogel, without or with fiber reinforcement, has a density and a thermal conductivity similar to those of pure silica aerogels. However, the PMA enhances mechanical properties. Specifically, flexural strength at rupture is increased to 102 psi (=0.7 MPa), about 50 times the flexural strength of typical pure silica aerogels. Resistance to compression is also increased: Applied pressure of 17.5 psi (=0.12 MPa) was found to reduce the thicknesses of several composite PMA/silica aerogels by only about 10 percent.

  19. Gold nanorods-silica Janus nanoparticles for theranostics

    NASA Astrophysics Data System (ADS)

    Wang, Ying-Shuai; Shao, Dan; Zhang, Lu; Zhang, Xu-Lin; Li, Jing; Feng, Jing; Xia, Hong; Huo, Qi-Sheng; Dong, Wen-Fei; Sun, Hong-Bo

    2015-04-01

    A multi-functional gold nanorods-mesoporous silica Janus nanoparticles (NPs) were fabricated by a facile and mild strategy. These Janus NPs not only exhibit small shift of the local surface plasmon resonance wavelength but also have high potential for drug loading and low cytotoxicity. More importantly, the Janus nano-composites could efficiently deliver the imaging agents or drugs into liver cancer cells, at the same time the Janus NPs have good effect on photothermal, which indicate that the unique Janus NPs could be a promising candidate of theranostic system for combined photothermo-/chemo-cancer therapy.

  20. Continuous polymer nanocoating on silica nanoparticles.

    PubMed

    Chen, Dengyue; Singh, Dhananjay; Sirkar, Kamalesh K; Zhu, Jiangtao; Pfeffer, Robert

    2014-07-01

    Continuous polymer coating of nanoparticles is of interest in many industries such as pharmaceuticals, cosmetics, food, and electronics. Here we introduce a polymer coating/precipitation technique to achieve a uniform and controllable nanosize polymer coating on nanoparticles in a continuous manner. The utility of this technique is demonstrated by coating Aerosil silica nanoparticles (SNPs) of diameter 12 nm with the polymer Eudragit RL 100. Both hydrophilic and hydrophobic SNPs were successfully coated. After determining the cloud point of an acetone solution of the polymer containing a controlled amount of the nonsolvent water, the solid hollow fiber cooling crystallization (SHFCC) technique was employed to continuously coat SNPs with the polymer. A suspension of the SNPs in an acetone-water solution of the polymer containing a surfactant was pumped through the lumen of solid polypropylene hollow fibers in a SHFCC device; cold liquid was circulated on the shell side. Because of rapid cooling-induced supersaturation and heterogeneous nucleation, precipitated polymers will coat the nanoparticles. The thickness and morphology of the nanocoating and the particle size distribution of the coated SNPs were analyzed by scanning transmission electron microscopy (STEM) with electron energy loss spectroscopy (EELS), thermogravimetric analysis (TGA), and dynamic light scattering (DLS). Results indicate that uniformly polymer-coated SNPs can be obtained from the SHFCC device after suitable post-treatments. The technique is also easily scalable by increasing the number of hollow fibers in the SHFCC device. PMID:24903705

  1. Silica and titanium dioxide nanoparticles cause pregnancy complications in mice

    NASA Astrophysics Data System (ADS)

    Yamashita, Kohei; Yoshioka, Yasuo; Higashisaka, Kazuma; Mimura, Kazuya; Morishita, Yuki; Nozaki, Masatoshi; Yoshida, Tokuyuki; Ogura, Toshinobu; Nabeshi, Hiromi; Nagano, Kazuya; Abe, Yasuhiro; Kamada, Haruhiko; Monobe, Youko; Imazawa, Takayoshi; Aoshima, Hisae; Shishido, Kiyoshi; Kawai, Yuichi; Mayumi, Tadanori; Tsunoda, Shin-Ichi; Itoh, Norio; Yoshikawa, Tomoaki; Yanagihara, Itaru; Saito, Shigeru; Tsutsumi, Yasuo

    2011-05-01

    The increasing use of nanomaterials has raised concerns about their potential risks to human health. Recent studies have shown that nanoparticles can cross the placenta barrier in pregnant mice and cause neurotoxicity in their offspring, but a more detailed understanding of the effects of nanoparticles on pregnant animals remains elusive. Here, we show that silica and titanium dioxide nanoparticles with diameters of 70 nm and 35 nm, respectively, can cause pregnancy complications when injected intravenously into pregnant mice. The silica and titanium dioxide nanoparticles were found in the placenta, fetal liver and fetal brain. Mice treated with these nanoparticles had smaller uteri and smaller fetuses than untreated controls. Fullerene molecules and larger (300 and 1,000 nm) silica particles did not induce these complications. These detrimental effects are linked to structural and functional abnormalities in the placenta on the maternal side, and are abolished when the surfaces of the silica nanoparticles are modified with carboxyl and amine groups.

  2. Uniform dispersion of lanthanum hexaboride nanoparticles in a silica thin film: synthesis and optical properties.

    PubMed

    Jiang, Fei; Leong, Yee-Kwong; Saunders, Martine; Martyniuk, Mariusz; Faraone, Lorenzo; Keating, Adrian; Dell, John M

    2012-11-01

    Silica thin films containing uniformly dispersed lanthanum hexaboride (LaB₆) nanoparticles have been prepared by spin-coating a sol-gel silica solution containing cetyltrimethyl ammonium bromide (CTAB)-stabilized LaB₆ nanoparticles onto a glass substrate followed by a standard heat treatment. The production of this thin film involved three steps: (i) a CTAB-stabilized LaB₆ nanoparticle dispersion was prepared in water and then dried, (ii) the dried nanoparticles were redispersed in a small amount of water and mixed with tetraethoxyorthosilane (TEOS), ethanol, and a little acid to initiate the sol-gel reaction, and (iii) this reaction mixture was spun to produce a thin film and then was annealed. A range of techniques such as zeta potential, laser sizing, energy-filtered transmission electron microscopy (EFTEM), scanning TEM (STEM), scanning electron microscopy (SEM), and energy dispersive X-ray spectrum (EDS) were employed to characterize the particle's size, elemental composition, and stability and the optical properties of silica thin films with LaB₆ nanoparticles. On the basis of the optical transmittance and reflectance spectra of an annealed silica thin film with LaB₆ nanoparticles, the annealed thin films clearly showed positive absorption of radiation in the near infrared (NIR) region meeting a main objective of this study. A potential optical micro-electromechanical sensing system in the NIR range can be realized on the basis of this silica thin film with LaB₆ nanoparticles. PMID:23057614

  3. Phase behavior and rheological characterization of silica nanoparticle gel

    NASA Astrophysics Data System (ADS)

    Metin, Cigdem O.; Rankin, Kelli M.; Nguyen, Quoc P.

    2014-01-01

    Preferential injection into high permeability thief zones or fractures can result in early breakthrough at production wells and large unswept areas of high oil saturation, which impact the economic life of a well. A variety of conformance control techniques, including polymer and silica gel treatments, have been designed to block flow through the swept zones. Over a certain range of salinities, silica nanoparticle suspensions form a gel in bulk phase behavior tests. These gels have potential for in situ flow diversion, but in situ flow tests are required to determine their applicability. To determine the appropriate scope of the in situ tests, it is necessary to obtain an accurate description of nanoparticle phase behavior and gel rheology. In this paper, the equilibrium phase behavior of silica nanoparticle solutions in the presence of sodium chloride (NaCl) is presented with four phase regions classified as a function of salinity and nanoparticle concentration. Once the gelation window was clearly defined, rheology experiments of silica nanoparticle gels were also carried out. Gelation time decreases exponentially as a function of silica concentration, salinity, and temperature. Following a power law behavior, the storage modulus, G', increases with particle concentration. Steady shear measurements show that silica nanoparticle gels exhibit non-Newtonian, shear thinning behavior. This comprehensive study of the silica nanoparticle gels has provided a clear path forward for in situ tests to determine the gel's applicability for conformance control operations.

  4. Insitu grafting silica nanoparticles reinforced nanocomposite hydrogels

    NASA Astrophysics Data System (ADS)

    Yang, Jun; Han, Chun-Rui; Duan, Jiu-Fang; Xu, Feng; Sun, Run-Cang

    2013-10-01

    Highly flexible nanocomposite hydrogels were prepared by using silica nanoparticles (SNPs) as fillers and multi-functional cross-links to graft hydrophilic poly(acrylic acid) (PAA) by free radical polymerization from an aqueous solution. The SNPs were collected by neighboring polymer chains and dispersed uniformly within a PAA matrix. The mechanical properties of the nanocomposite hydrogels were tailored by the concentration of SNPs according to the percolation model. It was proposed that covalent bonds of adsorbed chains on the filler surface resulted in the formation of a shell of an immobilized glassy layer and trapped entanglements, where the glassy polymer layer greatly enhanced the elastic modulus and the release of trapped entanglements at deformation contributed to the viscoelastic properties.Highly flexible nanocomposite hydrogels were prepared by using silica nanoparticles (SNPs) as fillers and multi-functional cross-links to graft hydrophilic poly(acrylic acid) (PAA) by free radical polymerization from an aqueous solution. The SNPs were collected by neighboring polymer chains and dispersed uniformly within a PAA matrix. The mechanical properties of the nanocomposite hydrogels were tailored by the concentration of SNPs according to the percolation model. It was proposed that covalent bonds of adsorbed chains on the filler surface resulted in the formation of a shell of an immobilized glassy layer and trapped entanglements, where the glassy polymer layer greatly enhanced the elastic modulus and the release of trapped entanglements at deformation contributed to the viscoelastic properties. Electronic supplementary information (ESI) available: FTIR spectra of SNP after silane treatment, dynamic oscillatory shear measurements as a function of frequency, constrained polymer chain analysis by a change in the peak height in loss factor spectra, molecular weight of grafted chains at different stages of gelation, prediction of the SNP reinforcing mechanism in the

  5. Functionalized mesoporous silica nanoparticles for oral delivery of budesonide

    NASA Astrophysics Data System (ADS)

    Yoncheva, K.; Popova, M.; Szegedi, A.; Mihaly, J.; Tzankov, B.; Lambov, N.; Konstantinov, S.; Tzankova, V.; Pessina, F.; Valoti, M.

    2014-03-01

    Non-functionalized and amino-functionalized mesoporous silica nanoparticle were loaded with anti-inflammatory drug budesonide and additionally post-coated with bioadhesive polymer (carbopol). TEM images showed spherical shape of the nanoparticles and slightly higher polydispersity after coating with carbopol. Nitrogen physisorption and thermogravimetic analysis revealed that more efficient loading and incorporation into the pores of nanoparticles was achieved with the amino-functionalized silica carrier. Infrared spectra indicated that the post-coating of these nanoparticles with carbopol led to the formation of bond between amino groups of the functionalized carrier and carboxyl groups of carbopol. The combination of amino-functionalization of the carrier with the post-coating of the nanoparticles sustained budesonide release. Further, an in vitro model of inflammatory bowel disease showed that the cytoprotective effect of budesonide loaded in the post-coated silica nanoparticles on damaged HT-29 cells was more pronounced compared to the cytoprotection obtained with pure budesonide.

  6. In vivo penetration of bare and lipid-coated silica nanoparticles across the human stratum corneum.

    PubMed

    Iannuccelli, Valentina; Bertelli, Davide; Romagnoli, Marcello; Scalia, Santo; Maretti, Eleonora; Sacchetti, Francesca; Leo, Eliana

    2014-10-01

    Skin penetration of silica nanoparticles (NP) currently used in pharmaceutical and cosmetic products is a topic of interest not only to evaluate their possible toxicity, but also to understand their behaviour upon contact with the skin and to exploit their potential positive effects in drug or cosmetic delivery field. Therefore, the present work aimed to elucidate the in vivo mechanism by which amorphous hydrophilic silica NP enter human stratum corneum (SC) through the evaluation of the role played by the nanoparticle surface polarity and the human hair follicle density. Two silica samples, bare hydrophilic silica (B-silica, 162±51nm in size) and hydrophobic lipid-coated silica (LC-silica, 363±74nm in size) were applied on both the volar and dorsal side of volunteer forearms. Twelve repetitive stripped tapes were removed from the human skin and evaluated for elemental composition by Energy Dispersive X-ray (EDX) analysis and for silicon content by Inductively Coupled Plasma quadrupole Mass Spectrometry (ICP-MS). All the stripped tapes revealed nanosized structures generally located in the broad spaces between corneocytes and characterized by the same elemental composition (relative weight percentage of silicon and silicon to oxygen weight ratio) than that of the applied samples. However, only about 10% B-silica permeated until the deepest SC layers considered in the study indicating a silica retention in the upper layers of SC, regardless of the hair follicle density. Otherwise, the exposure to LC-silica led to a greater silica skin penetration extent into the deeper SC layers (about 42% and 18% silica following volar and dorsal forearm application, respectively) indicating that the NP surface polarity played a predominant role on that of their size in determining the route and the extent of penetration. PMID:25139292

  7. Multifunctional mesoporous silica nanocomposite nanoparticles for theranostic applications.

    PubMed

    Lee, Ji Eun; Lee, Nohyun; Kim, Taeho; Kim, Jaeyun; Hyeon, Taeghwan

    2011-10-18

    Clever combinations of different types of functional nanostructured materials will enable the development of multifunctional nanomedical platforms for multimodal imaging or simultaneous diagnosis and therapy. Mesoporous silica nanoparticles (MSNs) possess unique structural features such as their large surface areas, tunable nanometer-scale pore sizes, and well-defined surface properties. Therefore, they are ideal platforms for constructing multifunctional materials that incorporate a variety of functional nanostructured materials. In this Account, we discuss recent progress by our group and other researchers in the design and fabrication of multifunctional nanocomposite nanoparticles based on mesoporous silica nanostructures for applications to simultaneous diagnosis and therapy. Versatile mesoporous silica-based nanocomposite nanoparticles were fabricated using various methods. Here, we highlight two synthetic approaches: the encapsulation of functional nanoparticles within a mesoporous silica shell and the assembly of nanoparticles on the surface of silica nanostructures. Various nanoparticles were encapsulated in MSNs using surfactants as both phase transfer agents and pore-generating templates. Using MSNs as a scaffold, functional components such as magnetic nanoparticles and fluorescent dyes have been integrated within these systems to generate multifunctional nanocomposite systems that maintain their individual functional characteristics. For example, uniform mesoporous dye-doped silica nanoparticles immobilized with multiple magnetite nanocrystals on their surfaces have been fabricated for their use as a vehicle capable of simultaneous magnetic resonance (MR) and fluorescence imaging and drug delivery. The resulting nanoparticle-incorporated MSNs were then tested in mice with tumors. These in vivo experiments revealed that these multifunctional nanocomposite nanoparticles were delivered to the tumor sites via passive targeting. These nanocomposite

  8. Selective porous gates made from colloidal silica nanoparticles

    PubMed Central

    Avetta, Paola; Calza, Paola; Fabbri, Debora; Magnacca, Giuliana; Scalarone, Dominique

    2015-01-01

    Summary Highly selective porous films were prepared by spin-coating deposition of colloidal silica nanoparticles on an appropriate macroporous substrate. Silica nanoparticles very homogenous in size were obtained by sol–gel reaction of a metal oxide silica precursor, tetraethyl orthosilicate (TEOS), and using polystyrene-block-poly(ethylene oxide) (PS-b-PEO) copolymers as soft-templating agents. Nanoparticles synthesis was carried out in a mixed solvent system. After spin-coating onto a macroporous silicon nitride support, silica nanoparticles were calcined under controlled conditions. An organized nanoporous layer was obtained characterized by a depth filter-like structure with internal porosity due to interparticle voids. Permeability and size-selectivity were studied by monitoring the diffusion of probe molecules under standard conditions and under the application of an external stimulus (i.e., electric field). Promising results were obtained, suggesting possible applications of these nanoporous films as selective gates for controlled transport of chemical species in solution. PMID:26665082

  9. Elastic Phase Response of Silica Nanoparticles Buried in Soft Matter

    SciTech Connect

    Tetard, Laurene; Passian, Ali; Lynch, Rachel M; Voy, Brynn H; Shekhawat, Gajendra; Dravid, Vinayak; Thundat, Thomas George

    2008-01-01

    Tracking the uptake of nanomaterials by living cells is an important component in assessing both potential toxicity and in designing future materials for use in vivo. We show that the difference in the local elasticity at the site of silica (SiO{sub 2}) nanoparticles confined within a macrophage enables functional ultrasonic interactions. By elastically exciting the cell, a phase perturbation caused by the buried SiO{sub 2} nanoparticles was detected and used to map the subsurface populations of nanoparticles. Localization and mapping of stiff chemically synthesized silica nanoparticles within the cellular structures of a macrophage are important in basic as well as applied studies.

  10. Functionalized mesoporous silica nanoparticles for oral delivery of budesonide

    SciTech Connect

    Yoncheva, K.; Popova, M.; Szegedi, A.; Mihaly, J.; Tzankov, B.; Lambov, N.; Konstantinov, S.; Tzankova, V.; Pessina, F.; Valoti, M.

    2014-03-15

    Non-functionalized and amino-functionalized mesoporous silica nanoparticle were loaded with anti-inflammatory drug budesonide and additionally post-coated with bioadhesive polymer (carbopol). TEM images showed spherical shape of the nanoparticles and slightly higher polydispersity after coating with carbopol. Nitrogen physisorption and thermogravimetic analysis revealed that more efficient loading and incorporation into the pores of nanoparticles was achieved with the amino-functionalized silica carrier. Infrared spectra indicated that the post-coating of these nanoparticles with carbopol led to the formation of bond between amino groups of the functionalized carrier and carboxyl groups of carbopol. The combination of amino-functionalization of the carrier with the post-coating of the nanoparticles sustained budesonide release. Further, an in vitro model of inflammatory bowel disease showed that the cytoprotective effect of budesonide loaded in the post-coated silica nanoparticles on damaged HT-29 cells was more pronounced compared to the cytoprotection obtained with pure budesonide. -- Graphical abstract: Silica mesoporous MCM-41 particles were amino-functionalized, loaded with budesonide and post-coated with bioadhesive polymer (carbopol) in order to achieve prolonged residence of anti-inflammatory drug in GIT. Highlights: • Higher drug loading in amino-functionalized mesoporous silica. • Amino-functionalization and post-coating of the nanoparticles sustained drug release. • Achievement of higher cytoprotective effect with drug loaded into the nanoparticles.

  11. Nanomachines on Porous Silica Nanoparticles for Cargo Delivery

    NASA Astrophysics Data System (ADS)

    Tarn, Derrick

    The field of nanomachines based on mesoporous and microporous silica nanoparticles is a relatively new one, but has quickly gained widespread popularity due to their large potential applications. These porous nanomaterials can both carry and release a therapeutic drug molecule at a targeted location. In order to regulate the movement of cargo, nanomachines are designed and assembled onto the silica nanoparticle, ultimately creating a delivery system on the nanoscale that is capable of a stimulus-responsive delivery of its cargo. This dissertation focuses on the design, synthesis and assembly of nanomachines on both meso- and microporous silica nanoparticles to achieve the goal of cargo delivery. The six chapters of this dissertation are presented as follows: 1) the design, synthesis and modification of silica nanoparticles for their use in biology, 2) a light activated, reversible nanovalve assembled on mesoporous silica nanoparticles to achieve a size-selective cargo delivery, 3) biological applications and the delivery of anti-cancer drugs using a pseudorotaxane-based light activated nanovalve, 4) a nanogate machine that is capable of the storage and delivery of both small metal ions and useful organic cargo molecules, 5) biological applications of the nanogate machine in order to deliver calcium ions to cancerous cells to induce cell apoptosis, and 6) thin wax coated microporous silica nanoparticles that are capable of delivering small ions including oxidizers.

  12. Fluorescence anisotropy metrology of electrostatically and covalently labelled silica nanoparticles

    NASA Astrophysics Data System (ADS)

    Yip, Philip; Karolin, Jan; Birch, David J. S.

    2012-08-01

    We compare determining the size of silica nanoparticles using the time-resolved fluorescence anisotropy decay of dye molecules when electrostatically and covalently bound to stable silica nanoparticles. Covalent labelling is shown to offer advantages by simplifying the dye rotational kinetics and the appropriateness of various kinetic models is discussed. Silica nanoparticles produced using Stöber synthesis of tetraethylorthosilicate (TEOS) are found to be controllable between ˜3.1 and 3.8 nm radius by adjusting the relative water:TEOS concentration. Covalent labelling with fluorescein 5(6)-isothiocyanate (FITC) bound to (3-aminopropyl) trimethoxysilane (FITC-APS) predicts a larger particle than electrostatically labelling with rhodamine 6G. The difference is attributed to the presence of an additional depolarization mechanism to Brownian rotation of the nanoparticle and dye wobbling with electrostatic labelling in the form of dye diffusion on the surface of the nanoparticle.

  13. Preparation of fluorescent mesoporous hollow silica-fullerene nanoparticles via selective etching for combined chemotherapy and photodynamic therapy

    NASA Astrophysics Data System (ADS)

    Yang, Yannan; Yu, Meihua; Song, Hao; Wang, Yue; Yu, Chengzhong

    2015-07-01

    Well-dispersed mesoporous hollow silica-fullerene nanoparticles with particle sizes of ~50 nm have been successfully prepared by incorporating fullerene molecules into the silica framework followed by a selective etching method. The fabricated fluorescent silica-fullerene composite with high porosity demonstrates excellent performance in combined chemo/photodynamic therapy.Well-dispersed mesoporous hollow silica-fullerene nanoparticles with particle sizes of ~50 nm have been successfully prepared by incorporating fullerene molecules into the silica framework followed by a selective etching method. The fabricated fluorescent silica-fullerene composite with high porosity demonstrates excellent performance in combined chemo/photodynamic therapy. Electronic supplementary information (ESI) available. See DOI: 10.1039/c5nr02769a

  14. Mechanism of cellular uptake of genotoxic silica nanoparticles

    PubMed Central

    2012-01-01

    Mechanisms for cellular uptake of nanoparticles have important implications for nanoparticulate drug delivery and toxicity. We have explored the mechanism of uptake of amorphous silica nanoparticles of 14 nm diameter, which agglomerate in culture medium to hydrodynamic diameters around 500 nm. In HT29, HaCat and A549 cells, cytotoxicity was observed at nanoparticle concentrations ≥ 1 μg/ml, but DNA damage was evident at 0.1 μg/ml and above. Transmission electron microscopy (TEM) combined with energy-dispersive X-ray spectroscopy confirmed entry of the silica particles into A549 cells exposed to 10 μg/ml of nanoparticles. The particles were observed in the cytoplasm but not within membrane bound vesicles or in the nucleus. TEM of cells exposed to nanoparticles at 4°C for 30 minutes showed particles enter cells when activity is low, suggesting a passive mode of entry. Plasma lipid membrane models identified physical interactions between the membrane and the silica NPs. Quartz crystal microbalance experiments on tethered bilayer lipid membrane systems show that the nanoparticles strongly bind to lipid membranes, forming an adherent monolayer on the membrane. Leakage assays on large unilamellar vesicles (400 nm diameter) indicate that binding of the silica NPs transiently disrupts the vesicles which rapidly self-seal. We suggest that an adhesive interaction between silica nanoparticles and lipid membranes could cause passive cellular uptake of the particles. PMID:22823932

  15. TOXICITY OF AMORPHOUS SILICA NANOPARTICLES IN MOUSE KERATINOCYTES

    SciTech Connect

    Yu, Kyung; Wang, Wei; Gu, Baohua; Hussain, Saber

    2009-01-01

    The present study was designed to examine the uptake, localization and the cytotoxic effects of well-dispersed amorphous silica nanoparticles in mouse keratinocytes (HEL-30). Mouse keratinocytes were exposed for 24h to various concentrations of amorphous silica nanoparticles in homogeneous suspensions of average size distribution (30, 48, 118 and 535 nm SiO2) then assessed for uptake and biochemical changes. Results of transmission electron microscopy revealed all sizes of silica were taken up into the cells and localized into the cytoplasm. The lactate dehydrogenase (LDH) assay shows LDH leakage was dose- and size-dependent with exposure to 30 and 48 nm nanoparticles. However, no LDH leakage was observed for either 118 or 535 nm nanoparticles. The mitochondrial viability assay (MTT) showed significant toxicity for 30 and 48 nm at high concentrations (100 g/mL) compare to the 118 and 535 nm particles. Further studies were carried out to investigate if cellular reduced GSH and mitochondria membrane potential are involved in the mechanism of SiO2 toxicity. The redox potential of cells (GSH) was reduced significantly at concentrations of 50, 100 and 200 g/mL at 30 nm nanoparticle exposures. However, silica nanoparticles larger than 30 nm showed no changes in GSH levels. Reactive oxygen species (ROS) formation did not show any significant change between controls and the exposed cells. In summary, amorphous silica nanoparticles below 100 nm induced cytotoxicity suggest size-of the particles is critical to produce biological effects.

  16. Effect of particle size on the thermoluminescence (TL) response of silica nanoparticles

    NASA Astrophysics Data System (ADS)

    Siti Shafiqah, A. S.; Amin, Y. M.; Nor, R. Md.; Bradley, D. A.

    2015-12-01

    By means of the sol-gel technique, silica nanoparticles have been synthesized at room temperature using tetraethyl orthosilicate, ethanol, deionized water, and ammonia solution. By increasing the amount of ethanol in the mixture, fine spherically shaped silica nanoparticles have been obtained. Using finite element scanning electron microscopy and energy dispersive x-ray spectroscopy, characterization was made of the morphology and elemental composition of the nanoparticles. The mean particle sizes of three of the samples were measured to be of the order of 80, 140, 550 nm, while the remaining sample contained particles of diameter <10 nm. To provide for thermoluminescence measurements, the samples were irradiated with γ-rays, delivering doses from 1-200 Gy. The smaller size silica particles, of around 80 nm, were observed to produce the largest thermoluminescence yield as a result of the surface to volume ratio increase, providing more accessible thermoluminescence carriers.

  17. Carbogenically coated silica nanoparticles and their forensic applications.

    PubMed

    Fernandes, D; Krysmann, M J; Kelarakis, A

    2016-07-01

    Carbogenically coated silica nanoparticles (C-SiO2) exhibit color-tunability and carry great promise for two important forensic applications. First, the C-SiO2 nanopowders are ideal for fingerprint development, yielding strong contrast against multicoloured and patterned backgrounds. Second, spontaneous nanoparticle aggregation leads to non-duplicable, inexpensive nanotags that can support sustainable technologies to combat counterfeiting. PMID:27294695

  18. Studying the interaction between silica nanoparticles and metals by spectrophotometry

    NASA Astrophysics Data System (ADS)

    Revina, A. A.; Potapov, V. V.; Baranova, E. K.; Smirnov, Yu. V.

    2013-02-01

    The optical absorption spectra of water silica sols containing nanoparticles (NPs) of metals (Ag, Pd, Fe, and Pt) are investigated. Silica sols are obtained from natural hydrothermal solutions via membrane concentration (ultrafiltration). Water sols of silica with specific sizes, pH values, ζ potentials of SiO2 NP surfaces, and low concentrations of SiO2 NPs are used. Plasmon resonance in optical absorption spectra is used to study the interaction between silica and metal NPs. Parameters of plasmon resonance (position, height, and half-width of optical absorption bands), from which the degree of interaction is assessed, are determined. Relationships between the optical properties of the surfaces of nanoparticle-size silica particles, the method of their production, and the effect of adsorbed metal particles on these properties are established.

  19. Composite Silica Aerogels Opacified with Titania

    NASA Technical Reports Server (NTRS)

    Paik, Jon-Ah; Sakamoto, Jeffrey; Jones, Steven; Fleurial, Jean-Pierre; DiStefano, Salvador; Nesmith, Bill

    2009-01-01

    A further improvement has been made to reduce the high-temperature thermal conductivities of the aerogel-matrix composite materials described in Improved Silica Aerogel Composite Materials (NPO-44287), NASA Tech Briefs, Vol. 32, No. 9 (September 2008), page 50. Because the contribution of infrared radiation to heat transfer increases sharply with temperature, the effective high-temperature thermal conductivity of a thermal-insulation material can be reduced by opacifying the material to reduce the radiative contribution. Therefore, the essence of the present improvement is to add an opacifying constituent material (specifically, TiO2 powder) to the aerogel-matrix composites.

  20. NIR fluorescent silica nanoparticles as reporting labels in bioanalytical applications

    NASA Astrophysics Data System (ADS)

    Patonay, Gabor; Henary, Maged; Chapman, Gala; Emer, Kyle; Crow, Sydney

    2015-03-01

    The use of the NIR spectral region (650-900 nm) for bioanalytical and biomedical analyses is advantageous due to the inherently lower background interference in biological matrices and the high molar absorptivities of NIR chromophores. There are several different groups of NIR fluorescing dye are available for bioanalytical applications. One of these groups, NIR carbocyanines are increasingly used in analytical, bioanalytical and medical applications. These dyes can be used as reporter labels for sensitive bioanalytical use, such as immunochemistry. Due to the spectroscopic sensitivity of NIR carbocyanines for polarity changes in the microenvironment fluorescence quantum yield can vary significantly dependent on the microenvironment. NIR dyes can have relatively low fluorescent quantum yields as compared to visible fluorophores, especially in aqueous buffers but the lower quantum yield is compensated for by a much higher molar absorptivity. The fluorescence intensity of NIR reporting labels can significantly be increased by enclosing several dye molecules in silica nanoparticles. Incorporation of NIR dyes in silica nanoparticles creates a unique challenge as these dyes can be unstable under certain chemical conditions present during silica nanoparticles syntheses. In addition, self quenching may also become a problem for carbocyanines at higher a concentrations that typically found inside of NIR dye loaded silica nanoparticles. Dyes possessing high Stokes' shift can significantly reduce this problem. NIR carbocyanines are uniquely positioned for achieving this goal using a synthetic route that substitutes meso position halogens in NIR fluorescent carbocyanines with a linker containing amino moiety, which can also serve as a linker for covalently attaching the dye molecule to the nanoparticle backbone. The resulting silica nanoparticles can contain a large number of NIR dyes dependent on their size. For example some NIR fluorescent silica nanoparticle labels

  1. Protein adsorption enhanced radio-frequency heating of silica nanoparticles

    PubMed Central

    Wosik, Jarek; Pande, Rohit; Xie, Leiming; Ketharnath, Dhivya; Srinivasan, Srimeenakshi; Godin, Biana

    2013-01-01

    Measurements of specific-absorption-rate (SAR) of silica 30, 50, and 100 nm nanoparticles (NP) suspended in water were carried out at 30 MHz in 7 kV/m radio-frequency (rf) electric field. Size dependent, NP-suspension interface related heating of silica NP was observed. To investigate a possible mechanism of heating, bovine serum albumin was adsorbed on the surface of silica NPs in suspension. It resulted in significant enhancement of SAR when compared to bare silica NPs. A calorimetric and rf loss model was used to calculate effective conductivity of silica NP with/without adsorbed albumin as a function of silica size and albumin concentration. PMID:23964135

  2. Surfactant-free small Ni nanoparticles trapped on silica nanoparticles prepared by pulsed laser ablation in liquid

    NASA Astrophysics Data System (ADS)

    Mafuné, Fumitaka; Okamoto, Takumi; Ito, Miho

    2014-01-01

    Small Ni nanoparticles supported on silica nanoparticles were formed by pulsed laser ablation in liquid. Water dispersing surfactant-free silica particles was used here as a solvent, and a bulk Ni metal plate as a target. The nanoparticles formed by laser ablation in water were readily stabilized by the silica particles, whereas Ni nanoparticles prepared in water without silica were found to be precipitated a few hours after aggregation into 5-30 nm particles. The nanoparticles were characterized by TEM, dark-field STEM and optical absorption spectroscopy, which indicated that small 1-3 nm Ni nanoparticles were adsorbed on the surface of silica.

