Note: This page contains sample records for the topic taenia saginata cysticercosis from Science.gov.
While these samples are representative of the content of Science.gov,
they are not comprehensive nor are they the most current set.
We encourage you to perform a real-time search of Science.gov
to obtain the most current and comprehensive results.
Last update: November 12, 2013.
1

Sheep as an experimental model of Taenia saginata cysticercosis  

Microsoft Academic Search

Taenia saginata cysticercosis was experimentally produced in 4 Soay sheep, 1 four-horned sheep and 1 Texel sheep by oral administration of eggs of the parasite. Some of these sheep were given dexamethasone therapy. The evolution ofT. saginata cysticercosis in this host is characterised by a rapid immune reaction so that by 6 weeks after infection almost all the cysts were

S. Geerts; V. Kumar; J. Mortelmans

1981-01-01

2

Seroepidemiological survey of Taenia saginata cysticercosis in Kenya  

Microsoft Academic Search

A sero-epidemiological study of Taenia saginata cysticercosis was carried out to determine the prevalence and distribution of the infection in three provinces of Kenya. Serum samples and meat inspection records were collected from cattle at slaughter at export and district abattoirs. Cattle origin and the presence of T. saginata cysticerci were noted as was the prevalence of other helminths such

Jael A. Onyango-Abuje; Joseph M. Nginyi; Moses K. Rugutt; Steven H. Wright; Patrick Lumumba; Gwenda Hughes; Leslie J. S. Harrison

1996-01-01

3

Protective immunity against Taenia crassiceps murine cysticercosis induced by DNA vaccination with a Taenia saginata tegument antigen  

Microsoft Academic Search

This study investigated the protective capacity of the recombinant Taenia saginata Tso18 antigen administered as a DNA vaccine in the Taenia crassiceps murine model of cysticercosis. This Tso18 DNA sequence, isolated from a T. saginata oncosphere cDNA library, has homologies with Taenia solium and Echinococcus sp. It was cloned in the pcDNA3.1 plasmid and injected once intramuscularly into mice. Compared to

Gabriela Rosas; Gladis Fragoso; Teresa Garate; Beatriz Hernández; Patricia Ferrero; Mildred Foster-Cuevas; R. Michael E. Parkhouse; Leslie J. S. Harrison; Sergio López Briones; Luis Miguel González; Edda Sciutto

2002-01-01

4

Sero-epidemiological study of Taenia saginata cysticercosis in Belgian cattle  

Microsoft Academic Search

A sero-epidemiological survey of Taenia saginata cysticercosis was carried out to determine the prevalence of the infection in cattle presented for slaughter in Belgium. Between November 1997 and June 1998, a total of 1164 serum samples were collected in 20 export abattoirs. Meat inspection was routinely carried out by veterinary inspectors. Serum samples were examined for circulating parasite antigen using

P Dorny; F Vercammen; J Brandt; W Vansteenkiste; D Berkvens; S Geerts

2000-01-01

5

Taenia saginata derived synthetic peptides with potential for the diagnosis of bovine cysticercosis  

Microsoft Academic Search

Immunity in Taeniids is predominantly antibody mediated and thus many serological immuno-determinants will have potential in both protection and diagnosis. The antigenicity of six peptides derived from four potentially protective molecules cloned from a Taenia saginata oncospheres cDNA library have been evaluated as targets for the specific diagnosis of bovine cysticercosis. The six peptides consist of: two peptides (HP6-2 and

E Ferrer; L Benitez; M Foster-Cuevas; D Bryce; L. W Wamae; J. A Onyango-Abuje; T Garate; L. J. S Harrison; R. M. E Parkhouse

2003-01-01

6

Evaluation of “crude” antigen prepared from Taenia saginata for the serological diagnosis of T. saginata cysticercosis in cattle using the enzyme-linked immunosorbent assay (ELISA)  

Microsoft Academic Search

A “crude” antigen prepared from the strobilate stage ofTaenia saginata was tested for its suitability in the peroxidase microenzyme-linked immunosorbent assay (ELISA) for the diagnosis ofT. saginata cysticercosis in cattle. Sera were tested from laboratory and pasture-reared calves experimentally infected withT. saginata as well as from cattle naturally infected by grazing on pasture irrigated with sewage effluent. The specificity of

P. S. Craig; M. D. Rickard

1980-01-01

7

Taenia saginata in Europe  

Microsoft Academic Search

In spite of the EU directives that regulate meat inspection for bovine cysticercosis, Taenia saginata is still present in Europe and causes economic losses due to condemnation, refrigeration and downgrading of infected carcasses. The main reasons for this persistence include the low sensitivity of current meat inspection protocols, the dissemination and survival of eggs in the environment and cattle husbandry

P. Dorny; N. Praet

2007-01-01

8

Development and field evaluation of a new serological test for Taenia saginata cysticercosis.  

PubMed

Cattle infected with the tapeworm cyst, Taenia saginata metacestode (synonym: Cysticercus bovis) are a source of human infection if affected beef is eaten raw or undercooked. Control measures targeted at individual cattle rather than all animals in a T. saginata-exposed herd should help reduce costs and alleviate current constraints associated with managing an outbreak. To that end, we have developed a reliable diagnostic test for use in live animals that would enable veterinary regulators to focus disease control strategies. The test detects bovine anti-T. saginata immunoglobulin G1 antibodies using an enzyme-linked immunosorbent assay (ELISA) which relies on the excretory-secretory antigens of T. saginata. Animals were inoculated with 10, 100 or 1000 viable T. saginata eggs in order to simulate the parasite burden of field-infected animals (parasite load=1-86; n=28). By testing sera obtained from the inoculated animals 84 days post-inoculation, test sensitivity was estimated to be 92.9% (95% confidence interval or CI=83.4-100.0%). Another 17 animals inoculated with 5000 or 10,000 viable eggs of T. saginata and shown to harbour metacestodes at post-mortem, all tested positive in the ELISA. Test specificity estimated from a herd of field animals with no historical, epidemiological, or post-mortem evidence of infection was 90.6% (95% CI=87.0-94.2%; n=256 field cattle). Using the test on samples (n=347) from a T. saginata-infected feedlot, the Bayesian approach estimate of seroprevalence was 4.6% (95% probability intervals=0.5-10.3%). The test performance characteristics of the ELISA suggest that it will be adequate for field application in bovine cysticercosis outbreaks. PMID:20083357

Ogunremi, Oladele; Benjamin, Jane

2009-12-22

9

Seroprevalence of Taenia saginata cysticercosis in the federal state of Lower Saxony in Germany.  

PubMed

Based on ELISA results from randomly selected serum samples taken from 128 cattle from different administrative and urban districts in the federal state of Lower Saxony in Germany a seroprevalence estimate of Taenia saginata cysticercosis in this area was derived. This estimate was subsequently used to calculate the sample size required in an epidemiological study to determine the actual prevalence of this infection in the cattle population (n = 2 604 767) in this federal state. The sample size was calculated as 1518 and the samples were collected according to the distribution of cattle among the 48 administrative and urban districts in Lower Saxony. The samples were tested with an evaluated antibody ELISA. The results showed a positive antibody titre rate of 8.83% from the total tested samples. PMID:21038810

Abuseir, Sameh; Nagel-Kohl, Uschi; Probst, Dieter; Kühne, Michael; Epe, Christian; Doherr, Marcus G; Schnieder, Thomas

10

Development of a biomolecular assay for postmortem diagnosis of Taenia saginata Cysticercosis.  

PubMed

Bovine cysticercosis is caused by the larval stage of the human tapeworm Taenia saginata. According to European data on meat inspection, the prevalence ranges from 0.007% to 6.8%, but the real prevalence is considered to be at least 10 times higher. Laboratory confirmation of the etiological agent is based on gross, stereomicroscopic, and histological examination of submitted specimens. False identifications may occur, possibly because of death and degeneration of cysts, or because taeniid larvae and other tissue parasites, such as Sarcocystis spp., may cause similar macroscopic morphological lesions. Therefore, tests that can warrant sure identification of taeniid lesions and calcified cysts in the muscle are needed. The focus of our study was to develop a suitable postmortem test that could be applied on putative lesions by T. saginata cysticerci, as ambiguously diagnosed after routine meat inspection. In particular, we proposed a biomolecular assay targeting the mitochondrial cytochrome c oxidase subunit I gene (COI). For developing the polymerase chain reaction assay, viable cysts of Cysticercus bovis (n?=?10) were used as positive reference samples, and those of Echinococcus granulosus (n?=?3), Cysticercus tenuicollis (n?=?3), and Sarcocystis spp. (n?=?4) as reference negative controls. Further, to evaluate the applicability of the proposed assay, 171 samples of bovine muscular tissue, obtained from local slaughterhouses and containing lesions recognized as T. saginata cysticerci by macroscopic examination, were tested. The proposed test confirmed the diagnosis at postmortem inspection in 94.7% (162/171) of samples. In conclusion, the assay developed in this study, amplifying a short fragment from the mitochondrial gene COI, showed to be suitable for samples containing both viable and degenerating T. saginata cysticerci, yielding an unequivocal diagnosis. PMID:20618079

Chiesa, Francesco; Dalmasso, Alessandra; Bellio, Alberto; Martinetti, Manuela; Gili, Stefano; Civera, Tiziana

2010-10-01

11

Evaluation of a serological method for the detection of Taenia saginata cysticercosis using serum and meat juice samples  

Microsoft Academic Search

Two peptides, HP6-2 and Ts45S-10, were used as antigens for the detection of antibodies against Taenia saginata cysticercosis in serum and meat juice samples using enzyme-linked immunosorbent assay (ELISA). Positive control samples were\\u000a obtained from animals experimentally infected (serum) and from animals naturally infected (meat juice). The two peptides and\\u000a a pooled preparation of both peptides were evaluated, and their

S. Abuseir; M. Kühne; T. Schnieder; G. Klein; C. Epe

2007-01-01

12

Diagnosis of Taenia saginata cysticercosis in Kenyan cattle by antibody and antigen ELISA  

Microsoft Academic Search

Sera from calves, either experimentally or naturally infected with Taenia saginata, were screened for an antibody response to T. saginata, and for parasite antigen, by enzyme-linked immunosorbent assays (ELISAs). An antibody response was detected by 3 weeks post infection (p.i.), rose to a peak at 10–12 weeks p.i., and was still in evidence 1 year p.i. Parasite antigen was first

J. A. Onyango-Abuje; G. Hughes; M. Opicha; K. M. Nginyi; M. K. Rugutt; S. H. Wright; L. J. S. Harrison

1996-01-01

13

The efficacy of mebendazole and praziquantel against Taenia saginata cysticercosis in cattle  

Microsoft Academic Search

Approximately 50,000Taenia saginata eggs were given orally to bullocks. Ten weeks later, mebendazole or praziquantel was administered in the fodder in single or multiple doses. The animals were slaughtered at intervals after medication when the numbers and viability of cysticerci in various sites were recorded. Single doses of 5 mg\\/kg mebendazole or 10 mg\\/kg praziquantel had little effect on the

Z. Pawlowski; B. Kozakeiwicz; H. Wroblewski

1978-01-01

14

Bovine cysticercosis: demonstration in experimentally infected calves of serum IgG antibodies reactive with neutral glycolipids of Taenia saginata and T. crassiceps metacestodes  

Microsoft Academic Search

The immunoreactivity ofTaenia saginata andT. crassiceps metacestode neutral glyco(sphingo)lipids towards IgG antibodies derived from the sera of calves with experimental cysticercosis has been established. The glyco(sphingo)lipids are separable by normal-phase HPTLC (high-performance thin-layer chromatography) into groups of increasing sugar-chain length (lipid\\/ceramide mono-, di-, tri-, tetra- and >tetrasaccharides), with those corresponding to three and four hexoses being the main immunoreactive components

S. Baumeister; Carmen Schuh; R. D. Dennis; M. Walther; K. Pfister; E. Geyer

1995-01-01

15

Taenia solium and Taenia saginata: Identification of sequence characterized amplified region (SCAR) markers  

Microsoft Academic Search

Cysticercosis is one of the most important zoonosis, not only because of the effects on animal health and its economic consequences, but also due to the serious danger it poses to humans. The two main parasites involved in the taeniasis–cysticercosis complex in Brazil are Taenia saginata and Taenia solium. Differentiating between these two parasites is important both for disease control

Ana Karina Kerche Dias; Sérgio Moraes Aoki; José Fernando Garcia; Cáris Maroni Nunes

2007-01-01

16

PCR tools for the differential diagnosis of Taenia saginata and Taenia solium taeniasis\\/cysticercosis from different geographical locations  

Microsoft Academic Search

The potential value of PCRs in the species-specific diagnosis of have been investigated, using samples of T. saginata and T. solium from different geographical areas. The PCRs examining inter-species differences were based on the sequence of the HDP2 DNA fragment, specific for T. saginata\\/T. solium, and the sequence of the rDNA internal transcribed spacer 1 and spacer 2 (ITS-1 and

Luis Miguel González; Estrella Montero; Sabino Puente; Rogelio López-Velez; Marisela Hernández; Edda Sciutto; Leslie J. S Harrison; R. Michael E Parkhouse; Teresa Gárate

2002-01-01

17

Visual diagnosis of Taenia saginata cysticercosis during meat inspection: is it unequivocal?  

Microsoft Academic Search

A total of 267 cysts were collected from March to December 2004 from two main abattoirs in northern Germany. The cysts were classified by the usual organoleptic methods during meat inspection as Cysticercus bovis. The reported prevalence of cysticercosis in the abattoirs was 0.48 and 1.08%, respectively. The cysts were examined macroscopically for description of their morphology and constituents and

S. Abuseir; C. Epe; T. Schnieder; G. Klein; M. Kühne

2006-01-01

18

Taenia saginata cysticercosis in cattle with special reference to its prevalence, pathogenesis and economic implications in Fars Province of Iran  

Microsoft Academic Search

The study was carried out during a 3-year period. Of 9501 cattle examined, 736 (7.7%) were infected with cysticerci of Taenia saginata. The endemic foci were identified and prevalence was significantly higher (P < 0.005) in animals from Noorabad Mammasani (10.7%), Kenareh (10.0%) and Shiraz area (8.5%) than elsewhere. The prevalence was significantly higher (P < 0.005) during spring and

A. Oryan; N. Moghaddar; S. N. S. Gaur

1995-01-01

19

Taenia saginata:Vaccination against Cysticercosis in Cattle with Recombinant Oncosphere Antigens  

Microsoft Academic Search

Taenia saginatais a medically and economically important cestode parasite. Infection with the cysticercus larval stage in cattle causes economic loss in the beef meat industry. A practical vaccine to prevent infection with the parasite in cattle would be valuable and would assist in control of transmission of the parasite to humans, the obligate definitive host. Here we use recombinant DNA

Marshall W. Lightowlers; Rick Rolfe; Charles G. Gauci

1996-01-01

20

Evaluation of recombinant HP6-Tsag, an 18 kDa Taenia saginata oncospheral adhesion protein, for the diagnosis of cysticercosis  

Microsoft Academic Search

With the objective of providing inexpensive and reproducible assays for the detection of antibodies indicating exposure to\\u000a Taenia saginata and Taenia solium, we have evaluated the diagnostic utility of the T. saginata oncosphere adhesion protein (HP6-Tsag), expressed in baculovirus (HP6-Bac) and bacteria (HP6-GST [glutathione S-transferase]),\\u000a employing enzyme-linked immunosorbent assays (ELISAs) and sera from T. saginata infected cattle, T. solium infected

Elizabeth Ferrer; Luís Miguel González; José Ángel Martínez-Escribano; María Eugenia González-Barderas; María Milagros Cortéz; Iris Dávila; Leslie J. S. Harrison; R. Michael E. Parkhouse; Teresa Gárate

2007-01-01

21

Taenia asiatica: the most neglected human Taenia and the possibility of cysticercosis.  

PubMed

Not only Taenia solium and Taenia saginata, but also Taenia asiatica infects humans. The last species is not included in the evaluation of the specificity of the immunodiagnostic techniques for taeniasis/cysticercosis. There is currently no specific immunodiagnostic method for T. asiatica available. Therefore, due to the fact that molecular techniques (the only tool to distinguish the 3 Taenia species) are normally not employed in routine diagnostic methods, the 2 questions concerning T. asiatica (its definite geographic distribution and its ability to cause human cysticercosis), remain open, turning T. asiatica into the most neglected agent of human taeniasis-cysticercosis. PMID:23467406

Galán-Puchades, M Teresa; Fuentes, Mario V

2013-02-18

22

Taenia asiatica: the Most Neglected Human Taenia and the Possibility of Cysticercosis  

PubMed Central

Not only Taenia solium and Taenia saginata, but also Taenia asiatica infects humans. The last species is not included in the evaluation of the specificity of the immunodiagnostic techniques for taeniasis/cysticercosis. There is currently no specific immunodiagnostic method for T. asiatica available. Therefore, due to the fact that molecular techniques (the only tool to distinguish the 3 Taenia species) are normally not employed in routine diagnostic methods, the 2 questions concerning T. asiatica (its definite geographic distribution and its ability to cause human cysticercosis), remain open, turning T. asiatica into the most neglected agent of human taeniasis-cysticercosis.

2013-01-01

23

The Asian Taenia and the possibility of cysticercosis.  

PubMed

In certain Asian countries, a third form of human Taenia, also known as the Asian Taenia, has been discovered. This Asian Taenia seems to be an intermediate between Taenia solium and T. saginata since in morphological terms it is similar to T. saginata, yet biologically, as it uses the same intermediate host (pigs), it is more akin to T. solium. Taenia solium causes human cysticercosis, while T. saginata does not. It is not known whether the Asian taeniid is able to develop to the larval stage in humans or not. The arguments proposed by those authors who consider it unlikely that the Asian Taenia causes human cysticercosis are: (a) its molecular similarities with T. saginata; (b) the absence of cases of human cysticercosis in populations where the Asian adult is highly prevalent; and (c) the unsupporting results derived from an experimental infestation study. These three arguments are debated, although bearing in mind that at present there is still no clear scientific data to support that human cysticercosis can be caused by the Asian Taenia. PMID:10743352

Galán-Puchades, M T; Fuentes, M V

2000-03-01

24

Differential diagnosis of Taenia saginata and Taenia saginata asiatica taeniasis through PCR  

Microsoft Academic Search

New multiplex-PCR and PCR-linked restriction fragment length polymorphism protocols, derived from Taenia saginata HDP2 DNA sequence (AccN#AJ133740), have been designed that allow the simultaneous and specific identification of T. saginata and Taenia saginata asiatica. Proglottids expelled from 20 different Spanish taeniasis patients, previously diagnosed as T. saginata by both morphological identification and multiplex HDP2-PCR, were also examined by the newly

Luis Miguel González; Estrella Montero; Nimit Morakote; Sabino Puente; Jose Luis Díaz De Tuesta; Teresa Serra; Rogelio López-Velez; Donald P McManus; Leslie J. S Harrison; R. Michael E Parkhouse; Teresa Gárate

2004-01-01

25

Taenia saginata: polymerase chain reaction for taeniasis diagnosis in human fecal samples  

Microsoft Academic Search

The taeniasis–cysticercosis complex is a zoonosis of great medical and economic importance where humans play an important role as the carrier of adult stage of Taenia solium and Taenia saginata. This paper describes PCR standardization that can be applied in human fecal samples for taeniasis diagnosis. DNA extraction was achieved with DNAzol reagent, after egg disruption with glass beads. DNA

Cáris Maroni Nunes; Luiz Gustavo Ferraz Lima; Camila Santos Manoel; Rodrigo Norberto Pereira; Mauro Massaharu Nakano; José Fernando Garcia

2003-01-01

26

Taenia solium cysticercosis  

PubMed Central

The larval stage of the pork tapeworm (Taenia solium) infects the human nervous system, causing neurocysticercosis. This disease is one of the main causes of epileptic seizures in many less developed countries and is also increasingly seen in more developed countries because of immigration from endemic areas. Little information is available on the natural evolution of taeniasis or cysticercosis. Available therapeutic measures include steroids, treatments for symptoms, surgery, and, more controversially, antiparasitic drugs to kill brain parasites. Efforts to control and eliminate this disease are underway through antiparasitic treatment of endemic populations, development of pig vaccines, and other measures.

Garcia, Hector H; Gonzalez, Armando E; Evans, Carlton A W; Gilman, Robert H

2010-01-01

27

Taenia saginata: production and characterization of monoclonal antibodies against Taenia saginata metacestode antigens.  

PubMed

Cysticercosis is a major cause of economic loss in bovine production due to meat condemnation. Chemotherapy is being used in Brazilian cattle and a diagnostic test to improve the treatment program is desired. We produced monoclonal antibodies against crude (TAEB) and cyst fluid (TAEF) Taenia saginata metacestode antigens using immunized BALB/c mice. After cell fusion, 10 TAEB and nine TAEF hybrids were selected and cloned resulting in 18 IgG(1) and 32 IgM TAEB clones, and 9 IgG(1) and 9 IgM TAEF clones. Ascites was produced and Western blot testing was performed resulting in reactivity to protein fractions of low molecular weight (<18kDa), 43, 55, 66 and 100kDa. The indirect immunofluorescence test, with one monoclonal antibody against crude and one against cyst fluid antigens, recognized antigenic fractions of both the scolex and the bladder wall of metacestodes from naturally infected bovine. PMID:20542032

Vicentini-Oliveira, Josy Campanhã; Golim, Marjorie A; de Cássia Paulan, Silvana; Biondi, Germano Francisco; Rossi-Ferreira, Rosana; Deffune, Elenice; Nunes, Cáris Maroni

2010-06-11

28

Recent hybridization between Taenia asiatica and Taenia saginata.  

PubMed

Five Taenia tapeworms collected from humans in Tibetan Plateau, Sichuan, China, where three species of human Taenia are sympatrically endemic, were examined for the mitochondrial cox1 gene and two nuclear genes, ef1 and elp. Phylogenetic analyses of these genes revealed that two adult worms showed nuclear-mitochondrial discordance, suggesting that they originated from hybridization between Taenia saginata and Taenia asiatica. One of two worms had T. asiatica-type mtDNA, whereas another worm had T. saginata-type mtDNA, indicating that reciprocal hybridization between T. saginata and T. asiatica could occur. The worm having T. asiatica-type mtDNA was heterozygous at both nuclear loci with T. saginata-type alleles and T. asiatica-type alleles. In another worm, the ef1 locus was heterozygous with a T. saginata-type alleles and T. asiatica-type alleles, while the elp locus was homozygous with T. saginata-type alleles. Self-fertilization is the main reproductive method of the genus Taenia. Since self-fertilization represents a type of inbreeding, each locus in the offspring would become homozygous over generations with genetic drift. The fact that some nuclear loci are still heterozygous means that hybridization might have occurred recently. Hybridization between T. asiatica and T. saginata is probably an ongoing event in many areas in which they are sympatrically endemic. PMID:22301089

Yamane, Kanako; Suzuki, Yumi; Tachi, Eiko; Li, Tiaoying; Chen, Xingwang; Nakao, Minoru; Nkouawa, Agathe; Yanagida, Testuya; Sako, Yasuhito; Ito, Akira; Sato, Hiroshi; Okamoto, Munehiro

2012-01-25

29

Evidence of hybridization between Taenia saginata and Taenia asiatica  

Microsoft Academic Search

There has long been a debate as to the specific status of the cestode Taenia asiatica, with some people regarding it as a distinct species and some preferring to recognize it as a strain of Taenia saginata. The balance of current opinion seems to be that T. asiatica is a distinct species. In this study we performed an allelic analysis

Munehiro Okamoto; Minoru Nakao; David Blair; Malinee T. Anantaphruti; Jitra Waikagul; Akira Ito

2010-01-01

30

Distribution of Taenia saginata cysticerci in tissues of experimentally infected cattle  

Microsoft Academic Search

Bovine cysticercosis caused by Taenia saginata is a zoonotic disease warranting routine inspection measures for the postmortem detection of cysticerci (cysts) in beef destined for human consumption. Detection is based on gross examination of traditional carcass predilection sites, although there is evidence to suggest that examination of other sites may offer improvements in sensitivity. In order to evaluate the efficacy

Brad Scandrett; Sarah Parker; Lorry Forbes; Alvin Gajadhar; Paron Dekumyoy; Jitra Waikagul; Deborah Haines

2009-01-01

31

A glance at Taenia saginata infection, diagnosis, vaccine, biological control and treatment.  

PubMed

The Taenia saginata taeniasis-cysticercosis complex is a cosmopolitan zoonosis of great medical, veterinary and economic importance where humans play an important role as the carrier of adult stage and cattle as carrier of the larval stage of the parasite. Here we reviewed aspects concerning diagnosis, vaccine development, biological control and treatment of the disease. PMID:20701576

Silva, Claudio V; Costa-Cruz, Julia M

2010-10-01

32

Taenia Antigens for Use as Immunodiagnostic Reagents for Bovine or Swine Cysticercosis.  

National Technical Information Service (NTIS)

Cysticercosis is a parasitic disease of cattle and swine caused by the larval (cyst) stage of the tapeworm Taenia saginata in cattle and Taenia solium in swine. Ingestion by man of viable larvae in undercooked meat results in intestinal tapeworm infection...

D. S. Zarlenga M. L. Rhoads

1991-01-01

33

Taenia asiatica and Taenia saginata: Genetic divergence estimated from their mitochondrial genomes  

Microsoft Academic Search

We conducted a differential identification of Taenia asiatica and Taenia saginata, through the mapping of mitochondrial genomes and the sequencing of the cox1 and cob genes. The entire mitochondrial genomes of T. asiatica and T. saginata were amplified by long-extension PCR and cloned; each was approximately 14kb in size. Restriction maps of T. asiatica and T. saginata mitochondrial genomes were

H. K. Jeon; K. S. Eom

2006-01-01

34

Redescription of Taenia solium Linnaeus, 1758 and Taenia saginata Goeze, 1782  

Microsoft Academic Search

Having redescribed the two species Taenia solium and Taenia saginata, it has been established that T. solium is not so rare as is usually supposed. The apparent scarcity is often due to a mis-identification of the proglottids of T. saginata. The apparent greater frequency of T. saginata can be explained insomuch that gravid proglottids of this species are voided spontaneously

Anna Verster; JEAN G. BAER

1967-01-01

35

Differential Diagnosis of Taenia saginata and Taenia solium Infection by PCR  

Microsoft Academic Search

We have designed species-specific oligonucleotides which permit the differential detection of two species of cestodes, Taenia saginata and Taenia solium. The oligonucleotides contain sequences established for two previously reported, noncoding DNA fragments cloned from a genomic library of T. saginata. The first, which is T. saginata specific (fragment HDP1), is a repetitive sequence with a 53-bp monomeric unit repeated 24

LUIS MIGUEL GONZALEZ; ESTRELLA MONTERO; LESLIE J. S. HARRISON; MICHAEL E. PARKHOUSE; TERESA GARATE; Ministerio de Sanidad

2000-01-01

36

Taenia saginata: A Rare Cause of Gall Bladder Perforation.  

PubMed

We report a case of biliary peritonitis caused by gall bladder perforation due to Taenia saginata induced gangrenous cholecystitis. Although parasites are not unusual causes of biliary tract disorders, especially in disease endemic areas, but this is for the first time that Taenia saginata has been reported to cause gall bladder perforation. PMID:22792505

Hakeem, Suhail Yaqoob; Rashid, Arshad; Khuroo, Suhail; Bali, Rajandeep Singh

2012-06-26

37

Taenia saginata: A Rare Cause of Gall Bladder Perforation  

PubMed Central

We report a case of biliary peritonitis caused by gall bladder perforation due to Taenia saginata induced gangrenous cholecystitis. Although parasites are not unusual causes of biliary tract disorders, especially in disease endemic areas, but this is for the first time that Taenia saginata has been reported to cause gall bladder perforation.