  3. Characterization of Electret Based on Inorganic-organic Nanocomposite Using Fluoropolymer and Silica Nanoparticles

    NASA Astrophysics Data System (ADS)

    Suzuki, M.; Shimokizaki, M.; Takahashi, T.; Yoshikawa, Y.; Aoyagi, S.

    2015-12-01

    An A novel electret based on inorganic-organic nano composite using fluoropolymer and silica nanoparticles was developed in this study. CYTOP® is used to fabricate the nanocomposite electret, which is one of fluoropolymer. Three kinds of silica nanoparticles dispersed in methyl ethyl ketone were employed. Each type of nanoparticles was mixed in the CYTOP or stuck between three layers of CYTOP. Then, negative charge was implanted by corona discharge method. The initial surface potential of the nanocomposite electret was higher than that of a control electret made of pure CYTOP. Additionally, time stability of those was also better than that of control electret. However, above mentioned properties of the mix-typed electret was worse than that of stuck-typed electret, because of discharging through aggregates composed of the nanoparticles.

  4. Memory effect in composites of liquid crystal and silica aerosil

    SciTech Connect

    Relaix, Sabrina; Leheny, Robert L.; Reven, Linda; Sutton, Mark

    2012-02-07

    Aerosil silica nanoparticles dispersed in a liquid crystal (LC) possess the interesting property of keeping memory of an electric- or magnetic-field-induced orientation. Two types of memory have been identified: thermally erasable memory arising from the pinning of defect lines versus a 'permanent' memory where the orientation persists even after thermal cycling the samples up to the isotropic phase. To address the source of the latter type of memory, solid-state nuclear magnetic resonance spectroscopy and conventional x-ray diffraction (XRD) were first combined to characterize the LC orientational order as a function of multiple in-field temperature cycles. Microbeam XRD was then performed on aligned gels of different concentrations to gain knowledge of the structural properties at the origin of the memory effect. No detectable anisotropy of the gel or significant breaking of silica strands with heating ruled out the formation of an anisotropic silica network as the source of the permanent memory as previously proposed. Instead, support for a role of the surface memory effect, well known for planar substrates, in stabilizing the permanent memory was deduced from 'training' of the composites, that is, optimizing the orientational order through the thermal in-field cycling. The ability to train the composites is inversely proportional to the strength of the random-field disorder. The portion of thermally erasable memory also decreases as the silica density increases. We propose that the permanent memory originates from the surface memory effect operating at points of intersection in the silica network. These areas, where the LC is strongly confined with conflicted surface interactions, are trained to achieve an optimized orientation and subsequently act as sites from which the LC orientational order regrows after zero-field thermal cycling up to the isotropic phase.

  5. Morphology controlling method for amorphous silica nanoparticles and jellyfish-like nanowires and their luminescence properties

    NASA Astrophysics Data System (ADS)

    Liu, Haitao; Huang, Zhaohui; Huang, Juntong; Xu, Song; Fang, Minghao; Liu, Yan-Gai; Wu, Xiaowen; Zhang, Shaowei

    2016-03-01

    Uniform silica nanoparticles and jellyfish-like nanowires were synthesized by a chemical vapour deposition method on Si substrates treated without and with Ni(NO3)2, using silicon powder as the source material. Composition and structural characterization using field emission scanning electron microscopy, transmission electron microscopy, energy dispersive X-ray spectroscopy and fourier-transform infrared spectroscopy showed that the as-prepared products were silica nanoparticles and nanowires which have amorphous structures. The form of nanoparticles should be related to gas-phase nucleation procedure. The growth of the nanowires was in accordance with vapour-liquid-solid mechanism, followed by Ostwald ripening to form the jellyfish-like morphology. Photoluminescence and cathodoluminescence measurements showed that the silica products excited by different light sources show different luminescence properties. The emission spectra of both silica nanoparticles and nanowires are due to the neutral oxygen vacancies (≡Si-Si≡). The as-synthesized silica with controlled morphology can find potential applications in future nanodevices with tailorable photoelectric properties.

  6. Effect of Silica Nanoparticles on the Photoluminescence Properties of BCNO Phosphor

    NASA Astrophysics Data System (ADS)

    Nuryadin, Bebeh W.; Faryuni, Irfana Diah; Iskandar, Ferry; Abdullah, Mikrajuddin; Khairurrijal, Khairurrijal

    2011-12-01

    Effect of additional silica nanoparticles on the photoluminescence (PL) performance of boron carbon oxy-nitride (BCNO) phosphor was investigated. As a precursor, boric acid and urea were used as boron and nitrogen sources, respectively. The carbon sources was polyethylene glycol (PEG) with average molecule weight 20000 g/mol.. Precursor solutions were prepared by mixing these raw materials in pure water, followed by stirring to achieve homogeneous solutions. In this precursor, silica nanoparticles were added at various mass ratio from 0 to 7 %wt in the solution. The precursors were then heated at 750 °C for 60 min in a ceramic crucible under atmospheric pressure. The photoluminescence (PL) spectrum that characterized by spectrophotometer showed a single, distinct, and broad emission band varied from blue to near red color, depend on the PEG, boric acid and urea ratio in the precursor. The addition of silica nanoparticles caused the increasing of PL intensity as well as the shifting of peak wavelength of PL spectrum. The peak shifting of PL was affected by the concentration of silica nanoparticles that added into the precursor. We believe that the BCNO-silica composite phosphor becomes a promising material for the phosphor conversion-based white light-emitting diodes.

  7. Morphology controlling method for amorphous silica nanoparticles and jellyfish-like nanowires and their luminescence properties.

    PubMed

    Liu, Haitao; Huang, Zhaohui; Huang, Juntong; Xu, Song; Fang, Minghao; Liu, Yan-Gai; Wu, Xiaowen; Zhang, Shaowei

    2016-01-01

    Uniform silica nanoparticles and jellyfish-like nanowires were synthesized by a chemical vapour deposition method on Si substrates treated without and with Ni(NO3)2, using silicon powder as the source material. Composition and structural characterization using field emission scanning electron microscopy, transmission electron microscopy, energy dispersive X-ray spectroscopy and fourier-transform infrared spectroscopy showed that the as-prepared products were silica nanoparticles and nanowires which have amorphous structures. The form of nanoparticles should be related to gas-phase nucleation procedure. The growth of the nanowires was in accordance with vapour-liquid-solid mechanism, followed by Ostwald ripening to form the jellyfish-like morphology. Photoluminescence and cathodoluminescence measurements showed that the silica products excited by different light sources show different luminescence properties. The emission spectra of both silica nanoparticles and nanowires are due to the neutral oxygen vacancies (≡Si-Si≡). The as-synthesized silica with controlled morphology can find potential applications in future nanodevices with tailorable photoelectric properties. PMID:26940294

  8. Morphology controlling method for amorphous silica nanoparticles and jellyfish-like nanowires and their luminescence properties

    PubMed Central

    Liu, Haitao; Huang, Zhaohui; Huang, Juntong; Xu, Song; Fang, Minghao; Liu, Yan-gai; Wu, Xiaowen; Zhang, Shaowei

    2016-01-01

    Uniform silica nanoparticles and jellyfish-like nanowires were synthesized by a chemical vapour deposition method on Si substrates treated without and with Ni(NO3)2, using silicon powder as the source material. Composition and structural characterization using field emission scanning electron microscopy, transmission electron microscopy, energy dispersive X-ray spectroscopy and fourier-transform infrared spectroscopy showed that the as-prepared products were silica nanoparticles and nanowires which have amorphous structures. The form of nanoparticles should be related to gas-phase nucleation procedure. The growth of the nanowires was in accordance with vapour-liquid-solid mechanism, followed by Ostwald ripening to form the jellyfish-like morphology. Photoluminescence and cathodoluminescence measurements showed that the silica products excited by different light sources show different luminescence properties. The emission spectra of both silica nanoparticles and nanowires are due to the neutral oxygen vacancies (≡Si-Si≡). The as-synthesized silica with controlled morphology can find potential applications in future nanodevices with tailorable photoelectric properties. PMID:26940294

  9. Surface treatment of silica nanoparticles for stable and charge-controlled colloidal silica

    PubMed Central

    Kim, Kyoung-Min; Kim, Hye Min; Lee, Won-Jae; Lee, Chang-Woo; Kim, Tae-il; Lee, Jong-Kwon; Jeong, Jayoung; Paek, Seung-Min; Oh, Jae-Min

    2014-01-01

    An attempt was made to control the surface charge of colloidal silica nanoparticles with 20 nm and 100 nm diameters. Untreated silica nanoparticles were determined to be highly negatively charged and have stable hydrodynamic sizes in a wide pH range. To change the surface to a positively charged form, various coating agents, such as amine containing molecules, multivalent metal cation, or amino acids, were used to treat the colloidal silica nanoparticles. Molecules with chelating amine sites were determined to have high affinity with the silica surface to make agglomerations or gel-like networks. Amino acid coatings resulted in relatively stable silica colloids with a modified surface charge. Three amino acid moiety coatings (L-serine, L-histidine, and L-arginine) exhibited surface charge modifying efficacy of L-histidine > L-arginine > L-serine and hydrodynamic size preservation efficacy of L-serine > L-arginine > L-histidine. The time dependent change in L-arginine coated colloidal silica was investigated by measuring the pattern of the backscattered light in a Turbiscan™. The results indicated that both the 20 nm and 100 nm L-arginine coated silica samples were fairly stable in terms of colloidal homogeneity, showing only slight coalescence and sedimentation. PMID:25565824

  10. Synthesis of internally functionalized silica nanoparticles for theranostic applications

    NASA Astrophysics Data System (ADS)

    Walton, Nathan Isaac

    This thesis addresses the synthesis and characterization of novel inorganic silica nanoparticle hybrids. It focuses in large part on their potential applications in the medical field. Silica acts as a useful carrier for a variety of compounds and this thesis silica will demonstrate its use as a carrier for boron or gadolinium. Boron-10 and gadolinium-157 have been suggested for the radiological treatment of tumor cells through the process called neutron capture therapy (NCT). Gadolinium is also commonly used as a Magnetic Resonance Imaging (MRI) contrast agent. Particles that carry it have potential theranostic applications of both imaging and treating tumors. Chapter 1 presents a background on synthetic strategies and usages of silica nanoparticles, and NCT theory. Chapter 2 describes a procedure to create mesoporous metal chelating silica nanoparticles, mDTTA. This is achieved via a co-condensation of tetraethoxysilane (TEOS) and 3-trimethoxysilyl-propyl diethylenetriamine (SiDETA) followed by a post-synthesis modification step with bromoacetic acid (BrAA). These particles have a large surface area and well-defined pores of ~2 nm. The mDTTA nanoparticles were used to chelate the copper(II), cobalt(II) and gadolinium(III). The chelating of gadolinium is the most interesting since it can be used as a MRI contrast agent and a neutron capture therapeutic. The synthetic procedure developed also allows for the attachment of a fluorophore that gives the gadolinium chelating mDTTA nanoparticles a dual imaging modality. Chapter 3 presents the synthetic method used to produce two classes of large surface area organically modified silica (ORMOSIL) nanoparticles. Condensating the organosilane vinyltrimethoxysilane in a micellar solution results in nanoparticles that are either surface rough (raspberry-like) or mesoporous nanoparticles, which prior to this thesis has not been demonstrated in ORMOSIL chemistry. Furthermore, the vinyl functionalities are modified, using

  11. Multifunctional clickable and protein-repellent magnetic silica nanoparticles

    NASA Astrophysics Data System (ADS)

    Estupiñán, Diego; Bannwarth, Markus B.; Mylon, Steven E.; Landfester, Katharina; Muñoz-Espí, Rafael; Crespy, Daniel

    2016-01-01

    Silica nanoparticles are versatile materials whose physicochemical surface properties can be precisely adjusted. Because it is possible to combine several functionalities in a single carrier, silica-based materials are excellent candidates for biomedical applications. However, the functionality of the nanoparticles can get lost upon exposure to biological media due to uncontrolled biomolecule adsorption. Therefore, it is important to develop strategies that reduce non-specific protein-particle interactions without losing the introduced surface functionality. Herein, organosilane chemistry is employed to produce magnetic silica nanoparticles bearing differing amounts of amino and alkene functional groups on their surface as orthogonally addressable chemical functionalities. Simultaneously, a short-chain zwitterion is added to decrease the non-specific adsorption of biomolecules on the nanoparticles surface. The multifunctional particles display reduced protein adsorption after incubation in undiluted fetal bovine serum as well as in single protein solutions (serum albumin and lysozyme). Besides, the particles retain their capacity to selectively react with biomolecules. Thus, they can be covalently bio-functionalized with an antibody by means of orthogonal click reactions. These features make the described multifunctional silica nanoparticles a promising system for the study of surface interactions with biomolecules, targeting, and bio-sensing.Silica nanoparticles are versatile materials whose physicochemical surface properties can be precisely adjusted. Because it is possible to combine several functionalities in a single carrier, silica-based materials are excellent candidates for biomedical applications. However, the functionality of the nanoparticles can get lost upon exposure to biological media due to uncontrolled biomolecule adsorption. Therefore, it is important to develop strategies that reduce non-specific protein-particle interactions without losing the

  12. Mesoporous silica nanoparticles for biomedical and catalytical applications

    SciTech Connect

    Sun, Xiaoxing

    2011-01-01

    Mesoporous silica materials, discovered in 1992 by the Mobile Oil Corporation, have received considerable attention in the chemical industry due to their superior textual properties such as high surface area, large pore volume, tunable pore diameter, and narrow pore size distribution. Among those materials, MCM-41, referred to Mobile Composition of Matter NO. 41, contains honeycomb liked porous structure that is the most common mesoporous molecular sieve studied. Applications of MCM-41 type mesoporous silica material in biomedical field as well as catalytical field have been developed and discussed in this thesis. The unique features of mesoporous silica nanoparticles were utilized for the design of delivery system for multiple biomolecules as described in chapter 2. We loaded luciferin into the hexagonal channels of MSN and capped the pore ends with gold nanoparticles to prevent premature release. Luciferase was adsorbed onto the outer surface of the MSN. Both the MSN and the gold nanoparticles were protected by poly-ethylene glycol to minimize nonspecific interaction of luciferase and keep it from denaturating. Controlled release of luciferin was triggered within the cells and the enzymatic reaction was detected by a luminometer. Further developments by varying enzyme/substrate pairs may provide opportunities to control cell behavior and manipulate intracellular reactions. MSN was also served as a noble metal catalyst support due to its large surface area and its stability with active metals. We prepared MSN with pore diameter of 10 nm (LP10-MSN) which can facilitate mass transfer. And we successfully synthesized an organo silane, 2,2'-Bipyridine-amide-triethoxylsilane (Bpy-amide-TES). Then we were able to functionalize LP10-MSN with bipyridinyl group by both post-grafting method and co-condensation method. Future research of this material would be platinum complexation. This Pt (II) complex catalyst has been reported for a C-H bond activation reaction as an

  13. Robust antireflection coatings By UV cross-linking of silica nanoparticles and diazo-resin polycation

    NASA Astrophysics Data System (ADS)

    Ridley, Jason I.; Heflin, James R.; Ritter, Alfred L.

    2007-09-01

    Antireflection coatings have been fabricated by self-assembly using silica nanoparticles. The ionic self-assembled multilayer (ISAM) films are tightly packed and homogeneous. While the geometric properties of a matrix of spherical particles with corresponding void interstices are highly suitable to meet the conditions for minimal reflectivity, it is also a cause for the lack of cohesion within the constituent body, as well as to the substrate surface. This study investigates methods for improving the interconnectivity of the nanoparticle structure. One such method involves UV curing of diazo-resin (DAR)/silica nanoparticle films, thereby converting the ionic interaction into a stronger covalent bond. Factorial analysis and response surface methods are incorporated to determine factors that affect film properties, and to optimize their optical and adhesive capabilities. The second study looks at the adhesive strength of composite multilayer films. Films are fabricated with silica nanoparticles and poly(allylamine hydrochloride) (PAH), and dipped into aqueous solutions of PAH and poly(methacrylic acid, sodium salt) (PMA) to improve cohesion of silica nanoparticles in the matrix, as well as binding strength to the substrate surface. The results of the two studies are discussed.

  14. Improved Silica Aerogel Composite Materials

    NASA Technical Reports Server (NTRS)

    Paik, Jong-Ah; Sakamoto, Jeffrey; Jones, Steven

    2008-01-01

    A family of aerogel-matrix composite materials having thermal-stability and mechanical- integrity properties better than those of neat aerogels has been developed. Aerogels are known to be excellent thermal- and acoustic-insulation materials because of their molecular-scale porosity, but heretofore, the use of aerogels has been inhibited by two factors: (1) Their brittleness makes processing and handling difficult. (2) They shrink during production and shrink more when heated to high temperatures during use. The shrinkage and the consequent cracking make it difficult to use them to encapsulate objects in thermal-insulation materials. The underlying concept of aerogel-matrix composites is not new; the novelty of the present family of materials lies in formulations and processes that result in superior properties, which include (1) much less shrinkage during a supercritical-drying process employed in producing a typical aerogel, (2) much less shrinkage during exposure to high temperatures, and (3) as a result of the reduction in shrinkage, much less or even no cracking.

  15. Magnetic solid phase adsorption, preconcentration and determination of methyl orange in water samples using silica coated magnetic nanoparticles and central composite design

    NASA Astrophysics Data System (ADS)

    Shariati-Rad, Masoud; Irandoust, Mohsen; Amri, Somayyeh; Feyzi, Mostafa; Ja'fari, Fattaneh

    2014-10-01

    This work evaluates the efficiency of SiO2-coated Fe3O4 magnetic nanoparticles (SMNPs) for adsorption of methyl orange (MO). Adsorption of MO on the studied nanoparticle was developed for removal, preconcentration and spectrophotometric determination of trace amounts of it. To find the optimum adsorption conditions, the influence of pH, dosage of the adsorbent and contact time was explored by central composite design. In pH 2.66, with 10.0 mg of the SMNPs and time of 30.0 min, the maximum adsorption of MO was obtained. The experimental adsorption data were analyzed by the Langmuir and Freundlich adsorption isotherms. Both models were fitted to the equilibrium data and the maximum monolayer capacity q max of 53.19 mg g-1 was obtained for MO. Moreover, the sorption kinetics was fitted well to the pseudo-second-order rate equation model. The results showed that desorption efficiencies higher than 99 % can be achieved in a short contact time and in one step elution by 2.0 mL of 0.1 mol L-1 NaOH. The SMNPs were washed with deionized water and reused for two successive removal processes with removal efficiencies more than 90 %. The calibration curve was linear in the range of 10.0-120.0 ng mL-1 for MO. A preconcentration factor of about 45 % was achieved by the method.

  16. Silica-based mesoporous nanoparticles for controlled drug delivery.

    PubMed

    Kwon, Sooyeon; Singh, Rajendra K; Perez, Roman A; Abou Neel, Ensanya A; Kim, Hae-Won; Chrzanowski, Wojciech

    2013-01-01

    Drug molecules with lack of specificity and solubility lead patients to take high doses of the drug to achieve sufficient therapeutic effects. This is a leading cause of adverse drug reactions, particularly for drugs with narrow therapeutic window or cytotoxic chemotherapeutics. To address these problems, there are various functional biocompatible drug carriers available in the market, which can deliver therapeutic agents to the target site in a controlled manner. Among the carriers developed thus far, mesoporous materials emerged as a promising candidate that can deliver a variety of drug molecules in a controllable and sustainable manner. In particular, mesoporous silica nanoparticles are widely used as a delivery reagent because silica possesses favourable chemical properties, thermal stability and biocompatibility. Currently, sol-gel-derived mesoporous silica nanoparticles in soft conditions are of main interest due to simplicity in production and modification and the capacity to maintain function of bioactive agents. The unique mesoporous structure of silica facilitates effective loading of drugs and their subsequent controlled release. The properties of mesopores, including pore size and porosity as well as the surface properties, can be altered depending on additives used to fabricate mesoporous silica nanoparticles. Active surface enables functionalisation to modify surface properties and link therapeutic molecules. The tuneable mesopore structure and modifiable surface of mesoporous silica nanoparticle allow incorporation of various classes of drug molecules and controlled delivery to the target sites. This review aims to present the state of knowledge of currently available drug delivery system and identify properties of an ideal drug carrier for specific application, focusing on mesoporous silica nanoparticles. PMID:24020012

  17. Silica-based mesoporous nanoparticles for controlled drug delivery

    PubMed Central

    Kwon, Sooyeon; Singh, Rajendra K; Perez, Roman A; Abou Neel, Ensanya A

    2013-01-01

    Drug molecules with lack of specificity and solubility lead patients to take high doses of the drug to achieve sufficient therapeutic effects. This is a leading cause of adverse drug reactions, particularly for drugs with narrow therapeutic window or cytotoxic chemotherapeutics. To address these problems, there are various functional biocompatible drug carriers available in the market, which can deliver therapeutic agents to the target site in a controlled manner. Among the carriers developed thus far, mesoporous materials emerged as a promising candidate that can deliver a variety of drug molecules in a controllable and sustainable manner. In particular, mesoporous silica nanoparticles are widely used as a delivery reagent because silica possesses favourable chemical properties, thermal stability and biocompatibility. Currently, sol-gel-derived mesoporous silica nanoparticles in soft conditions are of main interest due to simplicity in production and modification and the capacity to maintain function of bioactive agents. The unique mesoporous structure of silica facilitates effective loading of drugs and their subsequent controlled release. The properties of mesopores, including pore size and porosity as well as the surface properties, can be altered depending on additives used to fabricate mesoporous silica nanoparticles. Active surface enables functionalisation to modify surface properties and link therapeutic molecules. The tuneable mesopore structure and modifiable surface of mesoporous silica nanoparticle allow incorporation of various classes of drug molecules and controlled delivery to the target sites. This review aims to present the state of knowledge of currently available drug delivery system and identify properties of an ideal drug carrier for specific application, focusing on mesoporous silica nanoparticles. PMID:24020012

  18. Incorporation of Ln-Doped LaPO4 Nanocrystals as Luminescent Markers in Silica Nanoparticles

    NASA Astrophysics Data System (ADS)

    van Hest, Jacobine J. H. A.; Blab, Gerhard A.; Gerritsen, Hans C.; Donega, Celso de Mello; Meijerink, Andries

    2016-05-01

    Lanthanide ions are promising for the labeling of silica nanoparticles with a specific luminescent fingerprint due to their sharp line emission at characteristic wavelengths. With the increasing use of silica nanoparticles in consumer products, it is important to label silica nanoparticles in order to trace the biodistribution, both in the environment and living organisms.

  19. Controlling stability of gold nanoparticles in mesoporous silica

    NASA Astrophysics Data System (ADS)

    Bore, Mangesh Tukaram

    Metal particles deposited on oxide supports are used extensively as heterogeneous catalysts. By using a suitable combination of active metal phases and supports, the catalysts are designed for high activity, selectivity and mechanical strength. However, catalysts undergo deactivation, with poisoning, fouling, sintering and volatilization being some of the common reasons for loss of catalyst activity. For supported metal catalysts, sintering of metal particles is a major cause of catalyst deactivation. The rate and extent of sintering of supported metals depends upon temperature, atmosphere, support, promoter and metal. It is known that gold nanoparticles show high reactivity for CO oxidation at low temperature, but only when the Au particles are very small (<5 nm). Gold nanoparticles supported on silica show rapid sintering at 200°C--400°C. Porosity of support could play an important role in controlling the sintering of metal particles. But the role of pore size, pore curvature and structure is difficult to study with conventional supported metal catalysts. Surfactant templated mesoporous silica is a promising support material since it provides well defined pores of uniform size and structure. Hence, these silica supports provide ideal model systems for control of nanoparticle sintering. Limitations of mesoporous silica are its low hydrothermal stability at elevated temperatures and its inert nature. The pores of mesoporous silica reportedly collapse at temperatures above 500°C and gold nanoparticles supported on reducible oxides such as TiO2, CO3O4 and Fe2O 3 are more active compared to pure silica for CO oxidation. In this work highly dispersed gold nanoparticles (<2 nm) were prepared within the pores of silica with pore sizes ranging from 2.2 nm to 6.5 nm and differing pore architecture (2D-hexagonal, 3D-hexagonal, cubic and pores coiled-up in spherical geometry). In the 2D-hexagonal pore structure, the pores are one dimensional and terminate on the particle

  20. Direct formation of S-nitroso silica nanoparticles from a single silica source.

    PubMed

    Chou, Hung-Chang; Chiu, Shih-Jiuan; Liu, Ying-Ling; Hu, Teh-Min

    2014-01-28

    Nitric oxide (NO) is a ubiquitous molecule in the body. Because of its multiple pathophysiologic roles, the potential for treating various diseases by the exogenous administration of NO has been under intensive investigation. However, the unstable, radical nature of NO poses a major challenge to the effective delivery of NO. Previously, silica nanoparticles synthesized by the traditional method have been developed into NO-carrying systems. In the present study, for the first time NO-carrying silica nanoparticles were prepared from a single silica precursor using a simple nanoprecipitation method. (3-Mercaptopropyl)-trimethoxysilane (MPTMS) was used as the sole silane source, which was subjected to acid-catalyzed S-nitrosation and condensation reactions in a one-pot organic phase. S-Nitroso silica nanoparticles (SNO-SiNPs) were then produced by injecting a smaller quantity of the organic phase into a larger amount of water without surfactants. Various preparation parameters were tested to obtain optimized conditions. Moreover, a phase diagram demonstrating the ouzo effect was constructed. The prepared SNO-SiNPs were spherical particles with a tunable size in the range of 100-400 nm. The nanoparticles in aqueous dispersions exhibited high colloid stability, possibly resulting from highly negatively charged surfaces. The result of solid-state (29)Si NMR shows the predominance of T(2) and T(3) silicon structures, suggesting that nanoparticles were formed from polycondensed silica species. In conclusion, NO-loaded silica nanoparticles have been directly prepared from a single silane precursor using a surfactant-free, low-energy, one-step nanoprecipitation approach. The method precludes the need for the initial formation of bare particles and subsequent functionalization steps. PMID:24410024

  1. Silicalites and Mesoporous Silica Nanoparticles for photodynamic therapy.

    PubMed

    Hocine, Ouahiba; Gary-Bobo, Magali; Brevet, David; Maynadier, Marie; Fontanel, Simon; Raehm, Laurence; Richeter, Sébastien; Loock, Bernard; Couleaud, Pierre; Frochot, Céline; Charnay, Clarence; Derrien, Gaëlle; Smaïhi, Monique; Sahmoune, Amar; Morère, Alain; Maillard, Philippe; Garcia, Marcel; Durand, Jean-Olivier

    2010-12-15

    The synthesis of silicalites and Mesoporous Silica Nanoparticles (MSN), which covalently incorporate original water-soluble photosensitizers for PDT applications is described. PDT was performed on MDA-MB-231 breast cancer cells. All the nanoparticles showed significant cell death after irradiation, which was not correlated with (1)O(2) quantum yield of the nanoparticles. Other parameters are involved and in particular the surface and shape of the nanoparticles which influence the pathway of endocytosis. Functionalization with mannose was necessary to obtain the best results with PDT due to an active endocytosis of mannose-functionalized nanoparticles. The quantity of mannose on the surface should be carefully adjusted as a too high amount of mannose impairs the phototoxicity of the nanoparticles. Fluorescein was also encapsulated in MCM-41 type MSN in order to localize the nanoparticles in the organelles of the cells by confocal microscopy. The MSN were localized in lysosomes after active endocytosis by mannose receptors. PMID:20934496

  2. Mesoporous silica nanoparticles deliver DNA and chemicals into plants

    NASA Astrophysics Data System (ADS)

    Torney, François; Trewyn, Brian G.; Lin, Victor S.-Y.; Wang, Kan

    2007-05-01

    Surface-functionalized silica nanoparticles can deliver DNA and drugs into animal cells and tissues. However, their use in plants is limited by the cell wall present in plant cells. Here we show a honeycomb mesoporous silica nanoparticle (MSN) system with 3-nm pores that can transport DNA and chemicals into isolated plant cells and intact leaves. We loaded the MSN with the gene and its chemical inducer and capped the ends with gold nanoparticles to keep the molecules from leaching out. Uncapping the gold nanoparticles released the chemicals and triggered gene expression in the plants under controlled-release conditions. Further developments such as pore enlargement and multifunctionalization of these MSNs may offer new possibilities in target-specific delivery of proteins, nucleotides and chemicals in plant biotechnology.

  3. Surfactant templating effects on the encapsulation of iron oxide nanoparticles within silica microspheres.

    PubMed

    Zheng, Tonghua; Pang, Jiebin; Tan, Grace; He, Jibao; McPherson, Gary L; Lu, Yunfeng; John, Vijay T; Zhan, Jingjing

    2007-04-24

    Hollow silica microspheres encapsulating ferromagnetic iron oxide nanoparticles were synthesized by a surfactant-aided aerosol process and subsequent treatment. The cationic surfactant cetyltrimethyl ammonium bromide (CTAB) played an essential role in directing the structure of the composite. Translation from mesoporous silica particles to hollow particles was a consequence of increased loading of ferric species in the precursor solution and the competitive partitioning of CTAB between silicate and ferric colloids. The hypothesis was that CTAB preferentially adsorbed onto more positively charged ferric colloids under acidic conditions. At a critical Fe/Si ratio, most of the CTAB was adsorbed onto ferric colloids and coagulated the colloids to form larger clusters. During the aerosol process, a silica shell was first formed due to the preferred silicate condensation on the gas-liquid interface of the aerosol droplet. Subsequent drying concentrated the ferric clusters inside the silica shell and resulted in a silica shell/ferric core particle. Thermal treatment of the core shell particle led to encapsulation of a single iron oxide nanoparticle inside each silica hollow microsphere. PMID:17397201

  4. Acetylcholinesterase immobilized onto PEI-coated silica nanoparticles.

    PubMed

    Tumturk, Hayrettin; Yüksekdag, Hazer

    2016-01-01

    Polyethyleneimine (PEI) coated-silica nanoparticles were prepared by the Stöber method. The formation and the structure of the nanoparticles were characterized by ATR-FT-IR spectroscopy and transmission electron microscopy (TEM). TEM images of the silica and PEI-coated nanoparticles revealed that they were well dispersed and that there was no agglomeration. The acetylcholineesterase enzyme was immobilized onto these nanoparticles. The effects of pH and temperature on the storage stability of the free and immobilized enzyme were investigated. The optimum pHs for free and immobilized enzymes were determined as 7.0 and 8.0, respectively. The optimum temperatures for free and immobilized enzymes were found to be 30.0 and 35.0°C, respectively. The maximum reaction rate (Vmax) and the Michaelis-Menten constant (Km) were investigated for the free and immobilized enzyme. The storage stability of acetylcholinesterase was increased when immobilized onto the novel PEI-coated silica nanoparticles. The reuse numbers of immobilized enzyme were also studied. These hybrid nanoparticles are desirable as carriers for biomedical applications. PMID:25365355

  5. A novel solid-state electrochemiluminescence sensor for the determination of hydrogen peroxide based on an Au nanocluster-silica nanoparticle nanocomposite.

    PubMed

    Wu, Yanfang; Huang, Jinhua; Zhou, Tingyao; Rong, Mingcong; Jiang, Yaqi; Chen, Xi

    2013-10-01

    A gold nanocluster@bovine serum albumin-silica nanoparticle composite has been synthesized and used for the solid-state electrochemiluminescence (ECL) sensing of hydrogen peroxide. The ECL characteristics have also been studied. PMID:23938445

  6. Interaction of surface-modified silica nanoparticles with clay minerals

    NASA Astrophysics Data System (ADS)

    Omurlu, Cigdem; Pham, H.; Nguyen, Q. P.

    2016-05-01

    In this study, the adsorption of 5-nm silica nanoparticles onto montmorillonite and illite is investigated. The effect of surface functionalization was evaluated for four different surfaces: unmodified, surface-modified with anionic (sulfonate), cationic (quaternary ammonium (quat)), and nonionic (polyethylene glycol (PEG)) surfactant. We employed ultraviolet-visible spectroscopy to determine the concentration of adsorbed nanoparticles in conditions that are likely to be found in subsurface reservoir environments. PEG-coated and quat/PEG-coated silica nanoparticles were found to significantly adsorb onto the clay surfaces, and the effects of electrolyte type (NaCl, KCl) and concentration, nanoparticle concentration, pH, temperature, and clay type on PEG-coated nanoparticle adsorption were studied. The type and concentration of electrolytes were found to influence the degree of adsorption, suggesting a relationship between the interlayer spacing of the clay and the adsorption ability of the nanoparticles. Under the experimental conditions reported in this paper, the isotherms for nanoparticle adsorption onto montmorillonite at 25 °C indicate that adsorption occurs less readily as the nanoparticle concentration increases.

  7. Fibrous composites comprising carbon nanotubes and silica

    DOEpatents

    Peng, Huisheng; Zhu, Yuntian Theodore; Peterson, Dean E.; Jia, Quanxi

    2011-10-11

    Fibrous composite comprising a plurality of carbon nanotubes; and a silica-containing moiety having one of the structures: (SiO).sub.3Si--(CH.sub.2).sub.n--NR.sub.1R.sub.2) or (SiO).sub.3Si--(CH.sub.2).sub.n--NCO; where n is from 1 to 6, and R.sub.1 and R.sub.2 are each independently H, CH.sub.3, or C.sub.2H.sub.5.

  8. Core-Shell Composite Nanoparticles: Synthesis, Characterization, and Applications

    NASA Astrophysics Data System (ADS)

    Sanyal, Sriya

    Nanoparticles are ubiquitous in various fields due to their unique properties not seen in similar bulk materials. Among them, core-shell composite nanoparticles are an important class of materials which are attractive for their applications in catalysis, sensing, electromagnetic shielding, drug delivery, and environmental remediation. This dissertation focuses on the study of core-shell type of nanoparticles where a polymer serves as the core and inorganic nanoparticles are the shell. This is an interesting class of supramolecular building blocks and can "exhibit unusual, possibly unique, properties which cannot be obtained simply by co-mixing polymer and inorganic particles". The one-step Pickering emulsion polymerization method was successfully developed and applied to synthesize polystyrene-silica core-shell composite particles. Possible mechanisms of the Pickering emulsion polymerization were also explored. The silica nanoparticles were thermodynamically favorable to self-assemble at liquid-liquid interfaces at the initial stage of polymerization and remained at the interface to finally form the shells of the composite particles. More importantly, Pickering emulsion polymerization was employed to synthesize polystyrene/poly(N-isopropylacrylamide) (PNIPAAm)-silica core-shell nanoparticles with N-isopropylacrylamide incorporated into the core as a co-monomer. The composite nanoparticles were temperature sensitive and could be up-taken by human prostate cancer cells and demonstrated effectiveness in drug delivery and cancer therapy. Similarly, by incorporating poly-2-(N,N)-dimethylamino)ethyl methacrylate (PDMA) into the core, pH sensitive core-shell composite nanoparticles were synthesized and applied as effective carriers to release a rheological modifier upon a pH change. Finally, the research focuses on facile approaches to engineer the transition of the temperature-sensitive particles and develop composite core-shell nanoparticles with a metallic shell.

  9. Hierarchical mesoporous silica nanoparticles as superb light scattering materials.

    PubMed

    Ryu, Jaehoon; Yun, Juyoung; Lee, Jungsup; Lee, Kisu; Jang, Jyongsik

    2016-02-01

    A novel approach to enhance the light scattering effect was explored by applying hierarchical silica nanoparticles in DSSCs as scattering layers. The WSN-incorporated cells showed a PCE value of 9.53% and a PCE enhancement of 30.19% compared with those of the reference cells. PMID:26699659

  10. Thermally Stable Nanocatalyst for High Temperature Reactions: Pt-Mesoporous Silica Core-Shell Nanoparticles

    SciTech Connect

    Joo, Sang Hoon; Park, J.Y.; Tsung, C.-K.; Yamada, Y.; Yang, P.; Somorjai, G.A.

    2008-10-25

    Recent advances in colloidal synthesis enabled the precise control of size, shape and composition of catalytic metal nanoparticles, allowing their use as model catalysts for systematic investigations of the atomic-scale properties affecting catalytic activity and selectivity. The organic capping agents stabilizing colloidal nanoparticles, however, often limit their application in high-temperature catalytic reactions. Here we report the design of a high-temperature stable model catalytic system that consists of Pt metal core coated with a mesoporous silica shell (Pt{at}mSiO{sub 2}). While inorganic silica shells encaged the Pt cores up to 750 C in air, the mesopores directly accessible to Pt cores made the Pt{at}mSiO{sub 2} nanoparticles as catalytically active as bare Pt metal for ethylene hydrogenation and CO oxidation. The high thermal stability of Pt{at}mSiO{sub 2} nanoparticles permitted high-temperature CO oxidation studies, including ignition behavior, which was not possible for bare Pt nanoparticles because of their deformation or aggregation. The results suggest that the Pt{at}mSiO{sub 2} nanoparticles are excellent nanocatalytic systems for high-temperature catalytic reactions or surface chemical processes, and the design concept employed in the Pt{at}mSiO{sub 2} core-shell catalyst can be extended to other metal-metal oxide compositions.

  11. Enhancement of Electrochromic Durability of a Film Made of Silica-Polyaniline Core-Shell Nanoparticles

    NASA Astrophysics Data System (ADS)

    Hwang, Taejin; Lee, Heungyeol; Kim, Hohyeong; Kim, Gyuntak; Mun, Gyeongjin

    Enhancing the operation life time or the electrochemical durability is one of the key issues in electrochromic material studies. It is generally accepted that the inorganic-organic hybrid structure is one of the effective ways to enhance the chemical stability of the material. In this study, an electrochromic film made of silica-polyaniline core-shell composite nanoparticles was tested. The composite particles were prepared through a chemical dispersion polymerization of aniline in an aqueous colloidal solution of silica. The synthesized particles were then dispersed into ethanol and the solution was deposited onto an Indium Tin Oxide (ITO)-coated glass substrate. The electrochromic characterization on the prepared films was performed using the cyclovoltammetry and the optical response to a switching potential. The results showed that the inorganic-organic core-shell hybrid nanoparticle could be a promising choice for the enhancement of electrochromic durability.

  12. Self-Assembled Silica Nano-Composite Polymer Electrolytes: Synthesis, Rheology & Electrochemistry

    SciTech Connect

    Khan, Saad A.: Fedkiw Peter S.; Baker, Gregory L.

    2007-01-24

    The ultimate objectives of this research are to understand the principles underpinning nano-composite polymer electrolytes (CPEs) and facilitate development of novel CPEs that are low-cost, have high conductivities, large Li+ transference numbers, improved electrolyte-electrode interfacial stability, yield long cycle life, exhibit mechanical stability and are easily processable. Our approach is to use nanoparticulate silica fillers to formulate novel composite electrolytes consisting of surface-modified fumed silica nano-particles in polyethylene oxides (PEO) in the presence of lithium salts. We intend to design single-ion conducting silica nanoparticles which provide CPEs with high Li+ transference numbers. We also will develop low-Mw (molecular weight), high-Mw and crosslinked PEO electrolytes with tunable properties in terms of conductivity, transference number, interfacial stability, processability and mechanical strength

  13. Activators generated by electron transfer for atom transfer radical polymerization of styrene in the presence of mesoporous silica nanoparticles

    SciTech Connect

    Khezri, Khezrollah; Roghani-Mamaqani, Hossein

    2014-11-15

    Graphical abstract: Effect of mesoporous silica nanoparticles (MCM-41) on the activator generated by electron transfer for atom transfer radical polymerization (AGET ATRP) is investigated. Decrement of conversion and number average molecular weight and also increment of polydispersity index (PDI) values are three main results of addition of MCM-41 nanoparticles. Incorporation of MCM-41 nanoparticles in the polystyrene matrix can clearly increase thermal stability and decrease glass transition temperature of the nanocomposites. - Highlights: • Spherical morphology, hexagonal structure, and high surface area with regular pore diameters of the synthesized MCM-41 nanoparticles are examined. • AGET ATRP of styrene in the presence of MCM-41 nanoparticles is performed. • Effect of MCM-41 nanoparticles addition on the polymerization rate, conversion and molecular weights of the products are discussed. • Improvement in thermal stability of the nanocomposites and decreasing T{sub g} values was also observed by incorporation of MCM-41 nanoparticles. - Abstract: Activator generated by electron transfer for atom transfer radical polymerization was employed to synthesize well-defined mesoporous silica nanoparticles/polystyrene composites. Inherent features of spherical mesoporous silica nanoparticles were evaluated by nitrogen adsorption/desorption isotherm, X-ray diffraction and scanning electron microscopy analysis techniques. Conversion and molecular weight evaluations were carried out using gas and size exclusion chromatography respectively. By the addition of only 3 wt% mesoporous silica nanoparticles, conversion decreases from 81 to 58%. Similarly, number average molecular weight decreases from 17,116 to 12,798 g mol{sup −1}. However, polydispersity index (PDI) values increases from 1.24 to 1.58. A peak around 4.1–4.2 ppm at proton nuclear magnetic resonance spectroscopy results clearly confirms the living nature of the polymerization. Thermogravimetric

  14. Synthesis of Ag@Silica Nanoparticles by Assisted Laser Ablation

    NASA Astrophysics Data System (ADS)

    González-Castillo, Jr.; Rodriguez, E.; Jimenez-Villar, E.; Rodríguez, D.; Salomon-García, I.; de Sá, Gilberto F.; García-Fernández, T.; Almeida, DB; Cesar, CL; Johnes, R.; Ibarra, Juana C.

    2015-10-01

    This paper reports the synthesis of silver nanoparticles coated with porous silica (Ag@Silica NPs) using an assisted laser ablation method. This method is a chemical synthesis where one of the reagents (the reducer agent) is introduced in nanometer form by laser ablation of a solid target submerged in an aqueous solution. In a first step, a silicon wafer immersed in water solution was laser ablated for several minutes. Subsequently, an AgNO3 aliquot was added to the aqueous solution. The redox reaction between the silver ions and ablation products leads to a colloidal suspension of core-shell Ag@Silica NPs. The influence of the laser pulse energy, laser wavelength, ablation time, and Ag+ concentration on the size and optical properties of the Ag@Silica NPs was investigated. Furthermore, the colloidal suspensions were studied by UV-VIS-NIR spectroscopy, X-Ray diffraction, and high-resolution transmission electron microscopy (HRTEM).

  15. Synthesis of Ag@Silica Nanoparticles by Assisted Laser Ablation.

    PubMed

    González-Castillo, J R; Rodriguez, E; Jimenez-Villar, E; Rodríguez, D; Salomon-García, I; de Sá, Gilberto F; García-Fernández, T; Almeida, D B; Cesar, C L; Johnes, R; Ibarra, Juana C

    2015-12-01

    This paper reports the synthesis of silver nanoparticles coated with porous silica (Ag@Silica NPs) using an assisted laser ablation method. This method is a chemical synthesis where one of the reagents (the reducer agent) is introduced in nanometer form by laser ablation of a solid target submerged in an aqueous solution. In a first step, a silicon wafer immersed in water solution was laser ablated for several minutes. Subsequently, an AgNO3 aliquot was added to the aqueous solution. The redox reaction between the silver ions and ablation products leads to a colloidal suspension of core-shell Ag@Silica NPs. The influence of the laser pulse energy, laser wavelength, ablation time, and Ag(+) concentration on the size and optical properties of the Ag@Silica NPs was investigated. Furthermore, the colloidal suspensions were studied by UV-VIS-NIR spectroscopy, X-Ray diffraction, and high-resolution transmission electron microscopy (HRTEM). PMID:26464175

  16. Fluorescent silica nanoparticles containing covalently bound dyes for reporter, marker, and sensor applications

    NASA Astrophysics Data System (ADS)

    Patonay, Gabor; Henary, Maged; Chapman, Gala; Emer, Kyle; Crow, Sidney

    2016-03-01

    Silica nanoparticles have proven to be useful in many bioanalytical and medical applications and have been used in numerous applications during the last decade. Combining the properties of silica nanoparticles and fluorescent dyes that may be used as chemical probes or labels can be relatively easy by simply soaking porous silica nanoparticles in a solution of the dye of interest. Under proper conditions the entrapped dye can stay inside the silica nanoparticle for several hours resulting in a useful probe. In spite of the relative durability of these probes, leaching can still occur. A much better approach is to synthesize silica nanoparticles that have the fluorescent dye covalently attached to the backbone structure of the silica nanoparticle. This can be achieved by using appropriately modified tetraethyl orthosilicate (TEOS) analogues during the silica nanoparticle synthesis. The molar ratio of TEOS and modified TEOS will determine the fluorescent dye load in the silica nanoparticle. Dependent on the chemical stability of the reporting dye either reverse micellar (RM) or Stöber method can be used for silica nanoparticle synthesis. If dye stability allows RM procedure is preferred as it results in a much easier control of the silica nanoparticle reaction itself. Also controlling the size and uniformity of the silica nanoparticles are much easier using RM method. Dependent on the functional groups present in the reporting dye used in preparation of the modified TEOS, the silica nanoparticles can be utilized in many applications such as pH sensor, metal ion sensors, labels, etc. In addition surface activated silica nanoparticles with reactive moieties are also excellent reporters or they can be used as bright fluorescent labels. Many different fluorescent dyes can be used to synthesize silica nanoparticles including visible and NIR dyes. Several bioanalytical applications are discussed including studying amoeba phagocytosis.

  17. Dye-doped silica-based nanoparticles for bioapplications

    NASA Astrophysics Data System (ADS)

    Nhung Tran, Hong; Nghiem, Thi Ha Lien; Thuy Duong Vu, Thi; Tan Pham, Minh; Van Nguyen, Thi; Trang Tran, Thu; Chu, Viet Ha; Thuan Tong, Kim; Thuy Tran, Thanh; Le, Thi Thanh Xuan; Brochon, Jean-Claude; Quy Nguyen, Thi; Nhung Hoang, My; Nguyen Duong, Cao; Thuy Nguyen, Thi; Hoang, Anh Tuan; Hoa Nguyen, Phuong

    2013-12-01

    This paper presents our recent research results on synthesis and bioapplications of dye-doped silica-based nanoparticles. The dye-doped water soluble organically modified silicate (ORMOSIL) nanoparticles (NPs) with the size of 15-100 nm were synthesized by modified Stöber method from methyltriethoxysilane CH3Si(OCH3)3 precursor (MTEOS). Because thousands of fluorescent dye molecules are encapsulated in the silica-based matrix, the dye-doped nanoparticles are extremely bright and photostable. Their surfaces were modified with bovine serum albumin (BSA) and biocompatible chemical reagents. The highly intensive luminescent nanoparticles were combined with specific bacterial and breast cancer antigen antibodies. The antibody-conjugated nanoparticles can identify a variety of bacterium, such as Escherichia coli O157:H7, through antibody-antigen interaction and recognition. A highly sensitive breast cancer cell detection has been achieved with the anti-HER2 monoclonal antibody-nanoparticles complex. These results demonstrate the potential to apply these fluorescent nanoparticles in various biodetection systems.

  18. Passive mass transport for direct and quantitative SERS detection using purified silica encapsulated metal nanoparticles

    NASA Astrophysics Data System (ADS)

    Shrestha, Binaya Kumar

    This thesis focuses on understanding implications of nanomaterial quality control and mass transport through internally etched silica coated nanoparticles for direct and quantitative molecular detection using surface enhanced Raman scattering (SERS). Prior to use, bare nanoparticles (partially or uncoated with silica) are removal using column chromatography to improve the quality of these nanomaterials and their SERS reproducibility. Separation of silica coated nanoparticles with two different diameters is achieved using Surfactant-free size exclusion chromatography with modest fractionation. Next, selective molecular transport is modeled and monitored using SERS and evaluated as a function of solution ionic strength, pH, and polarity. Molecular detection is achieved when the analytes first partition through the silica membrane then interact with the metal surface at short distances (i.e., less than 2 nm). The SERS intensities of unique molecular vibrational modes for a given molecule increases as the number of molecules that bind to the metal surface increases and are enhanced via both chemical and electromagnetic enhancement mechanisms as long as the vibrational mode has a component of polarizability tensor along the surface normal. SERS signals increase linearly with molecular concentration until the three-dimensional SERS-active volume is saturated with molecules. Implications of molecular orientation as well as surface selection rules on SERS intensities of molecular vibrational modes are studied to improve quantitative and reproducible SERS detection using internally etched Ag Au SiO2 nanoparticles. Using the unique vibrational modes, SERS intensities for p-aminothiophenol as a function of metal core compositions and plasmonics are studied. By understanding molecular transport mechanisms through internally etched silica matrices coated on metal nanoparticles, important experimental and materials design parameters are learned, which can be subsequently applied

  19. Chromogenic Detection of Aqueous Formaldehyde Using Functionalized Silica Nanoparticles.

    PubMed

    El Sayed, Sameh; Pascual, Lluı́s; Licchelli, Maurizio; Martínez-Máñez, Ramón; Gil, Salvador; Costero, Ana M; Sancenón, Félix

    2016-06-15

    Silica nanoparticles functionalized with thiol reactive units and bulky polar polyamines were used for the selective colorimetric detection of formaldehyde. The reaction of thiols groups in the nanoparticles surface with a squaraine dye resulted in loss of the π-conjugation of the chromophores, and the subsequent bleaching of the solution. However, when formaldehyde was present in the suspension, the thiol-squaraine reaction was inhibited and a chromogenic response was observed. A selective response to formaldehyde was observed only when the thiol and polyamine groups were anchored to the silica surface. The observed selective response was ascribed to the fact that bulky polyamines generate a highly polar environment around thiols, which were only able to react with the small and polar formaldehyde, but not with other aldehydes. The sensing nanoparticles showed a limit of detection (LOD) for formaldehyde of 36 ppb in water. PMID:27250594

  20. Thrombin-Responsive Gated Silica Mesoporous Nanoparticles As Coagulation Regulators.

    PubMed

    Bhat, Ravishankar; Ribes, Àngela; Mas, Núria; Aznar, Elena; Sancenón, Félix; Marcos, M Dolores; Murguía, Jose R; Venkataraman, Abbaraju; Martínez-Máñez, Ramón

    2016-02-01

    The possibility of achieving sophisticated actions in complex biological environments using gated nanoparticles is an exciting prospect with much potential. We herein describe new gated mesoporous silica nanoparticles (MSN) loaded with an anticoagulant drug and capped with a peptide containing a thrombin-specific cleavage site. When the coagulation cascade was triggered, active thrombin degraded the capping peptidic sequence and induced the release of anticoagulant drugs to delay the clotting process. The thrombin-dependent response was assessed and a significant increase in coagulation time in plasma from 2.6 min to 5 min was found. This work broadens the application of gated silica nanoparticles and demonstrates their ability to act as controllers in a complex scenario such as hemostasis. PMID:26794474

  1. Comparative Investigation on Thermal Insulation of Polyurethane Composites Filled with Silica Aerogel and Hollow Silica Microsphere.

    PubMed

    Liu, Chunyuan; Kim, Jin Seuk; Kwon, Younghwan

    2016-02-01

    This paper presents a comparative study on thermal conductivity of PU composites containing open-cell nano-porous silica aerogel and closed-cell hollow silica microsphere, respectively. The thermal conductivity of PU composites is measured at 30 degrees C with transient hot bridge method. The insertion of polymer in pores of silica aerogel creates mixed interfaces, increasing the thermal conductivity of resulting composites. The measured thermal conductivity of PU composites filled with hollow silica microspheres is estimated using theoretical models, and is in good agreement with Felske model. It appears that the thermal conductivity of composites decreases with increasing the volume fraction (phi) when hollow silica microsphere (eta = 0.916) is used. PMID:27433652

  2. Diatomite silica nanoparticles for drug delivery

    NASA Astrophysics Data System (ADS)

    Ruggiero, Immacolata; Terracciano, Monica; Martucci, Nicola M.; De Stefano, Luca; Migliaccio, Nunzia; Tatè, Rosarita; Rendina, Ivo; Arcari, Paolo; Lamberti, Annalisa; Rea, Ilaria

    2014-07-01

    Diatomite is a natural fossil material of sedimentary origin, constituted by fragments of diatom siliceous skeletons. In this preliminary work, the properties of diatomite nanoparticles as potential system for the delivery of drugs in cancer cells were exploited. A purification procedure, based on thermal treatments in strong acid solutions, was used to remove inorganic and organic impurities from diatomite and to make them a safe material for medical applications. The micrometric diatomite powder was reduced in nanoparticles by mechanical crushing, sonication, and filtering. Morphological analysis performed by dynamic light scattering and transmission electron microscopy reveals a particles size included between 100 and 300 nm. Diatomite nanoparticles were functionalized by 3-aminopropyltriethoxysilane and labeled by tetramethylrhodamine isothiocyanate. Different concentrations of chemically modified nanoparticles were incubated with cancer cells and confocal microscopy was performed. Imaging analysis showed an efficient cellular uptake and homogeneous distribution of nanoparticles in cytoplasm and nucleus, thus suggesting their potentiality as nanocarriers for drug delivery.

  3. Action of colloidal silica films on different nano-composites

    NASA Astrophysics Data System (ADS)

    Abdalla, S.; Al-Marzouki, F.; Obaid, A.; Gamal, S.

    Nano-composite films have been the subject of extensive work to develop the energy-storage efficiency of electrostatic capacitors. Factors such as polymer purity, nano-particles size, and film morphology drastically affect the electrostatic efficiency of the dielectric material that form an insulating film between conductive electrodes of a capacitor. This in turn affects the energy storage performance of the capacitor. In the present work, we have studied the dielectric properties of 4 high pure amorphous polymer films: polymethylmethacrylate (PMMA), polystyrene, polyimide and poly-4-vinylpyridine. Comparison between the dielectric properties of these polymers has revealed that the higher break down performance is a character of polyimide PI and PMMA. Also, our experimental data shows that adding colloidal silica to PMMA and PI leads to a net decrease in the dielectric properties compared to the pure polymer.

  4. Mesoporous Silica Nanoparticles and Films for Cargo Delivery

    NASA Astrophysics Data System (ADS)

    Guardado Alvarez, Tania Maria

    Mesoporous silica materials are well known materials that can range from films to nanoparticles. Mesoporous silica nanoparticles (MSNs) and mesoporous silica films have been of increasing interest among the scientific community for its use in cargo delivery. Silica provides ease of functionalization, a robust support and biocompatibility. Several methods have been used in order to give the mesoporous silica nanomaterials different qualities that render them a useful material with different characteristics. Among these methods is surface modification by taking advantage of the OH groups on the surface. When a molecule attached to the surface can act as a molecular machine it transforms the nanomaterial to act as delivery system that can be activated upon command. The work covered in this thesis focuses on the development and synthesis of different mesoporous silica materials for the purpose of trapping and releasing cargo molecules. Chapter 2 focuses in the photoactivation of "snap-top" stoppers over the pore openings of mesoporous silica nanoparticles that releases intact cargo molecules from the pores. The on-command release can be stimulated by either one UV photon or two coherent near-IR photons. Two-photon activation is particularly desirable for use in biological systems because it enables good tissue penetration and precise spatial control. Chapter 3 focuses on the design and synthesis of a nano-container consisting of mesoporous silica nanoparticles with the pore openings covered by "snap-top" caps that are opened by near-IR light. A photo transducer molecule that is a reducing agent in an excited electronic state is covalently attached to the system. Near IR two-photon excitation causes intermolecular electron transfer that reduces a disulfide bond holding the cap in place, thus allowing the cargo molecules to escape. The operation of the "snap-top" release mechanism by both one- and two photon is described. This system presents a proof of concept of a near

  5. Interferences of Silica Nanoparticles in Green Fluorescent Protein Folding Processes.

    PubMed

    Klein, Géraldine; Devineau, Stéphanie; Aude, Jean Christophe; Boulard, Yves; Pasquier, Hélène; Labarre, Jean; Pin, Serge; Renault, Jean Philippe

    2016-01-12

    We investigated the relationship between unfolded proteins, silica nanoparticles and chaperonin to determine whether unfolded proteins could stick to silica surfaces and how this process could impair heat shock protein activity. The HSP60 catalyzed green fluorescent protein (GFP) folding was used as a model system. The adsorption isotherms and adsorption kinetics of denatured GFP were measured, showing that denaturation increases GFP affinity for silica surfaces. This affinity is maintained even if the surfaces are covered by a protein corona and allows silica NPs to interfere directly with GFP folding by trapping it in its unstructured state. We determined also the adsorption isotherms of HSP60 and its chaperonin activity once adsorbed, showing that SiO2 NP can interfere also indirectly with protein folding through chaperonin trapping and inhibition. This inhibition is specifically efficient when NPs are covered first with a layer of unfolded proteins. These results highlight for the first time the antichaperonin activity of silica NPs and ask new questions about the toxicity of such misfolded proteins/nanoparticles assembly toward cells. PMID:26649773

  6. Mesoporous silica nanoparticles in target drug delivery system: A review

    PubMed Central

    Bharti, Charu; Nagaich, Upendra; Pal, Ashok Kumar; Gulati, Neha

    2015-01-01

    Due to lack of specification and solubility of drug molecules, patients have to take high doses of the drug to achieve the desired therapeutic effects for the treatment of diseases. To solve these problems, there are various drug carriers present in the pharmaceuticals, which can used to deliver therapeutic agents to the target site in the body. Mesoporous silica materials become known as a promising candidate that can overcome above problems and produce effects in a controllable and sustainable manner. In particular, mesoporous silica nanoparticles (MSNs) are widely used as a delivery reagent because silica possesses favorable chemical properties, thermal stability, and biocompatibility. The unique mesoporous structure of silica facilitates effective loading of drugs and their subsequent controlled release of the target site. The properties of mesoporous, including pore size, high drug loading, and porosity as well as the surface properties, can be altered depending on additives used to prepare MSNs. Active surface enables functionalization to changed surface properties and link therapeutic molecules. They are used as widely in the field of diagnosis, target drug delivery, bio-sensing, cellular uptake, etc., in the bio-medical field. This review aims to present the state of knowledge of silica containing mesoporous nanoparticles and specific application in various biomedical fields. PMID:26258053

  7. Surfactant-free synthesis of mesoporous and hollow silica nanoparticles with an inorganic template.

    PubMed

    Baù, Luca; Bártová, Barbora; Arduini, Maria; Mancin, Fabrizio

    2009-12-28

    A surfactant-free synthesis of mesoporous and hollow silica nanoparticles is reported in which boron acts as the templating agent. Using such a simple and mild procedure as a treatment with water, the boron-rich phase is selectively removed, affording mesoporous pure silica nanoparticles with wormhole-like pores or, depending on the synthetic conditions, silica nanoshells. PMID:20024287

  8. Fast determination of Ziziphora tenuior L. essential oil by inorganic-organic hybrid material based on ZnO nanoparticles anchored to a composite made from polythiophene and hexagonally ordered silica.

    PubMed

    Piryaei, Marzieh; Abolghasemi, Mir Mahdi; Nazemiyeh, Hossein

    2015-01-01

    In this paper, for the first time, an inorganic-organic hybrid material based on ZnO nanoparticles was anchored to a composite made from polythiophene and hexagonally ordered silica (ZnO/PT/SBA-15) for use in solid-phase fibre microextraction (SPME) of medicinal plants. A homemade SPME apparatus was used for the extraction of volatile components of Ziziphora tenuior L. A simplex method was used for optimisation of five different parameters affecting the efficiency of the extraction. The main constituents extracted by ZnO/PT/SBA-15 and PDMS fibres and hydrodistillation (HD) methods, respectively, included pulegone (51.25%, 53.64% and 56.68%), limonene (6.73%, 6.58% and 8.3%), caryophyllene oxide (5.33%, 4.31% and 4.53%) and 1,8-cineole (4.21%, 3.31% and 3.18%). In comparison with the HD method, the proposed technique could equally monitor almost all the components of the sample, in an easier way, in a shorter time and requiring a much lower amount of the sample. PMID:25496469

  9. Electrochemiluminescence sensor for melamine based on a Ru(bpy)₃²⁺-doped silica nanoparticles/carboxylic acid functionalized multi-walled carbon nanotubes/Nafion composite film modified electrode.