Hakeem, Suhail Yaqoob; Rashid, Arshad; Khuroo, Suhail; Bali, Rajandeep Singh

2012-01-01

38

Ag-ELISA and PCR for Monitoring the Vaccination of Cattle against Taenia saginata Cysticercosis Using an Oncospheral Adhesion Protein (HP6) with Surface and Secreted Localization  

Microsoft Academic Search

ATaenia saginata oncosphere-derived adhesion protein (HP6) with surface and secreted localization was used to successfully vaccinate calves against oral challenge withT. saginata eggs. In contrast, vaccination using a combination ofT. saginata oncosphere-derived peptides, selected on the basis of their antigenic index, and including three derived from the HP6 molecule (HP6-1, HP6-2 and HP6-3), was unsuccessful. This either indicated that the

L. J. S. Harrison; T. Garate; D. M. Bryce; L. M. Gonzalez; M. Foster-Cuevas; L. W. Wamae; J. A. Onyango-Abuje; R. M. E. Parkhouse

2005-01-01

39

Abnormal Taenia saginata tapeworms in Thailand.  

PubMed

Sixty-eight residents of Ban Luang and Ban Pang Kae villages, in Nan Province, northern Thailand, visited our mobile field station in September 2006 and March 2007, seeking treatment for taeniasis. After treatment, 22 cases discharged tapeworm strobila in their fecal samples and 17 scolices were recovered. Among these, 3 were morphologically abnormal, with six suckers on the scolex. To confirm the species of these tapeworms, the mitochondrial cytochrome c oxidase subunit I (COI) gene was used as a molecular marker. The partial COI sequences (800 bp) of the abnormal tapeworms were identical to the sequences of Taenia saginata deposited in Genbank. PMID:22299430

Maipanich, Wanna; Sato, Megumi; Pubampen, Somchit; Sanguankiat, Surapol; Kusolsuk, Teera; Thaenkham, Urusa; Waikagul, Jitra

2011-09-01

40

Development of a dot-enzyme immunoassay for the detection of circulating antigen in cattle infected with Taenia saginata cysticerci  

Microsoft Academic Search

A monoclonal antibody-based dot-ELISA was developed for the detection of antigen in the sera of cattle with Taenia saginata cysticercosis. After pretreatment of the sera with trichloroacetic acid, antigen could be detected in experimentally infected animals from five weeks after infection. The assay distinguished animals harbouring living cysts from those carrying only dead cysts. A reliable diagnosis of animals harbouring

E Draelants; E Hofkens; E Harding; J Brandt; S Geerts

1995-01-01

41

Evidence of hybridization between Taenia saginata and Taenia asiatica.  

PubMed

There has long been a debate as to the specific status of the cestode Taenia asiatica, with some people regarding it as a distinct species and some preferring to recognize it as a strain of Taenia saginata. The balance of current opinion seems to be that T. asiatica is a distinct species. In this study we performed an allelic analysis to explore the possibility of gene exchange between these closely related taxa. In total, 38 taeniid tapeworms were collected from humans living in many localities including Kanchanaburi Province, Thailand where the two species are sympatric. A mitochondrial DNA (mtDNA)-based multiplex PCR tentatively identified those parasites as T. asiatica (n=20) and T. saginata (n=18). Phylogenetic analyses of a mitochondrial cytochrome c oxidase subunit 1 (cox1) gene and two nuclear loci, for elongation factor-1 alpha (ef1) and ezrin-radixin-moesin (ERM)-like protein (elp), assigned all except two individual parasites to the species indicated by multiplex PCR. The two exceptional individuals, from Kanchanaburi Province, showed a discrepancy between the mtDNA and nuclear DNA phylogenies. In spite of their possession of sequences typical of the T. saginata cox1 gene, both were homozygous at the elp locus for one of the alleles found in T. asiatica. At the ef1 locus, one individual was homozygous for the allele found at high frequency in T. asiatica while the other was homozygous for the major allele in T. saginata. These findings are evidence of occasional hybridization between the two species, although the possibility of retention of ancestral polymorphism cannot be excluded. PMID:19874910

Okamoto, Munehiro; Nakao, Minoru; Blair, David; Anantaphruti, Malinee T; Waikagul, Jitra; Ito, Akira

2009-10-27

42

Molecular identification of species of Taenia causing bovine cysticercosis in Ethiopia.  

PubMed

Bovine cysticercosis causing damage to the beef industry is closely linked to human taeniasis due to Taenia saginata. In African countries, Taenia spp. from wildlife are also involved as possible sources of infections in livestock. To identify the aetiological agents of bovine cysticercosis in Ethiopia, cysticerci were collected from 41 cattle slaughtered in the eastern and central areas during 2010-2012. A single cysticercus per animal was subjected to the polymerase chain reaction (PCR)-based DNA sequencing of mitochondrial cytochrome c oxidase subunit 1 gene, and the resultant sequence was compared with those of members of the genus Taenia. Although 38 out of 41 cysticerci (92.7%) were identified as T. saginata, three samples (7.3%) showed the hitherto unknown sequences of Taenia sp., which is distantly related to Taenia solium, Taenia arctos and Taenia ovis. Old literatures suggest it to be Taenia hyaenae, but morphological identification of species could not be completed by observing only the larval samples. PMID:23452760

Hailemariam, Z; Nakao, M; Menkir, S; Lavikainen, A; Iwaki, T; Yanagida, T; Okamoto, M; Ito, A

2013-03-01

43

Differentiating Taenia solium and Taenia saginata Infections by Simple Hematoxylin-Eosin Staining and PCR-Restriction Enzyme Analysis  

PubMed Central

Species-specific identification of human tapeworm infections is important for public health purposes, because prompt identification of Taenia solium carriers may prevent further human cysticercosis infections (a major cause of acquired epilepsy). Two practical methods for the differentiation of cestode proglottids, (i) routine embedding, sectioning, and hematoxylin-eosin (HE) staining and (ii) PCR with restriction enzyme analysis (PCR-REA), were tested on samples from 40 individuals infected with T. solium (n = 34) or Taenia saginata (n = 6). Microscopic examination of HE staining of sections from 24 cases, in which conserved proglottids were recovered, clearly revealed differences in the number of uterine branches. Distinct restriction patterns for T. solium and T. saginata were observed when the PCR products containing the ribosomal 5.8S gene plus internal transcribed spacer regions were digested with either AluI, DdeI, or MboI. Both HE histology and PCR-REA are useful techniques for differentiating T. solium from T. saginata. Importantly, both techniques can be used in zones of endemicity. HE histology is inexpensive and is currently available in most regions of endemicity, and PCR-REA can be performed in most hospital centers already performing PCR without additional equipment or the use of radioactive material.

Mayta, H.; Talley, A.; Gilman, R. H.; Jimenez, J.; Verastegui, M.; Ruiz, M.; Garcia, H. H.; Gonzalez, A. E.

2000-01-01

44

Cloning and characterization of Taenia saginata paramyosin cDNA  

Microsoft Academic Search

A ?ZAP-express cDNA library of Taenia saginata metacestodes was constructed. Antibody screening yielded a clone with an insert of 3,408 bp, an open reading frame of 2,589 bp, a deduced sequence of 863 amino acid and a molecular mass of 98.89 kDa. Alignments of the predicted amino acid sequence showed identity with paramyosins from several species: 98.8% with Taenia solium, 96.3% with Echinococcus.granulosus

Elizabeth Ferrer; Eva Moyano; Laura Benitez; Luis Miguel González; Denise Bryce; Mildred Foster-Cuevas; Iris Dávila; Maria Milagros Cortéz; Leslie J. S. Harrison; R. Michael E. Parkhouse; Teresa Gárate

2003-01-01

45

Differential diagnosis of Taenia saginata and Taenia solium infections: from DNA probes to polymerase chain reaction  

Microsoft Academic Search

The objective of this work was the rapid and easy differential diagnosis of Taenia saginata and T. solium. First, a T. saginata size-selected genomic deoxyribonucleic acid (gDNA) library was constructed in the vector ?gt10 using the 2–4 kb fraction from the parasite DNA digested with EcoR1, under ‘star’ conditions. After differential screening of the library and hybridization analysis with DNA

Luis Miguel González; Estrella Montero; Edda Sciutto; Leslie J. S. Harrison; R. Michael E. Parkhouse; Teresa Garate

2002-01-01

46

Differential Diagnosis of Taenia saginata and Taenia solium Infection by PCR  

PubMed Central

We have designed species-specific oligonucleotides which permit the differential detection of two species of cestodes, Taenia saginata and Taenia solium. The oligonucleotides contain sequences established for two previously reported, noncoding DNA fragments cloned from a genomic library of T. saginata. The first, which is T. saginata specific (fragment HDP1), is a repetitive sequence with a 53-bp monomeric unit repeated 24 times in direct tandem along the 1,272-bp fragment. From this sequence the two oligonucleotides that were selected (oligonucleotides PTs4F1 and PTs4R1) specifically amplified genomic DNA (gDNA) from T. saginata but not T. solium or other related cestodes and had a sensitivity down to 10 pg of T. saginata gDNA. The second DNA fragment (fragment HDP2; 3,954 bp) hybridized to both T. saginata and T. solium DNAs and was not a repetitive sequence. Three oligonucleotides (oligonucleotides PTs7S35F1, PTs7S35F2, and PTs7S35R1) designed from the sequence of HDP2 allowed the differential amplification of gDNAs from T. saginata, T. solium, and Echinococcus granulosus in a multiplex PCR, which exhibits a sensitivity of 10 pg.

Gonzalez, Luis Miguel; Montero, Estrella; Harrison, Leslie J. S.; Parkhouse, R. Michael E.; Garate, Teresa

2000-01-01

47

[Research progress on molecular identification and biologic behavior of Taenia saginata in Western China].  

PubMed

This article reviews the epidemiological investigation of taeniasis saginata in 10 counties of 7 provinces/ autonomous regions in western China. The morphological observation of adult worms, molecular identification of 10 isolates of the worms, experimental infection on pigs and cattle with Taenia saginata and T. asiatica, observation on development and biology behavior of cysticercus, and pathological changes in the intermediate host pig and cattle revealed that T. asiatica is a new species, instead of a subspecies of T. saginata. PMID:20232638

Bao, Huai-En; Mou, Rong

2009-12-01

48

Experimental single and trickle infections of cattle with Taenia saginata: Studies of immunodiagnosis  

Microsoft Academic Search

Two groups of 12 calves were given either a single infection dose of 30,000 Taenia saginata eggs (group A) or trickle infected with 12 × 2500 T saginata eggs (group B). The calves were killed 16, 22 or 54 weeks after infection and the numbers of viable and dead parasites were counted by slicing selected organs and muscles of half

S Geerts

1996-01-01

49

Homologous and heterologous immunization against the metacestodes of Taenia saginata and Taenia taeniaeformis in cattle and mice  

Microsoft Academic Search

Cattle and mice were immunized against infection withTaenia saginata andTaenia taeniaeformis, respectively, using antigens obtained from both homologous and heterologous species of cestodes. Mice were protected against infection withT. taeniaeformis when they were immunized intramuscularly or orally with either a somatic antigen extracted from the metacestodes or an excretory\\/secretory (E\\/S) antigen collected during the in vitro culture of oncospheres ofT.

S. Lloyd

1979-01-01

50

Investigation of an outbreak of Taenia saginata cysts (cysticercus bovis) in dairy cattle from two farms.  

PubMed

The paper describes the epidemiological investigation carried out on two dairy farms with cattle infected with Taenia saginata cysts. On the first affected farm it was estimated using Bayesian techniques that approximately 65% of 1400 mixed-age cattle were infected with Taenia saginata cysts. The investigation aimed to determine potential exposure pathways of cattle to Taenia saginata with a view to finding the human source of infection and to describe the epidemiology of the outbreak on the affected farms. In order to determine potential exposure pathways, investigation was centred on how feed or water could have been contaminated with eggs. The plausibility of pathways was determined by examining the spatial and temporal association between factors related to the pathway and the prevalence of infection in cattle strata. We describe the investigation carried out on affected farms. PMID:21130574

McFadden, A M J; Heath, D D; Morley, C M; Dorny, P

2010-11-05

51

Taenia saginata a rare cause of acute cholangitis: a case report.  

PubMed

Parasitic infestations of the galdbladder and biliary tract are quite rare. Taenia saginata is an intestinal helmint and patients harbouring adult T.saginata tapeworms are mostly asymptomatic and discharge only fecal proglottids. In some cases there might be nonspecific symptoms like vomiting, nausea, epigastric pain, diarrhea and weight loss. Tenia saginata is a also rare cause of ileus, pancreatitis, cholecystitis and cholangitis. We report a case of acute cholangitis caused by T. saginata presenting with fever, nausea, vomiting, jaundice and right upper quadrant pain. Although parasites are not an uncommon cause of cholangitis especially in diseaseendemic areas like the Far East, this is not true for T. saginata causing acute cholangitis. PMID:23340150

Uygur-Bayramiçli, O; Ak, O; Dabak, R; Demirhan, G; Ozer, S

52

Application of Taenia saginata metacestodes as an alternative antigen for the serological diagnosis of human neurocysticercosis  

Microsoft Academic Search

Serological tests are an important tool for the diagnosis of neurocysticercosis (NCC), the disease caused by Taenia solium metacestodes. The aim of the present research was to test the application of Taenia saginata metacestodes as an alternative antigen for use in the immunofluorescence antibody test (IFAT), enzyme-linked immunosorbent\\u000a assay (ELISA), and Western blotting (WB) tests compared with the metacestodes antigen

Heliana B. Oliveira; Gleyce A. Machado; Dagmar D. Cabral; Julia M. Costa-Cruz

2007-01-01

53

Taeniasis and cysticercosis due to Taenia solium in Japan  

PubMed Central

Taenia solium is a zoonotic cestode that causes taeniasis and cysticercosis in humans. The parasite is traditionally found in developing countries where undercooked pork is consumed under poor sanitary conditions and/or as part of traditional food cultures. However, the recent increase in international tourism and immigration is spreading the disease into non-endemic developed countries such as the United States. Although there has been concern that the number of cysticercosis cases is increasing in Japan, the current situation is not clear. This is largely because taeniasis and cysticercosis are not notifiable conditions in Japan and because there have been no comprehensive reviews of T. solium infections in Japan conducted in the last 15 years. Herein, we provide an overview of the status of T. solium infection in Japan over the past 35 years and point out the potential risks to Japanese society.

2012-01-01

54

Taenia saginata: Differential diagnosis of human taeniasis by polymerase chain reaction-restriction fragment length polymorphism assay  

Microsoft Academic Search

Speciation of Taenia in human stool is important because of their different clinical and epidemiological features. DNA analysis has recently become possible which overcomes the problems of differentiating human taeniid cestodes morphologically. In the present study, we evaluated PCR coupled to restriction fragment length polymorphism to differentiate Taenia solium from Taenia saginata eggs present in fecal samples from naturally infected

Cáris Maroni Nunes; Ana Karina Kerche Dias; Francisca Elda Ferreira Dias; Sérgio Moraes Aoki; Henrique Borges de Paula; Luis Gustavo Ferraz Lima; José Fernando Garcia

2005-01-01

55

Distribution of Taenia saginata cysts by muscle group in naturally infected cattle in Tanzania  

Microsoft Academic Search

The distribution of Taenia saginata cysts among organs and muscle groups was determined by slicing the heart, masseters, liver and muscles of the half carcass of 21 naturally infected Zebu cattle from Morogoro abattoir, Tanzania. The carcasses harboured from 1 to 310 cysts. In the muscle groups, normally considered predilection sites, the heart and Musculus triceps brachii harboured the highest

Godfrey E. Maeda; Niels Chr. Kyvsgaard; Peter Nansen; Henrik O. Bøgh

1996-01-01

56

Preferential infection sites of Cysticercus bovis in cattle experimentally infected with Taenia saginata eggs  

Microsoft Academic Search

The preferential sites of infection of Cysticercus bovis were evaluated in the skeletal muscle and entrails of 25 cattle that were experimentally infected with Taenia saginata (2×104 eggs). Two other animals were not inoculated (control). Ninety days after inoculation, all the cattle were euthanized. The carcasses were deboned and dissected into 26 anatomical sections (masseter muscles, brain, tongue, esophagus, heart,

Welber D. Z. Lopes; Thaís R. Santos; Vando E. Soares; Jorge L. N. Nunes; Rafael P. Mendonça; Roberto C. A. de Lima; Cláudio A. M. Sakamoto; Gustavo H. N. Costa; Vanete Thomaz-Soccol; Gilson P. Oliveira; Alvimar J. Costa

2011-01-01

57

Vaccines against cysticercosis and hydatidosis: Foundations in taeniid cestode immunology  

Microsoft Academic Search

Recombinant oncosphere antigens have been used in the development of effective vaccines for the prevention of cysticercosis caused by Taenia ovis, Taenia saginata, Taenia solium and hydatid disease caused by Echinococcus granulosus. These vaccines were developed utilizing information gathered from numerous researchers over some 60 years which had established many of the principals concerning immunity to taeniid cestodes in their

Marshall W. Lightowlers

2006-01-01

58

Taenia solium taeniosis\\/cysticercosis in Asia: epidemiology, impact and issues  

Microsoft Academic Search

Several reports of patients with cysticercosis from many countries in Asia such as India, China, Indonesia, Thailand, Korea, Taiwan and Nepal are a clear indicator of the wide prevalence of Taenia solium cysticercosis and taeniosis in these and other Asian countries. However, epidemiological data from community based studies are sparse and available only for a few countries in Asia. Cysticercosis

Vedantam Rajshekhar; Durga Dutt Joshi; Nguyen Quoc Doanh; Nguyen van De; Zhou Xiaonong

59

Taenia solium taeniosis\\/cysticercosis in Asia: epidemiology, impact and issues  

Microsoft Academic Search

Several reports of patients with cysticercosis from many countries in Asia such as India, China, Indonesia, Thailand, Korea, Taiwan and Nepal are a clear indicator of the wide prevalence of Taenia solium cysticercosis and taeniosis in these and other Asian countries. However, epidemiological data from community based studies are sparse and available only for a few countries in Asia. Cysticercosis

Vedantam Rajshekhar; Durga Dutt Joshi; Nguyen Quoc Doanh; Nguyen van De; Zhou Xiaonong

2003-01-01

60

Molecular and functional characterization of a Taenia adhesion gene family (TAF) encoding potential protective antigens of Taenia saginata oncospheres  

Microsoft Academic Search

Two clones from an activated Taenia saginata oncosphere cDNA library, Ts45W and Ts45S, were isolated and sequenced. Both of these genes belong to the Taenia ovis 45W gene family. The Ts45W and Ts45S cDNAs are 997- and 1,004-bp-long, each corresponding to 255 amino acids and with theoretical\\u000a molecular masses of 27.8 and 27.7 kDa, respectively. Southern blot profiles obtained with Ts45W

Luis Miguel Gonzalez; Pedro Bonay; Laura Benitez; Elizabeth Ferrer; Leslie J. S. Harrison; R. Michael E. Parkhouse; Teresa Garate

2007-01-01

61

Immunization of pigs against Taenia solium cysticercosis: factors related to effective protection  

Microsoft Academic Search

Fifty-six (56) pigs were immunized against Taenia solium cysticercosis with antigens from Taenia crassiceps metacestodes, in a variety of protocols, and then challenged orally with Taenia solium proglottids or eggs. Results of immunization (expressed as individual parasite loads) ranged from significant reduction of parasite loads (host protection) to clear increase (parasite facilitation) in apparent relation to the immunogen dose, adjuvant

E. Sciutto; A. Aluja; G. Fragoso; L. F. Rodarte; M. Hernández; M. N. Villalobos; A. Padilla; N. Keilbach; M. Baca; T. Govezensky; S. Díaz; C. Larralde

1995-01-01

62

Cysticercosis  

MedlinePLUS

... is an infection by a parasite called Taenia solium ( T. solium ), a pork tapeworm that creates cysts in different ... Cysticercosis is caused by swallowing eggs from T. solium , which are found in contaminated food. Autoinfection is ...

63

The Mass Treatment of 'Taenia saginata' with Bithionol.  

National Technical Information Service (NTIS)

Fifty-four Taiwan aborigines with taeiasis saginata were treated with bithionol in a mass therapeutic study. The subjects were divided into two groups of 28 and 26 individuals. The first group received treatment following an overnight fast and the second ...

C. S. Tsai J. H. Cross

1971-01-01

64

The serological response of calves infected neonatally with Taenia saginata (Cysticercus bovis )  

Microsoft Academic Search

The serological response of five calves which had received a dose of 10,000Taenia saginata eggs at 2–3 days of age and weekly serial doses of 500 eggs for 12 months thereafter, was compared with that of a similar group of five calves which had received a single infection of 10,000 eggs at 2–3 days of age only. Both groups developed

G. J. Gallie; M. M. H. Sewell

1974-01-01

65

Haematological and immunological response of calves to infection with Taenia saginata  

Microsoft Academic Search

Calves were infected with eggs ofTaenia saginata and the haematologic response and the antigen-induced responsiveness of their peripheral blood lymphocytes was followed. No changes were observed in the erythrocyte levels, but a leukocytosis developed. This was contributed to primarily by a lymphocytosis, but also by an eosinophilia. Antigen-induced lymphocyte blastogenesis measured the antigen-sensitive cell population in peripheral blood and this

S. Lloyd

1980-01-01

66

Genetic Variation and Population Genetics of Taenia saginata in North and Northeast Thailand in relation to Taenia asiatica.  

PubMed

Taenia saginata is the most common human Taenia in Thailand. By cox1 sequences, 73 isolates from four localities in north and northeast were differentiated into 14 haplotypes, 11 variation sites and haplotype diversity of 0.683. Among 14 haplotypes, haplotype A was the major (52.1%), followed by haplotype B (21.9%). Clustering diagram of Thai and GenBank sequences indicated mixed phylogeny among localities. By MJ analysis, haplotype clustering relationships showed paired-stars-like network, having two main cores surrounded by minor haplotypes. Tajima's D values were significantly negative in T. saginata world population, suggesting population expansion. Significant Fu's F s values in Thai, as well as world population, also indicate that population is expanding and may be hitchhiking as part of selective sweep. Haplotype B and its dispersion were only found in populations from Thailand. Haplotype B may evolve and ultimately become an ancestor of future populations in Thailand. Haplotype A seems to be dispersion haplotype, not just in Thailand, but worldwide. High genetic T. saginata intraspecies divergence was found, in contrast to its sister species, T. asiatica; among 30 samples from seven countries, its haplotype diversity was 0.067, while only 2 haplotypes were revealed. This extremely low intraspecific variation suggests that T. asiatica could be an endangered species. PMID:23864933

Anantaphruti, Malinee; Thaenkham, Urusa; Kusolsuk, Teera; Maipanich, Wanna; Saguankiat, Surapol; Pubampen, Somjit; Phuphisut, Orawan

2013-06-24

67

Genetic Variation and Population Genetics of Taenia saginata in North and Northeast Thailand in relation to Taenia asiatica  

PubMed Central

Taenia saginata is the most common human Taenia in Thailand. By cox1 sequences, 73 isolates from four localities in north and northeast were differentiated into 14 haplotypes, 11 variation sites and haplotype diversity of 0.683. Among 14 haplotypes, haplotype A was the major (52.1%), followed by haplotype B (21.9%). Clustering diagram of Thai and GenBank sequences indicated mixed phylogeny among localities. By MJ analysis, haplotype clustering relationships showed paired-stars-like network, having two main cores surrounded by minor haplotypes. Tajima's D values were significantly negative in T. saginata world population, suggesting population expansion. Significant Fu's Fs values in Thai, as well as world population, also indicate that population is expanding and may be hitchhiking as part of selective sweep. Haplotype B and its dispersion were only found in populations from Thailand. Haplotype B may evolve and ultimately become an ancestor of future populations in Thailand. Haplotype A seems to be dispersion haplotype, not just in Thailand, but worldwide. High genetic T. saginata intraspecies divergence was found, in contrast to its sister species, T. asiatica; among 30 samples from seven countries, its haplotype diversity was 0.067, while only 2 haplotypes were revealed. This extremely low intraspecific variation suggests that T. asiatica could be an endangered species.

Anantaphruti, Malinee; Thaenkham, Urusa; Kusolsuk, Teera; Maipanich, Wanna; Saguankiat, Surapol; Pubampen, Somjit; Phuphisut, Orawan

2013-01-01

68

Characterization of the Taenia spp HDP2 sequence and development of a novel PCR-based assay for discrimination of Taenia saginata from Taenia asiatica.  

PubMed

A previously described Taenia saginata HDP2 DNA sequence, a 4-kb polymorphic fragment, was previously used as the basis for developing PCR diagnostic protocols for the species-specific discrimination of T. saginata from T. solium and for the differentiation of T. saginata from T. asiatica. The latter was shown subsequently to lack the required specificity, so we undertook genetic studies of the HDP2 sequence from T. saginata and T. asiatica to determine why, and to develop a novel HDP2-PCR protocol for the simultaneous unambiguous identification of human taeniids. Sequencing and further analysis of the HDP2 DNA fragments of 19 Asiatic isolates of T. saginata and T. asiatica indicated that the HDP2 sequences of both species exhibited clear genomic variability, due to polymorphic variable fragments, that could correspond to the non-transcribed region of ribosomal DNA. This newly observed polymorphism allowed us to develop a novel, reproducible and reliable HDP2-PCR protocol which permitted the simultaneous discrimination of all T. saginata and T. asiatica isolates examined. This species-specific identification was based on, and facilitated by, the clear size difference in amplicon profiles generated: fragments of 1300 bp, 600 bp and 300 bp were produced for T. asiatica, amplicons of 1300 bp and 300 bp being obtained for T. saginata. Control T. solium samples produced one amplicon of 600 bp with the HDP2-PCR protocol. The assay has the potential to prove useful as a diagnostic tool in areas such as South East Asia where T. saginata, T. asiatica and T. solium coexist. PMID:20540755

González, Luis M; Bailo, Begoña; Ferrer, Elizabeth; García, Maria D Fernandez; Harrison, Leslie Js; Parkhouse, Michael Re; McManus, Donald P; Gárate, Teresa

2010-06-11

69

Characterization of the Taenia spp HDP2 sequence and development of a novel PCR-based assay for discrimination of Taenia saginata from Taenia asiatica  

PubMed Central

A previously described Taenia saginata HDP2 DNA sequence, a 4-kb polymorphic fragment, was previously used as the basis for developing PCR diagnostic protocols for the species-specific discrimination of T. saginata from T. solium and for the differentiation of T. saginata from T. asiatica. The latter was shown subsequently to lack the required specificity, so we undertook genetic studies of the HDP2 sequence from T. saginata and T. asiatica to determine why, and to develop a novel HDP2-PCR protocol for the simultaneous unambiguous identification of human taeniids. Sequencing and further analysis of the HDP2 DNA fragments of 19 Asiatic isolates of T. saginata and T. asiatica indicated that the HDP2 sequences of both species exhibited clear genomic variability, due to polymorphic variable fragments, that could correspond to the non-transcribed region of ribosomal DNA. This newly observed polymorphism allowed us to develop a novel, reproducible and reliable HDP2-PCR protocol which permitted the simultaneous discrimination of all T. saginata and T. asiatica isolates examined. This species-specific identification was based on, and facilitated by, the clear size difference in amplicon profiles generated: fragments of 1300 bp, 600 bp and 300 bp were produced for T. asiatica, amplicons of 1300 bp and 300 bp being obtained for T. saginata. Control T. solium samples produced one amplicon of 600 bp with the HDP2-PCR protocol. The assay has the potential to prove useful as a diagnostic tool in areas such as South East Asia where T. saginata, T. asiatica and T. solium coexist.