    PubMed

    Chen, Xiaomei; Lian, Sai; Ma, Ying; Peng, Aihong; Tian, Xiaotian; Huang, Zhiyong; Chen, Xi

    2016-01-01

    In this work, a sensitive electrochemiluminescence (ECL) sensor for the determination of melamine (MEL) was developed based on a Ru(bpy)3(2+)-doped silica nanoparticles (RUDS)/carboxylic acid functionalized multi-walled carbon nanotubes (CMWCNTs)/Nafion composite film modified electrode. The homogeneous spherical RUDS were synthesized by a reverse microemulsion method. As Ru(bpy)3(2+) were encapsulated in the RUDS, Ru(bpy)3(2+) dropping from the modified electrode can be greatly prevented, which is helpful for obtaining a stable ECL signal. Moreover, to improve the conductivity of the film and promote the electron transfer rate on electrode surface, CMWCNTs with excellent electrical conductivity and large surface area were applied in the construction of the sensing film. As CMWCNTs acted as electron bridges making more Ru(bpy)3(2+) participate in the reaction, the ECL intensity was greatly enhanced. Under the optimum conditions, the relative ECL signal (△IECL) was proportional to the logarithmic MEL concentration ranging from 5×10(-13) to 1×10(-7) mol L(-1) with a detection limit of 1×10(-13) mol L(-1). To verify the reliability, the thus-fabricated ECL sensor was applied to determine the concentration of MEL in milk. Based on these investigations, the proposed ECL sensor exhibited good feasibility and high sensitivity for the determination of MEL, promising the applicability of this sensor in practical analysis. PMID:26695338

  10. Luminescent Silica Nanoparticles Featuring Collective Processes for Optical Imaging.

    PubMed

    Rampazzo, Enrico; Prodi, Luca; Petrizza, Luca; Zaccheroni, Nelsi

    2016-01-01

    The field of nanoparticles has successfully merged with imaging to optimize contrast agents for many detection techniques. This combination has yielded highly positive results, especially in optical and magnetic imaging, leading to diagnostic methods that are now close to clinical use. Biological sciences have been taking advantage of luminescent labels for many years and the development of luminescent nanoprobes has helped definitively in making the crucial step forward in in vivo applications. To this end, suitable probes should present excitation and emission within the NIR region where tissues have minimal absorbance. Among several nanomaterials engineered with this aim, including noble metal, lanthanide, and carbon nanoparticles and quantum dots, we have focused our attention here on luminescent silica nanoparticles. Many interesting results have already been obtained with nanoparticles containing only one kind of photophysically active moiety. However, the presence of different emitting species in a single nanoparticle can lead to diverse properties including cooperative behaviours. We present here the state of the art in the field of silica luminescent nanoparticles exploiting collective processes to obtain ultra-bright units suitable as contrast agents in optical imaging and optical sensing and for other high sensitivity applications. PMID:26589504

  11. Evaluation of silica nanoparticle binding to major human blood proteins

    NASA Astrophysics Data System (ADS)

    Hata, Katsutomo; Higashisaka, Kazuma; Nagano, Kazuya; Mukai, Yohei; Kamada, Haruhiko; Tsunoda, Shin-ichi; Yoshioka, Yasuo; Tsutsumi, Yasuo

    2014-12-01

    Nanomaterials are used for various biomedical applications because they are often more effective than conventional materials. Recently, however, it has become clear that the protein corona that forms on the surface of nanomaterials when they make contact with biological fluids, such as blood, influences the pharmacokinetics and biological responses induced by the nanomaterials. Therefore, when evaluating nanomaterial safety and efficacy, it is important to analyze the interaction between nanomaterials and proteins in biological fluids and to evaluate the effects of the protein corona. Here, we evaluated the interaction of silica nanoparticles, a commonly used nanomaterial, with the human blood proteins albumin, transferrin, fibrinogen, and IgG. Sodium dodecyl sulfate-polyacrylamide gel electrophoresis analysis showed that the amount of albumin, transferrin, and IgG binding to the silica particles increased as the particle size decreased under conditions where the silica particle mass remained the same. However, under conditions in which the specific surface area remained constant, there were no differences in the binding of human plasma proteins to the silica particles tested, suggesting that the binding of silica particles with human plasma proteins is dependent on the specific surface area of the silica particles. Furthermore, the amount of albumin, transferrin, and IgG binding to silica nanoparticles with a diameter of 70 nm (nSP70) and a functional amino group was lower than that with unmodified nSP70, although there was no difference in the binding between nSP70 with the surface modification of a carboxyl functional group and nSP70. These results suggest that the characteristics of nanomaterials are important for binding with human blood proteins; this information may contribute to the development of safe and effective nanomaterials.

  12. Magnetic heating of silica-coated manganese ferrite nanoparticles

    NASA Astrophysics Data System (ADS)

    Iqbal, Yousaf; Bae, Hongsub; Rhee, Ilsu; Hong, Sungwook

    2016-07-01

    Manganese ferrite nanoparticles were synthesized using the reverse micelle method; these particles were then coated with silica. The silica-coated nanoparticles were spherical in shape, with an average diameter of 14 nm. The inverse spinel crystalline structure was observed through X-ray diffraction patterns. The coating status of silica on the surface of the nanoparticles was confirmed with a Fourier transform infrared spectrometer. The superparamagnetic properties were revealed by the zero coercive force in the hysteresis curve. Controllable heating at a fixed temperature of 42 °C was achieved by changing either the concentration of nanoparticles in the aqueous solution or the intensity of the alternating magnetic field. We found that at a fixed field strength of 5.5 kA/m, the 2.6 mg/ml sample showed a saturation temperature of 42 °C for magnetic hyperthermia. On the other hand, at a fixed concentration of 3.6 mg/ml, a field intensity of 4.57 kA/m satisfied the required temperature of 42 °C.

  13. Antibacterial Dental Composites with Chlorhexidine and Mesoporous Silica

    PubMed Central

    Zhang, J.F.; Wu, R.; Fan, Y.; Liao, S.; Wang, Y.; Wen, Z.T.; Xu, X.

    2014-01-01

    One of the leading causes for the failure of dental composite restorations is secondary caries. Effectively inhibiting cariogenic biofilms and reducing secondary caries could extend the service life of composite restorations. Dental composites releasing antibacterial agents such as chlorhexidine (CHX) have shown biofilm-inhibitory efficacy, but they usually have poor physical and mechanical properties. Herein, we present a study of a new method to encapsulate and release CHX from dental composite using mesoporous silica nanoparticles (MSNs). SBA-15 MSNs were synthesized according to a reported procedure. CHX (62.9 wt%) was encapsulated into dried MSN from 0.3 M CHX ethanol solution. The dental composites containing 0% (control), 3%, 5%, and 6.3% CHX or the same amounts of CHX entrapped in MSN (denoted as CHX@MSN) were fabricated with methacrylate monomers and silanized glass fillers (CHX or CHX@MSN + glass filler particle = 70 wt%). The monomer mixture consisted of bisphenol A glycidyl methacrylate (BisGMA), hexanediol dimethacrylate (HDDMA), ethoxylated bisphenol A dimethacrylate (EBPADMA), and urethane dimethacrylates (UEDMA) at a weight ratio of 40:30:20:10. The composites were tested for CHX release and recharge, flexural strength and modulus (at 24 hr and 1 mo), surface roughness, in vitro wear, and antibacterial activity against Streptococcus mutans and Lactobacillus casei (in both planktonic growth and biofilm formation). The results showed that the composites with CHX@MSN largely retained mechanical properties and smooth surfaces and showed controlled release of CHX over a long time. In contrast, the composites with directly mixed CHX showed reduced mechanical properties, rough surfaces, and burst release of CHX in a short time. The composites with CHX either directly mixed or in MSN showed strong inhibition to S. mutans and L. casei. This research has demonstrated the successful application of MSNs as a novel nanotechnology in dental materials to inhibit

  14. Antibacterial dental composites with chlorhexidine and mesoporous silica.

    PubMed

    Zhang, J F; Wu, R; Fan, Y; Liao, S; Wang, Y; Wen, Z T; Xu, X

    2014-12-01

    One of the leading causes for the failure of dental composite restorations is secondary caries. Effectively inhibiting cariogenic biofilms and reducing secondary caries could extend the service life of composite restorations. Dental composites releasing antibacterial agents such as chlorhexidine (CHX) have shown biofilm-inhibitory efficacy, but they usually have poor physical and mechanical properties. Herein, we present a study of a new method to encapsulate and release CHX from dental composite using mesoporous silica nanoparticles (MSNs). SBA-15 MSNs were synthesized according to a reported procedure. CHX (62.9 wt%) was encapsulated into dried MSN from 0.3 M CHX ethanol solution. The dental composites containing 0% (control), 3%, 5%, and 6.3% CHX or the same amounts of CHX entrapped in MSN (denoted as CHX@MSN) were fabricated with methacrylate monomers and silanized glass fillers (CHX or CHX@MSN + glass filler particle = 70 wt%). The monomer mixture consisted of bisphenol A glycidyl methacrylate (BisGMA), hexanediol dimethacrylate (HDDMA), ethoxylated bisphenol A dimethacrylate (EBPADMA), and urethane dimethacrylates (UEDMA) at a weight ratio of 40:30:20:10. The composites were tested for CHX release and recharge, flexural strength and modulus (at 24 hr and 1 mo), surface roughness, in vitro wear, and antibacterial activity against Streptococcus mutans and Lactobacillus casei (in both planktonic growth and biofilm formation). The results showed that the composites with CHX@MSN largely retained mechanical properties and smooth surfaces and showed controlled release of CHX over a long time. In contrast, the composites with directly mixed CHX showed reduced mechanical properties, rough surfaces, and burst release of CHX in a short time. The composites with CHX either directly mixed or in MSN showed strong inhibition to S. mutans and L. casei. This research has demonstrated the successful application of MSNs as a novel nanotechnology in dental materials to inhibit

  15. Facile Fabrication of Ultrafine Hollow Silica and Magnetic Hollow Silica Nanoparticles by a Dual-Templating Approach

    NASA Astrophysics Data System (ADS)

    Wu, Wei; Xiao, Xiangheng; Zhang, Shaofeng; Fan, Lixia; Peng, Tangchao; Ren, Feng; Jiang, Changzhong

    2010-01-01

    The development of synthetic process for hollow silica materials is an issue of considerable topical interest. While a number of chemical routes are available and are extensively used, the diameter of hollow silica often large than 50 nm. Here, we report on a facial route to synthesis ultrafine hollow silica nanoparticles (the diameter of ca. 24 nm) with high surface area by using cetyltrimethylammmonium bromide (CTAB) and sodium bis(2-ethylhexyl) sulfosuccinate (AOT) as co-templates and subsequent annealing treatment. When the hollow magnetite nanoparticles were introduced into the reaction, the ultrafine magnetic hollow silica nanoparticles with the diameter of ca. 32 nm were obtained correspondingly. Transmission electron microscopy studies confirm that the nanoparticles are composed of amorphous silica and that the majority of them are hollow.

  16. Uniform silica nanoparticles encapsulating two-photon absorbing fluorescent dye

    SciTech Connect

    Wu Weibing; Liu Chang; Wang Mingliang; Huang Wei; Zhou Shengrui; Jiang Wei; Sun Yueming; Cui Yiping; Xu Chunxinag

    2009-04-15

    We have prepared uniform silica nanoparticles (NPs) doped with a two-photon absorbing zwitterionic hemicyanine dye by reverse microemulsion method. Obvious solvatochromism on the absorption spectra of dye-doped NPs indicates that solvents can partly penetrate into the silica matrix and then affect the ground and excited state of dye molecules. For dye-doped NP suspensions, both one-photon and two-photon excited fluorescence are much stronger and recorded at shorter wavelength compared to those of free dye solutions with comparative overall dye concentration. This behavior is possibly attributed to the restricted twisted intramolecular charge transfer (TICT), which reduces fluorescence quenching when dye molecules are trapped in the silica matrix. Images from two-photon laser scanning fluorescence microscopy demonstrate that the dye-doped silica NPs can be actively uptaken by Hela cells with low cytotoxicity. - Graphical abstract: Water-soluble silica NPs doped with a two-photon absorbing zwitterionic hemicyanine dye were prepared. They were found of enhanced one-photon and two-photon excited fluorescence compared to free dye solutions. Images from two-photon laser scanning fluorescence microscopy demonstrate that the dye-doped silica NPs can be actively uptaken by Hela cells.

  17. Effect of silica nanoparticles on microbial biomass and silica availability in maize rhizosphere.

    PubMed

    Rangaraj, Suriyaprabha; Gopalu, Karunakaran; Rathinam, Yuvakkumar; Periasamy, Prabu; Venkatachalam, Rajendran; Narayanasamy, Kannan

    2014-01-01

    The effect of silica nanoparticles and conventional silica sources on the changes in microbial biomass and silica availability to pure soil and maize rhizosphere was studied. Nanosilica (20-40 nm) was synthesized from rice husk and comprehensively characterized. The efficiency of nanosilica was evaluated in terms of its effects on beneficial microbial population such as phosphate solubilizers, nitrogen fixers, silicate solubilizers, microbial biomass carbon and nitrogen content, and silica content in comparison with other silica sources such as microsilica, sodium silicate, and silicic acid. Nanosilica significantly (P < 0.05) enhanced microbial populations, total biomass content (C = 1508 μg g(-1) and N = 178 μg g(-1) ), and silica content (14.75 mg mL(-1) ). Although microsilica sources enhanced factors associated with soil fertility, their use by maize roots and silicification in soil was found to be less. The results show that nanosilica plays a vital role in influencing soil nutrient content and microbial biota and, hence, may promote the growth of maize crop. PMID:24329970

  18. Enhanced hydrophobicity of polyurethane via non-solvent induced surface aggregation of silica nanoparticles.

    PubMed

    Seyfi, Javad; Hejazi, Iman; Jafari, Seyed Hassan; Khonakdar, Hossein Ali; Simon, Frank

    2016-09-15

    Fabrication of superhydrophobic surfaces from hydrophilic polymers has always been regarded as a challenge. In this study, to achieve superhydrophobic polyurethane (PU) surfaces, silica nanoparticles and ethanol as non-solvent were simultaneously utilized during a solution casting-based process. Such modified version of phase separation process was found to be highly efficient, and also it required much lower concentration of nanoparticles to achieve superhydrophobicity as compared to the previously reported methods in the literature. According to the proposed mechanism, non-solvent induces a more profound aggregation of silica nanoparticles at the surface's top layer causing the surface energy to be highly diminished, and thus, the water repellency is improved. Morphology and topography results showed that a unique "triple-sized" structure was formed on the surface of superhydrophobic samples. X-ray photoelectron spectroscopy results proved that both PU macromolecules and silica nanoparticles were concurrently present at the surface layer of the superhydrophobic sample. It was concluded that surface composition and roughness could be regarded as competing factors in achieving superhydrophobicity. Based on the obtained results, the proposed method exhibits a promising potential in large-scale fabrication of surface layers with superhydrophobic property. Moreover, a mechanism was also presented to further explicate the physics behind the suggested method. PMID:27288577

  19. Diatomite silica nanoparticles for drug delivery

    PubMed Central

    2014-01-01

    Diatomite is a natural fossil material of sedimentary origin, constituted by fragments of diatom siliceous skeletons. In this preliminary work, the properties of diatomite nanoparticles as potential system for the delivery of drugs in cancer cells were exploited. A purification procedure, based on thermal treatments in strong acid solutions, was used to remove inorganic and organic impurities from diatomite and to make them a safe material for medical applications. The micrometric diatomite powder was reduced in nanoparticles by mechanical crushing, sonication, and filtering. Morphological analysis performed by dynamic light scattering and transmission electron microscopy reveals a particles size included between 100 and 300 nm. Diatomite nanoparticles were functionalized by 3-aminopropyltriethoxysilane and labeled by tetramethylrhodamine isothiocyanate. Different concentrations of chemically modified nanoparticles were incubated with cancer cells and confocal microscopy was performed. Imaging analysis showed an efficient cellular uptake and homogeneous distribution of nanoparticles in cytoplasm and nucleus, thus suggesting their potentiality as nanocarriers for drug delivery. PACS 87.85.J81.05.Rm; 61.46. + w PMID:25024689

  20. β-ray irradiation effects on silica nanoparticles

    NASA Astrophysics Data System (ADS)

    Alessi, A.; Agnello, S.; Buscarino, G.; Boizot, B.; Cannas, M.; Gelardi, F. M.

    2015-04-01

    By electron paramagnetic resonance (EPR) measurements, we examine the amplitude of the signal typically due to a combination of NBOHC (Non Bridging Hole Center) and POR (Peroxy Radical) defects induced by β-ray irradiation (from 1.2 to 1200 MGy) in silica nanoparticles with diameter ranging from 7 to 20 nm. Our data indicate that the signal line-shapes recorded at different doses is quite independent from the particles sizes and from the dose. Furthermore, for each considered nanoparticles size, the concentration of defects is also almost constant with respect to dose, and it does not change significantly if measured after 2 or 9 months from the irradiation. By contrast, we observed that the concentration of NBOHC+POR decreases on increasing the specific surface, indicating that the content of the defects depends on the nanoparticles size. Such dependence can be explained by a shell model in which the detected defects are located in the inner part of the nanoparticles.

  1. Photothermally responsive gold nanoparticle conjugated polymer-grafted porous hollow silica nanocapsules.

    PubMed

    Paramelle, David; Gorelik, Sergey; Liu, Ye; Kumar, Jatin

    2016-08-01

    Polymer-grafted porous hollow silica nanoparticles prepared by reversible addition-fragmentation chain transfer polymerisation have an upper critical solution temperature of 45 °C. Conjugation of 5 nm gold nanoparticles onto polymer-grafted porous hollow silica nanoparticles enables remarkable specific photothermally-induced controlled release of encapsulated Rhodamine B by laser-stimulation at physiological temperature. PMID:27427407

  2. Silica nanoparticles as vehicles for therapy delivery in neurological injury

    NASA Astrophysics Data System (ADS)

    Schenk, Desiree

    Acrolein, a very reactive aldehyde, is a culprit in the biochemical cascade after primary, mechanical spinal cord injury (SCI), which leads to the destruction of tissue initially unharmed, referred to as "secondary injury". Additionally, in models of multiple sclerosis (MS) and some clinical research, acrolein levels are significantly increased. This aldehyde overwhelms the natural anti-oxidant system, reacts freely with proteins, and releases during lipid peroxidation (LPO), effectively regenerating its self. Due to its ability to make more copies of itself in the presence of tissue via lipid peroxidation, researchers believe that acrolein plays a role in the increased destruction of the central nervous system in both SCI and MS. Hydralazine, an FDA-approved hypertension drug, has been shown to scavenge acrolein, but its side effects and short half life at the appropriate dose for acrolein scavenging must be improved for beneficial clinical translation. Due to the inefficient delivery of therapeutic drugs, nanoparticles have become a major field of exploration for medical applications. Based on their material properties, they can help treat disease by delivering drugs to specific tissues, enhancing detection methods, or a mixture of both. Nanoparticles made from silica provide distinct advantages. They form porous networks that can carry therapeutic molecules throughout the body. Therefore, a nanomedical approach has been designed using silica nanoparticles as a porous delivery vehicle hydralazine. The silica nanoparticles are formed in a one-step method that incorporates poly(ethylene) glycol (PEG), a stealth molecule, directly onto the nanoparticles. As an additional avenue for study, a natural product in green tea, epigallocatechin gallate (EGCG), has been explored for its ability to react with acrolein, disabling its reactive capabilities. Upon demonstration of attenuating acrolein, EGCG's delivery may also be improved using the nanomedical approach. The

  3. Mesoporous silica nanoparticles for treating spinal cord injury

    NASA Astrophysics Data System (ADS)

    White-Schenk, Désirée.; Shi, Riyi; Leary, James F.

    2013-02-01

    An estimated 12,000 new cases of spinal cord injury (SCI) occur every year in the United States. A small oxidative molecule responsible for secondary injury, acrolein, is an important target in SCI. Acrolein attacks essential proteins and lipids, creating a feed-forward loop of oxidative stress in both the primary injury area and the surrounding areas. A small molecule used and FDA-approved for hypertension, hydralazine, has been found to "scavenge" acrolein after injury, but its delivery and short half-life, as well as its hypertension effects, hinder its application for SCI. Nanomedical systems broaden the range of therapeutic availability and efficacy over conventional medicine. They allow for targeted delivery of therapeutic molecules to tissues of interest, reducing side effects of untargeted therapies in unwanted areas. Nanoparticles made from silica form porous networks that can carry therapeutic molecules throughout the body. To attenuate the acrolein cascade and improve therapeutic availability, we have used a one-step, modified Stober method to synthesize two types of silica nanoparticles. Both particles are "stealth-coated" with poly(ethylene) glycol (PEG) (to minimize interactions with the immune system and to increase circulation time), which is also a therapeutic agent for SCI by facilitating membrane repair. One nanoparticle type contains an amine-terminal PEG (SiNP-mPEG-Am) and the other possesses a terminal hydrazide group (SiNP-mPEG-Hz). The former allows for exploration of hydralazine delivery, loading, and controlled release. The latter group has the ability to react with acrolein, allowing the nanoparticle to scavenge directly. The nanoparticles have been characterized and are being explored using neuronal PC-12 cells in vitro, demonstrating the potential of novel silica nanoparticles for use in attenuating secondary injury after SCI.

  4. Mesoporous silica nanoparticles for bioadsorption, enzyme immobilisation, and delivery carriers

    NASA Astrophysics Data System (ADS)

    Popat, Amirali; Hartono, Sandy Budi; Stahr, Frances; Liu, Jian; Qiao, Shi Zhang; Qing (Max) Lu, Gao

    2011-07-01

    Mesoporous silica nanoparticles (MSNs) provide a non-invasive and biocompatible delivery platform for a broad range of applications in therapeutics, pharmaceuticals and diagnosis. The creation of smart, stimuli-responsive systems that respond to subtle changes in the local cellular environment are likely to yield long term solutions to many of the current drug/gene/DNA/RNA delivery problems. In addition, MSNs have proven to be promising supports for enzyme immobilisation, enabling the enzymes to retain their activity, affording them greater potential for wide applications in biocatalysis and energy. This review provides a comprehensive summary of the advances made in the last decade and a future outlook on possible applications of MSNs as nanocontainers for storage and delivery of biomolecules. We discuss some of the important factors affecting the adsorption and release of biomolecules in MSNs and review of the cytotoxicity aspects of such nanomaterials. The review also highlights some promising work on enzyme immobilisation using mesoporous silica nanoparticles.

  5. Mesoporous silica nanoparticles with organo-bridged silsesquioxane framework as innovative platforms for bioimaging and therapeutic agent delivery.

    PubMed

    Du, Xin; Li, Xiaoyu; Xiong, Lin; Zhang, Xueji; Kleitz, Freddy; Qiao, Shi Zhang

    2016-06-01

    Mesoporous silica material with organo-bridged silsesquioxane frameworks is a kind of synergistic combination of inorganic silica, mesopores and organics, resulting in some novel or enhanced physicochemical and biocompatible properties compared with conventional mesoporous silica materials with pure Si-O composition. With the rapid development of nanotechnology, monodispersed nanoscale periodic mesoporous organosilica nanoparticles (PMO NPs) and organo-bridged mesoporous silica nanoparticles (MSNs) with various organic groups and structures have recently been synthesized from 100%, or less, bridged organosilica precursors, respectively. Since then, these materials have been employed as carrier platforms to construct bioimaging and/or therapeutic agent delivery nanosystems for nano-biomedical application, and they demonstrate some unique and/or enhanced properties and performances. This review article provides a comprehensive overview of the controlled synthesis of PMO NPs and organo-bridged MSNs, physicochemical and biocompatible properties, and their nano-biomedical application as bioimaging agent and/or therapeutic agent delivery system. PMID:27017579

  6. Multi-photon imaging of amine-functionalized silica nanoparticles

    NASA Astrophysics Data System (ADS)

    Natalio, Filipe; Kashyap, Anubha; Lorenz, Steffen; Kerschbaumer, Hannes; Dietzsch, Michael; Tahir, Muhammad Nawaz; Duschner, Heinz; Strand, Susanne; Strand, Dennis; Tremel, Wolfgang

    2012-07-01

    A convenient and simple strategy for preparing water soluble, photoluminescent functionalized silica nanoparticles (M-dots) in the absence of fluorophores or metal doping is demonstrated. These M-dots can be used for bioimaging using one and two-photon microscopy. Because of their high photostability, low toxicity and high biocompatibility compared with Lumidot™ CdSe/ZnS quantum dots, functionalized silica particles are superior alternatives for current bioimaging platforms. Moreover, the presence of a free amine group at the surface of the M-dots allows biomolecule conjugation (e.g. with antibodies, proteins) in a single step for converting these photoluminescent SiO2 nanoparticles into multifunctional efficient vehicles for theragnostics.A convenient and simple strategy for preparing water soluble, photoluminescent functionalized silica nanoparticles (M-dots) in the absence of fluorophores or metal doping is demonstrated. These M-dots can be used for bioimaging using one and two-photon microscopy. Because of their high photostability, low toxicity and high biocompatibility compared with Lumidot™ CdSe/ZnS quantum dots, functionalized silica particles are superior alternatives for current bioimaging platforms. Moreover, the presence of a free amine group at the surface of the M-dots allows biomolecule conjugation (e.g. with antibodies, proteins) in a single step for converting these photoluminescent SiO2 nanoparticles into multifunctional efficient vehicles for theragnostics. Electronic supplementary information (ESI) available: TEM images of unfunctionalized, XRD, UV-Vis spectra, XPS spectra and gallery of two-photon images. See DOI: 10.1039/c2nr30660c

  7. Adsorption of Surface-Modified Silica Nanoparticles to the Interface of Melt Poly(lactic acid) and Supercritical Carbon Dioxide.

    PubMed

    Sarikhani, K; Jeddi, K; Thompson, R B; Park, C B; Chen, P

    2015-05-26

    With the purpose of fabricating polymer nanocomposite foams and preventing coalescence in foaming processes, the interfacial tension of poly(lactic acid) (PLA)-silica composites is investigated in this work. Synthesized silica nanoparticles (SNs) with a CO2-philic surface modification are used as the dispersed nanoparticles. Interfacial tension is a key parameter in processing of polymer foams since it directly affects the final foam properties, such as cell size and cell density. Interfacial tension of silica-containing PLA and supercritical carbon dioxide (CO2) is measured using axisymmetric drop shape analysis profile (ADSA-P) pendant drop method at high pressures and high temperatures. The interfacial tension between PLA and supercritical CO2 is observed to decrease as a result of the nanoparticles' adsorption to the interface. These results indicate that the reduction in interfacial tension with increasing silica content significantly deviates from a linear trend; there is a minimum at 2 wt % loading of the SNs and then the interfacial tension curve reaches a plateau. Contact angle measurements show an affinity of the SNs for the polymer-supercritical CO2 interface, and these obtained results are used to calculate the binding energy of the nanoparticles to the PLA/CO2 interface. In addition to interfacial properties, the adsorption of silica nanoparticles at the interface is also studied in detail with scanning electron microscopy. PMID:25919815

  8. Highly ordered mesoporous silica nanoparticles and their application to DNA separation

    NASA Astrophysics Data System (ADS)

    Lee, Hye Sun; Chang, Jeong Ho

    2008-12-01

    This work describes the innovative development of high throughput human DNA purification process using the molecular self-assembled mesoporous silica nanoparticles. The mesoporous silica nanoparticles were prepared by sol-gel method and the formation of molecular self-assembled monolayers with functional groups was chemically demonstrated. The surface modification of functional groups was performed with aminofunctionallized organic silanes on mesoporous silica nanoparticles and the results of DNA separation was represented with electrophoresis images.

  9. Conductive polyurethane composites containing polyaniline-coated nano-silica.

    PubMed

    Liu, Bo-Tau; Syu, Jhan-Rong; Wang, De-Hua

    2013-03-01

    In this study, we used 1.2-Aminopropyltriethoxysilane (APTS) as a coupling agent to synthesize silica-polyaniline (PANI) core-shell nanoparticles. The core-shell nanoparticles and PANI oligomers were reacted with isocyanates to prepare the conductive polyurethane (PU)-PANI-silica nanocomposites. The core-shell-nanoparticle structure shows significant enhancement on electrical properties of the conductive nanocomposites even though only 0.0755-wt.% PANI was coated on the nano-silica. The surface resistance of the nanocomposite containing 5 wt.% PANI can reduce to ~10(8) Ω/sq, lowering two orders in contrast to the nanocomposite without the core-shell structure. In comparison with the neat PU, tensile strength and elongation of the nanocomposite containing silica-PANI core-shell nanoparticles can increase 3.1 and 3.8 times, respectively. We suspect that the extraordinary enhancement of electrical and mechanical properties may result from the fact that contact probability among PANI moieties and chemical bonding between particles and PU matrix increase due to the PANI coated on the surface of silica. PMID:23261334

  10. Silica aerogel-polymer nanocomposites and new nanoparticle syntheses

    NASA Astrophysics Data System (ADS)

    Boday, Dylan Joseph

    Aerogels are extremely high surface area, low density materials with applications including thermal and acoustic insulators, radiation detectors and cometary dust particle traps. However, their low density and aggregate structure makes them extremely fragile and practically impossible to machine or handle without breaking. This has led to the development of aerogel composites with enhanced mechanical properties through the addition of polymers or surface modifiers. To date, attempts to strengthen aerogels have come with significant increases in density and processing time. Here I will describe our search for a solution to these problems with our invention using methyl cyanoacrylate chemical vapor deposition (CVD) to strengthen silica, aminated silica and bridged polysilsesquioxane aerogels. This approach led to a strength improvement of the composites within hours and the strongest composite prepared had a 100x strength improvement over the precursor aerogel. We also developed the first approach to control the molecular weight of the polymers that reinforce silica aerogels using surface-initiated atom transfer radical polymerization (SI-ATRP). Although PMMA reinforcement of silica aerogels improved the mechanical properties, further strength improvements were achieved by cross-linking the grafted PMMA. Additionally, we developed the first silica aerogels reinforced with polyaniline nanofibers that were strong and electrically conductive. Reinforcing silica aerogels with polyaniline allowed them to be used as a sensor for the detection of protonating and deprotonating gaseous species. Finally we developed a new approach for the synthesis of silica and bridged polysilsesquioxane spheres using a surfactant free synthesis. This approach allowed for the first in-situ incorporation of base sensitive functionalities during the sol-gel polymerization.

  11. Sonochemical synthesis of (3-aminopropyl)triethoxysilane-modified monodispersed silica nanoparticles for protein immobilization

    SciTech Connect

    Shen, Shou-Cang; Ng, Wai Kiong; Chia, Leonard; Dong, Yuan-Cai; Tan, Reginald B.H.

    2011-10-15

    Graphical abstract: 3-Aminopropyltriethoxysilane modified monodispersed silica nanoparticles were synthesized by rapid sonochemical co-condensation to achieve high capability for protein immobilization. Highlights: {yields} Amino-modified monodispersed silica nanoparticles were synthesized by rapid co-condensation. {yields} Strong positive charge was created by aminopropyl-modification. {yields} Capability for immobilization of negatively charged protein was enhanced. {yields} Electrostatic interaction between proteins and surface contributed to the enhanced adsorption. -- Abstract: 3-Aminopropyltriethoxysilane modified monodispersed silica nanoparticles were synthesized by a rapid sonochemical co-condensation synthesis procedure. The chemical nature of surface organic modifier on the obtained modified silica nanoparticle was characterized by {sup 13}C and {sup 29}Si MAS Nuclear Magnetic Resonance (NMR) spectroscopies, Fourier-transform infrared spectroscopy (FTIR), thermogravimetric analysis (TGA)- differential scanning calorimetry (DSC). Due to the strengthened positive surface charge of the silica nanoparticles by the modification with aminopropyl groups, the capability for bovine serum albumin (BSA) adsorption was significantly increased as compared with bare silica nanoparticles. 80 mg/g BSA was adsorbed on modified silica nanoparticles, whereas only 20 mg/g BSA could be loaded on pure silica nanoparticles. The enhanced positive surface charge repelled proteins with net positive charge and the modified silica nanoparticles exhibited negligible adsorption of lysozyme, thus a selective adsorption of proteins could be achieved.

  12. A study of water chemistry extends the benefits of using silica-based nanoparticles on enhanced oil recovery

    NASA Astrophysics Data System (ADS)

    Hendraningrat, Luky; Torsæter, Ole

    2016-01-01

    Chemistry of the injected water has been investigated as an important parameter to improve/enhance oil recovery (IOR/EOR). Numerous extensive experiments have observed that water chemistry, such as ionic composition and salinity, can be modified for IOR/EOR purposes. However, the possible oil displacement mechanism remains debatable. Nanoparticle recently becomes more popular that have shown a great potential for IOR/EOR purposes in lab-scale, where in most experiments, water-based fluid were used as dispersed fluid. As yet, there has been no discussion in the literature on the study of water chemistry on enhanced oil recovery using silica-based nanoparticles. A broad range of laboratory studies involving rock, nanoparticles and fluid characterization; fluid-fluid and fluid-rock interactions; surface conductivity measurement; coreflood experiment; injection strategy formulation; filtration mechanism and contact angle measurement are conducted to investigate the impact of water chemistry, such as water salinity and ionic composition including hardness cations, on the performance of silica-based nanoparticles in IOR/EOR process and reveal possible displacement mechanism. The experimental results demonstrated that water salinity and ionic composition significantly impacted oil recovery using hydrophilic silica-based nanoparticles and that the oil recovery increased with the salinity. The primary findings from this study are that the water salinity, the ionic composition and the injection strategy are important parameters to be considered in Nano-EOR.

  13. Multimodality Imaging with Silica-Based Targeted Nanoparticle Platforms

    SciTech Connect

    Jason S. Lewis

    2012-04-09

    Objectives: To synthesize and characterize a C-Dot silica-based nanoparticle containing 'clickable' groups for the subsequent attachment of targeting moieties (e.g., peptides) and multiple contrast agents (e.g., radionuclides with high specific activity) [1,2]. These new constructs will be tested in suitable tumor models in vitro and in vivo to ensure maintenance of target-specificity and high specific activity. Methods: Cy5 dye molecules are cross-linked to a silica precursor which is reacted to form a dye-rich core particle. This core is then encapsulated in a layer of pure silica to create the core-shell C-Dot (Figure 1) [2]. A 'click' chemistry approach has been used to functionalize the silica shell with radionuclides conferring high contrast and specific activity (e.g. 64Cu and 89Zr) and peptides for tumor targeting (e.g. cRGD and octreotate) [3]. Based on the selective Diels-Alder reaction between tetrazine and norbornene, the reaction is bioorthogonal, highyielding, rapid, and water-compatible. This radiolabeling approach has already been employed successfully with both short peptides (e.g. octreotate) and antibodies (e.g. trastuzumab) as model systems for the ultimate labeling of the nanoparticles [1]. Results: PEGylated C-Dots with a Cy5 core and labeled with tetrazine have been synthesized (d = 55 nm, zeta potential = -3 mV) reliably and reproducibly and have been shown to be stable under physiological conditions for up to 1 month. Characterization of the nanoparticles revealed that the immobilized Cy5 dye within the C-Dots exhibited fluorescence intensities over twice that of the fluorophore alone. The nanoparticles were successfully radiolabeled with Cu-64. Efforts toward the conjugation of targeting peptides (e.g. cRGD) are underway. In vitro stability, specificity, and uptake studies as well as in vivo imaging and biodistribution investigations will be presented. Conclusions: C-Dot silica-based nanoparticles offer a robust, versatile, and multi

  14. Shape dependence of nonlinear optical behaviors of nanostructured silver and their silica gel glass composites

    SciTech Connect

    Zheng Chan; Du Yuhong; Feng Miao; Zhan Hongbing

    2008-10-06

    Nanostructured Ag in shapes of nanoplate, nanowire, and nanoparticle, as well as their silica gel glass composites have been prepared and characterized. Nonlinear optical (NLO) properties were measured at 532 and 1064 nm using open aperture z-scan technique and studied from the view of shape effect. NLO behaviors of the nanostructured Ag are found to be shape dependent in suspensions at both the investigated wavelengths, although they originate differently. Comparing to the mother suspensions, the Ag/silica gel glass nanocomposites present rather dissimilar NLO behaviors, which is quite interesting for further studies.

  15. Biocide silver nanoparticles in two different silica-based coating

    NASA Astrophysics Data System (ADS)

    Babapour, A.; Yang, B.; Bahang, S.; Cao, W.

    2012-09-01

    Silica-based coatings containing biocide silver nanoparticles have been synthesized using low temperature sol-gel method. Two different silane based matrices, phenyltriethoxysilane (PhTEOS) and tetraethyl orthosilicate (TEOS), were selected as precursor to prepare silica-based film. The films were analyzed by using UV-visible spectrophotometry, atomic force microscopy (AFM) and scanning electron microscopy (SEM) for their optical, surface morphological as well as structural properties. Optical properties of nanosilver in these two matrices showed that the peak absorption observed at different wavelength, which is due to the fact that optical absorption of nanoparticles is affected by the surrounding medium. It is also found that the silver absorption has higher intensity in PhTEOS than in TEOS matrix, indicating higher concentration of silver nanoparticles being loaded into the coating. To study silver release property, the films were immersed in water for 12 and 20 days. AFM and SEM analyzes present that higher concentration of silver nanoparticles and smaller particle sizes were synthesis in PhTEOS coating and consequently, more particles remains on the surfaces after 20 days which leads to longer antibacterial activity of PhTEOS coating.

  16. M2 polarization enhances silica nanoparticle uptake by macrophages

    PubMed Central

    Hoppstädter, Jessica; Seif, Michelle; Dembek, Anna; Cavelius, Christian; Huwer, Hanno; Kraegeloh, Annette; Kiemer, Alexandra K.

    2015-01-01

    While silica nanoparticles have enabled numerous industrial and medical applications, their toxicological safety requires further evaluation. Macrophages are the major cell population responsible for nanoparticle clearance in vivo. The prevailing macrophage phenotype largely depends on the local immune status of the host. Whereas M1-polarized macrophages are considered as pro-inflammatory macrophages involved in host defense, M2 macrophages exhibit anti-inflammatory and wound-healing properties, but also promote tumor growth. We employed different models of M1 and M2 polarization: granulocyte-macrophage colony-stimulating factor/lipopolysaccharide (LPS)/interferon (IFN)-γ was used to generate primary human M1 cells and macrophage colony-stimulating factor (M-CSF)/interleukin (IL)-10 to differentiate M2 monocyte-derived macrophages (MDM). PMA-differentiated THP-1 cells were polarized towards an M1 type by LPS/IFN-γ and towards M2 by IL-10. Uptake of fluorescent silica nanoparticles (Ø26 and 41 nm) and microparticles (Ø1.75 μm) was quantified. At the concentration used (50 μg/ml), silica nanoparticles did not influence cell viability as assessed by MTT assay. Nanoparticle uptake was enhanced in M2-polarized primary human MDM compared with M1 cells, as shown by flow cytometric and microscopic approaches. In contrast, the uptake of microparticles did not differ between M1 and M2 phenotypes. M2 polarization was also associated with increased nanoparticle uptake in the macrophage-like THP-1 cell line. In accordance, in vivo polarized M2-like primary human tumor-associated macrophages obtained from lung tumors took up more nanoparticles than M1-like alveolar macrophages isolated from the surrounding lung tissue. In summary, our data indicate that the M2 polarization of macrophages promotes nanoparticle internalization. Therefore, the phenotypical differences between macrophage subsets should be taken into consideration in future investigations on nanosafety, but

  17. M2 polarization enhances silica nanoparticle uptake by macrophages.

    PubMed

    Hoppstädter, Jessica; Seif, Michelle; Dembek, Anna; Cavelius, Christian; Huwer, Hanno; Kraegeloh, Annette; Kiemer, Alexandra K

    2015-01-01

    While silica nanoparticles have enabled numerous industrial and medical applications, their toxicological safety requires further evaluation. Macrophages are the major cell population responsible for nanoparticle clearance in vivo. The prevailing macrophage phenotype largely depends on the local immune status of the host. Whereas M1-polarized macrophages are considered as pro-inflammatory macrophages involved in host defense, M2 macrophages exhibit anti-inflammatory and wound-healing properties, but also promote tumor growth. We employed different models of M1 and M2 polarization: granulocyte-macrophage colony-stimulating factor/lipopolysaccharide (LPS)/interferon (IFN)-γ was used to generate primary human M1 cells and macrophage colony-stimulating factor (M-CSF)/interleukin (IL)-10 to differentiate M2 monocyte-derived macrophages (MDM). PMA-differentiated THP-1 cells were polarized towards an M1 type by LPS/IFN-γ and towards M2 by IL-10. Uptake of fluorescent silica nanoparticles (Ø26 and 41 nm) and microparticles (Ø1.75 μm) was quantified. At the concentration used (50 μg/ml), silica nanoparticles did not influence cell viability as assessed by MTT assay. Nanoparticle uptake was enhanced in M2-polarized primary human MDM compared with M1 cells, as shown by flow cytometric and microscopic approaches. In contrast, the uptake of microparticles did not differ between M1 and M2 phenotypes. M2 polarization was also associated with increased nanoparticle uptake in the macrophage-like THP-1 cell line. In accordance, in vivo polarized M2-like primary human tumor-associated macrophages obtained from lung tumors took up more nanoparticles than M1-like alveolar macrophages isolated from the surrounding lung tissue. In summary, our data indicate that the M2 polarization of macrophages promotes nanoparticle internalization. Therefore, the phenotypical differences between macrophage subsets should be taken into consideration in future investigations on nanosafety, but

  18. Sodium hydroxide catalyzed monodispersed high surface area silica nanoparticles

    NASA Astrophysics Data System (ADS)

    Bhakta, Snehasis; Dixit, Chandra K.; Bist, Itti; Abdel Jalil, Karim; Suib, Steven L.; Rusling, James F.

    2016-07-01

    Understanding of the synthesis kinetics and our ability to modulate medium conditions allowed us to generate nanoparticles via an ultra-fast process. The synthesis medium is kept quite simple with tetraethyl orthosilicate (TEOS) as precursor and 50% ethanol and sodium hydroxide catalyst. Synthesis is performed under gentle conditions at 20 °C for 20 min Long synthesis time and catalyst-associated drawbacks are most crucial in silica nanoparticle synthesis. We have addressed both these bottlenecks by replacing the conventional Stober catalyst, ammonium hydroxide, with sodium hydroxide. We have reduced the overall synthesis time from 20 to 1/3 h, ∼60-fold decrease, and obtained highly monodispersed nanoparticles with 5-fold higher surface area than Stober particles. We have demonstrated that the developed NPs with ∼3-fold higher silane can be used as efficient probes for biosensor applications.

  19. Morphology and Optical Properties of Bare and Silica Coated Hybrid Silver Nanoparticles.

    PubMed

    Ghimire, Sushant; Lebek, Werner; Godehardt, Reinhold; Lee, Wan In; Adhikari, Rameshwar

    2016-05-01

    Owing to their wide applications in the field of optoelectronics, photonics, catalysis, and medicine; plasmonic metal nanoparticles are attaining considerable interest nowadays. The optical properties of these metal nanoparticles depend upon their size, shape, and surrounding medium. The present work studies the morphology and optical properties of bare silver nanoparticles and silica coated hybrid silver nanoparticles. Aqueous phase mediated synthesis and water-in-oil microemulsion mediated synthesis are two different wet chemical routes employed for nanosynthesis. Direct coating of silica is performed in water-in-oil microemulsion on pre-synthesized silver nanoparticles using tetraethyl orthosilicate as silica precursor. This study shows that using different wet chemical routes the size of the synthesized nanoparticles could be tuned. In addition, using reverse micelles as nanoreactors, the thickness of the silica shell around the core silver nanoparticles could be significantly controlled. Further, the optical properties of silver nanoparticles could be adjusted through the size and the surface coating. PMID:27483900

  20. Microwave-assisted silica coating and photocatalytic activities of ZnO nanoparticles

    SciTech Connect

    Siddiquey, Iqbal Ahmed; Furusawa, Takeshi; Sato, Masahide; Suzuki, Noboru

    2008-12-01

    A new and rapid method for silica coating of ZnO nanoparticles by the simple microwave irradiation technique is reported. Silica-coated ZnO nanoparticles were characterized by X-ray photoelectron spectroscopy (XPS), Fourier transform infrared spectroscopy (FT-IR), high-resolution transmission electron microscopy (HR-TEM), CHN elemental analysis and zeta potential measurements. The FT-IR spectra and XPS clearly confirmed the silica coating on ZnO nanoparticles. The results of XPS analysis showed that the elements in the coating at the surface of the ZnO nanoparticles were Zn, O and Si. HR-TEM micrographs revealed a continuous and uniform dense silica coating layer of about 3 nm in thickness on the surface of ZnO nanoparticles. In addition, the silica coating on the ZnO nanoparticles was confirmed by the agreement in the zeta potential of the silica-coated ZnO nanoparticles with that of SiO{sub 2}. The results of the photocatalytic degradation of methylene blue (MB) in aqueous solution showed that silica coating effectively reduced the photocatalytic activity of ZnO nanoparticles. Silica-coated ZnO nanoparticles showed excellent UV shielding ability and visible light transparency.

  1. Monodisperse Mesoporous Carbon Nanoparticles from Polymer/Silica Self-Aggregates and Their Electrocatalytic Activities.

    PubMed

    Huang, Xiaoxi; Zhou, Li-Jing; Voiry, Damien; Chhowalla, Manish; Zou, Xiaoxin; Asefa, Tewodros

    2016-07-27

    In our quest to make various chemical processes sustainable, the development of facile synthetic routes and inexpensive catalysts can play a central role. Herein we report the synthesis of monodisperse, polyaniline (PANI)-derived mesoporous carbon nanoparticles (PAMCs) that can serve as efficient metal-free electrocatalysts for the hydrogen peroxide reduction reaction (HPRR) as well as the oxygen reduction reaction (ORR) in fuel cells. The materials are synthesized by polymerization of aniline with the aid of (NH4)2S2O8 as oxidant and colloidal silica nanoparticles as templates, then carbonization of the resulting PANI/silica composite material at different high temperatures, and finally removal of the silica templates from the carbonized products. The PAMC materials that are synthesized under optimized synthetic conditions possess monodisperse mesoporous carbon nanoparticles with an average size of 128 ± 12 nm and an average pore size of ca. 12 nm. Compared with Co3O4, a commonly used electrocatalyst for HPRR, these materials show much better catalytic activity for this reaction. In addition, unlike Co3O4, the PAMCs remain relatively stable during the reaction, under both basic and acidic conditions. The nanoparticles also show good electrocatalytic activity toward ORR. Based on the experimental results, PAMCs' excellent electrocatalytic activity is attributed partly to their heteroatom dopants and/or intrinsic defect sites created by vacancies in their structures and partly to their high porosity and surface area. The reported synthetic method is equally applicable to other polymeric precursors (e.g., polypyrrole (PPY)), which also produces monodisperse, mesoporous carbon nanoparticles in the same way. The resulting materials are potentially useful not only for electrocatalysis of HPRR and ORR in fuel cells but also for other applications where high surface area, small sized, nanostructured carbon materials are generally useful for (e.g., adsorption

  2. Preparation, characterization and FE-simulation of the reinforcement of polycaprolactone with PEGylated silica nanoparticles

    NASA Astrophysics Data System (ADS)

    Moussaif, N.; Viejo, I.; Bielsa, J. M.; Crespo, C.; Irusta, S.; Yagüe, C.; Meier, J. G.

    2012-09-01

    We recently published the preparation and characterization of polycaprolactone (PCL) nanocomposites with a 45% increased modulus reinforced with only 4 wt% PEGylated silica (polyethylene-glycol/SiO2) nanoparticles obtained by melt-extrusion [1]. The achieved reinforcement is related to an excellent dispersion of the nanoparticles due to the polyethylene-glycol graft of the nanoparticles which was obtained by a simple one-pot synthesis. X-ray photoelectron spectroscopy (XPS) and infrared spectroscopy (FTIR) analyses identified the location of the PEG at the PCL/silica interface. However, the extension of the interface could not be resolved. In an attempt to describe the effect of the interface on the reinforcement we applied several analytical micromechanical models. Models considering core-shell systems fitted the experimental data well and gave estimations of the modulus and extension of the interphase. However, different sets of parameters gave equally good representations. In an alternative approach, 3D representative volume elements (RVE) of the composite with spherical nanoparticles including the shell were built-up from the morphological data to carry out computational micromechanics based on finite elements (FE). The interphase was modeled in the RVE. Both approaches demonstrated the need of an interphase extension of roughly twice the radius of the particle. The FEM approach estimates the interface-modulus much higher than the analytical models.

  3. Synthesis and Characterization of Bionanoparticle-Silica Composites and Mesoporous Silica with Large Pores

    SciTech Connect

    Niu, Z.; Yang, L.; Kabisatpathy, S.; He, J.; Lee, A.; Ron, J.; Sikha, G.; Popov, B.N.; Emrick, T.; Russell, T. P.; Wang. Q.

    2009-03-24

    A sol-gel process has been developed to incorporate bionanoparticles, such as turnip yellow mosaic virus, cowpea mosaic virus, tobacco mosaic virus, and ferritin into silica, while maintaining the integrity and morphology of the particles. The structures of the resulting materials were characterized by transmission electron microscopy, small angle X-ray scattering, and N{sub 2} adsorption-desorption analysis. The results show that the shape and surface morphology of the bionanoparticles are largely preserved after being embedded into silica. After removal of the bionanoparticles by calcination, mesoporous silica with monodisperse pores, having the shape and surface morphology of the bionanoparticles replicated inside the silica, was produced,. This study is expected to lead to both functional composite materials and mesoporous silica with structurally well-defined large pores.

  4. Chemoradiotherapeutic wrinkled mesoporous silica nanoparticles for use in cancer therapy

    NASA Astrophysics Data System (ADS)

    Munaweera, Imalka; Koneru, Bhuvaneswari; Shi, Yi; Di Pasqua, Anthony J.; Balkus, Kenneth J., Jr.

    2014-11-01

    Over the last decade, the development and application of nanotechnology in cancer detection, diagnosis, and therapy have been widely reported. Engineering of vehicles for the simultaneous delivery of chemo- and radiotherapeutics increases the effectiveness of the therapy and reduces the dosage of each individual drug required to produce an observable therapeutic response. We here developed a novel chemoradiotherapeutic 1,2-dioleoyl-sn-glycero-3-phosphocholine lipid coated/uncoated platinum drug loaded, holmium-containing, wrinkled mesoporous silica nanoparticle. The materials were characterized with TEM, FTIR, 1H NMR, energy dispersive x-ray, inductively coupled plasma-mass spectrometry, and zeta potential measurements. In vitro platinum drug release from both lipid coated and uncoated chemoradiotherapeutic wrinkled mesoporous silica are reported. Various kinetic models were used to analyze the release kinetics. The radioactivity of the chemoradiotherapeutic nanocarriers was measured after neutron-activation.

  5. Chemoradiotherapeutic wrinkled mesoporous silica nanoparticles for use in cancer therapy

    SciTech Connect

    Munaweera, Imalka; Balkus, Kenneth J. Jr. E-mail: Anthony.DiPasqua@unthsc.edu; Koneru, Bhuvaneswari; Shi, Yi; Di Pasqua, Anthony J. E-mail: Anthony.DiPasqua@unthsc.edu

    2014-11-01

    Over the last decade, the development and application of nanotechnology in cancer detection, diagnosis, and therapy have been widely reported. Engineering of vehicles for the simultaneous delivery of chemo- and radiotherapeutics increases the effectiveness of the therapy and reduces the dosage of each individual drug required to produce an observable therapeutic response. We here developed a novel chemoradiotherapeutic 1,2-dioleoyl-sn-glycero-3-phosphocholine lipid coated/uncoated platinum drug loaded, holmium-containing, wrinkled mesoporous silica nanoparticle. The materials were characterized with TEM, FTIR, {sup 1}H NMR, energy dispersive x-ray, inductively coupled plasma-mass spectrometry, and zeta potential measurements. In vitro platinum drug release from both lipid coated and uncoated chemoradiotherapeutic wrinkled mesoporous silica are reported. Various kinetic models were used to analyze the release kinetics. The radioactivity of the chemoradiotherapeutic nanocarriers was measured after neutron-activation.

  6. Electrical resistivity of assembled transparent inorganic oxide nanoparticle thin layers: Influence of silica, insulating impurities and surfactant layer thickness

    PubMed Central

    Bubenhofer, Stephanie B.; Schumacher, Christoph M.; Koehler, Fabian M.; Luechinger, Norman A.; Sotiriou, Georgios A.; Grass, Robert N.; Stark, Wendelin J.

    2013-01-01

    Transparent, conductive layers prepared from nanoparticle dispersion of doped oxides are highly sensitive to impurities. Currently investigated cost efficient and fast production of thin conducting films for use in consumer electronics relies on wet processing such as spin and/or dip coating of surfactant-stabilized nanoparticle dispersions. This inherently results in entrainment of organic and inorganic impurities into the conducting layer leading to largely varying electrical conductivity. Therefore this study provides a systematic investigation on the effect of insulating surfactants, small organic molecules and silica in terms of pressure dependent electrical conductivity as a result of different core/shell structure (layer thickness). Application of high temperature flame synthesis gives access to antimony-doped tin oxide (ATO) nanoparticles with high purity. This well-defined starting material was then subjected to representative film preparation processes using organic additives. In addition ATO nanoparticles were prepared with a homogeneous inorganic silica layer (silica layer thickness from 0.7 to 2 nm). Testing both organic and inorganic shell materials for the electronic transport through the nanoparticle composite allowed a systematic study on the influence of surface adsorbates (e.g. organic, insulating materials on the conducting nanoparticle’s surface) in comparison to well-known insulators such as silica. Insulating impurities or shells revealed a dominant influence of tunneling effect on the overall layer resistance. Mechanical relaxation phenomena were found for 2 nm insulating shells for both large polymer surfactants and (inorganic) SiO2 shells. PMID:22545730

  7. The infrared fingerprint signals of silica nanoparticles and its application in immunoassay

    NASA Astrophysics Data System (ADS)

    Ding, Yadan; Chu, Xueying; Hong, Xia; Zou, Peng; Liu, Yichun

    2012-01-01

    Infrared absorption properties of silica nanoparticles were studied. The transverse optical and the longitudinal optical phonon modes from the silica were proved to be the characteristic spectroscopic fingerprint signals. Based on this, a sandwich-structured immunoassay was performed, and the detection of the analyte (human IgG) was achieved by using biofunctional silica nanoparticles as infrared probes. The immunoassay based on Fourier transform infrared reflection absorption spectroscopy of silica nanoparticles shows significant value for potential applications in many areas, such as biomedicine, food safety, and waste treatment.

  8. One-pot synthesis of silica-coated copper nanoparticles with high chemical and thermal stability.

    PubMed

    Shiomi, Shohei; Kawamori, Makoto; Yagi, Shunsuke; Matsubara, Eiichiro

    2015-12-15

    With the recent development of nanotechnology, enhancement of the stability of nanomaterials is becoming ever more important for their practical applications. We studied the silica-coating of Cu nanoparticles and the enhanced stability of silica-coated Cu nanoparticles to oxidation. The metallic nanoparticles are easily oxidized and agglomerated compared with the bulk metals because the nanoparticles possess large specific surfaces. The Cu nanoparticle is one of the most difficult nanoparticles to be handled due to its absence of the oxidation stability. In the synthesis of silica-coated Cu nanoparticles via a sol-gel process using tetraethyl orthosilicate, the addition of NH3 as a catalyst of sol-gel reaction yielded homogeneous silica-coating. However, a large amount of Cu nanoparticles is instantly dissolved by forming complex ions in a NH3 solution during and before the silica-coating process. This is the difficulty in the silica-coating of Cu nanoparticles. In the present work, the dissolution behavior of Cu nanoparticles was electrochemically examined. This electrochemistry-based optimization of reducing power of a reaction bath enabled us to synthesize the silica-coated Cu nanoparticle via a consecutive liquid-phase reaction which requires only basic equipment and involves no separate centrifuging or extraction step. Cu nanoparticles coated by silica shells had the remarkable stability even in the presence of a strong oxidizing agent. Furthermore, we demonstrated that the highly stable Cu nanoparticles can be applied to a red pigment using a unique red color of Cu nanoparticles because of its surface plasmon resonance. PMID:26313712

  9. Microwave attenuation of multiwalled carbon nanotube-fused silica composites

    SciTech Connect

    Xiang Changshu; Pan Yubai; Liu Xuejian; Sun Xingwei; Shi Xiaomei; Guo Jingkun

    2005-09-19

    Multiwalled carbon nanotubes (MWCNTs) were used to convert radome materials to microwave absorbing materials. Dense MWCNT-fused silica composites were prepared by hot-pressing technique. The composites exhibit high complex permittivities at X-band frequencies, depending on the content of MWCNTs. The value of the loss tangent increases three orders over pure fused silica only by incorporating 2.5 vol % MWCNTs into the composites. The average magnitude of microwave transmission reaches -33 dB at 11-12 GHz in the 10 vol % MWCNT-fused silica composites, which indicates the composites have excellent microwave attenuation properties. The attenuation properties mainly originate from the electric loss of MWCNTs by the motion of conducting electrons.

  10. Observation of blue phase in chiral nematic liquid crystal and its stabilization by silica nanoparticles

    NASA Astrophysics Data System (ADS)

    Singh, Arshdeep; Malik, Praveen; Jayoti, Divya

    2016-01-01

    In the present work, we report the blue phase (BP) in a binary mixture of cholesteryl nonanoate (CN) and N-(4-ethoxybenzylidene)-4-butylaniline (EBBA). The mixture exhibits BP over a temperature range of 2.3 K at optimum composition (50:50) of liquid crystals (LCs). The effect of silica nanoparticles (SNPs) doping on thermal stability of BPs has also been demonstrated and nearly 6 K wide BP temperature range was achieved at 0.5 wt.% of SNPs. A porous type texture was also observed during the BP formation process in the doped samples.

  11. Producing ultra-thin silica coatings on iron-oxide nanoparticles to improve their surface reactivity

    NASA Astrophysics Data System (ADS)

    Kralj, Slavko; Makovec, Darko; Čampelj, Stanislav; Drofenik, Miha

    2010-07-01

    The reactivity of the relatively inert surfaces of iron-oxide magnetic nanoparticles can be significantly improved by coating the surfaces with silica. Unfortunately, however, this nonmagnetic silica layer tends to dilute the magnetic properties of the nanoparticles. Therefore, the silica layer should be as continuous, homogeneous, and as thin as possible. In this investigation we coated superparamagnetic maghemite nanoparticles by hydrolysis and the polycondensation of tetraethyl orthosilicate (TEOS), with the ethanol solution of TEOS being added to a stable suspension of citric acid-coated nanoparticles. The influences of the various parameters of the procedure on the quality of the coatings were systematically evaluated. The quality of the silica layer was characterized using electron microscopy and by performing leaching of the nanoparticles in HCl, while the surface reactivity was tested by grafting (3-aminopropyl) triethoxysilane (APS) onto the nanoparticles. We observed that the surface concentration of the grafted APS strongly increased when the nanoparticles were coated with a silica layer. The choice of experimental conditions for the coating procedure that favors the heterogeneous nucleation of silica on the surfaces of the nanoparticles enabled the preparation of very thin silica layers, less than 2 nm thick. By decreasing the amount of added TEOS to correspond to a monolayer of -Si-OH at the nanoparticles' surfaces, their surface reactivity could be very much improved, and with a reduction in their magnetization of only ˜10%.

  12. Passive targeting of ischemic-reperfused myocardium with adenosine-loaded silica nanoparticles

    PubMed Central

    Galagudza, Michael; Korolev, Dmitry; Postnov, Viktor; Naumisheva, Elena; Grigorova, Yulia; Uskov, Ivan; Shlyakhto, Eugene

    2012-01-01

    Pharmacological agents suggested for infarct size limitation have serious side effects when used at cardioprotective doses which hinders their translation into clinical practice. The solution to the problem might be direct delivery of cardioprotective drugs into ischemic-reperfused myocardium. In this study, we explored the potential of silica nanoparticles for passive delivery of adenosine, a prototype cardioprotective agent, into ischemic-reperfused heart tissue. In addition, the biodegradation of silica nanoparticles was studied both in vitro and in vivo. Immobilization of adenosine on the surface of silica nanoparticles resulted in enhancement of adenosine-mediated infarct size limitation in the rat model. Furthermore, the hypotensive effect of adenosine was attenuated after its adsorption on silica nanoparticles. We conclude that silica nanoparticles are biocompatible materials that might potentially be used as carriers for heart-targeted drug delivery. PMID:22619519

  13. Fluorescent Silica Nanoparticles with Multivalent Inhibitory Effects towards Carbonic Anhydrases.

    PubMed

    Touisni, Nadia; Kanfar, Nasreddine; Ulrich, Sébastien; Dumy, Pascal; Supuran, Claudiu T; Mehdi, Ahmad; Winum, Jean-Yves

    2015-07-13

    Multifunctional silica nanoparticles decorated with fluorescent and sulfonamide carbonic anhydrase (CA) inhibitors were prepared and investigated as multivalent enzyme inhibitors against the cytosolic isoforms hCA I and II and the transmembrane tumor-associated ones hCA IX and XII. Excellent inhibitory effects were observed with these nanoparticles, with KI values in the low nanomolar range (6.2-0.67 nM) against all tested isozymes. A significant multivalency effect was seen for the inhibition of the monomeric enzymes hCA I and II compared to the dimeric hCA IX and hCA XII isoforms, where no multivalent effect was observed, suggesting that the multivalent binding is occurring through enzyme clustering. PMID:25965260

  14. Mesoporous-Silica-Functionalized Nanoparticles for Drug Delivery.

    PubMed

    Giret, Simon; Wong Chi Man, Michel; Carcel, Carole

    2015-09-28

    The ever-growing interest for finding efficient and reliable methods for treatment of diseases has set a precedent for the design and synthesis of new functional hybrid materials, namely porous nanoparticles, for controlled drug delivery. Mesoporous silica nanoparticles (MSNPs) represent one of the most promising nanocarriers for drug delivery as they possess interesting chemical and physical properties, thermal and mechanical stabilities, and are biocompatibile. In particular, their easily functionalizable surface allows a large number of property modifications further improving their efficiency in this field. This Concept article deals with the advances on the novel methods of functionalizing MSNPs, inside or outside the pores, as well as within the walls, to produce efficient and smart drug carriers for therapy. PMID:26250991

  15. Lysosomal Dysfunction Caused by Cellular Accumulation of Silica Nanoparticles.

    PubMed

    Schütz, Irene; Lopez-Hernandez, Tania; Gao, Qi; Puchkov, Dmytro; Jabs, Sabrina; Nordmeyer, Daniel; Schmudde, Madlen; Rühl, Eckart; Graf, Christina M; Haucke, Volker

    2016-07-01

    Nanoparticles (NPs) are widely used as components of drugs or cosmetics and hold great promise for biomedicine, yet their effects on cell physiology remain poorly understood. Here we demonstrate that clathrin-independent dynamin 2-mediated caveolar uptake of surface-functionalized silica nanoparticles (SiNPs) impairs cell viability due to lysosomal dysfunction. We show that internalized SiNPs accumulate in lysosomes resulting in inhibition of autophagy-mediated protein turnover and impaired degradation of internalized epidermal growth factor, whereas endosomal recycling proceeds unperturbed. This phenotype is caused by perturbed delivery of cargo via autophagosomes and late endosomes to SiNP-filled cathepsin B/L-containing lysosomes rather than elevated lysosomal pH or altered mTOR activity. Given the importance of autophagy and lysosomal protein degradation for cellular proteostasis and clearance of aggregated proteins, these results raise the question of beneficial use of NPs in biomedicine and beyond. PMID:27226546