2010-01-01

70

Measures for the prevention and control of Taenia solium taeniosis and cysticercosis  

Microsoft Academic Search

Taeniosis and cysticercosis due to Taenia solium are public health problems in many developing countries. Many studies of this parasitic zoonosis have focused on clinical features, diagnosis, treatment, surveillance, epidemiology and risk factors analysis. More recently projects on community and mass intervention strategies had been conducted in several rural areas worldwide focused on pig vaccination, pig cysticercosis treatment, human mass

Elsa Sarti; Vedantam Rajshekhar

2003-01-01

71

Regional status, epidemiology and impact of Taenia solium cysticercosis in Western and Central Africa  

Microsoft Academic Search

In West Africa, Taenia solium cysticercosis in both pigs and man has been reported in Benin, Burkina-Faso, Ghana, Ivory Coast, Senegal and Togo, and although official data are lacking, T. solium is anticipated to be present in most of the pig-raising regions of other West African countries as well. In some regions of Nigeria, the prevalence of porcine cysticercosis and

André Zoli; Oliver Shey-Njila; Emmanuel Assana; Jean-Pierre Nguekam; Pierre Dorny; Jef Brandt; Stanny Geerts

2003-01-01

72

DNA Differential Diagnosis of Taeniasis and Cysticercosis by Multiplex PCR  

Microsoft Academic Search

Received 11 August 2003\\/Returned for modification 19 September 2003\\/Accepted 26 November 2003 Multiplex PCR was established for differential diagnosis of taeniasis and cysticercosis, including their caus- ative agents. For identification of the parasites, multiplex PCR with cytochrome c oxidase subunit 1 gene yield- ed evident differential products unique for Taenia saginata and Taenia asiatica and for American\\/African and Asian genotypes

Hiroshi Yamasaki; James C. Allan; Marcello Otake Sato; Minoru Nakao; Yasuhito Sako; Kazuhiro Nakaya; Dongchuan Qiu; Wulamu Mamuti; Philip S. Craig; Akira Ito

2004-01-01

73

Development of the S3Pvac vaccine against porcine Taenia solium cysticercosis: a historical review.  

PubMed

Herein we present a review of our research dealing with vaccination against experimental and naturally acquired porcine Taenia solium cysticercosis using Taenia crassiceps-derived antigens. Results strongly support that the different versions of S3Pvac vaccine are indeed effective against porcine T. solium cysticercosis. Immunological results related to vaccination prove that protection is at least partially mediated by specific immunity. The data also support the validity of T. crassiceps murine cysticercosis as an effective tool to identify vaccine candidates against some metacestode infections. PMID:23445359

Sciutto, Edda; Fragoso, Gladis; Hernández, Marisela; Rosas, Gabriela; Martínez, José J; Fleury, Agnès; Cervantes, Jacquelynne; Aluja, Aline; Larralde, Carlos

2013-02-27

74

Variation in the cellular localization of host-protective oncospheral antigens in Taenia saginata and Taenia solium.  

PubMed

Immunohistochemistry and immunofluorescence with confocal microscopy were used to localize the host-protective antigens of Taenia saginata (TSA9 and TSA18) and Taenia solium (TSOL16, TSOL18 and TSOL45). In nonactivated oncospheres, TSA9 and TSOL45 antigens were found primarily in the cytoplasm of the penetration gland type one (PG1) cell. A similar pattern of staining was seen for TSOL45 in oncospheres of T. solium that remained within the oncospheral membrane. In addition, there was less intense staining of TSA9 and TSOL45 in the quadri-nucleate penetration gland type 2 (PG2) cell. TSA18, TSOL16 and TSOL18 were predominantly found in the PG2 cell. In activated oncospheres that had escaped the oncospheral membrane, the antigens (other than TSA9) were seen both in the penetration gland cell locations and throughout the oncospheral parenchyma. Co-localization analyses revealed that only TSOL16 and TSOL18 antigens were co-localized in the PG2 cell of oncospheres that had not escaped the oncospheral membrane. However, in activated oncospheres that escaped the oncospheral membrane, all three antigens of T. solium were co-localized as they were present throughout the parenchyma. No positive staining was observed on the surface of nonactivated or recently activated oncospheres of T. saginata or T. solium. PMID:20691020

Jabbar, A; Verástegui, M; Lackenby, J A; Walduck, A K; Gauci, C G; Gilman, R H; Lightowlers, M W

75

Jacalin-unbound fraction of Taenia saginata in immunodiagnosis of neurocysticercosis in human cerebrospinal fluid.  

PubMed

The aim of this study was to evaluate jacalin-bound fraction (JBF) and jacalin-unbound fraction (JUF) of the total saline extract from Taenia saginata metacestodes for human neurocysticercosis (NC) immunodiagnosis in cerebrospinal fluid. Total extract, JBF, and JUF were separated by affinity chromatography using Sepharose(®)-jacalin and were tested in enzyme-linked immunosorbent assay (ELISA) and Western blotting (WB) to detect immunoglobulin G. In ELISA test, JUF showed the higher diagnostic efficiency and specificity indexes, 92% and 100%, respectively. In WB, 5 immunodominant proteins (39-42, 47-52, 64-68, 70, and 75 kDa) were detected when using JUF. In conclusion, the results achieved demonstrate that JUF, obtained from T. saginata metacestodes, are an important source of specific peptides and are efficient in the diagnosis of NC. PMID:20846809

da Silva Nunes, Daniela; da Silva Ribeiro, Vanessa; Manhani, Marianna Nascimento; Costa-Cruz, Julia Maria

2010-09-16

76

Vaccination trials against Taenia solium eggs in pigs injected with frozen oncospheres of T. solium or Taenia saginata asiatica.  

PubMed

In this study, 12 Small-Ear-Miniature pigs aged 142 to 185 days were used to determine whether pigs injected with nonviable oncospheres of Taenia solium or Taenia saginata asiatica can become resistant to the challenge of viable eggs of T. solium. The 12 pigs were equally divided into 4 groups: 3 experimental groups in which each pig was injected subcutaneously with a mixture of 0.2 mL complete Freund's adjuvant and 10(4)/0.2 mL nonviable Taiwan/Asian Taenia, Indonesia Taenia, or T. solium oncospheres, and 1 control group in which each pig was injected subcutaneously with 0.2 mL phosphate buffer solution and 0.2 mL complete Freund's adjuvant. Each pig was orally inoculated with 10000 viable T. solium eggs 1 month later. The infection rates were 100% (2/2), 100% (3/3), 33% (1/3), and 100% (3/3) and cysticerci recovery rates were 1.3% (254/20000), 1.2% (371/30000), 0.01% (4/30000), and 8.6% (2,577/30000), respectively. Except for the location of 72 cysticerci located in the viscera, 3134 cysticerci were recovered from the muscles. In the experimental groups, 4 cysticerci recovered were viable and the remaining 625 were either calcified or degenerated. However, 2567 cysticerci recovered from the control group remained viable and only 10 were calcified or degenerated. The results indicate that in addition to the vaccine of T. solium, those of Taiwan Taenia and Indonesia Taenia can also induce high-crossing immunologic reactions against T. solium infection. PMID:12886959

Fan, Ping-Chin; Chung, Wen-Cheng; Lin, Chun-Yun; Wu, Chin-Cheng

2003-06-01

77

Long-term Taenia saginata infection successfully treated with meglumine/diatrizoate sodium.  

PubMed

A 46-year-old Japanese man visited our hospital for chronic abdominal pain, persistent diarrhea and discharge of proglottids for 7 years. He had been living in Lao People's Democratic Republic. Ileography using meglumine/diatrizoate sodium (Gastrografin) revealed a long tapeworm. A Taenia saginata including the scolex was excreted through the intestinal tract by the administration of total 780 ml of Gastrografin. Taeniasis is an important disease in the differential diagnosis of imported diseases in Japan. Parasite infection should be suspected in patients with chronic abdominal pain or persistent diarrhea regardless of the findings for small bowel obstruction when there is a history of overseas travel. PMID:22246486

Hirasaki, Shoji; Murakami, Kazutoshi; Mizushima, Takaaki; Hiramatsu, Kazuhisa; Hanayama, Yoshihisa; Kanamori, Tatsuya; Koide, Norio

2012-01-15

78

Sequence and immunogenicity of the Taenia saginata homologue of the major surface antigen of Echinococcus spp  

Microsoft Academic Search

A clone (R-Tso18) was isolated from a Taenia saginata oncosphere cDNA library by screening with sera from rabbits immunised with oncosphere extract. It contained a full-length\\u000a cDNA sequence of 1893?bp with an open reading frame of 1680?bp, corresponding to 559 amino acids with a deduced molecular\\u000a mass of 65.173?kDa and an isoelectric point of 6.08. The R-Tso18 protein showed 80–84%

Laura Benitez; Leslie J. S. Harrison; R. Michael E. Parkhouse; Luis M. Gonzalez; Bruno Gottstein; Teresa Garate

1998-01-01

79

Development of Taenia saginata asiatica metacestodes in SCID mice and its infectivity in human and alternative definitive hosts  

Microsoft Academic Search

Development of Taenia saginata asiatica metacestodes in SCID mice, and its infectivity in humans, golden hamsters, and Mongolian gerbils as alternative definitive hosts, were investigated. Cysticerci were recovered from SCID mice that were subcutaneously injected with hatched oncospheres of T. s. asiatica. The morphological changes of metacestodes were observed. The recovered cysticerci were fed to gerbils, hamsters and humans, to

S. L. Chang; N. Nonaka; M. Kamiya; Y. Kanai; H. K. Ooi; W. C. Chung; Y. Oku

2005-01-01

80

The serological response of three month old calves to infection with Taenia saginata (Cysticercus bovis) and their resistance to reinfection  

Microsoft Academic Search

Three calves, to which had been given100,000 eggs ofTaenia saginata at3 months of age, were significantly more resistant to a challenge infection10 months later than two previously uninfected control calves, although their resistance to reinfection was not complete.

G. J. Gallie; M. M. H. Sewell

1974-01-01

81

Characterization of microRNAs in Taenia saginata of zoonotic significance by Solexa deep sequencing and bioinformatics analysis.  

PubMed

The beef tapeworm Taenia saginata infects human beings with symptoms ranging from nausea, abdominal discomfort to digestive disturbances and intestinal blockage. In the present study, microRNA (miRNA) expressing profile in adult T. saginata was analyzed using Solexa deep sequencing and bioinformatics analysis. A total of 15.8 million reads was obtained by Solexa sequencing, and 13.3 million clean reads (1.73 million unique sequences) was obtained after removing reads smaller than 18 nt. Ten conserved miRNAs corresponding to 607,382 reads were found when matching the reads against known miRNAs of Schistosoma japonicum in miRBase database. The miR-71 had the most abundant expression in T. saginata, followed by miR-219-5p, but some other common miRNAs such as let-7, miR-40, and miR-103 were not identified in T. saginata. Nucleotide bias analysis found that the known miRNAs showed high bias and the uracil was the dominant nucleotide, particularly at the first and 11th positions which were almost at the beginning and middle of conserved miRNAs. One novel miRNA (Tsa-miR-001) corresponding to ten precursors was identified and confirmed by stem-loop RT-PCR. To our knowledge, this is the first report of miRNA profiles in T. saginata, which will contribute to better understanding of the complex biology of this zoonotic trematode. The reported data of T. saginata miRNAs should provide valuable references for miRNA studies of closed related zoonotic Taenia cestodes such as Taenia solium and Taenia asiatica. PMID:22203522

Ai, L; Xu, M J; Chen, M X; Zhang, Y N; Chen, S H; Guo, J; Cai, Y C; Zhou, X N; Zhu, X Q; Chen, J X

2011-12-28

82

Case-control study to identify risk factors for bovine cysticercosis on farms in Switzerland  

Microsoft Academic Search

SUMMARY Taenia saginata cysticercosis causes financial losses to the beef industry and farmers, and represents a significant source for human infection in many countries. A case-control study was conducted to identify risk factors for bovine cysticercosis on farms in Switzerland. The case group (n=119) consisted of farms with infected cattle identified at slaughter in 2005 and 2006. Infections were confirmed

F. FLÜTSCH; D. HEINZMANN; A. MATHIS; H. HERTZBERG; R. STEPHAN; P. DEPLAZES

2008-01-01

83

Two Epitopes Shared by Taenia crassiceps and Taenia solium Confer Protection against Murine T. crassiceps Cysticercosis along with a Prominent T1 Response  

Microsoft Academic Search

Taenia crassiceps recombinant antigens KETc1 and KETc12 have been shown to induce high level of protection against experimental murine T. crassiceps cysticercosis, an experimental model successfully used to test candidate antigens for use in vaccination against porcine Taenia solium cysticercosis. Based on the deduced amino acid sequence, KETc1 and KETc12 were chemically synthesized in linear form. Immunization with KETc1 induced

ANDREA TOLEDO; GLADIS FRAGOSO; GABRIELA ROSAS; MARISELA HERNANDEZ; GOAR GEVORKIAN; FERNANDO LOPEZ-CASILLAS; BEATRIZ HERNANDEZ; GONZALO ACERO; MIRNA HUERTA; CARLOS LARRALDE; EDDA SCIUTTO

2001-01-01

84

Genetic variability of the 18 kDa/HP6 protective antigen in Taenia saginata and Taenia asiatica: implications for vaccine development.  

PubMed

Genomic characterization of the genes encoding the Taenia 18 kDa/HP6 protective antigens was carried out for Taenia saginata and T. asiatica using 42 taeniid isolates comprising 23 samples of T. saginata, 13 samples of T. asiatica and 6 samples of T. solium. The corresponding sequences from all taeniid isolates were PCR-amplified with specific primers and then sequenced. All the genes, and other described taeniid gene homologues, had the same genomic structure. Surprisingly, the T. saginata TSA18 gene showed nucleotide variability within the 23 samples analyzed. This resulted in two distinct genotypes with 96% DNA sequence similarity and deduced amino acid sequences with 21 substitutions, mainly located in the second exon which contains the fibronectin type III domain. In regards to T. asiatica, the 18 kDa gene (TASI18) was very similar to the T. saginata antigen homologues, both at the DNA and deduced amino acid sequence levels, and the TSOL18 gene was conserved among T. solium isolates as previously described. The implications of these findings on the future development of taeniid vaccines are discussed. PMID:21232558

González, Luis M; Ramiro, Raquel; García, Luz; Parkhouse, R Michael E; McManus, Donald P; Gárate, Teresa

2011-01-11

85

The Taenia saginata homologue of the major surface antigen of Echinococcus spp. is immunogenic and 97% identical to its Taenia solium homologue  

Microsoft Academic Search

The TEG-Tsag gene of Taenia saginata is homologous to the genes expressing the two major surface antigens of Echinococcus spp. (EM10 and EG10). Surface antigens of parasites are logical candidates for vaccines, and in this paper we demonstrate\\u000a that cattle vaccinated with the recombinant TEG-Tsag protein, either used singly or in conjunction with the recombinant HP6-Tsag\\u000a protein, the major 18 kDa

Andrea Spickett; Lynne M. Michael; Adriano F. Vatta; Teresa Gárate; Leslie J. S. Harrison; R. Michael E. Parkhouse

2007-01-01

86

Taenia saginata: failure treatment in a child with 5-year long-lasting infection.  

PubMed

The management of these infections requires protocols that allow the clinic and laboratory to reach a timely and accurate diagnosis through the differential identification of Taenia species and consequently determine appropriate treatment. On the other hand, the inadequate implementation of treatments and the lack of follow-up coupled with biological phenomena such as resistance to drugs contribute important risks of infection for the population. This case could be caused by a strain of T. saginata with a low sensitivity to albendazole. This case emphasizes the need of developing and implementing techniques that will help us differentiate the species of Taenia in laboratories as well as establish treatments with alternative drugs. It is important to report this kind of infection with the aim of giving laboratory personnel as well as healthcare providers a broader knowledge of these parasites in order to improve treatment with alternative drugs. In addition, improvements in the habits among individuals must be addressed to avoid the increased risk of infection. PMID:22472672

Márquez-Navarro, Adrián; Cornejo-Coria, María del Carmen; Cebada-López, Flora; Sánchez-Manzano, Rosa M; Díaz-Chiguer, Dylan L; Nogueda-Torres, Benjamín

87

Sequence and preliminary characterisation of a Taenia saginata oncosphere gene homologue of the small heat-shock protein family  

Microsoft Academic Search

During antibody screening of a Taenia saginata oncosphere cDNA library a clone (R-Tso2) sharing a high degree of homology at both the DNA and amino acid levels with the\\u000a small heat-shock protein (shsp) family was identified. The R-Tso2 clone was a full-length sequence (1162 bp) with an open\\u000a reading frame of 945?bp and 314 amino acids, corresponding to a deduced

L. Benitez; L. J. S. Harrison; R. M. E. Parkhouse; T. Garate

1998-01-01

88

Inoculation of calves and adult cattle with oncospheres of Taenia saginata and their resistance to challenge infection  

Microsoft Academic Search

Following intramuscular inoculation ofTaenia saginata eggs hatchedin vitro, 1-month-old calves were capable of developing a complete immunity to the establishment of a living infection by oral challenge. Cysticerci developed at the injection sites and produced an effective immunity whether the hatched oncospheres were activatedin vitro or not. A few living cysticerci found at sites other than the inoculation sites were

G. J. Gallie; M. M. H. Sewell

1981-01-01

89

Studies on abnormality of metacestodes and adult worms of Taenia solium and Taenia saginata asiatica in rodents and pigs.  

PubMed

Abnormalities are not uncommon in Taenia saginata and T. solium. After examining 328 mature proglottids from 2 adult worms from two experimentally infected hamsters, 13 (4.0%) were found to have no genital pore but with numerous testes and several vas efferents; 1 (0.3%) one genital pore with one reproductive system; 12 (3.7%) one on each side with two sets of reproductive system; 17 (5.2%) two on one side with 2 sets of reproductive system; 8 (2.4%) one on one side and two on the other side with 3 sets of reproductive system; 2 (0.6%) two on each side with 4 sets of reproductive system; 4 (1.2%) three on one side with 3 sets of reproductive system, and 4 one on one side and three on the other side with 4 sets of reproductive system. Nine evaginated abnormal cysticerci of T. s. asiatica from three experimentally infected SCID mice each had two protoscoleces and a big bladder. From two experimentally infected pigs, one abnormal cysticercus was observed to have two invaginated canals each in one end. Another one had a neck-band behind the scolex and a big bladder. This paper is not only the first report of abnormality of T. solium from hamster but also the first one of abnormal cysticerci of T. s. asiatica from pigs and mice. PMID:12041572

Fan, P C; Wan, I C; Chung, W C; Guo, J X; Ma, X Y; Xu, Z J

2001-01-01

90

Cysticercosis/taeniasis in Asia and the Pacific.  

PubMed

Three taeniid tapeworms infect humans in Asia and the Pacific: Taenia solim, Taenia saginata, and Taenia asiatica. Although there is continuing debate about the definition of a new species, phylogenetic analyses of these parasites have provided multiple lines of evidence that T. asiatica is an independent species and the sister species of T. saginata. Here we review briefly the morphology, pathology, molecular biology, distribution and control options of taeniasis/cysticercosis in Asia and the Pacific and comment on the potential role which dogs may play in the transmission of T. solium. Special attention is focused on Indonesia: taeniasis caused by T. asiatica in North Sumatra, taeniasis/cysticercosis of T. solium and taeniasis of T. saginata in Bali, and taeniasis/cysticercosis of T. solium in Papua (formerly Irian Jaya). Issues relating to the spread of taeniasis/cysticercosis caused by T. solium in Papua New Guinea are highlighted, since serological evidence suggests that cysticercosis occurs among the local residents. The use of modern techniques for detection of taeniasis in humans and cysticercosis in humans, pigs and dogs, with the possible adoption of new control measures will provide a better understanding of the epidemiology of taeniasis/cysticercosis in Asia and the Pacific and lead to improved control of zoonotic and simultaneously meat-borne disease transmission. PMID:15228810

Ito, Akira; Wandra, Toni; Yamasaki, Hiroshi; Nakao, Minoru; Sako, Yasuhito; Nakaya, Kazuhiro; Margono, Sri S; Suroso, Thomas; Gauci, Charles; Lightowlers, Marshall W

2004-01-01

91

The pig tapeworm Taenia solium, the cause of cysticercosis: Biogeographic (temporal and spacial) origins in Madagascar.  

PubMed

Cysticercosis is a serious public health problem in Madagascar. The prevalence rate of active cysticercosis reached 21% in regions with a high level of livestock farming. Taenia solium of African-American and Asian genotypes are both present on the island. The times of divergence of the 13 specimens studied suggests a very ancient diversification of T. solium. These events are widely thought to be prior to the domestication of pigs, and seem to follow the expansion of Homo in Asia. Multiple human migrations and the diversity of potential intermediate hosts may have led to a complex epidemiological situation on the island. PMID:20093191

Michelet, Lorraine; Carod, Jean-François; Rakontondrazaka, Mahenintsoa; Ma, Laurence; Gay, Frédérick; Dauga, Catherine

2010-01-20

92

Synthetic peptide vaccine against Taenia solium pig cysticercosis: successful vaccination in a controlled field trial in rural Mexico  

Microsoft Academic Search

Taenia solium cysticercosis seriously affects human health when localised in the central nervous system (CNS) and causes great economic loss in pig husbandry in rural areas of endemic countries. Increasing the resistance to the parasite in the obligatory host pig may help in curbing transmission. Three synthetic peptides based on protein sequences of the murine parasite Taenia crassiceps, which had

M Huerta; A. S de Aluja; G Fragoso; A Toledo; N Villalobos; M Hernández; G Gevorkian; G Acero; A D??az; I Alvarez; R Avila; C Beltrán; G Garcia; J. J Martinez; C Larralde; E Sciutto

2001-01-01

93

Characterization and Protective Potential of the Immune Response to Taenia solium Paramyosin in a Murine Model of Cysticercosis  

Microsoft Academic Search

Paramyosin has been proposed as a vaccine candidate in schistosomiasis and filariasis. However, limited information is available about its protective potential against cysticercosis and the immune response it induces. Immunization of mice with recombinant full-length paramyosin of Taenia solium (TPmy) results in about a 52% reduction in parasite burden after a subsequent challenge by intraperitoneal inoculation of Taenia crassiceps cysticerci.

J. Vazquez-Talavera; C. F. Solis; L. I. Terrazas; J. P. Laclette

2001-01-01

94

Taenia solium cysticercosis in Bali, Indonesia: serology and mtDNA analysis.  

PubMed

An active Taenia solium cysticercosis case in Bali, Indonesia, was followed-up by serology and computed tomography. Serology using semi-purified glycoprotein and recombinant antigens showed a drastic drop in titers after calcification of the cysts. Three paraffin-embedded cysts, prepared for histopathological examination, from three other patients were used for mtDNA analysis. The sequences of cox1 gene from T. solium cysticerci from Bali differed from those in Papua and other Asian countries. PMID:17920648

Sudewi, A A R; Wandra, T; Artha, A; Nkouawa, A; Ito, A

2007-10-24

95

Development of the S3Pvac vaccine against murine Taenia crassiceps cysticercosis: a historical review.  

PubMed

Our work of the last 25 yr was concerned with the development of a vaccine aimed to prevent porcine Taenia solium cysticercosis and was based on cross-reacting Taenia crassiceps antigens that had proved protective against experimental intraperitoneal murine T. crassiceps cysticercosis (EIMTcC). In recent times the efficacy of the vaccine has been considered in need of confirmation, and the use of EIMTcC has been questioned as a valid tool in screening for vaccine candidates among the many antigens possibly involved. A review of our work divided in 2 parts is presented at this point, the first dealing with EIMTcC and the second with porcine T. solium cysticercosis (presented in this issue). Herein, we revise our results using EIMTcC as a measure of the protective capacity of T. crassiceps complex antigen mixtures, of purified native antigens, and of S3Pvac anti-cysticercosis vaccine composed by 3 protective peptides: GK-1, KETc1, and KETc12 either synthetic or recombinantly expressed and collectively or separately, by diverse delivery systems when administered at different doses and by different routes. Statistical analyses of the data lead confidently to the strong inference that S3Pvac is indeed an effective vaccine against EIMTcC via specific and non-specific mechanisms of protection. PMID:23409920

Sciutto, Edda; Fragoso, Gladis; Hernández, Marisela; Rosas, Gabriela; Martínez, José J; Fleury, Agnès; Cervantes, Jacquelynne; Aluja, Aline; Larralde, Carlos

2013-02-14

96

Effective protection induced by three different versions of the porcine S3Pvac anticysticercosis vaccine against rabbit experimental Taenia pisiformis cysticercosis.  

PubMed

In an effort to develop an effective and affordable oral vaccine against porcine Taenia solium cysticercosis, the S3Pvac anti-cysticercosis vaccine was expressed in papaya calli. Taenia pisiformis experimental rabbit cysticercosis was used as a model to compare the efficacy of the oral vaccine vs. the injectable S3Pvac-synthetic and S3Pvac-phage versions. Oral S3Pvac-papaya significantly reduced the expected number of hepatic lesions and peritoneal cysticerci to a similar extent than the injectable vaccines. This study reports for the first time an effective oral vaccine against T. pisiformis cysticercosis, possibly useful against porcine T. solium cysticercosis. PMID:22349522

Betancourt, Miguel Angel; de Aluja, Aline S; Sciutto, Edda; Hernández, Marisela; Bobes, Raúl J; Rosas, Gabriela; Hernández, Beatriz; Fragoso, Gladis; Hallal-Calleros, Claudia; Aguilar, Liliana; Flores-Peréz, Iván

2012-02-18

97

Spatial distribution of Taenia solium porcine cysticercosis within a rural area of Mexico.  

PubMed

Cysticercosis is caused by Taenia solium, a parasitic disease that affects humans and rurally bred pigs in developing countries. The cysticercus may localize in the central nervous system of the human, causing neurocysticercosis, the most severe and frequent form of the disease. There appears to be an association between the prevalence of porcine cysticercosis and domestic pigs that wander freely and have access to human feces. In order to assess whether the risk of cysticercosis infection is clustered or widely dispersed in a limited rural area, a spatial analysis of rural porcine cysticercosis was applied to 13 villages of the Sierra de Huautla in Central Mexico. Clustering of cases in specific households would indicate tapeworm carriers in the vicinity, whereas their dispersal would suggest that the ambulatory habits of both humans and pigs contribute to the spread of cysticercosis. A total of 562 pigs were included in this study (August-December 2003). A global positioning system was employed in order to plot the geographic distribution of both cysticercotic pigs and risk factors for infection within the villages. Prevalence of pig tongue cysticercosis varied significantly in sampled villages (p = 0.003), ranging from 0% to 33.3% and averaging 13.3%. Pigs were clustered in households, but no differences in the clustering of cysticercotic and healthy pigs were found. In contrast, the presence of pigs roaming freely and drinking stagnant water correlated significantly with porcine cysticercosis (p = 0.07), as did the absence of latrines (p = 0.0008). High prevalence of porcine cysticercosis proves that transmission is still quite common in rural Mexico. The lack of significant differentiation in the geographical clustering of healthy and cysticercotic pigs weakens the argument that focal factors (e.g., household location of putative tapeworm carriers) play an important role in increasing the risk of cysticercosis transmission in pigs. Instead, it would appear that other wide-ranging biological, physical, and cultural factors determine the geographic spread of the disease. Extensive geographic dispersal of the risk of cysticercosis makes it imperative that control measures be applied indiscriminately to all pigs and humans living in this endemic area. PMID:18846230

Morales, Julio; Martínez, José Juan; Rosetti, Marcos; Fleury, Agnes; Maza, Victor; Hernandez, Marisela; Villalobos, Nelly; Fragoso, Gladis; de Aluja, Aline S; Larralde, Carlos; Sciutto, Edda

2008-09-03

98

Prevalence of antibodies to unique Taenia solium oncosphere antigens in taeniasis and human and porcine cysticercosis.  

PubMed

The presence of two oncosphere antigens (OAs) of 22.5 and 31.3 kD in whole and excretory/secretory (ES) OA preparations of both Taenia solium and T. saginata or in antigen preparations from T. solium metacestodes or immature tapeworms was assessed. This included an evaluation of whether antibodies to other cestodes cross-reacted to these OAs. The OAs were present in whole oncosphere extract and E/S antigens of T. solium, but were not present in other stages (immature tapeworm or metacestode) or in OAs of T. saginata. The majority (95%) of T. solium tapeworm carriers had antibodies to these OAs, while only 20% of active neurocysticercosis cases were positive. No antibodies to the OAs were found in healthy controls, subjects infected with Hymenolepis nana, patients with hydatid disease, T. saginata tapeworm carriers, hamsters infected with immature T. solium tapeworms, or dogs infected with Echinococcus granulosus. The OAs are stage and species specific to T. solium and antibodies to OAs are usually present in tapeworm carriers. PMID:14640505

Verastegui, Manuela; Gilman, Robert H; Garcia, Hector H; Gonzalez, Armando E; Arana, Yanina; Jeri, Cesar; Tuero, Iskra; Gavidia, Cesar M; Levine, Min; Tsang, Victor C W

2003-10-01

99

Other cestodes: sparganosis, coenurosis and Taenia crassiceps cysticercosis.  