  16. Optimization of protocell of silica nanoparticles using 3² factorial designs.

    PubMed

    Kaur, Gunjeet; Rath, Goutam; Heer, Hemraj; Goyal, Amit K

    2012-03-01

    The purpose of the research is to carry out systemic optimization of protocells (liposomes entrapped with silica particles). Optimization was carried out using 3(2) factorial designs for the selection of the optimized protocell composition with reference to particle size distribution and zetapotential. This design was carried out to study the effect of independent variables such as molar ratio of phosphatidylcholine to cholesterol and concentration of silica nanoparticles. A total of nine formulations of protocells were prepared and analyzed using Design expert® software from Stat-Ease, Inc. (Version 8.0.4.1 trial 2010) for the selection of the optimized combination. Contour plots were constructed with independent variables like size and potential. Protocell with 7:3 ratio of phosphatidyl choline to cholesterol and 0.5 mg/ml of silica nanoparticles demonstrated better colloidal behaviors. The findings obtained from the software corresponding to independent variables demonstrated accurate means for the optimization of the pharmaceutical formulations. PMID:22173376

  17. Size-dependent interaction of silica nanoparticles with different surfactants in aqueous solution.

    PubMed

    Kumar, Sugam; Aswal, Vinod K; Kohlbrecher, Joachim

    2012-06-26

    The size-dependent interaction of anionic silica nanoparticles with ionic (anionic and cationic) and nonionic surfactants has been studied using small-angle neutron scattering (SANS). The surfactants used are anionic sodium dodecyl sulfate (SDS), cationic dodecyltrimethyl ammonium bromide (DTAB), and nonionic decaoxyethylene n-dodecylether (C(12)E(10)). The measurements have been carried out for three different sizes of silica nanoparticles (8, 16, and 26 nm) at fixed concentrations (1 wt % each) of nanoparticles and surfactants. It is found that irrespective of the size of the nanoparticles there is no significant interaction evolved between like-charged nanoparticles and the SDS micelles leading to any structural changes. However, the strong attraction of oppositely charged DTAB micelles with silica nanoparticles results in the aggregation of nanoparticles. The number of micelles mediating the nanoparticle aggregation increases with the size of the nanoparticle. The aggregates are characterized by fractal structure where the fractal dimension is found to be constant (D ≈ 2.3) independent of the size of the nanoparticles and consistent with diffusion-limited-aggregation-type fractal morphology in these systems. In the case of nonionic surfactant C(12)E(10), micelles interact with the individual silica nanoparticles. The number of adsorbed micelles per nanoparticle increases drastically whereas the percentage of adsorbed micelles on nanoparticles decreases with the increase in the size of the nanoparticles. PMID:22655980

  18. Bifunctional hairy silica nanoparticles as high-performance additives for lubricant

    PubMed Central

    Sui, Tianyi; Song, Baoyu; Wen, Yu-ho; Zhang, Feng

    2016-01-01

    Bifunctional hairy silica nanoparticles (BHSNs), which are silica nanoparticles covered with alkyl and amino organic chains, were prepared as high-performance additives for lubricants. Compared with hairy silica nanoparticles covered by a single type of organic chain, binary hairy silica nanoparticles exhibit the advantages of both types of organic chains, which exhibit excellent compatibility with lubricants and adsorbability to metal surfaces. Nanoparticles with different ratios of amino and alkyl ligands were investigated. In comparison to an untreated lubricant, BHSNs reduce the friction coefficient and wear scar diameter by 40% and 60%, respectively. The wear mechanism of BHSNs was investigated, and the protective and filling effect of the nanoparticles improved because of collaboration of amino and alkyl ligands. PMID:26936117

  19. Bifunctional hairy silica nanoparticles as high-performance additives for lubricant.

    PubMed

    Sui, Tianyi; Song, Baoyu; Wen, Yu-Ho; Zhang, Feng

    2016-01-01

    Bifunctional hairy silica nanoparticles (BHSNs), which are silica nanoparticles covered with alkyl and amino organic chains, were prepared as high-performance additives for lubricants. Compared with hairy silica nanoparticles covered by a single type of organic chain, binary hairy silica nanoparticles exhibit the advantages of both types of organic chains, which exhibit excellent compatibility with lubricants and adsorbability to metal surfaces. Nanoparticles with different ratios of amino and alkyl ligands were investigated. In comparison to an untreated lubricant, BHSNs reduce the friction coefficient and wear scar diameter by 40% and 60%, respectively. The wear mechanism of BHSNs was investigated, and the protective and filling effect of the nanoparticles improved because of collaboration of amino and alkyl ligands. PMID:26936117

  20. Bifunctional hairy silica nanoparticles as high-performance additives for lubricant

    NASA Astrophysics Data System (ADS)

    Sui, Tianyi; Song, Baoyu; Wen, Yu-Ho; Zhang, Feng

    2016-03-01

    Bifunctional hairy silica nanoparticles (BHSNs), which are silica nanoparticles covered with alkyl and amino organic chains, were prepared as high-performance additives for lubricants. Compared with hairy silica nanoparticles covered by a single type of organic chain, binary hairy silica nanoparticles exhibit the advantages of both types of organic chains, which exhibit excellent compatibility with lubricants and adsorbability to metal surfaces. Nanoparticles with different ratios of amino and alkyl ligands were investigated. In comparison to an untreated lubricant, BHSNs reduce the friction coefficient and wear scar diameter by 40% and 60%, respectively. The wear mechanism of BHSNs was investigated, and the protective and filling effect of the nanoparticles improved because of collaboration of amino and alkyl ligands.

  1. Silica nanoparticles for cell imaging and intracellular sensing

    NASA Astrophysics Data System (ADS)

    Korzeniowska, B.; Nooney, R.; Wencel, D.; McDonagh, C.

    2013-11-01

    There is increasing interest in the use of nanoparticles (NPs) for biomedical applications. In particular, nanobiophotonic approaches using fluorescence offers the potential of high sensitivity and selectivity in applications such as cell imaging and intracellular sensing. In this review, we focus primarily on the use of fluorescent silica NPs for these applications and, in so doing, aim to enhance and complement the key recent review articles on these topics. We summarize the main synthetic approaches, namely the Stöber and microemulsion processes, and, in this context, we deal with issues in relation to both covalent and physical incorporation of different types of dyes in the particles. The important issue of NP functionalization for conjugation to biomolecules is discussed and strategies published in the recent literature are highlighted and evaluated. We cite recent examples of the use of fluorescent silica NPs for cell imaging in the areas of cancer, stem cell and infectious disease research, and we review the current literature on the use of silica NPs for intracellular sensing of oxygen, pH and ionic species. We include a short final section which seeks to identify the main challenges and obstacles in relation to the potential widespread use of these particles for in vivo diagnostics and therapeutics.

  2. Colloidal mesoporous silica nanoparticles enhance the biological activity of resveratrol.

    PubMed

    Summerlin, Natalie; Qu, Zhi; Pujara, Naisarg; Sheng, Yong; Jambhrunkar, Siddharth; McGuckin, Michael; Popat, Amirali

    2016-08-01

    The naturally occurring polyphenol resveratrol (RES) has attracted increasing attention in recent years due to its antioxidant, anti-inflammatory, and anticancer activity. However, resveratrol's promising potential as a nutraceutical is hindered by its poor aqueous solubility, which limits its biological activity. Here we show that encapsulating resveratrol in colloidal mesoporous silica nanoparticles (MCM-48-RES) enhances its saturated solubility by ∼95% and increases its in vitro release kinetics compared to pure resveratrol. MCM-48-RES showed high loading capacity (20% w/w) and excellent encapsulation efficiency (100%). When tested against HT-29 and LS147T colon cancer cell lines, MCM-48-RES-mediated in vitro cell death was higher than that of pure resveratrol, mediated via the PARP and cIAP1 pathways. Finally, MCM-48-RES treatment also inhibited lipopolysaccharide-induced NF-κB activation in RAW264.7 cells, demonstrating improved anti-inflammatory activity. More broadly, our observations demonstrate the potential of colloidal mesoporous silica nanoparticles as next generation delivery carriers for hydrophobic nutraceuticals. PMID:27060664

  3. In Caenorhabditis elegans Nanoparticle-Bio-Interactions Become Transparent: Silica-Nanoparticles Induce Reproductive Senescence

    PubMed Central

    Bossinger, Olaf; von Mikecz, Anna

    2009-01-01

    While expectations and applications of nanotechnologies grow exponentially, little is known about interactions of engineered nanoparticles with multicellular organisms. Here we propose the transparent roundworm Caenorhabditis elegans as a simple but anatomically and biologically well defined animal model that allows for whole organism analyses of nanoparticle-bio-interactions. Microscopic techniques showed that fluorescently labelled nanoparticles are efficiently taken up by the worms during feeding, and translocate to primary organs such as epithelial cells of the intestine, as well as secondary organs belonging to the reproductive tract. The life span of nanoparticle-fed Caenorhabditis elegans remained unchanged, whereas a reduction of progeny production was observed in silica-nanoparticle exposed worms versus untreated controls. This reduction was accompanied by a significant increase of the ‘bag of worms’ phenotype that is characterized by failed egg-laying and usually occurs in aged wild type worms. Experimental exclusion of developmental defects suggests that silica-nanoparticles induce an age-related degeneration of reproductive organs, and thus set a research platform for both, detailed elucidation of molecular mechanisms and high throughput screening of different nanomaterials by analyses of progeny production. PMID:19672302

  4. Interfacial interaction between the epoxidized natural rubber and silica in natural rubber/silica composites

    NASA Astrophysics Data System (ADS)

    Xu, Tiwen; Jia, Zhixin; Luo, Yuanfang; Jia, Demin; Peng, Zheng

    2015-02-01

    The epoxidized natural rubber (ENR) as an interfacial modifier was used to improve the mechanical and dynamical mechanical properties of NR/silica composites. In order to reveal the interaction mechanism between ENR and silica, the ENR/Silica model compound was prepared by using an open mill and the interfacial interaction of ENR with silica was investigated by Fourier transform infrared spectroscopy (FTIR), X-ray photoelectron spectroscopy (XPS), transmission electron microscopy (TEM), X-ray diffraction (XRD) and stress-strain testing. The results indicated that the ring-opening reaction occurs between the epoxy groups of ENR chains and Si-OH groups on the silica surfaces and the covalent bonds are formed between two phases, which can improve the dispersion of silica in the rubber matrix and enhance the interfacial combination between rubber and silica. The ring-opening reaction occurs not only in vulcanization process but also in mixing process, meanwhile, the latter seems to be more important due to the simultaneous effects of mechanical force and temperature.

  5. Thermal pretreatment of silica composite filler materials

    PubMed Central

    Wan, Quan; Ramsey, Christopher

    2010-01-01

    Three different silica filler materials were thermally treated in order to effect dehydration, dehydroxylation, and rehydroxylation. Samples were characterized by thermogravimetry (TG), pycnometry, elemental analysis, and scanning electron microscopy (SEM). For all fillers, our results indicate incremental removal of silanol groups at higher heating temperatures and irreversible dehydroxylation at over 673 K. To remove the organic content and maintain adequate silanol density for subsequent silanization on Stöber-type silica, we suggest heating at 673 K followed by overnight boiling in water. PMID:20445821

  6. Mechanized Silica Nanoparticles: A New Frontier in Theranostic Nanomedicine

    PubMed Central

    Ambrogio, Michael W.; Thomas, Courtney R.; Zhao, Yan-Li; Zink, Jeffrey I.; Stoddart, J. Fraser

    2011-01-01

    Conspectus Nanotechnology has been cited as a response to the most challenging issues facing society as a whole today. With nanoscale assemblies promising to improve on previously established therapeutic and diagnostic motifs, medicine stands to benefit significantly from advances in nanotechnology. To this end, the use of delivery platforms has attracted attention during the past decade, with researchers shifting their focus towards devising ways to deliver therapeutic and / or diagnostic agents, and away from developing new drug candidates. Metaphorically, the use of delivery platforms in medicine can be viewed as the “bow-and-arrow” approach, where the drugs are the arrows and the delivery vehicles are the bows. Even if one possesses the best arrows that money can buy, the arrows are not going to be useful if one does not have the appropriate bow to deliver the arrows to a desired location. The same can be said of drugs. Currently, a variety of strategies for delivering bioactive agents within living tissue exists. Dendrimers, polymers, micelles, vesicles, and nanoparticles have all been investigated for their use as possible delivery vehicles. With the growth of nanomedicine, one can then envisage the possibility in theranostic medicine of fabricating a vector that is capable of releasing simultaneously powerful therapeutics and diagnostic markers selectively to diseased tissue. In our design of new theranostic delivery systems, we have focused our attention on using mesoporous silica nanoparticles (SNPs). It is possible to store a payload of “cargo” molecules within such a robust platform that is stable to a wide range of chemical conditions. This stability allows SNPs to be functionalized with responsive mechanically interlocked molecules (MIMs) in the shape of bistable rotaxanes and psuedorotaxanes to yield mechanized silica nanoparticles (MSNPs). These MIMs can be designed in such a way that they either change shape or shed off some of their parts

  7. Fluorescent core-shell silica nanoparticles: an alternative radiative materials platform

    NASA Astrophysics Data System (ADS)

    Herz, Erik; Burns, Andrew; Lee, Stephanie; Sengupta, Prabuddha; Bonner, Daniel; Ow, Hooisweng; Liddell, Chekesha; Baird, Barbara; Wiesner, Ulrich

    2006-02-01

    We report on monodisperse fluorescent core-shell silica nanoparticles (C dots) with enhanced brightness and photostability as compared to parent free dye in aqueous solution. Dots containing either tetramethylrhodamine or 7-nitrobenz-2-oxa-1,3-diazole dyes with diameters ranging from tens of nanometers to microns are discussed. The benefits of the core-shell architecture are described in terms of enhanced fluorescent yield of the fluorophores in the quasi-solid-state environment within the particle as compared with parent free dye in water. Several applications of these particles in the fields of photonics and the life sciences are discussed. Specifically, fluorescent core-shell silica nanoparticles are investigated as an active medium for photonic building blocks assembled on zinc sulfide-based seed particles. Initial assembly results for these composite raspberry structures are shown. Finally, applications in the life sciences are explored, including targeting of specific antibody receptors using these single-emission nanoparticles. We expand on single-emission core-shell architecture to incorporate environmentally-sensitive fluorophores to create quantitative ratiometric nanoscale sensors capable of interrogating chemical concentrations on the sub-cellular to molecular levels and demonstrate initial results of intracellular pH imaging. The concept of a single particle laboratory (SPL) is introduced as an active investigator of its environment.

  8. Experimental Investigation of Mechanical and Thermal Properties of Silica Nanoparticle-Reinforced Poly(acrylamide) Nanocomposite Hydrogels.

    PubMed

    Zaragoza, Josergio; Babhadiashar, Nasim; O'Brien, Victor; Chang, Andrew; Blanco, Matthew; Zabalegui, Aitor; Lee, Hohyun; Asuri, Prashanth

    2015-01-01

    Current studies investigating properties of nanoparticle-reinforced polymers have shown that nanocomposites often exhibit improved properties compared to neat polymers. However, over two decades of research, using both experimental studies and modeling analyses, has not fully elucidated the mechanistic underpinnings behind these enhancements. Moreover, few studies have focused on developing an understanding among two or more polymer properties affected by incorporation of nanomaterials. In our study, we investigated the elastic and thermal properties of poly(acrylamide) hydrogels containing silica nanoparticles. Both nanoparticle concentration and size affected hydrogel properties, with similar trends in enhancements observed for elastic modulus and thermal diffusivity. We also observed significantly lower swellability for hydrogel nanocomposites relative to neat hydrogels, consistent with previous work suggesting that nanoparticles can mediate pseudo crosslinking within polymer networks. Collectively, these results indicate the ability to develop next-generation composite materials with enhanced mechanical and thermal properties by increasing the average crosslinking density using nanoparticles. PMID:26301505

  9. Experimental Investigation of Mechanical and Thermal Properties of Silica Nanoparticle-Reinforced Poly(acrylamide) Nanocomposite Hydrogels

    PubMed Central

    O’Brien, Victor; Chang, Andrew; Blanco, Matthew; Zabalegui, Aitor; Lee, Hohyun; Asuri, Prashanth

    2015-01-01

    Current studies investigating properties of nanoparticle-reinforced polymers have shown that nanocomposites often exhibit improved properties compared to neat polymers. However, over two decades of research, using both experimental studies and modeling analyses, has not fully elucidated the mechanistic underpinnings behind these enhancements. Moreover, few studies have focused on developing an understanding among two or more polymer properties affected by incorporation of nanomaterials. In our study, we investigated the elastic and thermal properties of poly(acrylamide) hydrogels containing silica nanoparticles. Both nanoparticle concentration and size affected hydrogel properties, with similar trends in enhancements observed for elastic modulus and thermal diffusivity. We also observed significantly lower swellability for hydrogel nanocomposites relative to neat hydrogels, consistent with previous work suggesting that nanoparticles can mediate pseudo crosslinking within polymer networks. Collectively, these results indicate the ability to develop next-generation composite materials with enhanced mechanical and thermal properties by increasing the average crosslinking density using nanoparticles. PMID:26301505

  10. Silica nanoparticles increase human adipose tissue-derived stem cell proliferation through ERK1/2 activation

    PubMed Central

    Kim, Ki Joo; Joe, Young Ae; Kim, Min Kyoung; Lee, Su Jin; Ryu, Yeon Hee; Cho, Dong-Woo; Rhie, Jong Won

    2015-01-01

    Background Silicon dioxide composites have been found to enhance the mechanical properties of scaffolds and to support growth of human adipose tissue-derived stem cells (hADSCs) both in vitro and in vivo. Silica (silicon dioxide alone) exists as differently sized particles when suspended in culture medium, but it is not clear whether particle size influences the beneficial effect of silicon dioxide on hADSCs. In this study, we examined the effect of different sized particles on growth and mitogen-activated protein kinase signaling in hADSCs. Methods Silica gel was prepared by a chemical reaction using hydrochloric acid and sodium silicate, washed, sterilized, and suspended in serum-free culture medium for 48 hours, and then sequentially filtered through a 0.22 μm filter (filtrate containing nanoparticles smaller than 220 nm; silica NPs). hADSCs were incubated with silica NPs or 3 μm silica microparticles (MPs), examined by transmission electron microscopy, and assayed for cell proliferation, apoptosis, and mitogen-activated protein kinase signaling. Results Eighty-nine percent of the silica NPs were around 50–120 nm in size. When hADSCs were treated with the study particles, silica NPs were observed in endocytosed vacuoles in the cytosol of hADSCs, but silica MPs showed no cell entry. Silica NPs increased the proliferation of hADSCs, but silica MPs had no significant effect in this regard. Instead, silica MPs induced slight apoptosis. Silica NPs increased phosphorylation of extracellular signal-related kinase (ERK)1/2, while silica MPs increased phosphorylation of p38. Silica NPs had no effect on phosphorylation of Janus kinase or p38. Pretreatment with PD98059, a MEK inhibitor, prevented the ERK1/2 phosphorylation and proliferation induced by silica NPs. Conclusion Scaffolds containing silicon dioxide for tissue engineering may enhance cell growth through ERK1/2 activation only when NPs around 50–120 nm in size are included, and single component silica

  11. Preparation of spherical ceria coated silica nanoparticle abrasives for CMP application

    NASA Astrophysics Data System (ADS)

    Peedikakkandy, Lekha; Kalita, Laksheswar; Kavle, Pravin; Kadam, Ankur; Gujar, Vikas; Arcot, Mahesh; Bhargava, Parag

    2015-12-01

    This paper describes synthesis of spherical and highly mono-dispersed ceria coated silica nanoparticles of size ∼70-80 nm for application as abrasive particles in Chemical Mechanical Planarization (CMP) process. Core silica nanoparticles were initially synthesized using micro-emulsion method. Ceria coating on these ultrafine and spherical silica nanoparticles was achieved using controlled chemical precipitation method. Study of various parameters influencing the formation of ceria coated silica nanoparticles of size less than 100 nm has been undertaken and reported. Ceria coating over silica nanoparticles was varied by controlling the reaction temperature, pH and precursor concentrations. Characterization studies using X-ray diffraction, scanning electron microscopy, transmission electron microscopy and Energy Dispersive X-ray analysis show formation of crystalline CeO2 coating of ∼10 nm thickness over silica with spherical morphology and particle size <100 nm. Aqueous slurry of ceria coated silica abrasive was prepared and employed for polishing of oxide and nitride films on silicon substrates. Polished films were studied using ellipsometry and an improvement in SiO2:SiN selective removal rates up to 12 was observed using 1 wt% ceria coated silica nanoparticles slurry.

  12. Synthesis of hybrid inorganic/organic nitric oxide-releasing silica nanoparticles for biomedical applications

    NASA Astrophysics Data System (ADS)

    Carpenter, Alexis Wells

    Nitric oxide (NO) is an endogenously produced free radical involved in a number of physiological processes. Thus, much research has focused on developing scaffolds that store and deliver exogenous NO. Herein, the synthesis of N-diazeniumdiolate-modified silica nanoparticles of various physical and chemical properties for biomedical applications is presented. To further develop NO-releasing silica particles for antimicrobial applications, a reverse microemulsion synthesis was designed to achieve nanoparticles of distinct sizes and similar NO release characteristics. Decreasing scaffold size resulted in improved bactericidal activity against Pseudomonas aeruginosa. Confocal microscopy revealed that the improved efficacy resulted from faster particle-bacterium association kinetics. To broaden the therapeutic potential of NO-releasing silica particles, strategies to tune NO release characteristics were evaluated. Initially, surface hydrophobicity and NO release kinetics were tuned by grafting hydrocarbon- and fluorocarbon-based silanes onto the surface of N-diazeniumdiolate-modified particles. The addition of fluorocarbons resulted in a 10x increase in the NO release half-life. The addition of short-chained hydrocarbons to the particle surface increased their stability in hydrophobic electrospun polyurethanes. Although NO release kinetics were longer than that of unmodified particles, durations were still limited to <7 days. An alternative strategy for increasing NO release duration involved directly stabilizing the N-diazeniumdiolate using O2-protecting groups. O2-Methoxymethyl 1-(4-(3-(trimethoxysilyl)propyl))piperazin-1-yl)diazen-1-ium-1,2-diolate (MOM-Pip/NO) was grafted onto mesoporous silica nanoparticles to yield scaffolds with an NO payload of 2.5 μmol NO/mg and an NO release half-life of 23 d. Doping the MOM-Pip/NO-modified particles into resin composites yielded antibacterial NO-releasing dental restorative materials. A 3-log reduction in viable adhered

  13. Bioactive Silica Nanoparticles Reverse Age-Associated Bone Loss in Mice

    PubMed Central

    Vikulina, Tatyana; Roser-Page, Susanne; Lee, Jin-Kyu; Beck, George R.

    2015-01-01

    We recently reported that in vitro, engineered 50 nm spherical silica nanoparticles promote the differentiation and activity of bone building osteoblasts but suppress that of bone-resorbing osteoclasts. Furthermore, these nanoparticles promote bone accretion in young mice in vivo. In the present study the capacity of these nanoparticles to reverse bone loss in aged mice, a model of human senile osteoporosis, was investigated. Aged mice received nanoparticles weekly and bone mineral density (BMD), bone structure, and bone turnover was quantified. Our data revealed a significant increase in BMD, bone volume, and biochemical markers of bone formation. Biochemical and histological examinations failed to identify any abnormalities caused by nanoparticle administration. Our studies demonstrate that silica nanoparticles effectively blunt and reverse age-associated bone loss in mice by a mechanism involving promotion of bone formation. The data suggest that osteogenic silica nanoparticles may be a safe and effective therapeutic for counteracting age-associated bone loss. PMID:25680544

  14. Thermal stability of bimetallic Au/Fe nanoparticles in silica matrix

    SciTech Connect

    Pannu, Compesh Singh, Udai B. Hooda, Sonu Kabiraj, D. Avasthi, D. K.

    2014-04-24

    Thin silica film containing Au and Fe bimetallic nanoparticles were prepared by atom beam cosputtering. The samples were annealed at different temperatures from 400 to 800° C to study the thermal stability of bimetallic nanoparticles using X ray diffraction. It is observed that at 800° C strong structural rearrangement took place leading to thermal decomposition of bimetallic nanoparticles.

  15. Preparation of bio-compatible boron nanoparticles and novel mesoporous silica nanoparticles for bio-applications

    NASA Astrophysics Data System (ADS)

    Gao, Zhe

    This dissertation presents the synthesis and characterization of several novel inorganic and hybrid nanoparticles, including the bio-compatible boron nanoparticles (BNPs) for boron neutron capture therapy (BNCT), tannic acid-templated mesoporous silica nanoparticles and degradable bridged silsesquioxane silica nanoparticles. Chapter 1 provides background information of BNCT and reviews the development of design and synthesizing silica nanoparticles and the study of silica material degradability. Chapter 2 describes the preparation and characterization of dopamine modified BNPs and the preliminary cell study of them. The BNPs were first produced via ball milling, with fatty acid on the surface to stabilize the combustible boron elements. This chapter will mainly focus on the ligand-exchange strategy, in which the fatty acids were replaced by non-toxic dopamines in a facile one-pot reaction. The dopamine-coated BNPs (DA-BNPs) revealed good water dispersibility and low cytotoxicity. Chapter 3 describes the synthesis of tannic acid template mesoporous silica nanoparticles (TA-TEOS SiNPs) and their application to immobilize proteins. The monodispersed TA SiNPs with uniform pore size up to approximately 13 nm were produced by utilizing tannic acid as a molecular template. We studied the influence of TA concentration and reaction time on the morphology and pore size of the particles. Furthermore, the TA-TEOS particles could subsequently be modified with amine groups allowing them to be capable of incorporating imaging ligands and other guest molecules. The ability of the TA-TEOS particles to store biomolecules was preliminarily assessed with three proteins of different charge characteristics and dimensions. The immobilization of malic dehydrogenase on TA-TEOS enhanced the stability of the enzyme at room temperature. Chapter 4 details the synthesis of several bridged silsesquioxanes and the preparation of degradable hybrid SiNPs via co-condensation of bridged

  16. Membrane interactions of mesoporous silica nanoparticles as carriers of antimicrobial peptides.

    PubMed

    Braun, Katharina; Pochert, Alexander; Lindén, Mika; Davoudi, Mina; Schmidtchen, Artur; Nordström, Randi; Malmsten, Martin

    2016-08-01

    Membrane interactions are critical for the successful use of mesoporous silica nanoparticles as delivery systems for antimicrobial peptides (AMPs). In order to elucidate these, we here investigate effects of nanoparticle charge and porosity on AMP loading and release, as well as consequences of this for membrane interactions and antimicrobial effects. Anionic mesoporous silica particles were found to incorporate considerable amounts of the cationic AMP [LL-37, 37 aa] (LL-37), whereas loading is much lower for non-porous or positively charged silica nanoparticles. Due to preferential pore localization, anionic mesoporous particles, but not the other particles, protect LL-37 from degradation by infection-related proteases. For anionic mesoporous nanoparticles, membrane disruption is mediated almost exclusively by peptide release. In contrast, non-porous silica particles build up a resilient LL-37 surface coating due to their higher negative surface charge, and display largely particle-mediated membrane interactions and antimicrobial effects. For positively charged mesoporous silica nanoparticles, LL-37 incorporation promotes the membrane binding and disruption displayed by the particles in the absence of peptide, but also causes toxicity against human erythrocytes. Thus, the use of mesoporous silica nanoparticles as AMP delivery systems requires consideration of membrane interactions and selectivity of both free peptide and the peptide-loaded nanoparticles, the latter critically dependent on nanoparticle properties. PMID:27174622

  17. Silica nanoparticles as indicator of hydrothermal activities at Enceladus ocean floor

    NASA Astrophysics Data System (ADS)

    Postberg, F.; Hsu, S.; Sekine, Y.; Kempf, S.; Juhasz, A.; Horanyi, M.; Moragas-Klostermeyer, G.; Srama, R.

    2013-12-01

    Silica nanoparticles as indicator of hydrothermal activities at Enceladus ocean floor F. Postberg, H.-W. Hsu, Y. Sekine, S. Kempf, A. Juhasz, M. Horanyi, G. Moragas-Klostermeyer, R. Srama Silica serves as a unique indicator of hydrothermal activities on Earth as well as on Mars. Here we report the Cassini Cosmic Dust Analyser (CDA) observation of nanosilica particles from the Saturnian system. Based on their interaction with the solar wind electromagnetic fields, these charged nanosilica particles, so-called stream particles, are found to be originated in Saturn's E ring, indicating Enceladus being their ultimate source. CDA stream particle mass spectra reveal a metal-free but silicon-rich composition that is only plausible for nearly pure silica particles. The size range derived from our measurements confines the size of these particles to a radius of 2 - 8 nm. The unique properties of nano-grains with the observed composition and size are a well-known phenomenon on Earth and their formation requires specific hydrothermal rock-water interactions. The observation of Saturnian nanosilica particles thus serves as an evidence of hydrothermal activities at the interface of Enceladus subsurface ocean and its rocky core. Considering plasma erosion as the major mechanism of releasing embedded nanosilica particles from their carriers, the much larger E ring ice grains, our dynamical model and CDA observation provide a lower limit on the average nanosilica concentration in E ring grains. Together with dedicated hydrothermal experiments (Sekine at al., 2013) this can be translated into constraints on the hydrothermal activities on Enceladus. Measurements and experiments both point at dissolved silica concentrations at the ocean floor in the order of 1 - 3 mMol. The hydrothermal reactions likely take place with a pristine, chondritic rock composition at temperature higher than 130°C (Sekine at al. 2013). Colloidal nano-silica forms upon supersaturation during cooling of the

  18. Electrical properties of multiwalled carbon nanotube reinforced fused silica composites.

    PubMed

    Xiang, Changshu; Pan, Yubai; Liu, Xuejian; Shi, Xiaomei; Sun, Xingwei; Guo, Jingkun

    2006-12-01

    Multiwalled carbon nanotube (MWCNT)-fused silica composite powders were synthesized by solgel method and dense bulk composites were successfully fabricated via hot-pressing. This composite was characterized by XRD, HRTEM, and FESEM. MWCNTs in the hot-pressed composites are in their integrity observed by HRTEM. The electrical properties of MWCNT-fused silica composites were measured and analyzed. The electrical resistivity was found to decrease with the increase in the amount of the MWCNT loading in the composite. When the volume percentage of the MWCNTs increased to 5 vol%, the electrical resistivity of the composite is 24.99 omega cm, which is a decrease of twelve orders of value over that of pure fused silica matrix. The electrical resistivity further decreases to 1.742 omega. cm as the concentration of the MWCNTs increased to 10 vol%. The dielectric properties of the composites were also measured at the frequency ranging from 12.4 to 17.8 GHz (Ku band) at room temperature. The experimental results reveal that the dielectric properties are extremely sensitive to the volume percentage of the MWCNTs, and the permittivities, especially the imaginary permittivities, increase dramatically with the increase in the concentration of the MWCNTs. The improvement of dielectric properties in high frequency region mainly originates from the greatly increasing electrical properties of the composite. PMID:17256338

  19. Silica-graphene oxide hybrid composite particles and their electroresponsive characteristics.

    PubMed

    Zhang, Wen Ling; Choi, Hyoung Jin

    2012-05-01

    Silica-graphene oxide (Si-GO) hybrid composite particles were prepared by the hydrolysis of tetraethyl orthosilicate (TEOS) in the presence of hydrophilic GO obtained from a modified Hummers method. Scanning electron microscopy (SEM) and transmission electron microscopy (TEM) images provided visible evidence of the silica nanoparticles grafted on the surface of GO, resulting in Si-GO hybrid composite particles. Energy dispersive X-ray spectroscopy (EDX) and X-ray diffraction (XRD) spectra indicated the coexistence of silica and GO in the composite particles. The Si-GO hybrid composite particles showed better thermal stability than that of GO according to thermogravimetric analysis (TGA). The electrorheological (ER) characteristics of the Si-GO hybrid composite based ER fluid were examined further by optical microscopy and a rotational rheometer in controlled shear rate mode under various electric field strengths. Shear stress curves were fitted using both conventional Bingham model and a constitutive Cho-Choi-Jhon model. The polarizability and relaxation time of the ER fluid from dielectric spectra measured using an LCR meter showed a good correlation with its ER characteristics. PMID:22486527

  20. Effect of acid and temperature on the discontinuous shear thickening phenomenon of silica nanoparticle suspensions

    NASA Astrophysics Data System (ADS)

    Li, Shuangbing; Wang, Jixiao; Cai, Wei; Zhao, Song; Wang, Zhi; Wang, Shichang

    2016-08-01

    The discontinuous shear thickening (DST) phenomenon of silica nanoparticle suspensions was investigated in this article. First, the non-aggregated silica nanoparticles were synthesized and characterized. The results indicate that the silica nanoparticles are spherical particles with a narrow size distribution with a diameter of approximately 90 nm. Next, the influence of nitric acid concentration and temperature on the DST phenomenon of shear thickening fluids (STFs) was investigated. The results indicate that the concentrated fluids with nitric acid concentration below 8.50 mmol/L and at a temperature below 40 °C exhibit a readily noticeable DST phenomenon.