PubMed

Many cestodes are capable of invading the central nervous system (CNS), and several are highly prevalent in the developing world. Neurocysticercosis due to Taenia solium and echinococcosis due to Echinoccocus granulosus are two of the most common parasitic infections affecting humans, but other less well-known parasites can also infect the nervous system. Coenurosis, caused by Taenia spp. such as T. multiceps, T. serialis, or T. brauni; sparganosis, caused by Spirometra spp., and neurocysticercosis caused by T. crassiceps are three less frequent zoonotic conditions that should be considered in the differential diagnosis of patients presenting with CNS infection - especially if they have lived in or traveled through areas where these infections are endemic. Diagnosis of these infections is typically made through a combination of serological testing, histopathology, and neuroimaging. PMID:23829923

Lescano, Andres G; Zunt, Joseph

2013-01-01

100

Combating Taenia solium cysticercosis in Southeast Asia an opportunity for improving human health and livestock production.  

PubMed

Cysticercosis caused by the zoonotic pork tapeworm Taenia solium is emerging as a constraint for the nutritional and economic well-being of small-holder farming communities in many underdeveloped areas of Southeast Asia. It occurs mainly in impoverished regions with inadequate sanitation, poor pig management practices and lack of meat inspection and control. Neurocysticercosis, the most serious form of the disease, is considered the most common parasitic infection of the human nervous system and the most frequent preventable cause of epilepsy in the developing world. Although theoretically easy to control and declared eradicable, T. solium taeniosis/cysticercosis remains a neglected disease. There is a lack of information and awareness of the burden and transmission of the disease at the regional and global level, partially explained by the unavailability of good quality diagnostic tools in field-applicable formats. These factors are further compounded by a lack of validated simple and sustainable intervention packages as part of integrated helminth control programmes. To date, T. solium taeniosis/cysticercosis has not been eliminated from any region by a specific programme in Southeast Asia, and no national control programmes are yet in place except in parts of the People's Republic of China. The presence, distribution, public health importance and economic relevance of cysticercosis need to be better documented in Southeast Asia in order to bring it to the attention of affected communities, decision-makers and funding bodies. A number of proven cost-effective intervention tools for combating cysticercosis appear to be available but need to be field validated. The Regional Network for Asian Schistosomiasis and Other Helminth Zoonoses (RNAS(+)) serves as an important regional 'driving force' for managing research, capacity building, knowledge and stakeholder engagement essential for controlling cysticercosis in the Southeast Asian region while ensuring that research efforts are integrated with regional needs for surveillance and control. PMID:20624534

Willingham, A Lee; Wu, Hai-Wei; Conlan, James; Satrija, Fadjar

2010-01-01

101

Efficacy and safety of anthelmintics tested against Taenia solium cysticercosis in pigs.  

PubMed

Porcine cysticercosis, an infection caused by Taenia solium metacestodes, is continuously being reported in low-income countries of Latin America, Asia, and sub-Saharan Africa. The disease was declared eradicable by the International Task Force for Diseases Eradication (ITFDE) in 1993, and it is listed among the 17 WHO Neglected Tropical Diseases and Neglected Zoonoses that are potentially eradicable. In view of that, WHO has proposed a step-wise approach to its elimination, including chemotherapy of infected pigs. Different drugs have been tested on porcine cysticercosis with varying efficacies. These include flubendazole, fenbendazole, albendazole, albendazole sulphoxide, oxfendazole, praziquantel, and nitazoxanide. This review summarises available information on the efficacies and adverse effects shown by these drugs in pigs. Oxfendazole has shown to be effective for the control of porcine cysticercosis; however, it needs to be integrated with other control approaches. There is a need for standardised guidelines for evaluating the efficacy of anthelmintics against porcine cysticercosis, and more efficacy studies are needed since the conclusions so far are based on a limited number of studies using few infected pigs. PMID:23936558

Mkupasi, Ernatus Martin; Sikasunge, Chummy Sikalizyo; Ngowi, Helena Aminiel; Johansen, Maria Vang

2013-07-25

102

Serological Diagnosis of Human Cysticercosis by Use of Recombinant Antigens from Taenia solium Cysticerci  

PubMed Central

A Taenia solium metacestode cDNA expression library in the lambda ZAPII vector was screened with pooled sera from patients with neurocysticercosis. Sixty primary clones were identified and shown to belong to two classes. The clones NC-3 and NC-9 did not reveal any significant homologies to sequences deposited in the databases and were further characterized. Both recombinant antigens were expressed as glutathione S-transferase fusion proteins and applied for serological diagnosis of human cysticercosis. An enzyme-linked immunosorbent assay was established and evaluated with 27 serum samples of La Réunion and Madagascar patients with cysticercosis. Diagnosis in these patients was established with radiological and serological procedures. For antigen NC-3 a sensitivity of 96.3% and a specificity of 91.5% for the serodiagnosis were achieved. In contrast, the sensitivity of antigen NC-9 was only 33.3%.

Hubert, Kerstin; Andriantsimahavandy, Abel; Michault, Alain; Frosch, Matthias; Muhlschlegel, Fritz A.

1999-01-01

103

In vitro Oncosphere-Killing Assays to Determine Immunity to the Larvae of Taenia pisiformis, Taenia ovis, Taenia saginata, and Taenia solium  

Microsoft Academic Search

Taeniid cestodes infect humans and livestock, causing considerable morbidity and mortality, as well as economic loss. Substantial progress has been made toward the production of recombinant vaccines against cysticercosis in livestock animals. Further development of these vaccines would be aided if a reliable in vitro test were available to measure host-protective immune responses in vaccinated animals. Here, we describe in

Craig T. Kyngdon; Charles G. Gauci; Rick A. Rolfe; Jeanette C. Velásquez Guzmán; Marilú J. Farfán Salazar; Manuela R. Verástegui Pimentel; Armando E. Gonzalez; Hector H. Garcia; Robert H. Gilman; Richard A. Strugnell; Marshall W. Lightowlers

2006-01-01

104

Taenia solium taeniosis/cysticercosis in Asia: epidemiology, impact and issues.  

PubMed

Several reports of patients with cysticercosis from many countries in Asia such as India, China, Indonesia, Thailand, Korea, Taiwan and Nepal are a clear indicator of the wide prevalence of Taenia solium cysticercosis and taeniosis in these and other Asian countries. However, epidemiological data from community based studies are sparse and available only for a few countries in Asia. Cysticercosis is the cause of epilepsy in up to 50% of Indian patients presenting with partial seizures. It is also a major cause of epilepsy in Bali (Indonesia), Vietnam and possibly China and Nepal. Seroprevalence studies indicate high rates of exposure to the parasite in several countries (Vietnam, China, Korea and Bali (Indonesia)) with rates ranging from 0.02 to 12.6%. Rates of taeniosis, as determined by stool examination for ova, have also been reported to range between 0.1 and 6% in the community in India, Vietnam, China, and Bali (Indonesia). An astonishingly high rate of taeniosis of 50% was reported from an area in Nepal populated by pig rearing farmers. In addition to poor sanitation, unhealthy pig rearing practices, low hygienic standards, unusual customs such as consumption of raw pork is an additional factor contributing to the spread of the disease in some communities of Asia. Undoubtedly, cysticercosis is a major public health problem in several Asian countries effecting several million people by not only causing neurological morbidity but also imposing economic hardship on impoverished populations. However, there are wide variations in the prevalence rates in different regions and different socio-economic groups in the same country. It is important to press for the recognition of cysticercosis as one of the major public health problems in Asia that needs to be tackled vigorously by the governments and public health authorities of the region. PMID:12781378

Rajshekhar, Vedantam; Joshi, Durga Dutt; Doanh, Nguyen Quoc; van De, Nguyen; Xiaonong, Zhou

2003-06-01

105

Taeniasis/cysticercosis in Bali, Indonesia.  

PubMed

Taenia solium and Taenia saginata are found in humans in Bali, Indonesia. During a field survey of 660 people in Bali from 2002-2009 of taeniasis/cysticercosis cases using mitochondrial DNA confirmation of the species, we detected 80 cases of T. saginata taeniasis, 2 dual T. saginata/T. solium infections with T. solium metacestodes in the brain and 12 neurocysticercosis (NCC) cases at Sanglah Hospital, Denpasar. Although the prevalence of NCC in Bali is low, sporadic cases are still present. There is no Taenia asiatica in Bali. We summarize here the field survey findings of taeniasis, including 1 dual infection with taeniasis and cysticercosis in 2007, and the reason why there are no T. asiatica cases and we describe 3 NCC cases admitted to Sanglah Hospital, Denpasar, Bali in 2004. Diagnosis was based on anamnesis, clinical examination, including CT Scan, histopathological, serological and mitochondrial DNA examinations. In order to prevent unexpected symptomatic NCC after treatment with praziquantel, we recommend introducing a rapid test to confirm taeniasis carriers and cysticercosis cases as a tool for real time diagnosis. PMID:22299461

Wandra, Toni; Sudewi, A A Raka; Swastika, I Kadek; Sutisna, Putu; Dharmawan, Nyoman S; Yulfi, Hemma; Darlan, Dewi Masyithah; Kapti, I Nengah; Samaan, Gina; Sato, Marcello Otake; Okamoto, Munehiro; Sako, Yasuhito; Ito, Akira

2011-07-01

106

Improved detection of circulating antigen in cattle infected with Taenia saginata metacestodes  

Microsoft Academic Search

In order to improve the sensitivity and the specificity of an existing IgM monoclonal antibody-based ELISA (Brandt et al., 1992) for the detection of circulating antigen in the sera of cattle infected with T. saginata metacestodes, a modified sandwich ELISA was developed. Monoclonal antibodies (MAbs) of the IgG isotype were produced against the excretory–secretory (ES)-products of T. saginata metacestodes. Since

I. Van Kerckhoven; W. Vansteenkiste; M. Claes; S. Geerts; J. Brandt

1998-01-01

107

A seroepidemiological survey of Taenia solium cysticercosis in Nabo, Guangxi Zhuang Autonomous Region, China  

PubMed Central

We have observed the seropositive rate of Taenia solium cysticercosis in residents at Nabo Village, Tiandong County, Guangxi Zhuang Autonomous Region, China by enzyme linked immunosorbent assay. The village had been found to be a relatively high endemic area of porcine cysticercosis among roaming pigs. Of 202 persons examined four males aged 15, 25, 35 and 41 year-old exhibited absorbance (abs) at 0.18, 0.20, 0.35 and 0.55, respectively. In addition, two females whose ages were 35 and 39 years revealed specific antibody levels of abs 0.26 and 0.41 in their sera. Overall positive rate among the people was 2.97%. All of these persons agreed that they had ingested the pork infected with T. solium metacestode (TsM), while history of proglottid discharge was not noticed from all of them. Three males and one female complained of intermittent headache. Our findings reinforced not only that the prevalence of cysticercosis might be related with roaming pigs infected with TsM but also that behavioral and environmental practices in local community constituted risk factors for transmission of the infection.

Chung, Joon-Yong; Eom, Keeseon S.; Yang, Yichao; Li, Xenming; Feng, Zheng; Rim, Han-Jong; Cho, Seung-Yull

2005-01-01

108

A seroepidemiological survey of Taenia solium cysticercosis in Nabo, Guangxi Zhuang Autonomous Region, China.  

PubMed

We have observed the seropositive rate of Taenia solium cysticercosis in residents at Nabo Village, Tiandong County, Guangxi Zhuang Autonomous Region, China by enzyme linked immunosorbent assay. The village had been found to be a relatively high endemic area of porcine cysticercosis among roaming pigs. Of 202 persons examined four males aged 15, 25, 35 and 41 year-old exhibited absorbance (abs) at 0.18, 0.20, 0.35 and 0.55, respectively. In addition, two females whose ages were 35 and 39 years revealed specific antibody levels of abs 0.26 and 0.41 in their sera. Overall positive rate among the people was 2.97%. All of these persons agreed that they had ingested the pork infected with T. solium metacestode (TsM), while history of proglottid discharge was not noticed from all of them. Three males and one female complained of intermittent headache. Our findings reinforced not only that the prevalence of cysticercosis might be related with roaming pigs infected with TsM but also that behavioral and environmental practices in local community constituted risk factors for transmission of the infection. PMID:16340302

Chung, Joon Yong; Eom, Keeseon S; Yang, Yichao; Li, Xenming; Feng, Zheng; Rim, Han Jong; Cho, Seung Yull; Kong, Yoon

2005-12-01

109

New approaches to improve a peptide vaccine against porcine Taenia solium cysticercosis.  

PubMed

Cysticercosis caused by Taenia solium frequently affects human health and rustic porciculture. Cysticerci may localize in the central nervous system of humans causing neurocysticercosis, a major health problem in undeveloped countries. Prevalence and intensity of this disease in pigs and humans are related to social factors (poor personal hygiene, low sanitary conditions, rustic rearing of pigs, open fecalism) and possibly to biological factors such as immunity, genetic background, and gender. The indispensable role of pigs as an obligatory intermediate host in the life cycle offers the possibility of interfering with transmission through vaccination of pigs. An effective vaccine based on three synthetic peptides against pig cysticercosis has been successfully developed and proved effective in experimental and field conditions. The well-defined peptides that constitute the cysticercosis vaccine offer the possibility to explore alternative forms of antigen production and delivery systems that may improve the cost/benefit of this and other vaccines. Encouraging results were obtained in attempts to produce large amounts of these peptides and increased its immunogenicity by expression in recombinant filamentous phage (M13), in transgenic plants (carrots and papaya), and associated to bacterial immunogenic carrier proteins. PMID:12234527

Sciutto, Edda; Fragoso, Gladis; Manoutcharian, Karen; Gevorkian, Goar; Rosas-Salgado, Gabriela; Hernández-Gonzalez, Marisela; Herrera-Estrella, Luis; Cabrera-Ponce, José; López-Casillas, Fernando; González-Bonilla, César; Santiago-Machuca, Araceli; Ruíz-Pérez, Fernando; Sánchez, Joaquín; Goldbaum, Fernando; Aluja, Aline; Larralde, Carlos

110

Research note a Taenia solium oncosphere protein homologous to host-protective Taenia ovis and Taenia saginata 18 kDa antigens fn1 fn1 The nucleotide sequence reported in this paper was deposited in the Genbank, embl and DDBJ databases under accession number AFO17788  

Microsoft Academic Search

A Taenia solium cDNA (TSOL-18) encoding a protein with close homology to host protective oncosphere antigens from Taenia ovis (To18) and Taenia saginata (TSA-18) is described here. TSOL-18 was cloned from mRNA obtained from hatched and activated oncospheres of T. solium. The high level of predicted amino acid sequence homology among TSOL-18 and other host protective taeniid antigens suggests that

Charles G. P Gauci; Ana Flisser; Marshall W Lightowlers

1998-01-01

111

Immunoelectrophoretic analyses of antigens shared by the vesicular fluid and cyst wall of Taenia crassiceps and Taenia saginata metacestodes  

Microsoft Academic Search

In this study, the antigenic mosaic of the vesicular fluid (VF) and hydrosoluble cyst-wall extract (CWE) ofT. crassiceps (Tc; harvested from mice) andT. saginata (Ts) metacestodes was analyzed by combined precipitation maps developed in single and bidimensional immunoelectrophorsis against the respective rabbit antiserum. Hostserum proteins demonstrated by immunodiffusion within TcVF (albumin, transferrin, IgG, and another five noncharacterized proteins), TcCWE (albumin,

B. Kalinna; Marion Becker; E. Geyer

1989-01-01

112

Taeniasis and cysticercosis in Asia and the Pacific: present state of knowledge and perspectives.  

PubMed

Several topics on taeniasis and cysticercosis in Asia and the Pacific are overviewed. In Asia and the Pacific, three human taeniid species have been recognized: Taenia solium, Taenia saginata and Taenia asiatica. The first topic is on evolution of T. solium. Mitochondrial DNA polymorphisms of T. solium worldwide are discussed with emphasis of two specific genotypes: American-African and Asian. The second topic is recent major advances in sero- and molecular-diagnosis of T. solium cysticercosis in humans, pigs and dogs. The third is the present situation of T. solium taeniasis/cysticercosis in Papua (Irian Jaya), Indonesia. The forth is the present situation of T. solium cysticercosis and T. saginata taeniasis in Bali, Indonesia. The fifth is the present situation of T. asiatica taeniasis in Asia and the Pacific and in North Sumatra, Indonesia. The sixth is on the debate of the exact definition of T. asiatica. Because T. asiatica can not be differentiated from T. saginata morphologically, it is time to re-evaluate T. saginata in Asia and the Pacific. New and broad-based surveys across this region are necessary from epidemiological and public health perspectives, based on evidence. PMID:16438196

Ito, Akira; Nakao, Minoru; Wandra, Toni; Suroso, Thomas; Okamoto, Munehiro; Yamasaki, Hiroshi; Sako, Yasuhito; Nakaya, Kazuhiro

2005-01-01

113

Taenia crassiceps cysticercosis in a ring-tailed lemur (Lemur catta).  

PubMed

Subcutaneous and intraperitoneal cysticercosis due to Taenia crassiceps was diagnosed in a 5-yr-old male ring-tailed lemur (Lemur catta) in the Madrid Zoo-Aquarium (Madrid, Spain). Under laparoscopic examination, several septated fibrous cystic structures and numerous masses of small transparent vesicles (ca. 3 mm in diameter) were observed subcutaneously and inside the peritoneal cavity. Most of the structures were extirpated but, after 2 days of postsurgical intensive care, the animal died. The loss of body weight of the animal after surgical extirpation (566 g) represented 22% of the total weight (body weight before mass removal, 2582 g). The vesicles were identified under light microscopic examination as cysticerci and by molecular diagnosis as Cysticercus longicollis, the larval form of T. crassiceps. The present report represents the first detection of T. crassiceps in the prosimian genus Lemur. PMID:20597227

Luzón, Mónica; de la Fuente-López, Concepción; Martínez-Nevado, Eva; Fernández-Morán, Jesús; Ponce-Gordo, Francisco

2010-06-01

114

Protection of pigs against Taenia solium cysticercosis by immunization with novel recombinant antigens  

PubMed Central

Recombinant antigens from the oncosphere stage of the parasite Taenia solium were expressed in Escherichia coli. The TSOL16, TSOL45-1A and TSOL45-1B recombinant antigens, each consisting of fibronectin type III (FnIII) domain S, were produced as fusion proteins with glutathione S-transferase (GST) and maltose binding protein (MBP). Groups of pigs were immunized twice with the GST fusions of the antigens and boosted a third time with the MBP fusions prior to receiving a challenge infection with T. solium eggs. The TSOL16 antigen was found to be capable of inducing high levels of immunity in pigs against a challenge infection with T. solium. Immunological investigations identified differences in immune responses in the pigs vaccinated with the various antigens. The results demonstrate that the TSOL16 antigen could be a valuable adjunct to current porcine vaccination approaches and may allow the further development of new vaccination strategies against T. solium cysticercosis.

Gauci, Charles G.; Jayashi, Cesar M.; Gonzalez, Armando E.; Lackenby, Julia; Lightowlers, Marshall W.

2012-01-01

115

Taenia solium cysticercosis/taeniosis: potential linkage with FAO activities; FAO support possibilities.  

PubMed

Neurocysticercosis due to Taenia solium metacestodes is an important cause of human morbidity and mortality, particularly in parts of Latin America, Africa and Asia. The disease has been recognized as potentially eradicable. Emphasis has been placed on control through mass chemotherapy of human populations to remove tapeworm carriers, but this strategy does not control the source of infections, which is cysticercosis in pigs. Also, transmission may continue due to incomplete chemotherapy coverage of human carriers or because of immigration of tapeworm carriers into controlled areas. The FAO through the Veterinary Public Health (VPH) and Food Safety program has provided support for the write-up of guidelines for cysticercosis, diagnoses and control. This should be released in a joint effort with OIE and WHO and will provide regular support to seminars, workshops and congresses related to VPH. The FAO regular program has also established a global network of people directly involved in VPH, and is currently in the process of establishing four regional networks located in Asia, Africa, Eastern and Central Europe and Latin America. The networks should provide a basic framework to spread information related to diagnosis, prevention and control of major zoonotic diseases through electronic conferences, discussions, newsletters, and a Directory to establish contact with people involved in VPH and zoonotic diseases. Through the Technical Cooperation Program (TCP) the FAO has a tool to help Member Countries to create the basic environment to control emerging zoo-sanitary problems, such as zoonotic and food borne diseases. PMID:12781389

Eddi, Carlos; Nari, Armando; Amanfu, William

2003-06-01

116

Taenia saginata metacestode antigenic fractions without affinity to concanavalin A are an important source of specific antigens for the diagnosis of human neurocysticercosis.  

PubMed

Taenia saginata metacestode antigens have been constituted a useful alternative antigen for neurocysticercosis (NC) serodiagnosis, particularly due to an increasing difficulty to obtain Taenia solium homologous antigen. Cross-reactivity with Echinococcus granulosus infection occurs in homologous and heterologous antigens and could be avoided by using different purified methods. The present study evaluated antigen fractions obtained from saline extracts of T. saginata metacestodes purified by affinity chromatography with jacalin or concanavalin A (ConA) lectins to detect IgG antibodies by enzyme-linked immunosorbent assay (ELISA) and immunoblot analysis to diagnose human NC. Serum samples were collected from 142 individuals: 40 of them were diagnosed with NC, 62 presented Taenia sp. and other parasites, and 40 were apparently healthy individuals. The jacalin- and ConA-unbound fractions demonstrated sensitivity and specificity higher than those of bound fractions. Among unbound fractions, ConA demonstrated statistically higher sensitivity and specificity by ELISA (90% and 93.1%, respectively). By immunoblot assay, the 64- to 68-kDa component from the ConA-unbound fraction showed 100% sensitivity and specificity, making this component suitable for use as a specific antigen for diagnosis of NC. To our knowledge, this is the first report showing the relevance of using the unbound ConA fraction of T. saginata metacestodes to diagnose NC. In conclusion, the results obtained herein clearly demonstrate that antigenic fractions without affinity to ConA, obtained from T. saginata metacestodes, are an important source of specific peptides and are efficient in the diagnosis of NC when tested by immunoblot assay. PMID:20130125

Oliveira, Heliana B; Machado, Gleyce A; Mineo, José R; Costa-Cruz, Julia M

2010-02-03

117

Taenia saginata Metacestode Antigenic Fractions without Affinity to Concanavalin A Are an Important Source of Specific Antigens for the Diagnosis of Human Neurocysticercosis?  

PubMed Central

Taenia saginata metacestode antigens have been constituted a useful alternative antigen for neurocysticercosis (NC) serodiagnosis, particularly due to an increasing difficulty to obtain Taenia solium homologous antigen. Cross-reactivity with Echinococcus granulosus infection occurs in homologous and heterologous antigens and could be avoided by using different purified methods. The present study evaluated antigen fractions obtained from saline extracts of T. saginata metacestodes purified by affinity chromatography with jacalin or concanavalin A (ConA) lectins to detect IgG antibodies by enzyme-linked immunosorbent assay (ELISA) and immunoblot analysis to diagnose human NC. Serum samples were collected from 142 individuals: 40 of them were diagnosed with NC, 62 presented Taenia sp. and other parasites, and 40 were apparently healthy individuals. The jacalin- and ConA-unbound fractions demonstrated sensitivity and specificity higher than those of bound fractions. Among unbound fractions, ConA demonstrated statistically higher sensitivity and specificity by ELISA (90% and 93.1%, respectively). By immunoblot assay, the 64- to 68-kDa component from the ConA-unbound fraction showed 100% sensitivity and specificity, making this component suitable for use as a specific antigen for diagnosis of NC. To our knowledge, this is the first report showing the relevance of using the unbound ConA fraction of T. saginata metacestodes to diagnose NC. In conclusion, the results obtained herein clearly demonstrate that antigenic fractions without affinity to ConA, obtained from T. saginata metacestodes, are an important source of specific peptides and are efficient in the diagnosis of NC when tested by immunoblot assay.

Oliveira, Heliana B.; Machado, Gleyce A.; Mineo, Jose R.; Costa-Cruz, Julia M.

2010-01-01

118

Identification of loci controlling restriction of parasite growth in experimental Taenia crassiceps cysticercosis.  

PubMed

Human neurocysticercosis (NC) caused by Taenia solium is a parasitic disease of the central nervous system that is endemic in many developing countries. In this study, a genetic approach using the murine intraperitoneal cysticercosis caused by the related cestode Taenia crassiceps was employed to identify host factors that regulate the establishment and proliferation of the parasite. A/J mice are permissive to T. crassiceps infection while C57BL/6J mice (B6) are comparatively restrictive, with a 10-fold difference in numbers of peritoneal cysticerci recovered 30 days after infection. The genetic basis of this inter-strain difference was explored using 34 AcB/BcA recombinant congenic strains derived from A/J and B6 progenitors, that were phenotyped for T. crassiceps replication. In agreement with their genetic background, most AcB strains (A/J-derived) were found to be permissive to infection while most BcA strains (B6-derived) were restrictive with the exception of a few discordant strains, together suggesting a possible simple genetic control. Initial haplotype association mapping using >1200 informative SNPs pointed to linkages on chromosomes 2 (proximal) and 6 as controlling parasite replication in the AcB/BcA panel. Additional linkage analysis by genome scan in informative [AcB55xDBA/2]F1 and F2 mice (derived from the discordant AcB55 strain), confirmed the effect of chromosome 2 on parasite replication, and further delineated a major locus (LOD = 4.76, p<0.01; peak marker D2Mit295, 29.7 Mb) that we designate Tccr1 (T. crassiceps cysticercosis restrictive locus 1). Resistance alleles at Tccr1 are derived from AcB55 and are inherited in a dominant fashion. Scrutiny of the minimal genetic interval reveals overlap of Tccr1 with other host resistance loci mapped to this region, most notably the defective Hc/C5 allele which segregates both in the AcB/BcA set and in the AcB55xDBA/2 cross. These results strongly suggest that the complement component 5 (C5) plays a critical role in early protective inflammatory response to infection with T. crassiceps. PMID:22206032

Ramirez-Aquino, Ruben; Radovanovic, Irena; Fortin, Anny; Sciutto-Conde, Edda; Fragoso-González, Gladis; Gros, Philippe; Aguilar-Delfin, Irma

2011-12-20

119

Identification of Loci Controlling Restriction of Parasite Growth in Experimental Taenia crassiceps Cysticercosis  

PubMed Central

Human neurocysticercosis (NC) caused by Taenia solium is a parasitic disease of the central nervous system that is endemic in many developing countries. In this study, a genetic approach using the murine intraperitoneal cysticercosis caused by the related cestode Taenia crassiceps was employed to identify host factors that regulate the establishment and proliferation of the parasite. A/J mice are permissive to T. crassiceps infection while C57BL/6J mice (B6) are comparatively restrictive, with a 10-fold difference in numbers of peritoneal cysticerci recovered 30 days after infection. The genetic basis of this inter-strain difference was explored using 34 AcB/BcA recombinant congenic strains derived from A/J and B6 progenitors, that were phenotyped for T. crassiceps replication. In agreement with their genetic background, most AcB strains (A/J-derived) were found to be permissive to infection while most BcA strains (B6-derived) were restrictive with the exception of a few discordant strains, together suggesting a possible simple genetic control. Initial haplotype association mapping using >1200 informative SNPs pointed to linkages on chromosomes 2 (proximal) and 6 as controlling parasite replication in the AcB/BcA panel. Additional linkage analysis by genome scan in informative [AcB55xDBA/2]F1 and F2 mice (derived from the discordant AcB55 strain), confirmed the effect of chromosome 2 on parasite replication, and further delineated a major locus (LOD?=?4.76, p<0.01; peak marker D2Mit295, 29.7 Mb) that we designate Tccr1 (T. crassiceps cysticercosis restrictive locus 1). Resistance alleles at Tccr1 are derived from AcB55 and are inherited in a dominant fashion. Scrutiny of the minimal genetic interval reveals overlap of Tccr1 with other host resistance loci mapped to this region, most notably the defective Hc/C5 allele which segregates both in the AcB/BcA set and in the AcB55xDBA/2 cross. These results strongly suggest that the complement component 5 (C5) plays a critical role in early protective inflammatory response to infection with T. crassiceps.

Fortin, Anny; Sciutto-Conde, Edda; Fragoso-Gonzalez, Gladis; Gros, Philippe; Aguilar-Delfin, Irma

2011-01-01

120

An unexpected resident in the ileum detected during robot-assisted laparoscopic radical cystoprostatectomy and intracorporeal Studer pouch formation: Taenia saginata parasite.  

PubMed

A case of moving ileal Taenia saginata parasites is presented with demonstrative images. We came across the parasites surprisingly while performing robot-assisted laparoscopic radical cystoprostatectomy with intracorporeal Studer pouch urinary diversion. We recommend stool sample evaluation in the preoperative period for possible presence of intestinal parasitic diseases, particularly in patients with bladder cancer who are admitted from areas with an increased incidence of intestinal parasitic diseases, before opening the bowel segments during surgery to perform radical cystectomy and urinary diversion. PMID:21231881

Canda, Abdullah Erdem; Asil, Erem; Balbay, Mevlana Derya

2011-01-13

121

Taeniasis/cysticercosis in a Tibetan population in Sichuan Province, China.  

PubMed

The results of a preliminary survey of taeniasis/cysticercosis in Yajiang County, Ganze Tibetan Prefecture in southwest Sichuan Province, China, indicated a very high prevalence of taeniasis (22.5%), with Taenia saginata as the dominant species. There was also a significant occurrence of late-onset epilepsy (8.5% prevalence and 16.4% seropositive for Taenia solium antibodies) attributable in large part to probable neurocysticercosis caused by T. solium. The poor sanitation and hygiene in this Tibetan community likely contributed to a high risk of human cysticercosis despite a low level of T. solium taeniasis (actually no T. solium carriers were detected amongst the 21 proven Taenia carriers). In addition, three taeniasis cases were confirmed by DNA genotyping as Taenia asiatica, which is the first report of this tapeworm in Tibetans, the first report for Sichuan Province and only the third report for mainland China. PMID:17166477

Li, Tiaoying; Craig, Philip S; Ito, Akira; Chen, Xingwang; Qiu, Dongchuan; Qiu, Jiamin; Sato, Marcello O; Wandra, Toni; Bradshaw, Helen; Li, Li; Yang, Yun; Wang, Qian

2006-12-12

122

Distribution of Taenia saginata metacestodes: a comparison of routine meat inspection and carcase dissection results in experimentally infected calves.  

PubMed

A comparison of techniques for detecting the presence of Cysticercus bovis in bovine carcasses was made by using carcass dissection and routine beef inspection guidelines. In the study, 28 calves were used after they were tested and found to be negative for the presence of anti-C. bovis serum antibodies and were inoculated orally with aliquots containing 6×10(4) Taenia saginata eggs. One hundred and twenty days after inoculation, the animals were slaughtered and a post mortem evaluation was done following Brazilian Federal Beef Inspection guidelines. This routine meat inspection was able to identify 71·42% of the assessed infected carcasses as being parasitized. This result implies that 28·58% of the infected carcasses would have been released as fit for human consumption since they would have been considered as free of C. bovis infection when using this method for carcass assessment. Only 3·07% of the total 2311 metacestodes present in the carcasses were identified by the conventional procedures of sanitary inspection. The assessment of different parts of the carcasses showed high infestation rates in shoulder clod (14·37%), head (11·21%), neck+chuck roll (8·05%), heart (7·75%) and top (inside) round (7·18%) which, together, were responsible for housing 48·51% of all the cysts found in the 24 beef cuts assessed. These numbers contrasted to the low incidence of cysts found in organs such as tongue (3·12%), diaphragm (1·69%) and esophagus (1·60%) which are usually described as predilection sites for the parasite. PMID:21929881

Soares, V E; De Andrade Belo, M A; Rezende, P C B; Soccol, V T; Fukuda, R T; De Ooliveira, G P; Da Costa, A J

2011-07-01

123

Improvement of the synthetic tri-peptide vaccine (S3Pvac) against porcine Taenia solium cysticercosis in search of a more effective, inexpensive and manageable vaccine  

Microsoft Academic Search

Vaccination of pigs may curtail Taenia solium transmission by reducing the number of cysticerci, the precursors of adult intestinal tapeworms in humans. Several antigen preparations induce protection against porcine cysticercosis in experimental settings but only one subunit vaccine (S3Pvac) has been tested and proved effective in the field against naturally acquired disease. Besides improving of the vaccine's effectiveness, significant reductions

Edda Sciutto; Gabriela Rosas; Marisela Hernández; Julio Morales; Carmen Cruz-Revilla; Andrea Toledo; Karen Manoutcharian; Goar Gevorkian; Abel Blancas; Gonzalo Acero; Beatriz Hernández; Jacquelynne Cervantes; Raul J. Bobes; Fernando A. Goldbaum; Mirna Huerta; Alicia Diaz-Orea; Agnes Fleury; Aline S. de Aluja; Jose Luis Cabrera-Ponce; Luis Herrera-Estrella; Gladis Fragoso; Carlos Larralde

2007-01-01

124

Prevalence of Taenia solium cysticercosis in swine from a community-based study in 21 villages of the Eastern Cape Province, South Africa  

Microsoft Academic Search

The pork tapeworm, Taenia solium, causative organism of porcine cysticercosis and human neurocysticercosis is known to occur in areas of South Africa including Eastern Cape Province but, despite increasing reports of its occurrence throughout the subregion, the prevalence is yet to be clearly established. The parasite presents a potentially serious agricultural problem and public health risk in endemic areas. The

R. C. Krecek; L. M. Michael; P. M. Schantz; L. Ntanjana; M. F. Smith; P. Dorny; L. J. S. Harrison; F. Grimm; N. Praet; A WILLINGHAMIII

2008-01-01

125

Mini review on chemotherapy of taeniasis and cysticercosis due to Taenia solium in Asia, and a case report with 20 tapeworms in China.  

PubMed

A 43-year-old Tibetan woman living in northwest Sichuan, China, confirmed to be a taeniasis carrier of Taenia solium was treated with pumpkin seeds combined with Areca nut extract in October 2009. All 20 tapeworms except one without scolex were expelled under good conditions. She was free of secondary cysticercosis within one year follow up. Although the first choice for treatment of taeniasis is still praziquantel, it may often cause serious side effect on asymptomatic cysticercosis cases to suddenly become symptomatic within a half day of the treatment. Therefore, the problems in treatment of taeniasis and/or cysticercosis in Asia are briefly overviewed, since other platyhelminthic diseases including schistosomiasis, opisthorchiasis etc. are more common and praziquantel is strongly recommended for mass treatment of these trematodiases with no idea on the co-infection with eggs of T. solium which cause asymptomatic cysticercosis. PMID:23959481

Ito, A; Li, T; Chen, X; Long, C; Yanagida, T; Nakao, M; Sako, Y; Okamoto, M; Wu, Y; Raoul, F; Giraudoux, P; Craig, P S

2013-06-01

126

Anti-oxidant activity of superoxide dismutase and glutathione peroxidase enzymes in skeletal muscles from slaughter cattle infected with Taenia saginata.  

PubMed

It is known that highly reactive oxygene species produced during normal cellular metabolism represent a powerful effector mechanism against parasites. Superoxide dismutase (SOD) and glutathione peroxidase (GPx) belong to the main defense anti-oxidants that prevent the formation of new free radical species. The aim of this study was to assess the activities of SOD and GPx in cattle tissues infected with Taenia saginata. We observed a statistically significant increase in the SOD and GPx activities (p=0.00003, 0.00008, respectively, Student's t-test) in skeletal muscles infected with T. saginata in spectrophotometric analysis. With the use of western blot technique, SOD synthesis stimulation has appeared in the host tissues containing cysticerci in contrast with the control samples. There was no statistically significant increase in the GPx band intensity observed in the studied samples in comparison to controls (Gene Tools Version 4.01 program). These results support the significance of anti-oxidant processes in host defense mechanism during parasitic infections. PMID:21272584

?uszczak, Joanna; Ziaja-So?tys, Marta; Rzymowska, Jolanta

2011-01-25

127

State of the art of Taenia solium as compared to Taenia asiatica.  

PubMed

Three species of tapeworms infect humans in their adult stage (Taenia solium, Taenia saginata and Taenia asiatica). The 3 are flat, opaque white or yellowish, and exceptional long segmented parasites, measuring 1 to 12 m in their adult stage. In this review, the development of the knowledge regarding the first species, mainly focused on understanding how the larval stage or cysticercus is transmitted to humans, is described. The second species is a cosmopolitan parasite that only causes taeniosis and not cysticercosis; therefore, it will not be included. Information on the third species, which is presently being produced, since this species was recognized as such only at the end of the 20th century, will be discussed at the end of this review. PMID:23467388

Flisser, Ana

2013-02-18

128

State of the Art of Taenia solium as Compared to Taenia asiatica  

PubMed Central

Three species of tapeworms infect humans in their adult stage (Taenia solium, Taenia saginata and Taenia asiatica). The 3 are flat, opaque white or yellowish, and exceptional long segmented parasites, measuring 1 to 12 m in their adult stage. In this review, the development of the knowledge regarding the first species, mainly focused on understanding how the larval stage or cysticercus is transmitted to humans, is described. The second species is a cosmopolitan parasite that only causes taeniosis and not cysticercosis; therefore, it will not be included. Information on the third species, which is presently being produced, since this species was recognized as such only at the end of the 20th century, will be discussed at the end of this review.

2013-01-01

129

Serologic Diagnosis of Human Taenia solium Cysticercosis by Using Recombinant and Synthetic Antigens in QuickELISA(TM)  

PubMed Central

Diagnosis of Taenia solium cysticercosis is an important component in the control and elimination of cysticercosis and taeniasis. New detection assays using recombinant and synthetic antigens originating from the lentil lectin-purified glycoproteins (LLGPs) of T. solium cysticerci were developed in a QuickELISA™ format. We analyzed a panel of 474 serum samples composed of 108 serum samples from donors with two or more viable cysts, 252 serum samples from persons with other parasitic infections, and 114 serum samples from persons with no documented illnesses. The sensitivities and specificities of T24H QuickELISA™, GP50 QuickELISA™, and Ts18var1 QuickELISA™ were 96.3% and 99.2%, 93.5% and 98.6%, and 89.8% and 96.4%, respectively, for detecting cases with multiple, viable cysts. T24H QuickELISA™ performs best among the three assays, and has sensitivity and specificity values comparable to those of the LLGP enzyme-linked immunosorbent blot. The QuickELISA™ are simple, rapid quantitative methods for detecting antibodies specific for T. solium cysticerci antigens.

Lee, Yeuk-Mui; Handali, Sukwan; Hancock, Kathy; Pattabhi, Sowmya; Kovalenko, Victor A.; Levin, Andrew; Rodriguez, Silvia; Lin, Sehching; Scheel, Christina M.; Gonzalez, Armando E.; Gilman, Robert H.; Garcia, Hector H.; Tsang, Victor C. W.

2011-01-01

130

DNA differential diagnosis of taeniasis and cysticercosis by multiplex PCR.  

PubMed

Multiplex PCR was established for differential diagnosis of taeniasis and cysticercosis, including their causative agents. For identification of the parasites, multiplex PCR with cytochrome c oxidase subunit 1 gene yielded evident differential products unique for Taenia saginata and Taenia asiatica and for American/African and Asian genotypes of Taenia solium with molecular sizes of 827, 269, 720, and 984 bp, respectively. In the PCR-based detection of tapeworm carriers using fecal samples, the diagnostic markers were detected from 7 of 14 and 4 of 9 T. solium carriers from Guatemala and Indonesia, respectively. Test sensitivity may have been reduced by the length of time (up to 12 years) that samples were stored and/or small sample volumes (ca. 30 to 50 mg). However, the diagnostic markers were detected by nested PCR in five worm carriers from Guatemalan cases that were found to be negative by multiplex PCR. It was noteworthy that a 720 bp-diagnostic marker was detected from a T. solium carrier who was egg-free, implying that it is possible to detect worm carriers and treat before mature gravid proglottids are discharged. In contrast to T. solium carriers, 827-bp markers were detected by multiplex PCR in all T. saginata carriers. The application of the multiplex PCR would be useful not only for surveillance of taeniasis and cysticercosis control but also for the molecular epidemiological survey of these cestode infections. PMID:14766815

Yamasaki, Hiroshi; Allan, James C; Sato, Marcello Otake; Nakao, Minoru; Sako, Yasuhito; Nakaya, Kazuhiro; Qiu, Dongchuan; Mamuti, Wulamu; Craig, Philip S; Ito, Akira

2004-02-01

131

Taeniasis and cysticercosis in Bali and North Sumatra, Indonesia  

Microsoft Academic Search

It has been reported that three human Taenia species are distributed in Indonesia: Taenia solium, Taenia asiatica and Taenia saginata. T. asiatica is well known in North Sumatra, especially on Samosir island in Lake Toba. T. solium and T. saginata are known from Bali. T. solium is most serious public health issue in Papua (former Irian Jaya). In this report,

Toni Wandra; A. A. Depary; Putu Sutisna; Sri S. Margono; Thomas Suroso; Munehiro Okamoto; Philip S. Craig; Akira Ito

2006-01-01

132

Molecular and serological survey on taeniasis and cysticercosis in Kanchanaburi Province, Thailand.  

PubMed

A community-based field survey on taeniasis and cysticercosis was performed in two villages in Thong Pha Phum District, Kanchanaburi Province, central Thailand, where 3 Taenia species, T. solium, T. saginata and T. asiatica, are sympatrically occurring. Four (0.6%) out of 667 stool samples were egg-positive for Taenia sp. by Kato-Katz technique. Three out of those four persons and other three persons who were Taenia egg-negative but having a recent (<1 year) history of discharging worms in stool were treated with niclosamide. One Taenia egg-positive woman was not treated because of severe ascites. After treatment, three persons expelled long strobilae with scolices and two persons expelled strobilae without scolex. One Taenia egg-positive person did not expel any worms post-treatment. Among 5 persons, four expelled a single worm, whereas one expelled multiple worms, may be 6 worms but not confirmed by detection of scolices. One scolex was armed with hooklets, whereas 2 others did not. Multiplex PCR of 10 expelled proglottids (including 6 estimated worms from one patient) revealed that one sample was T. solium, one T. saginata, and 8 T. asiatica. A total of 159 residents agreed to receive a serological test for cysticercosis. By ELISA using partially purified glycoprotein antigen, 9 cases, 5 and 4 from villages A and B respectively, were found to be sero-positive. The five and an additional sample on the border line from village A were evaluated using confirmative immunoblot using recombinant chimeric antigen. Among the six samples, four including the border line sample were confirmed to be cysticercosis by immunoblotting. One of the 4 persons had neurological symptoms with nodular lesions in the brain by computed tomography. These 4 confirmed or suspected cysticercosis cases were free of T. solium worms, but two of them including confirmed NCC case had a past (>1 year) history of expelling proglottids in the stool. PMID:20380891

Anantaphruti, Malinee T; Okamoto, Munehiro; Yoonuan, Tippayarat; Saguankiat, Surapol; Kusolsuk, Teera; Sato, Megumi; Sato, Marcello O; Sako, Yasuhito; Waikagul, Jitra; Ito, Akira

2010-04-07

133

Molecular approaches to Taenia asiatica.  

PubMed

Taenia solium, T. saginata, and T. asiatica are taeniid tapeworms that cause taeniasis in humans and cysticercosis in intermediate host animals. Taeniases remain an important public health concerns in the world. Molecular diagnostic methods using PCR assays have been developed for rapid and accurate detection of human infecting taeniid tapeworms, including the use of sequence-specific DNA probes, PCR-RFLP, and multiplex PCR. More recently, DNA diagnosis using PCR based on histopathological specimens such as 10% formalin-fixed paraffin-embedded and stained sections mounted on slides has been applied to cestode infections. The mitochondrial gene sequence is believed to be a very useful molecular marker for not only studying evolutionary relationships among distantly related taxa, but also for investigating the phylo-biogeography of closely related species. The complete sequence of the human Taenia tapeworms mitochondrial genomes were determined, and its organization and structure were compared to other human-tropic Taenia tapeworms for which complete mitochondrial sequence data were available. The multiplex PCR assay with the Ta4978F, Ts5058F, Tso7421F, and Rev7915 primers will be useful for differential diagnosis, molecular characterization, and epidemiological surveys of human Taenia tapeworms. PMID:23467738

Jeon, Hyeong-Kyu; Eom, Keeseon S

2013-02-18

134

Molecular Approaches to Taenia asiatica  

PubMed Central

Taenia solium, T. saginata, and T. asiatica are taeniid tapeworms that cause taeniasis in humans and cysticercosis in intermediate host animals. Taeniases remain an important public health concerns in the world. Molecular diagnostic methods using PCR assays have been developed for rapid and accurate detection of human infecting taeniid tapeworms, including the use of sequence-specific DNA probes, PCR-RFLP, and multiplex PCR. More recently, DNA diagnosis using PCR based on histopathological specimens such as 10% formalin-fixed paraffin-embedded and stained sections mounted on slides has been applied to cestode infections. The mitochondrial gene sequence is believed to be a very useful molecular marker for not only studying evolutionary relationships among distantly related taxa, but also for investigating the phylo-biogeography of closely related species. The complete sequence of the human Taenia tapeworms mitochondrial genomes were determined, and its organization and structure were compared to other human-tropic Taenia tapeworms for which complete mitochondrial sequence data were available. The multiplex PCR assay with the Ta4978F, Ts5058F, Tso7421F, and Rev7915 primers will be useful for differential diagnosis, molecular characterization, and epidemiological surveys of human Taenia tapeworms.

Jeon, Hyeong-Kyu

2013-01-01

135

Taenia solium cysticercosis\\/taeniosis: potential linkage with FAO activities; FAO support possibilities  

Microsoft Academic Search

Neurocysticercosis due to Taenia solium metacestodes is an important cause of human morbidity and mortality, particularly in parts of Latin America, Africa and Asia. The disease has been recognized as potentially eradicable. Emphasis has been placed on control through mass chemotherapy of human populations to remove tapeworm carriers, but this strategy does not control the source of infections, which is

Carlos Eddi; Armando Nari; William Amanfu

2003-01-01

136

Short communication Taenia solium cysticercosis\\/taeniosis: potential linkage with FAO activities; FAO support possibilities  

Microsoft Academic Search

Neurocysticercosis due to Taenia solium metacestodes is an important cause of human morbidity and mortality, particularly in parts of Latin America, Africa and Asia. The disease has been recognized as potentially eradicable. Emphasis has been placed on control through mass chemotherapy of human populations to remove tapeworm carriers, but this strategy does not control the source of infections, which is

Carlos Eddi; Armando Nari; William Amanfu

137

Taenia saginata metacestode antigenic fractions obtained by ion-exchange chromatography: potential source of immunodominant markers applicable in the immunodiagnosis of human neurocysticercosis.  

PubMed

The aim of this study was to fractionate and partially characterize fractions obtained from the total saline extract (SE) of Taenia saginata metacestodes after ion-exchange procedure in carboxymethyl sepharose (CM) and diethylaminoethyl sepharose (DEAE) resins, as a source of antigenic markers applicable in the immunodiagnosis of neurocysticercosis (NCC). For IgG detection by enzyme-linked immunosorbent assay (ELISA) and immunoblotting, 140 serum samples were analyzed: 45 from patients with NCC (G1), 50 from patients with other parasitic infections (G2), and 45 from healthy individuals. Sensitivity (Se), specificity (Sp), area under curve (AUC), and likelihood ratios (LR) were calculated. CM S2 and DEAE S2 fractions provided high diagnostic values (Se 88.8% and 93.4%; Sp 93.7% and 92.6%; AUC 0.965 and 0.987; LR+ 14.07 and 12.67; LR- 0.11 and 0.07, respectively). In conclusion, CM S2 and DEAE S2 fractions are important sources of specific peptides, with high efficiency to diagnose NCC. PMID:23433713

Nunes, Daniela da Silva; Gonzaga, Henrique Tomaz; Ribeiro, Vanessa da Silva; da Cunha, Jair Pereira; Costa-Cruz, Julia Maria

2013-02-19

138

Evaluation of purified Taenia solium glycoproteins and recombinant antigens in the serologic detection of human and swine cysticercosis.  

PubMed

Cysticercosis caused by infection with embryonated eggs of Taenia solium is an important cause of neurological disease worldwide. On the basis of mitochondrial DNA analysis, T. solium is divided into 2 (African/American and Asian) genotypes. Glycoproteins (GPs) in cyst fluid purified from the 2 genotypes of T. solium were characterized and compared with the recombinant chimeric T. solium-Ag1V1/Ag2 protein (Rec-Ag1V1/Ag2) as serodiagnostic antigens. Immunoblot analysis revealed that banding patterns of GPs differed between the 2 genotypes because of posttranslation modification, especially glycosylation. The comparison of native GPs with Rec-Ag1V1/Ag2 by enzyme-linked immunosorbent assay demonstrated that there was no statistical difference in sensitivity. In addition, the conservation of the genes encoding Ag1V1 and Ag2 in T. solium worldwide was verified. These results indicate that Rec-Ag1V1/Ag2 has great potential for usefulness in serodiagnosis as an alternative to native antigens. PMID:17109353

Sato, Marcello Otake; Sako, Yasuhito; Nakao, Minoru; Yamasaki, Hiroshi; Nakaya, Kazuhiro; Ito, Akira

2006-11-06

139

Prevalence of bovine cysticercosis in slaughtered cattle in Iran.  

PubMed

Bovine cysticercosis is an important food safety issue and can cause economic loss. A cross sectional study on Taenia saginata cysticercosis was carried out in slaughtered cattle in Iran in order to determine the infection rate during a three-years period, from 2005 to 2007. A total of 4,534,105 cattle were examined by routine meat inspection. The results showed that 11,410 cattle (0.25 %) were infected with Cysticercus bovis; among those 1,041 carcasses (0.02%) were condemned. In such carcasses the metacestodes caused extensive damage in the vicinity of cysts in infected cattle. The rejected carcasses had an average of 410 thousands USD loss annually. PMID:19568950

Khaniki, Gh R Jahed; Raei, M; Kia, E B; Haghi, A Motevalli; Selseleh, M

2009-07-01

140

Effect of heat treatment on viability of Taenia hydatigena eggs.  

PubMed

Effects of heat treatments on activation and infectivity of Taenia hydatigena eggs were assessed. Eggs containing oncospheres were used for in vitro and in vivo studies to determine the response to 5min of heat treatment, ranging from room temperature (22°C) to 60°C. The study demonstrated 99.47% and 100% reduction in oncosphere activation or infectivity after 5min of heat treatment at 60°C and 57.38°C under in vitro and in vivo conditions, respectively. Similar results between the two approaches indicted the appropriateness of the in vitro methods to identify oncosphericidal treatments of practical significance. Similar heat treatments may also be effective against Taenia saginata and help to reduce occurrence of beef cysticercosis. PMID:23333617

Buttar, Birpal S; Nelson, Mark L; Busboom, Jan R; Hancock, Dale D; Walsh, Douglas B; Jasmer, Douglas P

2013-01-17

141

Current status of cysticercosis in Vietnam.  

PubMed

This English review concerning the current status of cysticercosis in Vietnam has been compiled from various reports of studies conducted over the past 15 years, which have appeared in national publications in Vietnamese, in order to make the information available to the international community. Hospital surveys indicate that cysticercosis is emerging as a serious health problem in the country though most of the information comes from the Hanoi area. Many more men than women are being treated for cysticercosis with most patients being young to middle-aged adults though several juvenile cases have been seen in the south. Clinical manifestations of the disease in humans include subcutaneous nodules, epileptic seizures, severe headache, impaired vision and memory loss. Albendazole has been found to be the best drug for treating cysticercosis though it does not appear to be totally effective for curing cerebral cysts. Information concerning porcine and bovine cysticercosis is very limited and based mostly on passive surveillance at Hanoi slaughterhouses. Surveys for human taeniasis in central and northern provinces indicate a prevalence of 0.2-7.2%. However, techniques of low sensitivity were used and the results are inconclusive since it is unknown with which species of tapeworm the people were infected. In addition to Taenia solium which causes human cysticercosis, T. saginata and T. asiatica are also known to be present in Vietnam. Risk factors investigated thus far with regard to transmission of T. solium suggest that consumption of raw pork, inadequate or absent meat inspection and control, poor sanitation in some areas, and the use of untreated human waste as fertilizer for crops may play important roles in Vietnam but this remains to be validated. The evidence thus far collected suggests that a national surveillance program for cysticercosis is a great need for Vietnam. The authors recommend further research on the epidemiology and impact of cysticercosis in both human and pig hosts in order to determine whether a prevention and control program in Vietnam would be merited and cost effective. PMID:12971506

Willingham, A Lee; De, Nguyen Van; Doanh, Nguyen Quoc; Cong, Le Dinh; Dung, Truong Van; Dorny, Pierre; Cam, Phung Dac; Dalsgaard, Anders

2003-01-01

142

Validation of an immunohistochemical assay for bovine cysticercosis, with comparison to a standard histological method.  

PubMed

The larval stage (syn Cysticercus bovis) of the human tapeworm Taenia saginata causes cysticercosis in cattle, which has both aesthetic and food safety implications to consumers of beef. A monoclonal antibody-based immunohistochemical (IHC) assay developed to improve postmortem diagnosis of this parasite and a standard histological method were assessed to determine their fitness for intended use. Sections from 169 known-positive specimens of T. saginata from experimentally or naturally infected cattle, and from 30 known-negative specimens and lesions of various etiologies from non-infected cattle, were tested. The IHC assay identified significantly more known positive bovine cysticerci than the histological method (91.7% and 38.5%, respectively). Positive IHC staining occurred on sections from other cestode species, but should not affect the diagnostic specificity of this assay for bovine cysticercosis, due to the different host and/or tissue preferences amongst these parasites. Use of the IHC assay should improve the reliability of diagnosing lesions caused by degenerated cysticerci, facilitating more effective and efficient control of bovine cysticercosis. PMID:22169223

Scandrett, W Brad; Haines, Deborah M; Parker, Sarah E; Robinson, Yves; Forbes, Lorry B; Brandt, Jef; Geerts, Stanny; Dorny, Pierre; Gajadhar, Alvin A

2011-11-12

143

Oral cysticercosis: a clinical dilemma.  

PubMed

Cysticercosis is a potentially fatal parasitic disease caused by cysticercus cellulosae, the larval stage of Taenia solium. Oral cysticercosis is a rare entity and represents difficulty in clinical diagnosis. This article reports two cases of oral cysticercosis involving buccal and labial mucosa. Both the cases presented with solitary, nodular swelling that had been clinically diagnosed as a mucocele. Histopathology of excisional biopsy revealed it to be cysticercosis. Single, cystic nodular swelling of oral cavity may be the only evidence of cysticercosis and may present first to dentist. These cases emphasise the role of dentist and thorough histopathological examination in the early diagnosis of disease that can prevent potential systemic complication. PMID:23580668

Wanjari, Sangeeta Panjab; Patidar, Kalpana A; Parwani, Rajkumar N; Tekade, Satyajitraje A

2013-04-10

144

Taenia solium Cysticercosis in the Democratic Republic of Congo: How Does Pork Trade Affect the Transmission of the Parasite?  