  1. Surface modification strategies on mesoporous silica nanoparticles for anti-biofouling zwitterionic film grafting.

    PubMed

    Khung, Yit Lung; Narducci, Dario

    2015-12-01

    In the past decade, zwitterionic-based anti-biofouling layers had gained much focus as a serious alternative to traditional polyhydrophilic films such as PEG. In the area of assembling silica nanoparticles with stealth properties, the incorporation of zwitterionic surface film remains fairly new but considering that silica nanoparticles had been widely demonstrated as useful biointerfacing nanodevice, zwitterionic film grafting on silica nanoparticle holds much potential in the future. This review will discuss on the conceivable functional chemistry approaches, some of which are potentially suitable for the assembly of such stealth systems. PMID:26589704

  2. Incorporation of Ln-Doped LaPO4 Nanocrystals as Luminescent Markers in Silica Nanoparticles.

    PubMed

    van Hest, Jacobine J H A; Blab, Gerhard A; Gerritsen, Hans C; Donega, Celso de Mello; Meijerink, Andries

    2016-12-01

    Lanthanide ions are promising for the labeling of silica nanoparticles with a specific luminescent fingerprint due to their sharp line emission at characteristic wavelengths. With the increasing use of silica nanoparticles in consumer products, it is important to label silica nanoparticles in order to trace the biodistribution, both in the environment and living organisms.In this work, we synthesized LaPO4 nanocrystals (NCs) with sizes ranging from 4 to 8 nm doped with europium or cerium and terbium. After silica growth using an inverse micelle method, monodisperse silica spheres were obtained with a single LaPO4 NC in the center. We demonstrate that the size of the silica spheres can be tuned in the 25-55 nm range by addition of small volumes of methanol during the silica growth reaction. Both the LaPO4 core and silica nanocrystal showed sharp line emission characteristic for europium and terbium providing unique optical labels in silica nanoparticles of variable sizes. PMID:27209405

  3. Mesoporous silica nanoparticles in tissue engineering--a perspective.

    PubMed

    Rosenholm, Jessica Maria; Zhang, Jixi; Linden, Mika; Sahlgren, Cecilia

    2016-02-01

    In this review, we summarize the latest developments and give a perspective on future applications of mesoporous silica nanoparticles (MSNs) in regenerative medicine. MSNs constitute a flexible platform for controlled delivery of drugs and imaging agents in tissue engineering and stem cell therapy. We highlight the recent advances in applying MSNs for controlled drug delivery and stem cell tracking. We touch upon novel functions of MSNs in real time imaging of drug release and biological function, and as tools to control the chemical and mechanical environment of stem cells. We discuss the need for novel model systems for studying biofunctionality and biocompatibility of MSNs, and how the interdisciplinary activities within the field will advance biotechnology research. PMID:26784861

  4. Porous thin films of functionalized mesoporous silica nanoparticles.

    PubMed

    Kobler, Johannes; Bein, Thomas

    2008-11-25

    The synthesis of extremely small mesoporous silica nanoparticles via a specific co-condensation process with phenyl groups is demonstrated. The suspensions are ideally suited for the production of nanoscale thin films by spin-coating. Thanks to the small particle size and the resulting low surface roughness, the films show excellent optical qualities and exhibit good diffusion properties and a highly accessible pore system. The availability of such homogeneous porous thin films made it possible to use ellipsometric porosimetry (EP) as a convenient method to determine the effective porosity of the films on their original support without destroying it. It was possible to record sorption isotherms of the thin films with ellipsometry and to correlate the data with nitrogen sorption data of dried powders of the same material. The thin films showed very low refractive indices of around 1.2. PMID:19206399

  5. Improved gene transfer with histidine-functionalized mesoporous silica nanoparticles.

    PubMed

    Brevet, David; Hocine, Ouahiba; Delalande, Anthony; Raehm, Laurence; Charnay, Clarence; Midoux, Patrick; Durand, Jean-Olivier; Pichon, Chantal

    2014-08-25

    Mesoporous silica nanoparticles (MSN) were functionalized with aminopropyltriethoxysilane (MSN-NH2) then L-histidine (MSN-His) for pDNA delivery in cells and in vivo. The complexation of pDNA with MSN-NH2 and MSN-His was first studied with gel shift assay. pDNA complexed with MSN-His was better protected from DNase degradation than with MSN-NH2. An improvement of the transfection efficiency in cells was observed with MSN-His/pDNA compared to MSN-NH2/pDNA, which could be explained by a better internalization of MSN-His. The improvement of the transfection efficiency with MSN-His was also observed for gene transfer in Achilles tendons in vivo. PMID:24853464

  6. Rapid Imaging of Latent Fingerprints Using Biocompatible Fluorescent Silica Nanoparticles.

    PubMed

    Kim, Young-Jae; Jung, Hak-Sung; Lim, Joohyun; Ryu, Seung-Jin; Lee, Jin-Kyu

    2016-08-16

    Fluorescent silica nanoparticles (FSNPs) are synthesized through the Stöber method by incorporating silane-modified organic dye molecules. The modified fluorescent organic dye molecule is able to be prepared by allylation and hydrosilylation reactions. The optical properties of as-prepared FSNPs are shown the similar optical properties of PR254A (allylated Pigment Red 254) and have outstanding photostability. The polyvinylpyrrolidone (PVP) is introduced onto the surface of FSNP to enhance the binding affinity of PVP-coated FSNP for latent fingerprints (LFPs) detection. The simple preparation and easy control of surface properties of FSNPs show potential as a fluorescent labeling material for enhanced latent fingerprint detection on hydrophilic and hydrophobic substrates in forensic science for individual identification. PMID:27452188

  7. Breakable mesoporous silica nanoparticles for targeted drug delivery.

    PubMed

    Maggini, Laura; Cabrera, Ingrid; Ruiz-Carretero, Amparo; Prasetyanto, Eko A; Robinet, Eric; De Cola, Luisa

    2016-04-01

    "Pop goes the particle". Here we report on the preparation of redox responsive mesoporous organo-silica nanoparticles containing disulfide (S-S) bridges (ss-NPs) that, even upon the exohedral grafting of targeting ligands, retained their ability to undergo structural degradation, and increase their local release activity when exposed to a reducing agent. This degradation could be observed also inside glioma C6 cancer cells. Moreover, when anticancer drug-loaded pristine and derivatized ss-NPs were fed to glioma C6 cells, the responsive hybrids were more effective in their cytotoxic action compared to non-breakable particles. The possibility of tailoring the surface functionalization of this hybrid, yet preserving its self-destructive behavior and enhanced drug delivery properties, paves the way for the development of effective biodegradable materials for in vivo targeted drug delivery. PMID:26974603

  8. In situ grafting silica nanoparticles reinforced nanocomposite hydrogels.

    PubMed

    Yang, Jun; Han, Chun-Rui; Duan, Jiu-Fang; Xu, Feng; Sun, Run-Cang

    2013-11-21

    Highly flexible nanocomposite hydrogels were prepared by using silica nanoparticles (SNPs) as fillers and multi-functional cross-links to graft hydrophilic poly(acrylic acid) (PAA) by free radical polymerization from an aqueous solution. The SNPs were collected by neighboring polymer chains and dispersed uniformly within a PAA matrix. The mechanical properties of the nanocomposite hydrogels were tailored by the concentration of SNPs according to the percolation model. It was proposed that covalent bonds of adsorbed chains on the filler surface resulted in the formation of a shell of an immobilized glassy layer and trapped entanglements, where the glassy polymer layer greatly enhanced the elastic modulus and the release of trapped entanglements at deformation contributed to the viscoelastic properties. PMID:24089085

  9. Hydrogen and oxygen adsorption stoichiometries on silica supported ruthenium nanoparticles

    SciTech Connect

    Berthoud, Romain; Delichere, Pierre; Gajan, David; Lukens, Wayne; Pelzer, Katrin; Basset, Jean-Marie; Candy, Jean-Pierre; Coperet, Christophe

    2008-12-01

    Treatment under H{sub 2} at 300 C of Ru(COD)(COT) dispersed on silica yields 2 nm ruthenium nanoparticles, [Ru{sub p}/SiO{sub 2}], according to EXAFS, HRTEM and XPS. H{sub 2} adsorption measurements on [Ru{sub p}/SiO{sub 2}] in the absence of O{sub 2} show that Ru particles adsorb up to ca. 2 H per surface ruthenium atoms (2H/Ru{sub s}) on various samples; this technique can therefore be used to measure the dispersion of Ru particles. In contrast, O{sub 2} adsorption on [Ru{sub p}/SiO{sub 2}] leads to a partial oxidation of the bulk at 25 C, to RuO{sub 2} at 200 C and to sintering upon further reduction under H{sub 2}, showing that O{sub 2} adsorption cannot be used to measure the dispersion of Ru particles.

  10. A comparative study of non-covalent encapsulation methods for organic dyes into silica nanoparticles

    PubMed Central

    2011-01-01

    Numerous luminophores may be encapsulated into silica nanoparticles (< 100 nm) using the reverse microemulsion process. Nevertheless, the behaviour and effect of such luminescent molecules appear to have been much less studied and may possibly prevent the encapsulation process from occurring. Such nanospheres represent attractive nanoplatforms for the development of biotargeted biocompatible luminescent tracers. Physical and chemical properties of the encapsulated molecules may be affected by the nanomatrix. This study examines the synthesis of different types of dispersed silica nanoparticles, the ability of the selected luminophores towards incorporation into the silica matrix of those nanoobjects as well as the photophysical properties of the produced dye-doped silica nanoparticles. The nanoparticles present mean diameters between 40 and 60 nm as shown by TEM analysis. Mainly, the photophysical characteristics of the dyes are retained upon their encapsulation into the silica matrix, leading to fluorescent silica nanoparticles. This feature article surveys recent research progress on the fabrication strategies of these dye-doped silica nanoparticles. PMID:21711855

  11. Breakable mesoporous silica nanoparticles for targeted drug delivery

    NASA Astrophysics Data System (ADS)

    Maggini, Laura; Cabrera, Ingrid; Ruiz-Carretero, Amparo; Prasetyanto, Eko A.; Robinet, Eric; de Cola, Luisa

    2016-03-01

    ``Pop goes the particle''. Here we report on the preparation of redox responsive mesoporous organo-silica nanoparticles containing disulfide (S-S) bridges (ss-NPs) that, even upon the exohedral grafting of targeting ligands, retained their ability to undergo structural degradation, and increase their local release activity when exposed to a reducing agent. This degradation could be observed also inside glioma C6 cancer cells. Moreover, when anticancer drug-loaded pristine and derivatized ss-NPs were fed to glioma C6 cells, the responsive hybrids were more effective in their cytotoxic action compared to non-breakable particles. The possibility of tailoring the surface functionalization of this hybrid, yet preserving its self-destructive behavior and enhanced drug delivery properties, paves the way for the development of effective biodegradable materials for in vivo targeted drug delivery.``Pop goes the particle''. Here we report on the preparation of redox responsive mesoporous organo-silica nanoparticles containing disulfide (S-S) bridges (ss-NPs) that, even upon the exohedral grafting of targeting ligands, retained their ability to undergo structural degradation, and increase their local release activity when exposed to a reducing agent. This degradation could be observed also inside glioma C6 cancer cells. Moreover, when anticancer drug-loaded pristine and derivatized ss-NPs were fed to glioma C6 cells, the responsive hybrids were more effective in their cytotoxic action compared to non-breakable particles. The possibility of tailoring the surface functionalization of this hybrid, yet preserving its self-destructive behavior and enhanced drug delivery properties, paves the way for the development of effective biodegradable materials for in vivo targeted drug delivery. Electronic supplementary information (ESI) available: Full experimental procedures, additional SEM and TEM images of particles, complete UV-Vis and PL-monitored characterization of the breakdown of

  12. Sol-Gel processing of silica nanoparticles and their applications.

    PubMed

    Singh, Lok P; Bhattacharyya, Sriman K; Kumar, Rahul; Mishra, Geetika; Sharma, Usha; Singh, Garima; Ahalawat, Saurabh

    2014-11-01

    Recently, silica nanoparticles (SNPs) have drawn widespread attention due to their applications in many emerging areas because of their tailorable morphology. During the last decade, remarkable efforts have been made on the investigations for novel processing methodologies to prepare SNPs, resulting in better control of the size, shape, porosity and significant improvements in the physio-chemical properties. A number of techniques available for preparing SNPs namely, flame spray pyrolysis, chemical vapour deposition, micro-emulsion, ball milling, sol-gel etc. have resulted, a number of publications. Among these, preparation by sol-gel has been the focus of research as the synthesis is straightforward, scalable and controllable. Therefore, this review focuses on the recent progress in the field of synthesis of SNPs exhibiting ordered mesoporous structure, their distribution pattern, morphological attributes and applications. The mesoporous silica nanoparticles (MSNPs) with good dispersion, varying morphology, narrow size distribution and homogeneous porous structure have been successfully prepared using organic and inorganic templates. The soft template assisted synthesis using surfactants for obtaining desirable shapes, pores, morphology and mechanisms proposed has been reviewed. Apart from single template, double and mixed surfactants, electrolytes, polymers etc. as templates have also been intensively discussed. The influence of reaction conditions such as temperature, pH, concentration of reagents, drying techniques, solvents, precursor, aging time etc. have also been deliberated. These MSNPs are suitable for a variety of applications viz., in the drug delivery systems, high performance liquid chromatography (HPLC), biosensors, cosmetics as well as construction materials. The applications of these SNPs have also been briefly summarized. PMID:25466691

  13. Magnetic mesoporous silica nanoparticles: fabrication and their laccase immobilization performance.

    PubMed

    Wang, Feng; Guo, Chen; Yang, Liang-rong; Liu, Chun-Zhao

    2010-12-01

    Newly large-pore magnetic mesoporous silica nanoparticles (MMSNPs) with wormhole framework structures were synthesized for the first time by using tetraethyl orthosilicate as the silica source and amine-terminated Jeffamine surfactants as template. Iminodiacerate was attached on these MMSNPs through a silane-coupling agent and chelated with Cu(2+). The Cu(2+)-chelated MMSNPs (MMSNPs-CPTS-IDA-Cu(2+)) showed higher adsorption capacity of 98.1 mg g(-1)-particles and activity recovery of 92.5% for laccase via metal affinity adsorption in comparison with MMSNPs via physical adsorption. The Michaelis constant (K(m)) and catalytic constant (k(cat)) of laccase immobilized on the MMSNPs-CPTS-IDA-Cu(2+) were 3.28 mM and 155.4 min(-1), respectively. Storage stability and temperature endurance of the immobilized laccase on MMSNPs-CPTS-IDA-Cu(2+) increased significantly, and the immobilized laccase retained 86.6% of its initial activity after 10 successive batch reactions operated with magnetic separation. PMID:20655206

  14. Synthesis of WO 3 nanoparticles for superthermites by the template method from silica spheres

    NASA Astrophysics Data System (ADS)

    Gibot, Pierre; Comet, Marc; Vidal, Loic; Moitrier, Florence; Lacroix, Fabrice; Suma, Yves; Schnell, Fabien; Spitzer, Denis

    2011-05-01

    Nanosized WO 3 tungsten trioxide was prepared by calcination of H 3P 4W 12O 40· xH 2O phosphotungstic acid, previously dissolved in a silica colloidal solution. The influence of the silica spheres/tungsten precursor weight ratio ( x) was investigated. The pristine oxide powders were characterized by XRD, nitrogen adsorption, SEM and TEM techniques. A specific surface area and a pore volume of 64.2 m 2 g -1 and 0.33 cm 3 g -1, respectively, were obtained for the well-crystallized WO 3 powder prepared with x = 2/3 and after the removal of the silica template. The WO 3 particles exhibit a sphere-shaped morphology with a particle size of 13 and 320 nm as function of the x ratio. The performance and the sensitivity levels of the thermites prepared from aluminium nanoparticles mixed with (i) the smallest tungsten (VI) oxide material and (ii) the microscale WO 3 were compared. The combustion of these energetic composites was investigated by time resolved cinematography (TRC). This unconventional experimental technique consists to ignite the dried compressed composites by using a CO 2 laser beam, in order to determine their ignition delay time (IDT) and their combustion rate. The downsizing WO 3 particles improves, without ambiguity, the energetic performances of the WO 3/Al thermite. For instance, the ignition delay time was greatly shortened from 54 ± 10 ms to 5.7 ± 0.2 ms and the combustion velocity was increased by a factor 50 to reach a value of 4.1 ± 0.3 m/s. In addition, the use of WO 3 nanoparticles sensitizes the mixture to mechanical stimuli but decreases the sensitivity to electrostatic discharge.

  15. Surface modification of silica particles with gold nanoparticles as an augmentation of gold nanoparticle mediated laser perforation.

    PubMed

    Kalies, Stefan; Gentemann, Lara; Schomaker, Markus; Heinemann, Dag; Ripken, Tammo; Meyer, Heiko

    2014-08-01

    Gold nanoparticle mediated (GNOME) laser transfection/perforation fulfills the demands of a reliable transfection technique. It provides efficient delivery and has a negligible impact on cell viability. Furthermore, it reaches high-throughput applicability. However, currently only large gold particles (> 80 nm) allow successful GNOME laser perforation, probably due to insufficient sedimentation of smaller gold nanoparticles. The objective of this study is to determine whether this aspect can be addressed by a modification of silica particles with gold nanoparticles. Throughout the analysis, we show that after the attachment of gold nanoparticles to silica particles, comparable or better efficiencies to GNOME laser perforation are reached. In combination with 1 µm silica particles, we report laser perforation with gold nanoparticles with sizes down to 4 nm. Therefore, our investigations have great importance for the future research in and the fields of laser transfection combined with plasmonics. PMID:25136494

  16. Surface modification of silica particles with gold nanoparticles as an augmentation of gold nanoparticle mediated laser perforation

    PubMed Central

    Kalies, Stefan; Gentemann, Lara; Schomaker, Markus; Heinemann, Dag; Ripken, Tammo; Meyer, Heiko

    2014-01-01

    Gold nanoparticle mediated (GNOME) laser transfection/perforation fulfills the demands of a reliable transfection technique. It provides efficient delivery and has a negligible impact on cell viability. Furthermore, it reaches high-throughput applicability. However, currently only large gold particles (> 80 nm) allow successful GNOME laser perforation, probably due to insufficient sedimentation of smaller gold nanoparticles. The objective of this study is to determine whether this aspect can be addressed by a modification of silica particles with gold nanoparticles. Throughout the analysis, we show that after the attachment of gold nanoparticles to silica particles, comparable or better efficiencies to GNOME laser perforation are reached. In combination with 1 µm silica particles, we report laser perforation with gold nanoparticles with sizes down to 4 nm. Therefore, our investigations have great importance for the future research in and the fields of laser transfection combined with plasmonics. PMID:25136494

  17. Biomimetic synthesis of chiral erbium-doped silver/peptide/silica core-shell nanoparticles (ESPN).

    PubMed

    Mantion, Alexandre; Graf, Philipp; Florea, Ileana; Haase, Andrea; Thünemann, Andreas F; Mašić, Admir; Ersen, Ovidiu; Rabu, Pierre; Meier, Wolfgang; Luch, Andreas; Taubert, Andreas

    2011-12-01

    Peptide-modified silver nanoparticles have been coated with an erbium-doped silica layer using a method inspired by silica biomineralization. Electron microscopy and small-angle X-ray scattering confirm the presence of an Ag/peptide core and silica shell. The erbium is present as small Er(2)O(3) particles in and on the silica shell. Raman, IR, UV-Vis, and circular dichroism spectroscopies show that the peptide is still present after shell formation and the nanoparticles conserve a chiral plasmon resonance. Magnetic measurements find a paramagnetic behavior. In vitro tests using a macrophage cell line model show that the resulting multicomponent nanoparticles have a low toxicity for macrophages, even on partial dissolution of the silica shell. PMID:22031101

  18. Polystyrene-Core-Silica-Shell Hybrid Particles Containing Gold and Magnetic Nanoparticles.

    PubMed

    Tian, Jia; Vana, Philipp

    2016-02-18

    Polystyrene-core-silica-shell hybrid particles were synthesized by combining the self-assembly of nanoparticles and the polymer with a silica coating strategy. The core-shell hybrid particles are composed of gold-nanoparticle-decorated polystyrene (PS-AuNP) colloids as the core and silica particles as the shell. PS-AuNP colloids were generated by the self-assembly of the PS-grafted AuNPs. The silica coating improved the thermal stability and dispersibility of the AuNPs. By removing the "free" PS of the core, hollow particles with a hydrophobic cage having a AuNP corona and an inert silica shell were obtained. Also, Fe3O4 nanoparticles were encapsulated in the core, which resulted in magnetic core-shell hybrid particles by the same strategy. These particles have potential applications in biomolecular separation and high-temperature catalysis and as nanoreactors. PMID:26639677

  19. Robust enzyme-silica composites made from enzyme nanocapsules.

    PubMed

    Li, Jie; Jin, Xin; Liu, Yang; Li, Fan; Zhang, Linlin; Zhu, Xianyuan; Lu, Yunfeng

    2015-06-14

    Novel enzyme composites are synthesized first by in situ polymerization around enzymes and a subsequent sol-gel process. Both the polymer shell and the silica shell with desired functional moieties provide not only great enzyme protection but also a favorable microenvironment, resulting in significantly enhanced activity and stability. PMID:25971337

  20. Investigation of internal microstructure and thermo-responsive properties of composite PNIPAM/silica microcapsules.

    PubMed

    Cejková, Jitka; Hanus, Jaroslav; Stepánek, Frantisek

    2010-06-15

    Composite microcapsules consisting of a thermo-responsive hydrogel poly-N-isopropylacrylamide (PNIPAM) and coated by silica (SiO(2)) nanoparticles have been synthesized by the inverse Pickering emulsion polymerization method. The composite capsules, whose mean diameter is in the 25-86 microm range in the expanded state, were characterized by static light scattering, atomic force microscopy (AFM), scanning electron microscopy (SEM), and laser scanning confocal microscopy (LSCM). It is reported that the hydrogel surface is uniformly covered by a monolayer of silica nanoparticles and that depending on the capsule size and degree of polymer cross-linking, either hollow-core or partially-filled hydrogel-core microcapsules can be created. Equilibrium thermo-responsive behavior of the composite microcapsules is investigated and it is found that after heating the particles above the lower critical solution temperature (LCST) of PNIPAM, the shrinkage ratio V/V(max) varies from 0.8 to 0.4 for a cross-linking ratio from 0.6% to 9% on a mass basis. Dynamic temperature cycling studies reveal no hysteresis in the shrinking and recovery phases, but a small measurable dependence of the asymptotic shrinkage ratio V/V(max) on the rate of temperature change exists. The composite capsules are stable under long-term storage in both dried and hydrated states and easily re-dispersible in water. PMID:20304409

  1. Synthesis and characterization of functionalized silica/SPES composite membranes

    NASA Astrophysics Data System (ADS)

    Gahlot, Swati; Sharma, Prem Prakash; Kulshrestha, Vaibhav

    2015-06-01

    Mesoporous silica (MCM-41) has been synthesized via sol gel route. Sulfonation of MCM-41 has been done. Synthesized Sulfonated MCM-41 (S-MCM-41) has been incorporated within SPES (sulfonated poly ether sulfone) polymer matrix to prepare composite membranes. Various concentration of S-MCM-41 has been incorporated into SPES i.e. 1, 2, 5, 10 and 20 wt% to synthesize membranes of different wt% of mesoporous silica. FTIR and XRD of MCM-41 and S-MCM-41 were done to confirm the chemical and structural properties. AFM and UTM are used to find out morphology and mechanical properties of the composites. The water uptake and ionic conductivity of the composite membranes increases with MCM content in composite membrane. Mechanical stability of the membrane also found to be increases with MCM content.

  2. Age hardening of 6061/alumina-silica fiber composite

    SciTech Connect

    Khangaonkar, P.R.; Shamsul, J.B.; Azmi, R.

    1994-12-31

    Continuous alumina-silica fiber (Altex of Sumitomo) which yields high performance composites with some aluminium alloys was tried for squeeze cast 6061 based composites with volume fractions of 0.5 and 0.32, and the matrix microhardness and resistivity changes during age hardening were studied. The matrix in the composites hardened much more than the unreinforced alloy. Microhardness increases of up to 70 VPN above the solution treated condition at various aging temperatures were observed. The resistivity variation indicated an appreciable state of internal stress which continued to persist even when hardness fell by overaging. Energy dispersive X-ray analysis indicated that the regions close to the fibers had a higher silicon content than the matrix, and amorphous silica in the fiber may have a role in the formation of an enriched layer which may help the bonding and strength in the composite.

  3. Label-Free Luminescent Mesoporous Silica Nanoparticles for Imaging and Drug Delivery

    PubMed Central

    Chen, Hongmin; Zhen, Zipeng; Tang, Wei; Todd, Trever; Chuang, Yen-Jun; Wang, Lianchun; Pan, Zhengwei; Xie, Jin

    2013-01-01

    We report herein a straightforward and label-free approach to prepare luminescent mesoporous silica nanoparticles. We found that calcination at 400 °C can grant mesoporous organosilica nanoparticles with strong fluorescence of great photo- and chemical stability. The luminescence is found to originate from the carbon dots generated from the calcination, rather than the defects in the silica matrix as was believed previously. The calcination does not impact the particles' abilities to load drugs and conjugate to biomolecules. In a proof-of-concept study, we demonstrated that doxorubicin (Dox) can be efficiently encapsulated into these fluorescent mesoporous silica nanoparticles. After coupled to c(RGDyK), the nanoconjugates can efficiently home to tumors through interactions with integrin αvβ3 overexpressed on the tumor vasculature. This calcination-induced luminescence is expected to find wide applications in silica-based drug delivery, nanoparticle coating, and immunofluorescence imaging. PMID:24052805

  4. Fabrication of pDMAEMA-coated silica nanoparticles and their enhanced antibacterial activity.

    PubMed

    Song, Jooyoung; Jung, Yujung; Lee, Inkyu; Jang, Jyongsik

    2013-10-01

    Thin pDMAEMA shells were formed on the surface of silica nanoparticles via vapor deposition polymerization. Scanning electron microscopy, transmission electron microscopy, Fourier transform infrared spectroscopy, and elemental analysis have been used to characterize the resulting pDMAEMA-coated silica nanoparticles. Electron microscopy studies reveal that the thin polymer shell is formed on the silica surface. In this work, the particle diameter can be controlled (from ~19 to ~69 nm) by varying the size of silica core. The antibacterial performance of the core-shell nanoparticles was investigated against both Gram-positive (Escherichia coli) and Gram-negative (Staphylococcus aureus) bacteria. Importantly, the nano-sized pDMAEMA particles presented antibacterial activity against both bacteria without additional quaternization due to its enlarged surface area. Additionally, the bactericidal efficiency was enhanced by reducing the particle size, because the expanded surface area of the cationic polymer nanoparticles provides more active sites that can kill the bacteria. PMID:23838333

  5. Fabrication of autofluorescent porous silica nanoparticles for redox-responsive drug release.

    PubMed

    Cao, Na; Zhao, Yanbao; Sang, Bin; Wang, Zhihua; Cao, Liuqin; Sun, Lei; Zou, Xueyan

    2016-12-01

    Porous silica nanoparticles were prepared by emulsion-condensation route. The silica nanoparticles with diameter of 50nm have both accessible center-radial large pore channels (19.9nm) and small pore size of 3.5nm. The hierarchical porous structure endows them large pore volume for loading drugs and sustained release property. The silica nanoparticles were further modified with glucose-oxidized glutathione. The formulated Schiff base and disulfide bonds render the silica nanoparticles auto-fluorescent and redox-responsive properties. The cleavage of disulfide bonds caused by reactive thiols facilitates aminomethylbenzoic acid (AMA) release. The release of drug leads to the loss of fluorescence, which would be used to monitor the drug delivery and carrier distribution. PMID:27612720

  6. Quantification of Internalized Silica Nanoparticles via STED Microscopy

    PubMed Central

    Peuschel, Henrike; Ruckelshausen, Thomas; Cavelius, Christian; Kraegeloh, Annette

    2015-01-01

    The development of safe engineered nanoparticles (NPs) requires a detailed understanding of their interaction mechanisms on a cellular level. Therefore, quantification of NP internalization is crucial to predict the potential impact of intracellular NP doses, providing essential information for risk assessment as well as for drug delivery applications. In this study, the internalization of 25 nm and 85 nm silica nanoparticles (SNPs) in alveolar type II cells (A549) was quantified by application of super-resolution STED (stimulated emission depletion) microscopy. Cells were exposed to equal particle number concentrations (9.2 × 1010 particles mL−1) of each particle size and the sedimentation of particles during exposure was taken into account. Microscopy images revealed that particles of both sizes entered the cells after 5 h incubation in serum supplemented and serum-free medium. According to the in vitro sedimentation, diffusion, and dosimetry (ISDD) model 20–27% of the particles sedimented. In comparison, 102-103 NPs per cell were detected intracellularly serum-containing medium. Furthermore, in the presence of serum, no cytotoxicity was induced by the SNPs. In serum-free medium, large agglomerates of both particle sizes covered the cells whereas only high concentrations (≥ 3.8 × 1012 particles mL−1) of the smaller particles induced cytotoxicity. PMID:26125028

  7. Engineered silica nanoparticles as additives in lubricant oils

    NASA Astrophysics Data System (ADS)

    Díaz-Faes López, Teresa; Fernández González, Alfonso; Del Reguero, Ángel; Matos, María; Díaz-García, Marta E.; Badía-Laíño, Rosana

    2015-10-01

    Silica nanoparticles (SiO2 NPs) synthesized by the sol-gel approach were engineered for size and surface properties by grafting hydrophobic chains to prevent their aggregation and facilitate their contact with the phase boundary, thus improving their dispersibility in lubricant base oils. The surface modification was performed by covalent binding of long chain alkyl functionalities using lauric acid and decanoyl chloride to the SiO2 NP surface. The hybrid SiO2 NPs were characterized by scanning electron microscopy, transmission electron microscopy, Fourier transform infrared spectroscopy, simultaneous differential thermal analysis, nuclear magnetic resonance and dynamic light scattering, while their dispersion in two base oils was studied by static multiple light scattering at low (0.01% w/v) and high (0.50%w/v) concentrations. The nature of the functional layer and the functionalization degree seemed to be directly involved in the stability of the suspensions. The potential use of the functional SiO2 NPs as lubricant additives in base oils, specially designed for being used in hydraulic circuits, has been outlined by analyzing the tribological properties of the dispersions. The dendritic structure of the external layer played a key role in the tribological characteristics of the material by reducing the friction coefficient and wear. These nanoparticles reduce drastically the waste of energy in friction processes and are more environmentally friendly than other additives.