Microsoft Academic Search

BackgroundTaenia solium, a zoonotic parasite that is endemic in most developing countries where pork is consumed, is recognised as the main cause of acquired epilepsy in these regions. T. solium has been reported in almost all of the neighboring countries of Democratic Republic of Congo (DRC) but data on the current prevalence of the disease in the country itself are

Nicolas Praet; Kirezi Kanobana; Constantin Kabwe; Vivi Maketa; Philippe Lukanu; Pascal Lutumba; Katja Polman; Peter Matondo; Niko Speybroeck; Pierre Dorny; Julienne Sumbu

2010-01-01

145

A Cross-Sectional Study of Taenia solium in a Multiple Taeniid-Endemic Region Reveals Competition May be Protective  

PubMed Central

We conducted cross-sectional surveys for taeniasis and cysticercosis in humans, pigs, and dogs in four northern provinces of Laos. Human cysticercosis and taeniasis prevalence was 2.2% (95% confidence interval [CI] = 1.4–3.0%) and 8.4% (95% CI = 6.9–9.9%), respectively. Eating uncooked beef, being male, province of residence, age, and ethnicity were significant risk factors for taeniasis and only province of residence was a significant risk factor for cystiercosis. Thirty-five human tapeworms were recovered during the survey and 33 (94.3%) and 2 (5.7%) were identified as Taenia saginata and T. solium, respectively. Maximum-likelihood adjusted prevalence of T. solium and T. hydatigena in pigs was 4.2% (95% CI = 0.5–7.9%) and 55.9% (95% CI = 47.5–64.3%), respectively, and T. hydatigena taeniasis in dogs was 4.8% (95% CI = 0.0–11.3%). Taenia hydatigena and T. saginata were the most prevalent taeniids in the respective pig and human populations and together may suppress T. solium transmission.

Conlan, James V.; Vongxay, Khamphouth; Khamlome, Boualam; Dorny, Pierre; Sripa, Banchob; Elliot, Aileen; Blacksell, Stuart D.; Fenwick, Stanley; Thompson, R. C. Andrew

2012-01-01

146

A cross-sectional study of Taenia solium in a multiple taeniid-endemic region reveals competition may be protective.  

PubMed

We conducted cross-sectional surveys for taeniasis and cysticercosis in humans, pigs, and dogs in four northern provinces of Laos. Human cysticercosis and taeniasis prevalence was 2.2% (95% confidence interval [CI] = 1.4-3.0%) and 8.4% (95% CI = 6.9-9.9%), respectively. Eating uncooked beef, being male, province of residence, age, and ethnicity were significant risk factors for taeniasis and only province of residence was a significant risk factor for cystiercosis. Thirty-five human tapeworms were recovered during the survey and 33 (94.3%) and 2 (5.7%) were identified as Taenia saginata and T. solium, respectively. Maximum-likelihood adjusted prevalence of T. solium and T. hydatigena in pigs was 4.2% (95% CI = 0.5-7.9%) and 55.9% (95% CI = 47.5-64.3%), respectively, and T. hydatigena taeniasis in dogs was 4.8% (95% CI = 0.0-11.3%). Taenia hydatigena and T. saginata were the most prevalent taeniids in the respective pig and human populations and together may suppress T. solium transmission. PMID:22855759

Conlan, James V; Vongxay, Khamphouth; Khamlome, Boualam; Dorny, Pierre; Sripa, Banchob; Elliot, Aileen; Blacksell, Stuart D; Fenwick, Stanley; Thompson, R C Andrew

2012-08-01

147

Cysticercosis: IgG-ELISA evaluations of peak1 antigen and <30 kDa antigen of delipidized extract of Taenia solium metacestodes.  

PubMed

The antigenicity of ether-delipidized Taenia solium metacestode extract (DLPAg) was investigated by IgG-ELISA. The antigen showed higher antigenicity than that of non-delipidized antigen (NDLPAg). Then the DLPAg was subjected to Sephacryl S-200 gel chromatography and a partially purified antigen (DLPP1Ag) was identified as the promised antigen by IgG-ELISA using 25 sera from cysticercosis cases, 177 cases of 24 heterologous infections, and healthy controls. Sensitivity was 52% and specificity was 91.8% at the cut-off value (X + 7SD), 0.399. Cross-reactivity occurred with 17 cases of eight diseases: cystic echinococcosis (7/11), taeniasis (1/16), gnathostomiasis (2/8), strongyloidiasis (1/12), angiostrongyliasis (1/12), paragonimiasis heterotremus (2/15), opisthorchiasis (1/9) and fascioliasis (2/7). When DLPP1Ag was fractionated through Ultra free centrifugal tube (retained 30 kDa) and Amicon (PM10), MWCOP1Ag (<30-10> kDa) was obtained; the antigen showed better results than DLPP1Ag with 88% sensitivity and 95.6% specificity at the cut-off value (X + 4SD), 0.264. Nine cases of six diseases cross-reacted with this antigen: cystic echinococcosis (2/11), gnathostomiasis (2/8), trichinellosis (2/12), toxocariasis (1/5), schistosomiasis (1/6), and fascioliasis (1/7). MWCOP1Ag gave higher sensitivity than that of DLPP1Ag but some cross-reactivity occurred. PMID:15272737

Dekumyoy, Paron; Waikagul, Jitra; Vanijanonta, Sirivan; Thairungroj, Malinee; Nakao, Minoru; Sako, Yasuhito; Watanabe, Sonoyo; Ito, Akira

2004-03-01

148

Cysticercosis Immunodiagnosis Using 18- and 14-Kilodalton Proteins from Taenia crassiceps Cysticercus Antigens Obtained by Immunoaffinity Chromatography  

PubMed Central

Monoclonal antibodies (MAb) against Taenia crassiceps and Taenia solium cysticerci were produced and showed cross-reactivity with a 14-kDa protein from T. solium and with 18- and 14-kDa proteins from T. crassiceps. These MAbs and antibodies from cerebrospinal fluid (CSF) as well as serum samples from patients with neurocysticercosis (NC) reacted with 18- and 14-kDa T. crassiceps proteins purified by immunoaffinity chromatography using a Sepharose column coupled with MAbs (anti-excretory/secretory or anti-vesicular fluid antigens). Immunoaffinity-purified 18- and 14-kDa proteins were used in the design of a diagnostic enzyme-linked immunosorbent assay (ELISA) to detect antibodies in 23 CSF and 20 serum samples from patients with NC, showing 100% sensitivity. The test specificity was determined using 42 noninflammatory CSF samples and 70 inflammatory CSF samples from patients with other neurological disorders (OND), showing 100% and 99.1% (confidence interval, 97.3% to 100%) specificity, respectively. A false-positive CSF sample result in the OND group was from a human immunodeficiency virus-positive patient with meningoencephalitis. By using serum samples from 194 healthy individuals, the specificity was 100%. Analysis of an additional 16 serum samples from individuals with other parasitic diseases (13 with intestinal parasitosis and 3 with schistosomiasis) showed negative results. Three (10%) serum samples from patients with hydatidosis were positive in our ELISA and in ELISA with T. solium cysticerci antigens. Two of them were also positive by immunoblotting. The use of 18- and 14-kDa T. crassiceps immunoaffinity-purified proteins for detection of anti-cysticercus antibodies in CSF and/or serum samples using an ELISA system showed a good performance and high specificity for serum samples, dispensing with the use of confirmatory tests, such as immunoblotting, for checking specificity.

Espindola, Noeli Maria; Iha, Alberto Hiroshi; Fernandes, Irene; Takayanagui, Osvaldo Massaiti; Machado, Luis dos Ramos; Livramento, Jose Antonio; Mendes Maia, Antonio Augusto; Peralta, Jose Mauro; Vaz, Adelaide Jose

2005-01-01

149

Masseter muscle cysticercosis: a common disease with uncommon presentation.  

PubMed

Cysticercosis in humans is caused by Taenia solium larvae infestation. Oral cysticercosis is a rare condition and is challenging to diagnose. We present a case of masseter cysticercosis in a young woman who presented with painful recurrent cheek swelling. Diagnosis confirmed it after neuroimaging and histopathological examination of the excised lesion from masseter muscle. PMID:23645645

Chaurasia, Rameshwar Nath; Jaiswal, Shalini; Gautam, Deepak; Mishra, Vijay Nath

2013-05-02

150

Cysticercosis Update  

PubMed Central

Already the most common brain parasite disease, cysticercosis has been increasingly seen throughout the American Southwest. Symptoms arise from infection with larvae of Taenia solium, the pork tapeworm. Seizures, hydrocephalus, focal deficits and chronic meningitis most commonly result. Cerebrospinal fluid eosinophilia, serology by indirect hemagglutination and computed tomography are helpful adjuncts to diagnosis. New evidence suggests that selective immunosuppression is important for the parasites' survival and that cyst death permits renewed host immunity, which may actually precipitate an acute neurologic presentation. New larvicides, including praziquantel, are being tested in humans; caution is indicated in assessing these drugs because of the acute worsening associated with cyst death. Conventional therapy includes anticonvulsants, steroids or ventricular drainage as needed. Prevention remains the best management. Person-to-person transmission within the United States has recently been documented and merits public health scrutiny.

Grisolia, James Santiago

1984-01-01

151

Jejunal perforation caused by morphologically abnormal Taenia saginata saginata infection  

Microsoft Academic Search

We report a case of jejunal perforation caused by infection with taeniid tapeworm possessing unusual morphology that has not been previously described. Among five cestodes recovered during operation, one exhibited a bifurcation at the posterior end and the other harbored a lateral branching of immature segments from the main strobila. By sequence analysis of the mitochondrial cytochrome c oxidase I

Somchai Jongwutiwes; Chaturong Putaporntip; Nutaros Chantachum; Pichet Sampatanukul

2004-01-01

152

Multiple genotypes of Taenia solium--ramifications for diagnosis, treatment and control.  

PubMed

Mitochondrial DNA sequences of Taenia solium have fully been analyzed. Analysis of the full length of cytochrome c oxidase subunit 1 (1620 bp) and cytochrome b (1068 bp) genes of T. solium, isolated from Asia (China, Thailand, Indonesia and India), from Latin America (Mexico, Ecuador, Bolivia, Peru and Brazil) and from Africa (Tanzania, Mozambique and Cameroon), has revealed that the two phylogenies obtained were similar to each other regardless of the genes examined. The isolates from Asia formed a single cluster, whereas those from Latin America combined with those from Africa to form an additional cluster. It was estimated that these two genotypes emerged approximately 4-8 x 10(5) years ago. These results together with recent study of the ancient of human taeniid cestodes emerged several MYA in Africa, historical data on swine domestication, distribution of pigs and colonization patterns suggest that T. solium was introduced recently into Latin America and Africa from different regions of Europe during the colonial age, which started 500 years ago, and that T. solium of another origin independently spread in Asian countries, perhaps from China. Why did not T. solium of European origin invade or spread into Asia during the colonial age? Analysis of T. solium distribution must include other Taenia species, especially T. saginata and T. asiatica, which can not be differentiated from each other morphologically. BESS T-base analysis for differentiation of all human Taenia species including the two genotypes of T. solium, and T. saginata and T. asiatica has also been characterized. BESS T-base analysis differentiates African isolates from Latin American isolates as well but more samples should be analyzed for obtaining conclusive evidence for the latter. Serological analysis of cyst fluid of T. solium cysticerci obtained in China and Indonesia and from Mozambique and Ecuador indicates geographical differences in their banding patterns. These differences are discussed in the light of possible differences in pathology of T. solium worldwide. As it has been speculated that the ancient T. solium emerged several million years ago in Africa, it is necessary to analyze more isolates from Africa. Such working hypothesis may be evaluated combined with symptomatology and serology when we get additional DNA data from such areas, since there are some varieties of manifestation of neurocysticercosis with or without subcutaneous cysticercosis and of antigens of cyst fluid of T. solium from Asia and from Africa and/or America. Transfer of techniques of molecular identification and sero- and immuno-diagnoses between researchers and technicians from endemic countries using their own materials should be promoted with the aim of better international cooperation for the control of cysticercosis. PMID:12781383

Ito, Akira; Yamasaki, Hiroshi; Nakao, Minoru; Sako, Yasuhito; Okamoto, Munehiro; Sato, Marcello O; Nakaya, Kazuhiro; Margono, Sri S; Ikejima, Takashi; Kassuku, Ayub A; Afonso, Sonia M S; Ortiz, Washington Benitez; Plancarte, Agustin; Zoli, Andre; Geerts, Stanny; Craig, Philip S

2003-06-01

153

Disseminated Cysticercosis  

PubMed Central

Disseminated cysticercosis is a rare form of cysticercosis in which the cysticerci spread out through the whole body. We report the first case of a 39-year-old Mongolian with disseminated cysticercosis. He visited our hospital with generalized tonic-clonic seizure. After extensive investigation from brain computed tomography (CT), spine magnetic resonance imaging (MRI), whole body MRI and pathologic biopsy, he was diagnosed as having cysticercosis involving the brain, subcutaneous tissue, and skeletal muscles through the whole body. We treated him with the albendazole in which case the followed MRI showed that numbers of cystic lesions were copiously decreased. We report an unsual case of disseminated cysticercosis treated with medical therapy.

Park, Soo Yong; Kim, Jung Hee; Song, Kwan Young

2011-01-01

154

Cysticercosis in Indonesia: epidemiological aspects.  

PubMed

Cysticercosis caused by the larval stage, cysticercus or cysticerci, of the pork tapeworm Taenia solium was recognized at first in Bali and in Paniai District, Irian Jaya (Papua), Indonesia in the 1970s. In the 1990s a rapid increase in the number of the cases of epileptic seizures and burns in Jayawijaya district, eastern Papua, was observed. There were a total of 1,120 new cases of burns (7.0%) and 293 new cases of epileptic seizures (1.8%) from 15,939 local people during 1991-1995. Both histopathological examination and mitochondrial DNA analysis of resected cysts from patients and pigs revealed cysticerci of T. solium. Antibody responses highly specific to cysticercosis were revealed in approximately 67% and 65% of persons respectively with epileptic seizures and with subcutaneous nodules. Therefore, most cases of epileptic seizures and burns were considered to be associated with cysticercosis in Papua. Additional serologically data from Bali showed that 13.5% of epileptic seizures (10/74) and 12.6% of asymptomatic individuals (94/746) were supposed having been exposed to T. solium. Histopathological evaluation of 80,000 tissue samples in East Java revealed that nine were cysticercosis. All cases were non-moslems and from two ethnic groups, Chinese and Balinese. Epidemiological data on cysticercosis are not available from other provinces of Indonesia, although cases of cysticercosis are occasionally reported. Therefore, other intensive epidemiological studies are strongly recommended, especially covering the eastern part of Indonesia. PMID:12041608

Margono, S S; Subahar, R; Hamid, A; Wandra, T; Sudewi, S S; Sutisna, P; Ito, A

2001-01-01

155

Towards the international collaboration for detection, surveillance and control of taeniasis/ cysticercosis and echinococcosis in Asia and the Pacific.  

PubMed

Both cysticercosis and echinococcosis are potentially among the most serious helminth zoonoses threatening human health worldwide. However, due to the lack of reliable tools for confirmation or identification of patients or infected animals, epidemiological data are expected to be underestimated. Conversely, sometimes, such data are over estimated due to the lack of specificity. The most important issue for doing field surveys is that they use evidence based science. In this communication, advanced immunological and molecular tools for detection of individuals infected with either metacestodes or adult tapeworms are briefly overviewed, and the applications of such tools for epidemiological surveys in Indonesia, China and other countries are introduced. As immunological tools are based on antigen-antibody responses, there may exist some cross-reactions. Therefore, immunodiagnostic tools are expected to be useful for primary screening, and should be combined with confirmation of direct parasitological evidence (morphology or DNA), and imaging techniques for cysts. As a risk factor for human cysticercosis is the presence of tapeworm carriers, detection of taeniasis cases and differentiation of the three human Taenia species (Taenia solium, T. saginata and T. asiatica) in Asia and the Pacific requires consideration. Similarly, in northwest China, Echinococcus granulosus and E. multilocularis are coendemic and differentiation of these species is required in humans and definitive hosts. It is stressed that combination of several tools for identification of the parasite and for confirmation of diseases is important for obtaining highly reliable data before consideration of control of these zoonoses. Recent projects coordinated by Asahikawa Medical College have concentrated on immunological and molecular diagnostic techniques transferable to colleagues from endemic regions of Asia and the Pacific, and on organization of two international symposia to establish a platform for further collaboration in the future. PMID:17547058

Ito, Akira; Wandra, Toni; Sato, Marcello O; Mamuti, Wulamu; Xiao, Ning; Sako, Yasuhito; Nakao, Minoru; Yamasaki, Hiroshi; Nakaya, Kazuhiro; Okamoto, Munehiro; Craig, Philip S

2006-01-01

156

The nuclear 18S ribosomal RNA gene as a source of phylogenetic information in the genus Taenia.  

PubMed

Most species of the genus Taenia are of considerable medical and veterinary significance. In this study, complete nuclear 18S rRNA gene sequences were obtained from seven members of genus Taenia [Taenia multiceps, Taenia saginata, Taenia asiatica, Taenia solium, Taenia pisiformis, Taenia hydatigena, and Taenia taeniaeformis] and a phylogeny inferred using these sequences. Most of the variable sites fall within the variable regions, V1-V5. We show that sequences from the nuclear 18S ribosomal RNA gene have considerable promise as sources of phylogenetic information within the genus Taenia. Furthermore, given that almost all the variable sites lie within defined variable portions of that gene, it will be appropriate and economical to sequence only those regions for additional species of Taenia. PMID:23183704

Yan, Hongbin; Lou, Zhongzi; Li, Li; Ni, Xingwei; Guo, Aijiang; Li, Hongmin; Zheng, Yadong; Dyachenko, Viktor; Jia, Wanzhong

2012-11-25

157

Immunological and molecular diagnosis of cysticercosis.  

PubMed

Cysticercosis, the infection with the larval stage of Taenia solium, is a cause of neurological symptoms including seizures, affecting the quality of life of patients and their families. Diagnosis focuses on brain imaging and serological tests are mostly used as confirmatory tools. Most cases, however, occur in poor endemic areas, where both kinds of diagnostic tools are poorly available. Development of point of care diagnostic tests is one of the most important priorities for cysticercosis researches today. The ideal point of care test would require detection of viable cysticercosis and hopefully identify cases with severe or progressive forms of neurocysticercosis, leading to referral of the patient for specialized medical attention. This manuscript describes the evolution of the serological diagnosis of cysticercosis over time, and the characteristics of the most common currently available tools, their advantages and disadvantages, and their potential use in future diagnostic tests. PMID:23265553

Rodriguez, Silvia; Wilkins, Patricia; Dorny, Pierre

2012-09-01

158

Molecular identification of Taenia tapeworms by Cox1 gene in Koh Kong, Cambodia.  

PubMed

We collected fecal samples from 21 individuals infected with Taenia tapeworms in Koh Kong Province, Cambodia, and performed nucleotide sequencing of the cox1 gene and multiplex PCR on the eggs for DNA differential diagnosis of human Taenia tapeworms. Genomic DNA was extracted from the eggs of a minimum number of 10 isolated from fecal samples. Using oligonucleotide primers Ta7126F, Ts7313F, Tso7466F, and Rev7915, the multiplex PCR assay proved useful for differentially diagnosing Taenia solium, Taenia saginata, and Taenia asiatica based on 706, 629, and 474 bp bands, respectively. All of the Taenia specimens from Kho Kong, Cambodia, were identified as either T. saginata (n=19) or T. solium (n=2) by cox1 sequencing and multiplex PCR. PMID:21738280

Jeon, Hyeong-Kyu; Yong, Tai-Soon; Sohn, Woon-Mok; Chai, Jong-Yil; Hong, Sung-Jong; Han, Eun-Taek; Jeong, Hoo-Gn; Chhakda, Tep; Sinuon, Muth; Socheat, Duong; Eom, Keeseon S

2011-06-14

159

A case of intramuscular cysticercosis diagnosed definitively by mitochondrial DNA analysis of extremely calcified cysts.  

PubMed

A case of obsolete intramuscular cysticercosis diagnosed definitively by mitochondrial DNA analysis of extremely calcified cysts was reported. X-ray and computed tomography findings highly suggested cysticercosis due to Taenia solium; however, no direct evidence of cysticercosis was obtained through serological or histopathological examinations. Mitochondrial DNA analysis of a histopathological specimen confirmed the causative agent to be the Asian genotype of T. solium. PMID:16406683

Yamasaki, Hiroshi; Nagase, Teruaki; Kiyoshige, Yoshiro; Suzuki, Mamoru; Nakaya, Kazuhiro; Itoh, Yukio; Sako, Yasuhito; Nakao, Minoru; Ito, Akira

2006-01-10

160

Morphologic and genetic identification of Taenia tapeworms in Tanzania and DNA genotyping of Taenia solium.  

PubMed

Species identification of Taenia tapeworms was performed using morphologic observations and multiplex PCR and DNA sequencing of the mitochondrial cox1 gene. In 2008 and 2009, a total of 1,057 fecal samples were collected from residents of Kongwa district of Dodoma region, Tanzania, and examined microscopically for helminth eggs and proglottids. Of these, 4 Taenia egg positive cases were identified, and the eggs were subjected to DNA analysis. Several proglottids of Taenia solium were recovered from 1 of the 4 cases. This established that the species were T. solium (n = 1) and T. saginata (n = 3). One further T. solium specimen was found among 128 fecal samples collected from Mbulu district in Arusha, and this had an intact strobila with the scolex. Phylegenetic analysis of the mtDNA cox1 gene sequences of these 5 isolates showed that T. saginata was basal to the T. solium clade. The mitochondrial cox1 gene sequences of 3 of these Tanzanian isolates showed 99% similarity to T. saginata, and the other 2 isolates showed 100% similarity to T. solium. The present study has shown that Taenia tapeworms are endemic in Kongwa district of Tanzania, as well as in a previously identified Mbulu district. Both T. solium isolates were found to have an "African/Latin American" genotype (cox1). PMID:22355207

Eom, Keeseon S; Chai, Jong-Yil; Yong, Tai-Soon; Min, Duk-Young; Rim, Han-Jong; Kihamia, Charles; Jeon, Hyeong-Kyu

2011-12-16

161

Current status and perspectives of cysticercosis and taeniasis in Japan.  

PubMed

This mini-review describes recent epidemiological trends in cysticercosis and taeniasis in Japan. Some of the topics discussed herein were presented at the first symposium on "Current perspectives of Taenia asiatica researches", that was held in Osong in Chungbuk Province, South Korea, in October 2011 and organized by Prof. K. S. Eom, Chungbuk National University School of Medicine. To better understand the trends in the occurrence of cysticercosis and taeniasis in Japan, clinical cases reported in 2005 have been updated. In addition, the current status of Taenia asiatica infections successively occurring in Japan since 2010 is also discussed. PMID:23467264

Yamasaki, Hiroshi

2013-02-18

162

What is Asian Taenia?  

PubMed

Asian Taenia is a human tapeworm which was first recognized in Taiwan aborigines and subsequently from Asian countries: Korea, Indonesia, Vietnam, and China. It was originally described as T. asiatica Eom and Rim, 1993 based on the morphology in its adult and larval stage. A taxonomic disagreement on whether it is species or subspecies level is mainly due to the morphological similarity of this tapeworm with T. saginata, but a sympatric distribution of these two tapeworms is also known in China. The life cycle is quite distinct from T. saginata in using the pig as intermediate host and parasitizing visceral organs such as liver, lung and omentum. A long unresolved question in Asian countries concerns the inconsistency between worm ratio and the food preferences was clarified with this viscerotropic tapeworm. Molecular biological differentiation is possible with DNA techniques and a complete genome of mtDNA was sequenced recently which may provide a resource for comparative mitochondrial genomics and systematic studies of parasitic cestodes. This is a young parasite discovered most recently with many research questions yet to be clarified. PMID:16387528

Eom, Keeseon S

2006-01-04

163

Sex steroids and parasitism: Taenia crassiceps cisticercus metabolizes exogenous androstenedione to testosterone in vitro  

Microsoft Academic Search

Sex hormones are known to modulate immune responses and may be implicated in sex associated susceptibilities to infections. Taenia crassiceps cysticerci grow to larger numbers in female mice than in males. Gonadectomy alters the course of this infection and hormone replacement with 17?-estradiol increases the parasite numbers. However, in chronic Taenia crassiceps cysticercosis the sex-hormone profile of males becomes more

Y Gomez; R. A Valdez; C Larralde; M. C Romano

2000-01-01

164

A loop-mediated isothermal amplification method for a differential identification of Taenia tapeworms from human: application to a field survey.  

PubMed

In this study, we applied a loop-mediated isothermal amplification method for identification of human Taenia tapeworms in Tibetan communities in Sichuan, China. Out of 51 proglottids recovered from 35 carriers, 9, 1, and 41 samples were identified as Taenia solium, Taenia asiatica and Taenia saginata, respectively. Same results were obtained afterwards in the laboratory, except one sample. These results demonstrated that the LAMP method enabled rapid identification of parasites in the field surveys, which suggested that this method would contribute to the control of Taenia infections in endemic areas. PMID:22698671

Nkouawa, Agathe; Sako, Yasuhito; Li, Tiaoying; Chen, Xingwang; Nakao, Minoru; Yanagida, Tetsuya; Okamoto, Munehiro; Giraudoux, Patrick; Raoul, Francis; Nakaya, Kazuhiro; Xiao, Ning; Qiu, Jiamin; Qiu, Dongchuan; Craig, Philip S; Ito, Akira

2012-06-11

165

Asymptomatic disseminated cysticercosis.  

PubMed

Cysticercosis is a common problem world wide. However, disseminated cysticercosis is rare. Still rarer is asymptomatic disseminated cysticercosis. We are reporting here a rare case of asymptomatic disseminated cysticercosis which involved brain, face, orbit, lungs, heart, pancreas and spleen in a young Nigerian male, who sought medical attention for dysphagia which was diagnosed as achalasia cardia. Despite widespread dissemination of cysticercosis which involves multiple organs, the individual was asymptomatic for the same. Pancreatic and splenic involvement in disseminated cysticercosis has extremely rarely been reported in literature. PMID:24086907

Vaidya, Ashima; Singhal, Suman; Dhall, Sonia; Manohar, Ashish; Mahajan, Harsh

2013-08-01

166

Asymptomatic Disseminated Cysticercosis  

PubMed Central

Cysticercosis is a common problem world wide. However, disseminated cysticercosis is rare. Still rarer is asymptomatic disseminated cysticercosis. We are reporting here a rare case of asymptomatic disseminated cysticercosis which involved brain, face, orbit, lungs, heart, pancreas and spleen in a young Nigerian male, who sought medical attention for dysphagia which was diagnosed as achalasia cardia. Despite widespread dissemination of cysticercosis which involves multiple organs, the individual was asymptomatic for the same. Pancreatic and splenic involvement in disseminated cysticercosis has extremely rarely been reported in literature.

Vaidya, Ashima; Singhal, Suman; Dhall, Sonia; Manohar, Ashish; Mahajan, Harsh

2013-01-01

167

Unusual presentation of orbital cysticercosis-ptosis, diminution of vision and medial rectus weakness: a case report  

PubMed Central

Cysticercosis is the most common parasitic disease of the nervous system. The disease occurs when humans become the intermediate host in the life cycle of Taenia solium by ingesting its eggs from contaminated food. The most common sites of involvement of cysticerci are soft tissue, eye and central nervous system. Unusual location of the cysts may result in uncommon manifestations. Ocular cysticercosis can involve both the intraocular and extra ocular muscle. Extra ocular muscle cysticercosis is rare. We are reporting the unusual manifestation of ptosis, proptosis, diminution of vision and medial rectus palsy due to cysticercosis. The patient was successfully treated with systemic steroids and albendazole.

Jajoo, Ulhas; Yelwatkar, Samir; Ashish, Jaikishan

2009-01-01

168

Ptosis: a rare presentation of ocular cysticercosis.  

PubMed

Background: Cysticercosis is a common parasitic infection involving multiple systems and caused by Cysticercus cellulosae, the larval form of the cestode, Taenia solium. The humans become infected by ingesting its eggs from contaminated food. Here, we present a case of ocular cysticercosis which presented with mild pain, ptosis, inflammation of upper eyelid and slightly restricted ocular motility. Case: A twelve-year-old girl presented with mild pain, unilateral ptosis and inflammation of the right upper eyelid for seven months. There was no history of diurnal variation and trauma. There was neither protrusion of the eyeball nor any mass was palpable in periorbital area. Visual acuity in both the eyes was normal. Periocular and ocular examination revealed a slightly restricted ocular motility in the right upward gaze and a reduced vertical fissure height a with good levator palpebrae function. The Bell's phenomenon was good. The magnetic resonance imaging of the orbit showed an intra-conal retro-orbital mass involving the superior rectus muscle of the right eye suggestive of ocular cysticercosis. The orbital sonogram revealed a cystic lesion in the superior rectus muscle with an echogenic intramural nodule. The enzyme-linked immunosorbent assay for serum antibodies against the cysticercus was positive. The ptosis improved with a therapeutic trial of albendazole and oral steroids for 6 weeks. Conclusion: Extra-ocular cysticercosis can be treated with oral steroid and albendazole. PMID:23584662

Labh, R K; Sharma, A K

2013-01-01

169

Soft Tissue Cysticercosis: Study of 21 Cases  

PubMed Central

Aim To evaluate the clinico – pathological profile of patients with cysticercosis cellulosae. Materials and Methods The clinico – pathological data of patients with cysticercosis cellulosae who were reviewed during the last 5 years, were retrospectively analysed. Results Of the total 6805 biopsies analysed , 21 cases of cysticercosis in the soft tissues were observed. Excisional biopsy was performed to diagnose the lesion. The pattern of distribution was striated muscles in 11(52.4%), eye in 6 (28.6%), subcutaneous tissues in 2(9.5%), tongue in 1(4.8%) and breast in 1(4.8%) patient. Anterior abdominal wall was the most involved site. Conclusion Cysticercosis, a parasitic infestation caused by Taenia solium is a major health problem in the developing countries. It is a diagnostic and therapeutic dilemma for the clinicians. Steps towards control and possible eradication of the disease are needed, as the disease causes not only chronic morbidity, but also contributes to economic losses in an already impoverished population.

Agrawal, Ranjan

2012-01-01

170

Cestode infestations: hydatid disease and cysticercosis.  

PubMed

Although humans can be definitive hosts for cestodes (tapeworms), major pathologic conditions occur during cestode larval stages when humans serve as the intermediate host for these parasites. The most relevant forms of human disease caused by cestode larvae are echinococcosis, caused by Echinococcus granulosus (cystic echinococcosis) and Echinococcus multilocularis (alveolar echinococcosis), and cysticercosis, caused by Taenia solium. These infections occur worldwide, but their relevance is particularly high in developing countries, where poor hygiene conditions facilitate the transmission of the parasites. The therapeutic approach is often complex, requiring surgery and/or chemotherapy or, in the case of cystic echinococcosis, percutaneous treatments. PMID:22632647

Brunetti, Enrico; White, A Clinton

2012-06-01

171

Taenia solium and Taenia ovis: Stage-specific expression of the vaccine antigen genes, TSOL18, TSOL16, and homologues, in oncospheres  

Microsoft Academic Search

Recombinant antigens that have been cloned from Taenia solium and Taenia ovis have been shown to be highly effective when used as vaccines against cysticercosis in the intermediate hosts. This study investigated the presence of mRNA encoding the TSOL18 and TSOL16 antigens in different life-cycle stages of T. solium, and their related homologues in T. ovis. Reverse transcription-PCR and Southern

Charles G. Gauci; Manuela R. Verástegui; Robert H. Gilman; Marshall W. Lightowlers

2006-01-01

172

Historical overview of Taenia asiatica in Taiwan.  

PubMed

An overview of the epidemiological, biological, and clinical studies of Taenia and taeniasis in Taiwan for the past century is presented. The phenomenal observations that led to the discovery of Taenia asiatica as a new species, which differ from Taenia solium and Taenia saginata, are described. Parasitological surveys of the aborigines in Taiwan revealed a high prevalence of taeniasis, which might be due to the culture of eating raw liver of hunted wild boars. Chemotherapeutic deworming trials involving many patients with taeniasis were discussed. Praziquantel was found to be very effective, but sometimes complete worms could not be recovered from the feces after treatment, probably due to the dissolution of the proglottids. Atabrine, despite some side effects, can still be used, in properly controlled dosages, as the drug of choice for human T. asiatica infection if we need to recover the expelled worms for morphological examinations. Research results on the infection of T. asiatica eggs from Taiwan aborigines in experimental animals were also noted. Since the pig serve as the natural intermediate host of T. asiatica and the predilection site is the liver, a differential comparison of other parasitic pathogens that might cause apparently similar lesions is also presented. PMID:23467308

Ooi, Hong Kean; Ho, Chau-Mei; Chung, Wen-Cheng

2013-02-18

173

Historical Overview of Taenia asiatica in Taiwan  

PubMed Central

An overview of the epidemiological, biological, and clinical studies of Taenia and taeniasis in Taiwan for the past century is presented. The phenomenal observations that led to the discovery of Taenia asiatica as a new species, which differ from Taenia solium and Taenia saginata, are described. Parasitological surveys of the aborigines in Taiwan revealed a high prevalence of taeniasis, which might be due to the culture of eating raw liver of hunted wild boars. Chemotherapeutic deworming trials involving many patients with taeniasis were discussed. Praziquantel was found to be very effective, but sometimes complete worms could not be recovered from the feces after treatment, probably due to the dissolution of the proglottids. Atabrine, despite some side effects, can still be used, in properly controlled dosages, as the drug of choice for human T. asiatica infection if we need to recover the expelled worms for morphological examinations. Research results on the infection of T. asiatica eggs from Taiwan aborigines in experimental animals were also noted. Since the pig serve as the natural intermediate host of T. asiatica and the predilection site is the liver, a differential comparison of other parasitic pathogens that might cause apparently similar lesions is also presented.

Ho, Chau-Mei; Chung, Wen-Cheng

2013-01-01

174

SHORT REPORT: SECONDARY TRANSMISSION IN PORCINE CYSTICERCOSIS: DESCRIPTION AND THEIR POTENTIAL IMPLICATIONS FOR CONTROL SUSTAINABILITY  

Microsoft Academic Search

Taenia solium taeniasis\\/cysticercosis is one of few potentially eradicable infectious diseases and is the target of control programs in several countries. The larval stage of this zoonotic cestode invades the human brain and is responsible for most cases of adult-onset epilepsy in the world. The pig is the natural intermediate host, harboring the larvae or cysticerci. Our current understanding of

ARMANDO E. GONZALEZ; TERESA LÓPEZ-URBINA; BYRON Y. TSANG; CÉSAR M. GAVIDIA; HÉCTOR H. GARCIA; MARÍA E. SILVA; DAPHNE D. RAMOS; RAFAEL MANZANEDO; LELIA SÁNCHEZ-HIDALGO

175

Antiparasitic treatment of cerebral cysticercosis: lessons and experiences from China.  

PubMed

Cysticercosis is a tropical disease caused by infection with the larval stage of the pork tapeworm, Taenia solium. Humans and pigs acquire cysticercosis by ingesting T. solium eggs shed in the feces of humans with taeniasis (i.e., infected with an adult intestinal tapeworm). Cerebral cysticercosis occurs when the cysts of T. solium develop within the central nervous system, and it is the primary cause of illness in T. solium infection. Currently, cerebral cysticercosis is endemic worldwide, and it is a leading cause of adult-onset epilepsy in developing countries. However, it is now increasingly detected in developed countries due to the immigration of T. solium carriers from the endemic areas. The antiparasitic treatment of cerebral cysticercosis remains controversial till now. In China, except a few cases who conform to the contraindicated criteria of antiparasitic therapy, most cerebral cysticercosis patients with symptoms and signs are given etiological treatment. This paper reviews the antiparasitic therapy of cerebral cysticercosis in China during the past several decades. Praziquantel treatment with different regimens has been used, and various efficacies are achieved. In the early stage, unsatisfactory therapeutic efficacy was achieved due to small doses and short treatment courses. Afterwards, the therapeutic efficacy became increasingly remarkable in both adults and children with the increases in dosage and courses. Albendazole also presents activity against cysticercosis with slow and moderate action, and it has been widely used in the treatment of the infection. The comparison between praziquantel and albendazole treatments showed that the immediate and short-term effects of albendazole treatment were better than those of praziquantel treatment, but similar mid- and long-term efficacies were observed following albendazole and praziquantel treatments. The combination of albendazole and praziquantel treatments can increase the therapeutic efficacy, and now, from the massive clinical practices, most of Chinese clinical specialists propose the combination therapy of albendazole and praziquantel for cerebral cysticercosis with simultaneous administration of steroids, especially in the first course. In addition, administration of praziquantel at a high dose can become a diagnostic treatment for suspected cerebral cysticercosis and serve as a supplement of the currently available diagnostic methods, such as diagnoses based on the clinical features, immunology, CT and MRI imaging, etc., in some atypical cerebral cysticercosis patients. Praziquantel and albendazole treatments have some adverse reactions, and to control these adverse effects, all the cerebral cysticercosis patients should be treated in hospital. According to the type of cerebral cysticercosis, especially for intracranial hypertension type and meningocephalitis type, the dosages of anti-cysticercus drugs need to follow a gradually increasing pattern. During the period of anti-cysticercosis treatments, steroids and/or dehydrating agents need be administered which can alleviate the intracranial hypertension and so on. Traditional Chinese medicines have been also used in the treatment of cerebral cysticercosis and achieve satisfactory outcomes. However, the compound prescription of traditional Chinese medicines is very complex, and the effective components are not fully clear. Some cerebral cysticercosis patients with very high intracranial tension could not receive antiparasitic treatment immediately, and surgical treatment is required. Chinese surgeons also achieve some successful experiences, but not all the cysticercus can be removed completely during the surgery. Therefore, antiparasitic drugs are still needed after the operation. The rehabilitative treatment is supplementary in the therapy of cerebral cysticercosis. In China, the rehabilitative treatment of cerebral cysticercosis is still at the initial stage. These lessons and experiences in China can be shared with medical staff and researchers from other countries where the disease is endemic. PMI

Wu, Wei; Jia, Fengju; Wang, Wei; Huang, Yixin; Huang, Yong

2013-05-22

176

Characterization of S3Pvac Anti-Cysticercosis Vaccine Components: Implications for the Development of an Anti-Cestodiasis Vaccine  

Microsoft Academic Search

BackgroundCysticercosis and hydatidosis seriously affect human health and are responsible for considerable economic loss in animal husbandry in non-developed and developed countries. S3Pvac and EG95 are the only field trial-tested vaccine candidates against cysticercosis and hydatidosis, respectively. S3Pvac is composed of three peptides (KETc1, GK1 and KETc12), originally identified in a Taenia crassiceps cDNA library. S3Pvac synthetically and recombinantly expressed

Dunia Rassy; Raúl J. Bobes; Gabriela Rosas; Victor H. Anaya; Klaus Brehm; Beatriz Hernández; Jacquelynne Cervantes; Saúl Pedraza; Julio Morales; Nelly Villalobos; Aline S. de Aluja; Juan P. Laclette; Caris M. Nunes; Germano F. Biondi; Gladis Fragoso; Marisela Hernández; Edda Sciutto; David Joseph Diemert

2010-01-01

177

Differential diagnosis of Taenia asiatica using multiplex PCR.  

PubMed

Taenia asiatica and T. saginata are frequently confused tapeworms due to their morphological similarities and sympatric distribution in Asian regions. To resolve this problem, a high-resolution multiplex PCR assay was developed to distinguish T. asiatica infections from infection with other human Taenia tapeworms. For molecular characterization, the species specificity of all materials used was confirmed by sequencing of the cox1 gene. Fifty-two samples were analyzed in this study, comprising 20 samples of T. asiatica genomic DNA from China, Korea, and the Philippines; 24 samples of T. saginata from Belgium, Chile, China, Ethiopia, France, Indonesia, Korea, Laos, the Philippines, Poland, Taiwan, Thailand, and Switzerland; and 10 samples of T. solium from Cape Verde, China, Honduras, and Korea. The diagnostic quality of the results obtained using PCR and species-specific primers designed from valine tRNA and NADH genes was equal to that based on the nucleotide sequencing of the cox1 gene. Using oligonucleotide primers Ta4978F, Ts5058F, Tso7421F, and Rev7915, the multiplex PCR assay was useful for the differentially diagnosing T. asiatica, T. saginata, and T. solium based on 706-, 629-, and 474-bp bands. PMID:19017531

Jeon, Hyeong-Kyu; Chai, Jong-Yil; Kong, Yoon; Waikagul, Jitra; Insisiengmay, Bounnaloth; Rim, Han-Jong; Eom, Keeseon S

2008-11-05

178

Steroid hormone production by parasites: the case of Taenia crassiceps and Taenia solium cysticerci.  

PubMed

Many examples of reciprocal endocrine interactions between parasites and hosts have been found in insects, arthropods and mammals. Cysticercosis produced by Taenia solium metacestodes is a widely distributed parasite infection that affects the human and the pig. Taenia crassiceps experimental murine cysticercosis has been used to explore the role of biological factors involved in host-parasite interactions. We had shown that T. crassiceps cysticercosis affects the serum concentration of steroid hormones and the reproduction behavior of the male mice host. In an effort to understand the biology of the parasite, we had investigated the parasite capacity to produce sex steroids. For this purpose, T. crassiceps cysticerci were incubated in the presence of different steroid precursors. TLC and recrystallization procedures showed that testosterone is produced from 3H-androstenedione in cysticerci. The conversion of 3H-testosterone to androstenedione, although present is much less significant. In addition, we had studied the production of testosterone by T. solium cysticerci. For this purpose, cysticerci were dissected from pork meat and incubated as above described. The results showed that T. solium cysticerci also produce testosterone. We have speculated about the importance of androgens in the growth of T. crassiceps cysticerci and found that the addition of the antiandrogen flutamide to the culture media of the parasites significantly decreased 3H-thymidine incorporation. We therefore hypothesized, that the ability of cysticerci to produce testosterone from steroid precursors might be important for the parasite growth and development. PMID:12943707

Romano, M C; Valdéz, R A; Cartas, A L; Gómez, Y; Larralde, C

2003-06-01

179

TLR2 Mediates Immunity to Experimental Cysticercosis  

PubMed Central

Information concerning TLR-mediated antigen recognition and regulation of immune responses during helminth infections is scarce. TLR2 is a key molecule required for innate immunity and is involved in the recognition of a wide range of viruses, bacteria, fungi and parasites. Here, we evaluated the role of TLR2 in a Taenia crassiceps cysticercosis model. We compared the course of T. crassiceps infection in C57BL/6 TLR2 knockout mice (TLR2-/-) with that in wild type C57BL/6 (TLR2+/+) mice. In addition, we assessed serum antibody and cytokine profiles, splenic cellular responses and cytokine profiles and the recruitment of alternatively activated macrophages (AAM?s) to the site of the infection. Unlike wild type mice, TLR2-/- mice failed to produce significant levels of inflammatory cytokines in either the serum or the spleen during the first two weeks of Taenia infection. TLR2-/- mice developed a Th2-dominant immune response, whereas TLR2+/+ mice developed a Th1-dominant immune response after Taenia infection. The insufficient production of inflammatory cytokines at early time points and the lack of Th1-dominant adaptive immunity in TLR2-/- mice were associated with significantly elevated parasite burdens; in contrast, TLR2+/+ mice were resistant to infection. Furthermore, increased recruitment of AAM?s expressing PD-L1, PD-L2, OX40L and mannose receptor was observed in TLR2-/- mice. Collectively, these findings indicate that TLR2-dependent signaling pathways are involved in the recognition of T. crassiceps and in the subsequent activation of the innate immune system and production of inflammatory cytokines, which appear to be essential to limit infection during experimental cysticercosis.

Reyes, Jose L.; Gonzalez, Marisol I.; Ledesma-Soto, Yadira; Satoskar, Abhay R.; Terrazas, Luis I.

2011-01-01

180

Epidemiological understanding of Taenia tapeworm infections with special reference to Taenia asiatica in Korea  

PubMed Central

In endemic areas of Taenia tapeworms in Korea, most of the reports showed that T. saginata was dominant over T. solium, but eating pigs is the dominant habit over eating cattle. Why do they have more T. saginata despite lower consumption of beef? This problem actually has long been recognized but until recently there has been no intensive trial to give a scientific explanation on this epidemiological enigma. By summing up the data published between the years 1963 and 1999, the ratio of armed versus unarmed tapeworms in humans was estimated at approximately 1:5. The ratio of pig-eaters versus cattle-eaters, however, was approximately 5:1. This inconsistency could be explained with the recently described T. asiatica, which infects humans through the eating of pig's viscera. We re-evaluate the importance of the consumption of visceral organ of pigs, leading us to an improved epidemiological understanding of the T. asiatica infection together with co-existing T. saginata and T. solium in Korea.

Rim, Han-Jong

2001-01-01

181

Seroprevalence of Cysticercosis in Children and Young Adults Living in a Helminth Endemic Community in Leyte, the Philippines  

PubMed Central

Cysticercosis is a significant public health problem in countries where pigs are raised for consumption and remains an important cause of neurological disease worldwide. The Philippines is considered an endemic area for cysticercosis because cases in both humans and pigs have been reported; however, epidemiologic information stays limited. We conducted a pilot survey of the seroprevalence of human cysticercosis in a village in Leyte, the Philippines, by measuring antibody specific for Taenia solium cyst-fluid antigen. There were 497 subjects aged 7–30 years in our study and most subjects were infected with one or more helminths. The overall cysticercosis seroprevalence in this population was 24.6% (95% CI: 20.82% ~ 28.58%) with no significant difference based on age, sex, or other helminth coinfection status. Although the sample may not be representative of the whole community, the findings suggest that cysticercosis is a significant, but underrecognized public health concern in the Philippines.

Xu, Jin-Mei; Acosta, Luz P.; Hou, Min; Manalo, Daria L.; Jiz, Mario; Jarilla, Blanca; Pablo, Archie O.; Ovleda, Remigio M.; Langdon, Gretchen; McGarvey, Stephen T.; Kurtis, Jonathan D.; Friedman, Jennifer F.; Wu, Hai-Wei

2010-01-01

182

Mass chemotherapy for intestinal Taenia solium infection: effect on prevalence in humans and pigs  

Microsoft Academic Search

Mass treatment of the human population with niclosamide was carried out in 2 villages in rural Guatemala where Taenia solium was endemic, to determine how this would affect the epidemiology of the parasite. Intestinal taeniasis was diagnosed by microscopy and coproantigen testing, and porcine cysticercosis by a specific Western blot. Before mass treatment, the prevalence of human taeniasis was 3·5%;

J. C. Allan; M. Velasquez-Tohom; C. Fletes; R. Torres-Alvarez; G. Lopez-Virula; P. Yurrita; H. Soto de Alfaro; A. Rivera; J. Garcia-Noval

1997-01-01

183

Geographical Distribution of Taenia asiatica and Related Species  

PubMed Central

Geographical information of Taenia asiatica is reviewed together with that of T. solium and T. saginata. Current distribution of T. asiatica was found to be mostly from Asian countries: the Republic of Korea, China, Taiwan, Indonesia, and Thailand. Molecular genotypic techniques have found out more countries with T. asiatica from Japan, the Philippines, and Vietnam. Specimens used in this paper were collected from around the world and mostly during international collaboration projects of Korean foundations for parasite control activities (1995-2009) in developing countries.

Jeon, Hyeong-Kyu; Rim, Han-Jong

2009-01-01

184

Geographical distribution of Taenia asiatica and related species.  

PubMed

Geographical information of Taenia asiatica is reviewed together with that of T. solium and T. saginata. Current distribution of T. asiatica was found to be mostly from Asian countries: the Republic of Korea, China, Taiwan, Indonesia, and Thailand. Molecular genotypic techniques have found out more countries with T. asiatica from Japan, the Philippines, and Vietnam. Specimens used in this paper were collected from around the world and mostly during international collaboration projects of Korean foundations for parasite control activities (1995-2009) in developing countries. PMID:19885327

Eom, Keeseon S; Jeon, Hyeong-Kyu; Rim, Han-Jong

2009-10-01

185

Clinical and Pathological Characteristics of Intraocular Cysticercosis  

PubMed Central

This study aimed to explore the clinical, radiological, and pathological characteristics of intraocular cysticercosis due to Taenia solium metacestode infection. Total 8 patients diagnosed with intraocular cysticercosis at the Red Cross Hospital of Yunnan Province, China were examined retrospectively. Patients with clear dioptic media had undergone fundus chromophotography. All patients underwent B ultrasonography of the ocular region (CT) successive scanning of the orbit and cerebral tissues. Parasites were extracted surgically and then examined pathologically. The fundus chromophotography showed a white and condensing scolex package in the vesicle. The B ultrasonic examination showed a vesicle-like echogenic mass in the vitreous chamber, in which the high-level echo spot was the cysticercus scolex. The pathological examinations showed that the vesicle wall exhibited hyaline degeneration, inflammatory cell infiltration, neuroglial fiber, and glial cell proliferation layers from the inside to the outside. The scolex is round and is composed of the outer tissue (the body wall) and the inner furrow tissue; these tissues migrated together. Primordially differentiated sucking discs were found in one case, but no hooklets were found. The inner scolex tissue was folded like a paper flower. The severity of intraocular disease is closely correlated with the pathophysiological processes of the cysticercus worm. Pathological examination of the intraocular lesions can help to evaluate the course of the disease as well as to provide a scientific basis for effective antiparasitic medication.

Zhang, Li-Wei; Li, Hua; Hu, Zhu-Lin

2013-01-01

186

Clinical and pathological characteristics of intraocular cysticercosis.  

PubMed

This study aimed to explore the clinical, radiological, and pathological characteristics of intraocular cysticercosis due to Taenia solium metacestode infection. Total 8 patients diagnosed with intraocular cysticercosis at the Red Cross Hospital of Yunnan Province, China were examined retrospectively. Patients with clear dioptic media had undergone fundus chromophotography. All patients underwent B ultrasonography of the ocular region (CT) successive scanning of the orbit and cerebral tissues. Parasites were extracted surgically and then examined pathologically. The fundus chromophotography showed a white and condensing scolex package in the vesicle. The B ultrasonic examination showed a vesicle-like echogenic mass in the vitreous chamber, in which the high-level echo spot was the cysticercus scolex. The pathological examinations showed that the vesicle wall exhibited hyaline degeneration, inflammatory cell infiltration, neuroglial fiber, and glial cell proliferation layers from the inside to the outside. The scolex is round and is composed of the outer tissue (the body wall) and the inner furrow tissue; these tissues migrated together. Primordially differentiated sucking discs were found in one case, but no hooklets were found. The inner scolex tissue was folded like a paper flower. The severity of intraocular disease is closely correlated with the pathophysiological processes of the cysticercus worm. Pathological examination of the intraocular lesions can help to evaluate the course of the disease as well as to provide a scientific basis for effective antiparasitic medication. PMID:23710092

Li, Juan-Juan; Zhang, Li-Wei; Li, Hua; Hu, Zhu-Lin

2013-04-25

187

Disseminated cutaneous cysticercosis and neurocysticercosis: A rare occurrence  

PubMed Central

Disseminated cysticercosis is a parasitic infestation of pork tapeworm, Taenia solium. A 19-year-old female presented with multiple nodules all over her body since 12 months. Histopathology showed features suggestive of parasitic granuloma with multinucleated giant cells and plenty of eosinophils admixed with necrosis. Ultrasonography of these lesions showed multiple well-defined cystic lesions of varying size with a few specks of calcification. Cranial computed tomography scan showed bilateral, multiple, small hyperdense lesions in the supratentorial compartment. She was treated with oral albendazole and oral corticosteroids. This case is being reported because of its rare, disseminated nature with cutaneous, neural and ocular involvement.

Sacchidanand, S.; Namitha, P.; Mallikarjuna, M.; Nataraj, H. V.

2012-01-01

188

Disseminated cutaneous cysticercosis and neurocysticercosis: A rare occurrence.  

PubMed

Disseminated cysticercosis is a parasitic infestation of pork tapeworm, Taenia solium. A 19-year-old female presented with multiple nodules all over her body since 12 months. Histopathology showed features suggestive of parasitic granuloma with multinucleated giant cells and plenty of eosinophils admixed with necrosis. Ultrasonography of these lesions showed multiple well-defined cystic lesions of varying size with a few specks of calcification. Cranial computed tomography scan showed bilateral, multiple, small hyperdense lesions in the supratentorial compartment. She was treated with oral albendazole and oral corticosteroids. This case is being reported because of its rare, disseminated nature with cutaneous, neural and ocular involvement. PMID:23130290

Sacchidanand, S; Namitha, P; Mallikarjuna, M; Nataraj, H V

2012-05-01

189

A new parasiticidal compound in T. solium cysticercosis.  

PubMed

The effect of 16?-bromoepiandrosterone (EpiBr), a dehydroepiandrosterone (DHEA) analogue, was tested on the cysticerci of Taenia solium, both in vitro and in vivo. In vitro treatment of T. solium cultures with EpiBr reduced scolex evagination, growth, motility, and viability in dose- and time-dependent fashions. Administration of EpiBr prior to infection with T. solium cysticerci in hamsters reduced the number and size of developed taenias in the intestine, compared with controls. These effects were associated to an increase in splenocyte proliferation in infected hamsters. These results leave open the possibility of assessing the potential of this hormonal analogue as a possible antiparasite drug, particularly in cysticercosis and taeniosis. PMID:23509732

Hernández-Bello, Romel; Escobedo, Galileo; Carrero, Julio Cesar; Cervantes-Rebolledo, Claudia; Dowding, Charles; Frincke, James; Reading, Chris; Morales-Montor, Jorge

2012-12-20

190

Molecular cloning of genes encoding oncosphere proteins reveals conservation of modular protein structure in cestode antigens  

Microsoft Academic Search

Recombinant oncosphere antigens have been found to be remarkably effective when used as vaccines against cysticercosis and hydatid disease. Comparison of the structural features of these proteins and their associated genes suggest common features between antigens. Here molecular cloning is used to complete comparisons of Taenia solium, Taenia saginata, Taenia ovis, Echinococcus granulosus and Echinococcus multilocularis oncosphere antigens and genes.

Charles Gauci; Marshall W. Lightowlers

2003-01-01

191

Mutation scanning-coupled tools for the analysis of genetic variation in Taenia and diagnosis – Status and prospects  

Microsoft Academic Search

Cestodes of the genus Taenia occur as adult tapeworms in the small intestine of carnivorous definitive hosts and are transmitted to particular mammalian intermediate hosts, in which they develop as fluid-filled larvae in tissues, causing the disease cysticercosis or coenuriasis. A number of species are of medical importance and\\/or cause losses to the meat and livestock industry mainly due to

Robin B. Gasser; Bronwyn E. Campbell; Aaron R. Jex

2009-01-01

192

Evaluation of ELISA, neck muscle, tongue and eyelid examinations for the diagnosis of swine cysticercosis in a highly endemic area of north India.  