  8. Silica Nanoparticles Effects on Blood Coagulation Proteins and Platelets

    PubMed Central

    Gryshchuk, Volodymyr; Galagan, Natalya

    2016-01-01

    Interaction of nanoparticles with the blood coagulation is important prior to their using as the drug carriers or therapeutic agents. The aim of present work was studying of the primary effects of silica nanoparticles (SiNPs) on haemostasis in vitro. We studied the effect of SiNPs on blood coagulation directly estimating the activation of prothrombin and factor X and to verify any possible effect of SiNPs on human platelets. It was shown that SiNPs shortened coagulation time in APTT and PT tests and increased the activation of factor X induced by RVV possibly due to the sorption of intrinsic pathway factors on their surface. SiNPs inhibited the aggregation of platelet rich plasma induced by ADP but in the same time partially activated platelets as it was shown using flow cytometry. The possibility of SiNPs usage in nanomedicine is strongly dependant on their final concentration in bloodstream and the size of the particles that are used. However SiNPs are extremely promising as the haemostatic agents for preventing the blood loss after damage. PMID:26881078

  9. Cancer therapy improvement with mesoporous silica nanoparticles combining photodynamic and photothermal therapy.

    PubMed

    Zhao, Z X; Huang, Y Z; Shi, S G; Tang, S H; Li, D H; Chen, X L

    2014-07-18

    In this work, we develop novel mesoporous silica composite nanoparticles (hm-SiO2(AlC4Pc)@Pd) for the co-delivery of photosensitizer (PS) tetra-substituted carboxyl aluminum phthalocyanine (AlC4Pc) and small Pd nanosheets as a potential dual carrier system to combine photodynamic therapy (PDT) with photothermal therapy (PTT). In the nanocomposite, PS AlC4Pc was covalently conjugated to a mesoporous silica network, and small Pd nanosheets were coated onto the surface of mesoporous silica by both coordination and electrostatic interaction. Since small Pd nanosheets and AlC4Pc display matched maximum absorptions in the 600-800 nm near-infrared (NIR) region, the fabricated hm-SiO2(AlC4Pc)@Pd nanocomposites can generate both singlet oxygen and heat upon 660 nm single continuous wavelength (CW) laser irradiation. In vitro results indicated that the cell-killing efficacy by simultaneous PDT/PTT treatment using hm-SiO2(AlC4Pc)@Pd was higher than PDT or PTT treatment alone after exposure to a 660 nm CW-NIR laser. PMID:24971525

  10. Cancer therapy improvement with mesoporous silica nanoparticles combining photodynamic and photothermal therapy

    NASA Astrophysics Data System (ADS)

    Zhao, Z. X.; Huang, Y. Z.; Shi, S. G.; Tang, S. H.; Li, D. H.; Chen, X. L.

    2014-07-01

    In this work, we develop novel mesoporous silica composite nanoparticles (hm-SiO2(AlC4Pc)@Pd) for the co-delivery of photosensitizer (PS) tetra-substituted carboxyl aluminum phthalocyanine (AlC4Pc) and small Pd nanosheets as a potential dual carrier system to combine photodynamic therapy (PDT) with photothermal therapy (PTT). In the nanocomposite, PS AlC4Pc was covalently conjugated to a mesoporous silica network, and small Pd nanosheets were coated onto the surface of mesoporous silica by both coordination and electrostatic interaction. Since small Pd nanosheets and AlC4Pc display matched maximum absorptions in the 600-800 nm near-infrared (NIR) region, the fabricated hm-SiO2(AlC4Pc)@Pd nanocomposites can generate both singlet oxygen and heat upon 660 nm single continuous wavelength (CW) laser irradiation. In vitro results indicated that the cell-killing efficacy by simultaneous PDT/PTT treatment using hm-SiO2(AlC4Pc)@Pd was higher than PDT or PTT treatment alone after exposure to a 660 nm CW-NIR laser.

  11. Mechanized silica nanoparticles: a new frontier in theranostic nanomedicine.

    PubMed

    Ambrogio, Michael W; Thomas, Courtney R; Zhao, Yan-Li; Zink, Jeffrey I; Stoddart, J Fraser

    2011-10-18

    Medicine can benefit significantly from advances in nanotechnology because nanoscale assemblies promise to improve on previously established therapeutic and diagnostic regimes. Over the past decade, the use of delivery platforms has attracted attention as researchers shift their focus toward new ways to deliver therapeutic and/or diagnostic agents and away from the development of new drug candidates. Metaphorically, the use of delivery platforms in medicine can be viewed as the "bow-and-arrow" approach, where the drugs are the arrows and the delivery vehicles are the bows. Even if one possesses the best arrows that money can buy, they will not be useful if one does not have the appropriate bow to deliver the arrows to their intended location. Currently, many strategies exist for the delivery of bioactive agents within living tissue. Polymers, dendrimers, micelles, vesicles, and nanoparticles have all been investigated for their use as possible delivery vehicles. With the growth of nanomedicine, one can envisage the possibility of fabricating a theranostic vector that could release powerful therapeutics and diagnostic markers simultaneously and selectively to diseased tissue. In our design of more robust theranostic delivery systems, we have focused our attention on using mesoporous silica nanoparticles (SNPs). The payload "cargo" molecules can be stored within this robust domain, which is stable to a wide range of chemical conditions. This stability allows SNPs to be functionalized with stimulus-responsive mechanically interlocked molecules (MIMs) in the shape of bistable rotaxanes and psuedorotaxanes to yield mechanized silica nanoparticles (MSNPs). In this Account, we chronicle the evolution of various MSNPs, which came about as a result of our decade-long collaboration, and discuss advances in the synthesis of novel hybrid SNPs and the various MIMs which have been attached to their surfaces. These MIMs can be designed in such a way that they either change shape

  12. Photoreactive azido-containing silica nanoparticle/polycation multilayers: durable superhydrophobic coating on cotton fabrics.

    PubMed

    Zhao, Yan; Xu, Zhiguang; Wang, Xungai; Lin, Tong

    2012-04-17

    In this study, we report the functionalization of silica nanoparticles with highly photoreactive phenyl azido groups and their utility as a negatively charged building block for layer-by-layer (LbL) electrostatic assembly to produce a stable silica nanoparticle coating. Azido-terminated silica nanoparticles were prepared by the functionalization of bare silica nanoparticles with 3-aminopropyltrimethoxysilane followed by the reaction with 4-azidobenzoic acid. The azido functionalization was confirmed by FTIR and XPS. Poly(allylamine hydrochloride) was also grafted with phenyl azido groups and used as photoreactive polycations for LbL assembly. For the photoreactive silica nanoparticle/polycation multilayers, UV irradiation can induce the covalent cross-linking within the multilayers as well as the anchoring of the multilayer film onto the organic substrate, through azido photochemical reactions including C-H insertion/abstraction reactions with surrounding molecules and dimerization of azido groups. Our results show that the stability of the silica nanoparticle/polycation multilayer film was greatly improved after UV irradiation. Combined with a fluoroalkylsilane post-treatment, the photoreactive LbL multilayers were used as a coating for superhydrophobic modification of cotton fabrics. Herein the LbL assembly method enables us to tailor the number of the coated silica nanoparticles through the assembly cycles. The superhydrophobicity of cotton fabrics was durable against acids, bases, and organic solvents, as well as repeated machine wash. Because of the unique azido photochemistry, the approach used here to anchor silica nanoparticles is applicable to almost any organic substrate. PMID:22462539

  13. Magnetic Silica-Supported Ruthenium Nanoparticles: An Efficient Catalyst for Transfer Hydrogenation of Carbonyl Compounds

    EPA Science Inventory

    One-pot synthesis of ruthenium nanoparticles on magnetic silica is described which involve the in situ generation of magnetic silica (Fe3O4@ SiO2) and ruthenium nano particles immobilization; the hydration of nitriles and transfer hydrogenation of carbonyl compounds occurs in hi...

  14. Silica nanoparticle stabilization of liquid crystalline lipid dispersions: impact on enzymatic digestion and drug solubilization.

    PubMed

    Bhatt, Achal B; Barnes, Timothy J; Prestidge, Clive A

    2015-01-01

    The high internal surface area and drug solubilizing capacity of liquid crystal lipids makes them promising oral drug delivery systems. Pluronic F127 is typically used to disperse highly viscous cubic liquid crystal lipids into cubosomes; however, such copolymers alter the internal structure and provide little control over enzymatic digestion. This study aimed to use hydrophilic silica nanoparticles to stabilize glyceryl monooleate (GMO) cubosomes prepared by ultrasonication. We investigate the influence of silica nanoparticles size and concentration on the physical (colloidal) and chemical (enzymatic digestion) stability, as well as in vitro solubilization of cinnarizine as a poorly soluble model drug. Silica stabilized nanostructured liquid crystal dispersions (120 nm to150 nm in diameter and zeta potentials of-30 mV to -60 mV) were successfully prepared with excellent long-term stability (<10% size change after 30 days). Silica stabilized GMO cubosomes demonstrated reduced enzymatic digestion compared to pluronic F127 stabilized cubosomes. This reduced digestion was attributed to a combination of adsorbed silica nanoparticles acting as a physical barrier and excess dispersed silica adsorbing/scavenging the lipase enzyme. Under simulated intestinal digestion conditions, silica stabilized GMO cubosomes showed a greater solubilization capacity for cinnarizine, which precipitated in non-crystalline form, in comparison to pure drug suspensions or pluronic F127 stabilized GMO cubosomes. Silica nanoparticle stabilized GMO liquid crystal dispersions are a promising oral delivery vehicle. PMID:25176029

  15. Cytotoxicity evaluation of silica nanoparticles using fish cell lines.

    PubMed

    Vo, Nguyen T K; Bufalino, Mary R; Hartlen, Kurtis D; Kitaev, Vladimir; Lee, Lucy E J

    2014-01-01

    Nanoparticles (NPs) have extensive industrial, biotechnological, and biomedical/pharmaceutical applications, leading to concerns over health risks to humans and biota. Among various types of nanoparticles, silica nanoparticles (SiO2 NPs) have become popular as nanostructuring, drug delivery, and optical imaging agents. SiO2 NPs are highly stable and could bioaccumulate in the environment. Although toxicity studies of SiO2 NPs to human and mammalian cells have been reported, their effects on aquatic biota, especially fish, have not been significantly studied. Twelve adherent fish cell lines derived from six species (rainbow trout, fathead minnow, zebrafish, goldfish, haddock, and American eel) were used to comparatively evaluate viability of cells by measuring metabolic impairment using Alamar Blue. Toxicity of SiO2 NPs appeared to be size-, time-, temperature-, and dose-dependent as well as tissue-specific. However, dosages greater than 100 μg/mL were needed to achieve 24 h EC50 values (effective concentrations needed to reduce cell viability by 50%). Smaller SiO2 NPs (16 nm) were relatively more toxic than larger sized ones (24 and 44 nm) and external lining epithelial tissue (skin, gills)-derived cells were more sensitive than cells derived from internal tissues (liver, brain, intestine, gonads) or embryos. Higher EC50 values were achieved when toxicity assessment was performed at higher incubation temperatures. These findings are in overall agreement with similar human and mouse cell studies reported to date. Thus, fish cell lines could be valuable for screening emerging contaminants in aquatic environments including NPs through rapid high-throughput cytotoxicity bioassays. PMID:24357037

  16. Apoptosis induction by silica nanoparticles mediated through reactive oxygen species in human liver cell line HepG2

    SciTech Connect

    Ahmad, Javed; Ahamed, Maqusood; Akhtar, Mohd Javed; Alrokayan, Salman A.; Siddiqui, Maqsood A.; Musarrat, Javed; Al-Khedhairy, Abdulaziz A.

    2012-03-01

    Silica nanoparticles are increasingly utilized in various applications including agriculture and medicine. In vivo studies have shown that liver is one of the primary target organ of silica nanoparticles. However, possible mechanisms of hepatotoxicity caused by silica nanoparticles still remain unclear. In this study, we explored the reactive oxygen species (ROS) mediated apoptosis induced by well-characterized 14 nm silica nanoparticles in human liver cell line HepG2. Silica nanoparticles (25–200 μg/ml) induced a dose-dependent cytotoxicity in HepG2 cells. Silica nanoparticles were also found to induce oxidative stress in dose-dependent manner indicated by induction of ROS and lipid peroxidation and depletion of glutathione (GSH). Quantitative real-time PCR and immunoblotting results showed that both the mRNA and protein expressions of cell cycle checkpoint gene p53 and apoptotic genes (bax and caspase-3) were up-regulated while the anti-apoptotic gene bcl-2 was down-regulated in silica nanoparticles treated cells. Moreover, co-treatment of ROS scavenger vitamin C significantly attenuated the modulation of apoptotic markers along with the preservation of cell viability caused by silica nanoparticles. Our data demonstrated that silica nanoparticles induced apoptosis in human liver cells, which is ROS mediated and regulated through p53, bax/bcl-2 and caspase pathways. This study suggests that toxicity mechanisms of silica nanoparticles should be further investigated at in vivo level. -- Highlights: ► We explored the mechanisms of toxicity caused by silica NPs in human liver HepG2 cells. ► Silica NPs induced a dose-dependent cytotoxicity in HepG2 cells. ► Silica NPs induced ROS generation and oxidative stress in a dose-dependent manner. ► Silica NPs were also modulated apoptosis markers both at mRNA and protein levels. ► ROS mediated apoptosis induced by silica NPs was preserved by vitamin C.

  17. Tuning the observability of surface plasmon in silica-gold raspberry shaped nanoparticles using cuprous oxide shell.

    PubMed

    Tyagi, Himanshu; Mohapatra, Jeotikanta; Kushwaha, Ajay; Aslam, Mohammed

    2013-12-11

    A raspberry shaped silica-gold nanoparticle system has been coated with a cuprous oxide shell using a simple wet chemical approach. The optical properties of such particles depend on thin dielectric shell material, and we calculate far-field scattering and extinction of cuprous oxide coated silica-gold composite. In accordance with our theoretical findings, for ultrasmall gold nanoparticles (AuNPs < 5 nm) attached over silica, the localized surface plasmon resonance (LSPR) peak is completely suppressed after Cu2O coating. The cloaking (nonobservability) of the LSPR peak in extinction spectra has been explained via calculation of contribution from absorbance (<10%) and scattering (>90%) in the composite nanostructure. For larger particles (>5 nm), the traditional red-shift of the plasmon peak (from 532 to 588 nm) is still significant due to the large dielectric constant (approx. 8.0 @ 600 nm) of cuprous oxide (Cu2O) coating. A complete and controlled suppression of LSPR in small sized gold nanoparticles due to high dielectric refractory oxide shell could play a significant role in plasmon derived applications. PMID:24237115

  18. Synthesis of magnetic rhenium sulfide composite nanoparticles

    NASA Astrophysics Data System (ADS)

    Tang, Naimei; Tu, Weixia

    2009-10-01

    Rhenium sulfide nanoparticles are associated with magnetic iron oxide through coprecipitation of iron salts with tetramethylammonium hydroxide. Sizes of the formed magnetic rhenium sulfide composite particles are in the range 5.5-12.5 nm. X-ray diffraction and energy-dispersive analysis of X-rays spectra demonstrate the coexistence of Fe 3O 4 and ReS 2 in the composite particle, which confirm the formation of the magnetic rhenium sulfide composite nanoparticles. The association of rhenium sulfide with iron oxide not only keeps electronic state and composition of the rhenium sulfide nanoparticles, but also introduces magnetism with the level of 24.1 emu g -1 at 14 kOe. Surface modification with monocarboxyl-terminated poly(ethylene glycol) (MPEG-COOH) has the role of deaggregating the composite nanoparticles to be with average hydrodynamic size of 27.3 nm and improving the dispersion and the stability of the composite nanoparticles in water.

  19. Layer-by-layer engineering fluorescent polyelectrolyte coated mesoporous silica nanoparticles as pH-sensitive nanocarriers for controlled release

    NASA Astrophysics Data System (ADS)

    Du, Pengcheng; Zhao, Xubo; Zeng, Jin; Guo, Jinshan; Liu, Peng

    2015-08-01

    Fluorescent core/shell composite has been fabricated by the layer-by-layer (LbL) assembly of the fluorescein isothiocyanate modified chitosan (CS-FITC) and sodium alginate (AL) onto the carboxyl modified mesoporous silica nanoparticles (MSN-COOH), followed by PEGylation. It exhibits stability in high salt-concentration media and the pH responsive fluorescent feature can be used for cell imaging. Furthermore, the modified MSN cores can enhance the DOX loading capacity and the multifunctional polyelectrolyte shell can adjust the drug release upon the media pH, showing a low leakage quantity at the neutral environment but significantly enhanced release at lower pH media mimicking the tumor environments. Therefore, the biocompatible fluorescent polyelectrolyte coated mesoporous silica nanoparticles (MSN-LBL-PEG) offer promise for tumor therapy.

  20. Preparation of Silica Nanoparticles Through Microwave-assisted Acid-catalysis

    PubMed Central

    Lovingood, Derek D.; Owens, Jeffrey R.; Seeber, Michael; Kornev, Konstantin G.; Luzinov, Igor

    2013-01-01

    Microwave-assisted synthetic techniques were used to quickly and reproducibly produce silica nanoparticle sols using an acid catalyst with nanoparticle diameters ranging from 30-250 nm by varying the reaction conditions. Through the selection of a microwave compatible solvent, silicic acid precursor, catalyst, and microwave irradiation time, these microwave-assisted methods were capable of overcoming the previously reported shortcomings associated with synthesis of silica nanoparticles using microwave reactors. The siloxane precursor was hydrolyzed using the acid catalyst, HCl. Acetone, a low-tan δ solvent, mediates the condensation reactions and has minimal interaction with the electromagnetic field. Condensation reactions begin when the silicic acid precursor couples with the microwave radiation, leading to silica nanoparticle sol formation. The silica nanoparticles were characterized by dynamic light scattering data and scanning electron microscopy, which show the materials' morphology and size to be dependent on the reaction conditions. Microwave-assisted reactions produce silica nanoparticles with roughened textured surfaces that are atypical for silica sols produced by Stöber's methods, which have smooth surfaces. PMID:24379052

  1. Compositional analysis of iron-platinum nanoparticles

    NASA Astrophysics Data System (ADS)

    Srivastava, Chandan

    FePt nanoparticles are candidates for the future magnetic recording technology because of their good chemical stability and high magnetocrystalline anisotropy. One of the fundamental problems that limit the application of these nanoparticles is the particle-to-particle compositional and size variations. This dissertation addresses the following: (a) The mechanism of formation of FePt nanoparticles by two synthesis methods, the iron pentacarbonyl method and the superhydride method (b) determines how the sequence of the nucleation and growth processes contribute to the size and compositional variability and (c) provides a method to engineer the nucleation and growth sequence to produce nanoparticle dispersions with high degree of compositional and size uniformity.

  2. Wettability alteration properties of fluorinated silica nanoparticles in liquid-loaded pores: An atomistic simulation

    NASA Astrophysics Data System (ADS)

    Sepehrinia, Kazem; Mohammadi, Aliasghar

    2016-05-01

    Control over the wettability of reservoir rocks is of crucial importance for enhancing oil and gas recovery. In order to develop chemicals for controlling the wettability of reservoir rocks, we present a study of functionalized silica nanoparticles as candidates for wettability alteration and improved gas recovery applications. In this paper, properties of fluorinated silica nanoparticles were investigated in water or decane-loaded pores of mineral silica using molecular dynamics simulation. Trifluoromethyl groups as water and oil repellents were placed on the nanoparticles. Simulating a pore in the presence of trapped water or decane molecules leads to liquid bridging for both of the liquids. Adsorption of nanoparticles on the pore wall reduces the density of liquid molecules adjacent to the wall. The density of liquid molecules around the nanoparticles decreases significantly with increasing the number of trifluoromethyl groups on the nanoparticles' surfaces. An increased hydrophobicity of the pore wall was observed in the presence of adsorbed fluorinated silica nanoparticles. Also, it is observed that increasing the number of the trifluoromethyl groups results in weakening of liquid bridges. Moreover, the free energy of adsorption on mineral surface was evaluated to be more favorable than that of aggregation of nanoparticles, which suggests nanoparticles adsorb preferably on mineral surface.

  3. Size dependent fractal aggregation mediated through surfactant in silica nanoparticle solution

    NASA Astrophysics Data System (ADS)

    Kumar, Sugam; Aswal, V. K.; Kohlbrecher, J.

    2012-06-01

    Small-angle neutron scattering (SANS) has been used to study aggregation of anionic silica nanoparticles in presence of cationic surfactant (DTAB) in aqueous solution. The measurements were carried out for different sizes of nanoparticles (8.2, 16.4 and 26.4 nm) at fixed (1 wt%) nanoparticles and surfactant concentration. It is found that the adsorption of surfactant micelles on the silica nanoparticles leads to the aggregation of nanoparticles, which is characterized by a fractal structure. The number of adsorbed micelles on nanoparticle increases from 7 to 152 with the increase in the size of the nanoparticle from 8.2 to 26.4 nm, whereas interestingly the fractal dimension remains same. The aggregate morphology in these systems is expected to be governed by the diffusion limited aggregation.

  4. On the stabilization of gold nanoparticles over silica-based magnetic supports modified with organosilanes.

    PubMed

    Oliveira, Rafael L; Zanchet, Daniela; Kiyohara, Pedro K; Rossi, Liane M

    2011-04-11

    The immobilization of gold nanoparticles (Au NPs) on silica is made possible by the functionalization of the silica surfaces with organosilanes. Au NPs could only be stabilized and firmly attached to silica-support surfaces that were previously modified with amino groups. Au NPs could not be stabilized on bare silica surfaces and most of the NPs were then found in the solution. The metal-support interactions before and after the Au NP formation, observed by X-ray absorption fine structure spectroscopy (XAFS), indicate a stronger interaction of gold(III) ions with amino-modified silica surfaces than with the silanol groups in bare silica. An amino-modified, silica-based, magnetic support was used to prepare an active Au NP catalyst for the chemoselective oxidation of alcohols, a reaction of great interest for the fine chemical industry. PMID:21360597

  5. Complete magnesiothermic reduction reaction of vertically aligned mesoporous silica channels to form pure silicon nanoparticles

    NASA Astrophysics Data System (ADS)

    Kim, Kyoung Hwan; Lee, Dong Jin; Cho, Kyeong Min; Kim, Seon Joon; Park, Jung-Ki; Jung, Hee-Tae

    2015-03-01

    Owing to its simplicity and low temperature conditions, magnesiothermic reduction of silica is one of the most powerful methods for producing silicon nanostructures. However, incomplete reduction takes place in this process leaving unconverted silica under the silicon layer. This phenomenon limits the use of this method for the rational design of silicon structures. In this effort, a technique that enables complete magnesiothermic reduction of silica to form silicon has been developed. The procedure involves magnesium promoted reduction of vertically oriented mesoporous silica channels on reduced graphene oxides (rGO) sheets. The mesopores play a significant role in effectively enabling magnesium gas to interact with silica through a large number of reaction sites. Utilizing this approach, highly uniform, ca. 10 nm sized silicon nanoparticles are generated without contamination by unreacted silica. The new method for complete magnesiothermic reduction of mesoporous silica approach provides a foundation for the rational design of silicon structures.

  6. The synthesis and application of two mesoporous silica nanoparticles as drug delivery system with different shape

    NASA Astrophysics Data System (ADS)

    Wang, Jiayi; Wang, Zhuyuan; Chen, Hui; Zong, Shenfei; Cui, Yiping

    2015-05-01

    Mesoporous silica nanospheres(MSNSs) have been obtained utilizing the conventional reverse micelles synthesis method while the mesoporous silica nanorods(MSNRs) have been acquired by means of changing certain parameters. Afterwards, the prepared mesoporous silica nanospheres and nanorods were used as drug carriers to load and release the classical cancer therapeutic drug—DOX. According to the absorption spectra, the encapsulation efficiency of the mesoporous silica nanospheres is almost as high as that of the nanospheres. Different from the familiar encapsulation efficiency, the release characteristic curves of the mesoporous silica nanospheres and nanorods possessed certain differences during the release process. Finally incellular fluorescence imaging was achieved to observe the endocytosis of the mesoporous silica materials. Our results show that although both of the two kinds of nanoparticles possess favourable properties for loading and releasing drugs, the mesoporous silica nanospheres perform better in dispersity and controlled release than the nanorods, which probably endow them the potential as incellular drug delivery system.

  7. Complete magnesiothermic reduction reaction of vertically aligned mesoporous silica channels to form pure silicon nanoparticles

    PubMed Central

    Kim, Kyoung Hwan; Lee, Dong Jin; Cho, Kyeong Min; Kim, Seon Joon; Park, Jung-Ki; Jung, Hee-Tae

    2015-01-01

    Owing to its simplicity and low temperature conditions, magnesiothermic reduction of silica is one of the most powerful methods for producing silicon nanostructures. However, incomplete reduction takes place in this process leaving unconverted silica under the silicon layer. This phenomenon limits the use of this method for the rational design of silicon structures. In this effort, a technique that enables complete magnesiothermic reduction of silica to form silicon has been developed. The procedure involves magnesium promoted reduction of vertically oriented mesoporous silica channels on reduced graphene oxides (rGO) sheets. The mesopores play a significant role in effectively enabling magnesium gas to interact with silica through a large number of reaction sites. Utilizing this approach, highly uniform, ca. 10 nm sized silicon nanoparticles are generated without contamination by unreacted silica. The new method for complete magnesiothermic reduction of mesoporous silica approach provides a foundation for the rational design of silicon structures. PMID:25757800

  8. Interfacial Effect on Confined Crystallization of Poly(ethylene oxide)/Silica Composites

    NASA Astrophysics Data System (ADS)

    Su, Yunlan; Zhao, Weiwei; Gao, Xia; Xu, Jianjun; Wang, Dujin

    The impact of nanoconfinement introduced by nanoparticles on polymer crystallization has attracted extensive attention because it plays the decisive role in the ultimate properties of polymer nanocomposites. In this study, interfacial and spatial confinement effects of silica (SiO2) nanoparticles on the crystallization behaviors of poly(ethylene oxide) (PEO)/SiO2 composites were systematically investigated by changing the size and concentration of SiO2 in PEO matrix. The composites with high silica loadings exhibit two crystallization peaks of PEO as determined by differential scanning calorimetry (DSC). The first peak at 7-43 °C is related to the bulk PEO, while the second peak at -20 to -30 °C is attributed to the restricted PEO segments. Three-layer (amorphous, interfacial and bulk) model is proposed to interpret the confined crystallization of PEO/SiO2 composites, which is supported by the results of thermogravimetric analysis (TGA) and solid-state 1H nuclear magnetic resonance (NMR). In amorphous layer, most PEO segments are directly adsorbed on SiO2 surface via hydrogen bonding. The interfacial PEO layer, which is nonuniform, is composed of crystallizable loops and tails extending from amorphous layer. National Natural Science Foundation of China (NSFC) under Contract 21274156.

  9. Surface functionalized mesoporous silica nanoparticles for intracellular drug delivery

    NASA Astrophysics Data System (ADS)

    Vivero-Escoto, Juan Luis

    Mesoporous silica nanoparticles (MSNs) are a highly promising platform for intracellular controlled release of drugs and biomolecules. Despite that the application of MSNs in the field of intracellular drug delivery is still at its infancy very exciting breakthroughs have been achieved in the last years. A general review of the most recent progress in this area of research is presented, including a description of the latest findings on the pathways of entry into live mammalian cells together with the intracellular trafficking, a summary on the contribution of MSNs to the development of site-specific drug delivery systems, a report on the biocompatibility of this material in vitro andin vivo, and a discussion on the most recent breakthroughs in the synthesis and application of stimuli-responsive mesoporous silica-based delivery vehicles. A gold nanoparticles (AuNPs)-capped MSNs-based intracellular photoinduced drug delivery system (PR-AuNPs-MSNs) for the controlled release of anticancer drug inside of human fibroblast and liver cells was synthesized and characterized. We found that the mesoporous channels of MSNs could be efficiently capped by the photoresponsive AuNPs without leaking the toxic drug, paclitaxel, inside of human cells. Furthermore, we demonstrated that the cargo-release property of this PR-AuNPs-MSNs system could be easily photo-controlled under mild and biocompatible conditions in vitro. In collaboration with Renato Mortera (a visiting student from Italy), a MSNs based intracellular delivery system for controlled release of cell membrane impermeable cysteine was developed. A large amount of cysteine molecules were covalently attached to the silica surface of MSNs through cleavable disulfide linkers. These cysteine-containing nanoparticles were efficiently endocytosed by human cervical cancer cells HeLa. These materials exhibit 450 times higher cell growth inhibition capability than that of the conventional N-acetylcysteine prodrug. The ability to

  10. A reversible light-operated nanovalve on mesoporous silica nanoparticles

    NASA Astrophysics Data System (ADS)

    Tarn, Derrick; Ferris, Daniel P.; Barnes, Jonathan C.; Ambrogio, Michael W.; Stoddart, J. Fraser; Zink, Jeffrey I.

    2014-02-01

    Two azobenzene α-cyclodextrin based nanovalves are designed, synthesized and assembled on mesoporous silica nanoparticles. Under aqueous conditions, the cyclodextrin cap is tightly bound to the azobenzene moiety and capable of holding back loaded cargo molecules. Upon irradiation with a near-UV light laser, trans to cis-photoisomerization of azobenzene initiates a dethreading process, which causes the cyclodextrin cap to unbind followed by the release of cargo. The addition of a bulky stopper to the end of the stalk allows this design to be reversible; complete dethreading of cyclodextrin as a result of unbinding with azobenzene is prevented as a consequence of steric interference. As a result, thermal relaxation of cis- to trans-azobenzene allows for the rebinding of cyclodextrin and resealing of the nanopores, a process which entraps the remaining cargo. Two stalks were designed with different lengths and tested with alizarin red S and propidium iodide. No cargo release was observed prior to light irradiation, and the system was capable of multiuse. On/off control was also demonstrated by monitoring the release of cargo when the light stimulus was applied and removed, respectively.Two azobenzene α-cyclodextrin based nanovalves are designed, synthesized and assembled on mesoporous silica nanoparticles. Under aqueous conditions, the cyclodextrin cap is tightly bound to the azobenzene moiety and capable of holding back loaded cargo molecules. Upon irradiation with a near-UV light laser, trans to cis-photoisomerization of azobenzene initiates a dethreading process, which causes the cyclodextrin cap to unbind followed by the release of cargo. The addition of a bulky stopper to the end of the stalk allows this design to be reversible; complete dethreading of cyclodextrin as a result of unbinding with azobenzene is prevented as a consequence of steric interference. As a result, thermal relaxation of cis- to trans-azobenzene allows for the rebinding of cyclodextrin and