PubMed

Swine cysticercosis is very common in the developing countries where pigs are raised. Undercooked measly pork consumption leads to taeniasis; Taenia carriers act as source of human and swine cysticercosis and neurocysticercosis. Diagnosis of swine cysticercosis is important to break the cycle of disease transmission. The present study compared the neck muscle, tongue and eye examinations, and serum ELISA with different preparations (crude lysate, cyst fluid, scolex and cyst wall antigens) of Taenia solium cyst for the diagnosis of swine cysticercosis. Total of 24 pigs initially identified by neck muscle, tongue and eyelid examinations were purchased from local slaughter house and subjected to MRI for confirmation of cysticercosis. Sera from 20 MRI confirmed infected pigs and 50 disease free controls were subjected to ELISA with T. solium cyst antigens. Neck muscle examination was 100% sensitive and 75% specific for the diagnosis of swine cysticercosis, whereas tongue and eye examinations were 70% and 25% sensitive, respectively. ELISA with crude lysate had 85% sensitivity and 98% specificity. ELISA with cyst fluid, scolex and cyst wall antigens showed 70%, 65%, and 45% sensitivity, respectively. The present study showed that neck muscle examination was highly sensitive but less specific, while ELISA with crude antigens had reasonable sensitivity and high specificity for diagnosis of swine cysticercosis. ELISA with crude lysate can be used as a screening tool for swine infection. PMID:23578857

Singh, Aloukick Kumar; Singh, Satyendra Kumar; Prasad, Kashi Nath; Singh, Amrita; Bajpai, Anamika; Rahman, Mohibur; Rai, Ravi Prakash; Gupta, Rakesh Kumar; Tripathi, Mukesh; Husain, Nuzhat

2013-04-08

193

Pig-farming systems and porcine cysticercosis in the north of Cameroon  

PubMed Central

A survey was conducted in 150 households owning 1756 pigs in the rural areas of Mayo-Danay division in the north of Cameroon. A questionnaire survey was carried out to collect information on the pig-farming system and to identify potential risk factors for Taenia solium cysticercosis infection in pigs. Blood samples were collected from 398 pigs with the aim of estimating the seroprevalence of T. solium cysticercosis. The results showed that 90.7% of the pigs are free roaming during the dry season and that 42.7% of households keeping pigs in the rural areas have no latrine facility. Seventy-six per cent of the interviewed pig owners confirmed that members of the household used open-field defecation. Enzyme-linked immunosorbent assay (ELISA) for antigen and antibody detection showed an apparent prevalence of cysticercosis of 24.6% and 32.2%, respectively. A Bayesian approach, using the conditional dependence between the two diagnostic tests, indicated that the true seroprevalence of cysticercosis in Mayo-Danay was 26.6%. Binary logistic regression analysis indicated that a lack of knowledge of the taeniasis–cysticercosis complex and the absence of a pig pen in the household were associated with pig cysticercosis.

Assana, E.; Amadou, F.; Thys, E.; Lightowlers, M.W.; Zoli, A.P.; Dorny, P.; Geerts, S.

2010-01-01

194

Cysticercosis of temporalis muscle: an unusual cause of temporal headaches. A case report  

Microsoft Academic Search

Cysticercosis is a common parasitic infection caused by encysted larvae of the helminth Taenia solium (pork tapeworm). The central nervous system (CNS) is the most important primary site of infection and the disease can present\\u000a with solitary or multiple space occupying lesions. Less common presentations in the CNS include the racemose variety with\\u000a macroscopic groups of cysticerci in the subarachnoid

Prahlad K. Sethi; Nitin K. Sethi; Josh Torgovnick; Edward Arsura

2007-01-01

195

Rare case of disseminated cysticercosis and taeniasis in a Japanese traveler after returning from India.  

PubMed

We report disseminated cysticercosis concurrent with taeniasis in a 31-year-old male Japanese, who had visited India three times and stayed for 1 month each time during the previous 1 year. The patient presented increasing numbers of subcutaneous nodules and expelled proglottids, although numerous cysts were also found in the brain in imaging findings, though no neurological symptoms were observed. Histopathological and serological findings strongly indicated cysticercosis. We found taeniid eggs in his stool by microscopic examination and revealed them as the Indian haplotype of Taenia solium by mitochondrial DNA analysis. We concluded that disseminated cysticercosis was caused by the secondary autoinfection with eggs released from the tapeworm carrier himself. After confirming the absence of adult worms in the intestine by copro-polymerase chain reaction, the patient was successfully treated with albendazole at a dose of 15 mg/kg/day for 28 days. Subcutaneous and intracranial lesions had completely disappeared by the end of the treatment period. PMID:23629930

Kobayashi, Ken-ichiro; Nakamura-Uchiyama, Fukumi; Nishiguchi, Takeshi; Isoda, Kenichi; Kokubo, Yasumasa; Ando, Katsuhiko; Katurahara, Masaki; Sako, Yasuhito; Yanagida, Tetsuya; Ito, Akira; Iwabuchi, Sentaro; Ohnishi, Kenji

2013-04-29

196

Efficacy of diverse antiparasitic treatments for cysticercosis in the pig model.  

PubMed

Taenia solium cysticercosis infects pigs and humans. Because antiparasitic treatment for human cysticercosis has sub-optimal efficacy, alternative regimes are needed. Seven antiparasitic regimens were tested in 42 naturally infected pigs with cysticercosis, and compared with prednisone alone (n = 6) or no treatment (n = 6). The numbers of viable cysts in muscles and in the brain were examined after necropsy and were significantly decreased in pigs receiving combined albendazole plus praziquantel, albendazole alone, or oxfendazole. Pigs receiving praziquantel alone and nitazoxanide had numerous surviving cysts. Control (untreated) pigs and prednisone-treated pigs had many more viable cysts, suggesting no effect. Combined albendazole plus praziquantel, and oxfendazole, showed a strong cysticidal effect and provide suitable alternative treatments to be further explored for their use for treatment of human neurocysticercosis. PMID:22855760

Gonzalez, Armando E; Bustos, Javier A; Jimenez, Juan A; Rodriguez, Mary L; Ramirez, Mercy G; Gilman, Robert H; Garcia, Hector H

2012-08-01

197

Efficacy of Diverse Antiparasitic Treatments for Cysticercosis in the Pig Model  

PubMed Central

Taenia solium cysticercosis infects pigs and humans. Because antiparasitic treatment for human cysticercosis has sub-optimal efficacy, alternative regimes are needed. Seven antiparasitic regimens were tested in 42 naturally infected pigs with cysticercosis, and compared with prednisone alone (n = 6) or no treatment (n = 6). The numbers of viable cysts in muscles and in the brain were examined after necropsy and were significantly decreased in pigs receiving combined albendazole plus praziquantel, albendazole alone, or oxfendazole. Pigs receiving praziquantel alone and nitazoxanide had numerous surviving cysts. Control (untreated) pigs and prednisone-treated pigs had many more viable cysts, suggesting no effect. Combined albendazole plus praziquantel, and oxfendazole, showed a strong cysticidal effect and provide suitable alternative treatments to be further explored for their use for treatment of human neurocysticercosis.

Gonzalez, Armando E.; Bustos, Javier A.; Jimenez, Juan A.; Rodriguez, Mary L.; Ramirez, Mercy G.; Gilman, Robert H.; Garcia, Hector H.

2012-01-01

198

Genetic diversity of Taenia asiatica from Thailand and other geographical locations as revealed by cytochrome c oxidase subunit 1 sequences.  

PubMed

Twelve 924 bp cytochrome c oxidase subunit 1 (cox1) mitochondrial DNA sequences from Taenia asiatica isolates from Thailand were aligned and compared with multiple sequence isolates from Thailand and 6 other countries from the GenBank database. The genetic divergence of T. asiatica was also compared with Taenia saginata database sequences from 6 different countries in Asia, including Thailand, and 3 countries from other continents. The results showed that there were minor genetic variations within T. asiatica species, while high intraspecies variation was found in T. saginata. There were only 2 haplotypes and 1 polymorphic site found in T. asiatica, but 8 haplotypes and 9 polymorphic sites in T. saginata. Haplotype diversity was very low, 0.067, in T. asiatica and high, 0.700, in T. saginata. The very low genetic diversity suggested that T. asiatica may be at a risk due to the loss of potential adaptive alleles, resulting in reduced viability and decreased responses to environmental changes, which may endanger the species. PMID:23467439

Anantaphruti, Malinee Thairungroj; Thaenkham, Urusa; Watthanakulpanich, Dorn; Phuphisut, Orawan; Maipanich, Wanna; Yoonuan, Tippayarat; Nuamtanong, Supaporn; Pubampen, Somjit; Sanguankiat, Surapol

2013-02-18

199

Genetic Diversity of Taenia asiatica from Thailand and Other Geographical Locations as Revealed by Cytochrome c Oxidase Subunit 1 Sequences  

PubMed Central

Twelve 924 bp cytochrome c oxidase subunit 1 (cox1) mitochondrial DNA sequences from Taenia asiatica isolates from Thailand were aligned and compared with multiple sequence isolates from Thailand and 6 other countries from the GenBank database. The genetic divergence of T. asiatica was also compared with Taenia saginata database sequences from 6 different countries in Asia, including Thailand, and 3 countries from other continents. The results showed that there were minor genetic variations within T. asiatica species, while high intraspecies variation was found in T. saginata. There were only 2 haplotypes and 1 polymorphic site found in T. asiatica, but 8 haplotypes and 9 polymorphic sites in T. saginata. Haplotype diversity was very low, 0.067, in T. asiatica and high, 0.700, in T. saginata. The very low genetic diversity suggested that T. asiatica may be at a risk due to the loss of potential adaptive alleles, resulting in reduced viability and decreased responses to environmental changes, which may endanger the species.

Thaenkham, Urusa; Watthanakulpanich, Dorn; Phuphisut, Orawan; Maipanich, Wanna; Yoonuan, Tippayarat; Nuamtanong, Supaporn; Pubampen, Somjit; Sanguankiat, Surapol

2013-01-01

200

Prevalence of porcine cysticercosis and associated risk factors in Homa Bay District, Kenya  

PubMed Central

Background Taenia solium is an important zoonosis in many developing countries. Cysticercosis poses a serious public health risk and leads to economic losses to the pig production industry. Due to scarcity of data on the epidemiology of porcine cysticercosis in Kenya, the present study was conducted to determine the prevalence and risk factors for porcine cysticercosis within Homa Bay district. A cross-sectional survey was carried out in 2010, and a total of 392 pigs were recruited in a household survey, with all being tested by ante-mortem lingual palpation (together with questionnaire data on pig production, occurrence and transmission of porcine cysticercosis, risk factors and awareness of porcine cysticercosis collected from the households from which pigs were sampled). Sufficient serum was collected from 232 of the pigs to be tested for the presence of circulating parasite antigen using a monoclonal antibody-based sandwich enzyme-linked immunosorbent assay (Ag-ELISA). Results Seventy six pigs were found positive by the Ag-ELISA (32.8%, 95% C.I. 26.8-39.2%), while by tongue inspection cysticerci were detected in 22/ 392 pigs (5.6% 95% C.I. 3.6-8.4%). The most important risk factor for porcine cysticercosis in the Homa Bay area was for pigs to belong to a farm where latrine use by members of the household was not evident (OR?=?1.9, 95% CI?=?1.13–2.37). Conclusion The present findings indicate that porcine cysticercosis is endemic in Homa Bay District, and that latrine provision, in conjunction with free-range pig keeping contributes significantly to porcine cysticercosis transmission.

2012-01-01

201

Mapping of Taenia solium TSOL18 antigenic epitopes by phage display library  

Microsoft Academic Search

Taenia solium is a cestode parasite that causes cysticercosis in humans and pigs. TSOL18 has been identified as a host-protective oncosphere\\u000a antigen. To obtain mouse monoclonal antibodies (mAbs) against TSOL18 and to map its antigenic epitopes are potentials to develop\\u000a a vaccine for the prevention of T. solium infection. In this study, mAbs were produced by the hybridoma technique using

Aijiang Guo; Xuepeng Cai; Wanzhong Jia; Bing Liu; Shaohua Zhang; Peiya Wang; Hongbing Yan; Xuenong Luo

2010-01-01

202

Cysticercosis in Nepal: a histopathologic study of sixty-two cases.  

PubMed

Human cysticercosis, an infection caused by larvae of Taenia solium, is a major public health problem in many developing countries. Sixty-two of 23,402 biopsy cases have been detected as cysticercosis in the last 5 years in Patan Hospital. Most (82%) of the patients presented with solitary skin nodules, another 10% with nodules in the oral mucosa, and 8% in the breast. Forty cases were identified from the Kathmandu valley and the rest from outside Kathmandu. Most patients were younger than 30 years of age (mean, 21+/-11 years). Statistically, there was no difference between males (0.28%) and females (0.24%). The average size of cysticercosis was 19 mm in diameter, and the histology of cysticercosis showed fibrous walled cysts covered by several layered epithelioid cells with a few Langhans' giant cells and infiltration of eosinophils without caseous necrosis. These cysticercosis findings from an endemic area will be helpful for doctors who examine immigrant patients in nonendemic areas. PMID:10524530

Amatya, B M; Kimula, Y

1999-10-01

203

Development and Evaluation of a Magnetic Immunochromatographic Test To Detect Taenia solium, Which Causes Taeniasis and Neurocysticercosis in Humans?  

PubMed Central

Taeniasis/cysticercosis caused by Taenia solium is a frequent parasitic infection of the human brain in most of the world. Rapid and simple screening tools to identify taeniasis and cysticercosis cases are needed for control programs, mostly to identify tapeworm carriers which are the source of infection and need to be treated, or as tools for point-of-care case detection or confirmation. These screening assays should be affordable, reliable, rapid, and easy to perform. Immunochromatographic tests meet these criteria. To demonstrate proof of principle, we developed and evaluated two magnetic immunochromatographic tests (MICTs) for detection of human Taenia solium taeniasis antibodies (ES33-MICT) and neurocysticercosis antibodies (T24-MICT). These assays detected stage-specific antibodies by using two recombinant proteins, rES33 for detection of taeniasis antibodies and rT24H for detection of cysticercosis antibodies. The sensitivity and specificity of the ES33-MICT to detect taeniasis infections were 94.5% and 96%, respectively, and those of the T24-MICT to detect cases of human cysticercosis with two or more viable brain cysts were 93.9% and 98.9%, respectively. These data provide proof of principle that the ES33- and T24-MICTs provide rapid and suitable methods to identify individuals with taeniasis and cysticercosis.

Handali, Sukwan; Klarman, Molly; Gaspard, Amanda N.; Dong, X. Fan; LaBorde, Ronald; Noh, John; Lee, Yeuk-Mui; Rodriguez, Silvia; Gonzalez, Armando E.; Garcia, Hector H.; Gilman, Robert H.; Tsang, Victor C. W.; Wilkins, Patricia P.

2010-01-01

204

Bovine cysticercosis--development of a real-time PCR to enhance classification of suspect cysts identified at meat inspection.  

PubMed

Laboratory confirmation methods are important in bovine cysticerosis diagnosis as other pathologies can result in morphologically similar lesions resulting in false identifications. We developed a probe-based real-time PCR assay to identify Taenia saginata in suspect cysts encountered at meat inspection and compared its use with the traditional method of identification, histology, as well as a published nested PCR. The assay simultaneously detects T. saginata DNA and a bovine internal control using the cytochrome c oxidase subunit 1 gene of each species and shows specificity against parasites causing lesions morphologically similar to those of T. saginata. The assay was sufficiently sensitive to detect 1 fg (Ct 35.09 ± 0.95) of target DNA using serially-diluted plasmid DNA in reactions spiked with bovine DNA as well as in all viable and caseated positive control cysts. A loss in PCR sensitivity was observed with increasing cyst degeneration as seen in other molecular methods. In comparison to histology, the assay offered greater sensitivity and accuracy with 10/19 (53%) T. saginata positives detected by real-time PCR and none by histology. When the results were compared with the reference PCR, the assay was less sensitive but offered advantages of faster turnaround times and reduced contamination risk. Estimates of the assay's repeatability and reproducibility showed the assay is highly reliable with reliability coefficients greater than 0.94. PMID:23499482

Cuttell, Leigh; Owen, Helen; Lew-Tabor, Alicja E; Traub, Rebecca J

2013-02-28

205

Role of the programmed Death1 pathway in the suppressive activity of alternatively activated macrophages in experimental cysticercosis  

Microsoft Academic Search

We characterised a population of macrophages potentially involved in the immunoregulation induced by experimental cysticercosis. Following Taenia crassiceps infection, macrophages recruited in the peritoneal cavity were isolated and co-cultured at different ratios with T cells from naïve mice previously stimulated with anti-CD3\\/CD28 antibodies; these macrophages inhibited naïve T cell proliferation. This suppressive effect was Interleukin (IL)-10, Interferon-gamma (IFN-?), and nitric

Luis I. Terrazas; Daniel Montero; César A. Terrazas; José L. Reyes; Miriam Rodríguez-Sosa

2005-01-01

206

Annual economic loss caused by Taenia saginata asiatica taeniasis in East Asia  

Microsoft Academic Search

Taeniasis is an important medical and economic problem in many countries in East Asia, especially in the mountainous and remote areas where the inhabitants are fond of eating raw or undercooked meat. P.C. Fan here discusses how sociocultural factors and local customs can contribute to the transmission of taeniasis and evaluates the economic losses caused by the disease.

P. C. Fan

1997-01-01

207

Ultrasonography for masseter muscle cysticercosis.  

PubMed

Solitary cheek swellings can present a diagnostic dilemma. We managed two children 10 y and 8 y presenting with pain and swelling on one side of cheek for over 15 d and no constitutional symptoms. Sonography showed cysticercosis in both of them. We treated both with steroids and albendazole, with good response. PMID:21378424

Gokarn, Anjali; Gokarn, Suhas; Rathod, Vivek

2011-02-01

208

Immunoblot findings of calcareous corpuscles binding proteins in cyst fluid of Taenia solium metacestodes  

PubMed Central

After collecting calcareous corpuscles from plerocercoid of Spirometra mansoni (sparganum), we evaluated the antigenic values of calcareous corpuscles binding proteins obtained from the cyst fluid of Taenia solium metacestodes. Immunoblot analysis revealed that cysticercosis patient sera strongly recognized 10 and 95 kDa calcareous corpuscles binding proteins. This result demonstrated that calcareous corpuscles are bound with major secretory antigenic proteins, which is possibly involved in the secretory pathways of the 10 and 95 kDa proteins presenting in the cyst fluid of T. solium metacestodes.

2004-01-01

209

Cysticercosis/taeniasis: recent advances in serological and molecular diagnoses.  

PubMed

Serodiagnosis by immunoblot, using recombinant chimeric T. solium antigen and native glycoprotein antigens, has been applied for neurocysticercosis cases. Specific antibodies against both antigens were detected in serum samples from NCC patients involving multiple cysts in the brain, whereas it was not always easy to detect specific antibodies in NCC cases with a solitary cyst or calcified lesion(s). On the other hand, the diagnosis for human taeniasis or worm carriers has been routinely performed by stool examination. In this study, multiplex PCR has been established to differentiate taeniasis using Taenia mitochondrial DNA in fecal samples from worm carriers. Furthermore, the molecular identification of human taeniid cestodes by base excision sequence scanning thymine-base analysis has also been introduced. This method provides four thymine-base peak profiles unique for Asian and American/African genotypes of T. solium, T. saginata and T. asiatica. By comparing thymine base peak profiles, it is possible to differentiate human taeniid cestodes without DNA sequencing. The approaches are powerful tools for the routine diagnosis of taeniasis and the molecular identification of taeniid cestodes. PMID:19230578

Yamasaki, H; Sato, M O; Sako, Y; Nakao, M; Nakaya, K; Mamuti, W; Craig, P S; Margono, S S; Ito, A

2003-01-01

210

Taenia spp.: 18S rDNA microsatellites for molecular systematic diagnosis.  

PubMed

The 18S rDNA gene of adult worms of Taenia parva found in Genetta genetta in the Iberian Peninsula and larval stages of T. pisiformis from the wild rabbit (Oryctolagus cuniculus) in Tenerife (Canary Islands) were amplified and sequenced. The sequences of the 18S rDNA gene of T. parva (1768 bp) and T. pisiformis (1760 bp) are reported for the first time (GenBank accession nos. AJ555167-AJ555168 and AJ555169-AJ555170, respectively). In 168 alignment positions microsatellites in the 18S rDNA of both taxa were detected for the first time (TGC in T. parva and TGCT in T. pisiformis) and differences in their sequences with different repetition numbers were observed. The use of nucleotide sequences of this gene in the resolution of systematic problems in cestodes is discussed with reference to the systematic status of Taenia spp. and mainly in human taeniids such as T. solium, T. saginata, and Asian human isolates of Taenia. PMID:15946391

Foronda, P; Casanova, J C; Martinez, E; Valladares, B; Feliu, C

2005-06-01

211

Tapeworm - beef or pork  

MedlinePLUS

Teniasis; Pork tapeworm; Beef tapeworm; Tapeworm; Taenia saginata; Taenia solium; Taeniasis ... usually carry Taenia saginata ( T. saginata ). Pigs carry Taenia solium (T. solium) . In the human intestine, the young ...

212

Protein and Antigen Diversity in the Vesicular Fluid of Taenia Solium Cysticerci Dissected from Naturally Infected Pigs  

PubMed Central

Cysticercosis caused by Taenia solium is a health threat for humans and pigs living in developing countries, for which there is neither a flawless immunodiagnostic test nor a totally effective vaccine. Suspecting of individual diversity of hosts and parasites as possible sources of the variations of the parasite loads among cysticercotic animals and of the limited success of such immunological applications as well as, we explored and measured both in nine cases of naturally acquired porcine cysticercosis. For this purpose, 2-Dimensional IgG immunoblots were performed by reacting the sera of each cysticercotic pig with the antigens contained in the vesicular fluid (VF) of their own cysticerci. We found an unexpectedly large diversity among the proteins and antigens contained in each of the nine VFs. Also diverse were the serum IgG antibody responses of the nine pigs, as none of their 2D- immunoblot images exhibited the same number of spots and resembled each other in only 6.3% to 65.3% of their features. So large an individual immunological diversity of the cysticercal antigens and of the infected pigs´ IgG antibody response should be taken into account in the design of immunological tools for diagnosis and prevention of cysticercosis and should also be considered as a possibly significant source of diversity in Taenia solium´s infectiveness and pathogenicity.

Esquivel-Velazquez, Marcela; Larralde, Carlos; Morales, Julio; Ostoa-Saloma, Pedro

2011-01-01

213

Intrasellar cysticercosis: a systematic review.  

PubMed

The objective of this study was to review patients with intrasellar cysticercosis to outline the features of this form of neurocysticercosis. A MEDLINE and manual search of patients with intrasellar cysticercosis were done. Abstracted data included clinical manifestations, neuroimaging findings, therapy, and outcome. Twenty-three patients were reviewed. Ophthalmological disturbances, including diminution of visual acuity and visual field defects following a chiasmatic pattern, were recorded in 67 % of cases. Endocrine abnormalities were found in 56 % of patients (panhypopituitarism, hyperprolactinemia, diabetes insipidus, and isolated hypothyroidism). In addition, some patients complained of seizures or chronic headaches. Neuroimaging studies showed lesions confined to the sellar region in 47 % of cases. The remaining patients also had subarachnoid cysts associated or not with hydrocephalus, parenchymal brain cysts, or parenchymal brain calcifications. Thirteen patients underwent surgical resection of the sellar cyst through a craniotomy in nine cases and by the transsphenoidal approach in four. Visual acuity or visual field defects improved in only two of these patients. Five patients were treated with cysticidal drugs without improvement. Intrasellar cysticercosis is rare and probably under-recognized. Clinical manifestations resemble those caused by pituitary tumors, cysts, or other granulomatous lesions. Neuroimaging findings are of more value when intrasellar cysts are associated with other forms of neurocysticercosis, such as basal subarachnoid cysts or hydrocephalus. Prompt surgical resection is mandatory to reduce the risk of permanent loss of visual function. There seems to be no role for cysticidal drug therapy in these cases. PMID:23605125

Del Brutto, Oscar H; Del Brutto, Victor J

2013-04-20

214

[Environmental spread of taenia proglottids: an atypical yet interesting public health problem in schools].  

PubMed

We report herein a new case of teniasis caused by Taenia saginata (tapeworm) in a pediatric patient with done-on-purpose dispersion of proglottids happened in an elementary school inside the health district ASL CN-1. This new case highlights how teniasis in children is not as rare, as it is not so rare dispersal of proglottids in the environmental, made on purpose, by the same subjects that have been parasitized. The environmental dispersion of proglottids is an important public health problem that requires a rapid and joint management of the problem aiming to identify the parasite as quickly as possible, given the different pathogenic larval stage of three species of tapeworm that can infest the man. PMID:21425650

Dutto, M; Sapino, G; Giovanetti, F; Pellegrino, A

215

[Cysticercosis in Spain. Epidemiologic data].  

PubMed

In our country, cysticercosis is an endemic zoonosis due to the infestation of the larva (cysticercus) of the helminth, Tenia Solium. We Have analyzed the epidemiological data of 52 patients studied at the "Doce Octubre" hospital. The areas at risk are those western rural communities of the peninsula. Although the disease has not yet been erradicated, the lowest number of cases reported was in the 70's due to the greater health, sanitary and social development of these areas. Computorized tomography has helped to identify late manifestations of the disease. PMID:2704868

García-Albea, E

1989-01-01

216

Parasites associated with exotic food  

Microsoft Academic Search

The short description of parasites associated with “exotic food” is by no means inclusive. Many others, such as Toxoplasma gondii, Spirometa spp. (sparganosis), Taenia saginata (cysticercosis), and Echinostoma malayanum, are transmitted via food. Raw sheep liver “sowda” is commonly consumed in Lebanon. Many people developed human toxocariasis after eating this dish (19). The economic loss associated with food-borne parasitic zoonoses

Susan M. Novak

1996-01-01

217

[Ocular cysticercosis, typical forms and treatment].  

PubMed

We report two personal cases of intra ocular cysticercosis typical by their sub retinal and intra vitreous localization. After a short review of epidemiology and biological diagnostic we propose a treatment which associates a medical part with Praziquantel, killing the larva and a surgical part with pars plana vitrectomy allowing the control of the inflammation, contemporary of the larva's death and the intra-vitreous cysticercosis extraction. PMID:2263392

Berche, M; Hayot, B; Mokrane, M; Najjar, G; Bouzas, E

218

The ladybird Thalassa saginata , an obligatory myrmecophile of Dolichoderus bidens ant colonies  

Microsoft Academic Search

The larvae and pupae of the ladybird Thalassa saginata develop inside colonies of the dolichoderine ant Dolichoderus bidens. This association is the first specific and obligatory relationship recorded between ants and ladybirds. The ants provide shelter and protection to the larvae but the diet of the latter remains unclear. The integration of T. saginata larvae into the ant colonies is

Jérôme Orivel; Pablo Servigne; Philippe Cerdan; Alain Dejean; Bruno Corbara

2004-01-01

219

Porcine Cysticercosis in Southeast Uganda: Seroprevalence in Kamuli and Kaliro Districts  

PubMed Central

The recent recognition of neurocysticercosis as a major cause of epilepsy in Uganda and changes in pig demography have lead to a need to better understand the basic epidemiology of Taenia solium infections in pigs and humans. Human exposure is a function of the size of the animal reservoir of this zoonosis. This is the first field survey for porcine cysticercosis to investigate the prevalence of antigen-positive pigs across an entire rural district of south-east Uganda. In our field surveys, 8.6% of 480 pigs screened were seropositive for the parasite by B158/B60 Ag-ELISA. In addition, of the 528 homesteads surveyed 138 (26%) did not have pit latrines indicating a high probability of pigs having access to human faeces and thus T. solium eggs. This study thus indicates the need for better data on this neglected zoonotic disease in Uganda, with a particular emphasis on the risk factors for infection in both pigs and humans. In this regard, further surveys of pigs, seroprevalence surveys in humans and an understanding of cysticercosis-related epilepsy are required, together with risk-factor studies for human and porcine infections.

Waiswa, C.; Fevre, E. M.; Nsadha, Z.; Sikasunge, C. S.; Willingham, A. L.

2009-01-01

220

[Evaluation of epidemiological situation of cestode infections in Poland in the years 1997-2006 on the basis of data from san-epid stations].  

PubMed

Between 1997-2006, 3,523 intestinal cestode infections were registered in Poland. Among them 2,748 were caused by Taenia saginata, 41 by T. solium, 533 by Taenia species, 20 by Hymenolepis nana, 5 by Hymenolepis diminuta, 11 by Diphyllobothrium latum, 3 by Dipylidium caninum. Moreover, 350 cases of cystic echinococcosis and 8 cases of cysticercosis were also registered. The obtained results confirmed decreasing frequency of intestinal cestodoses in Poland. PMID:21473070

Waloch, Maria; Sobolewska, Alicja; Dzbe?ski, Tadeusz H

2010-01-01

221

Risk Factors of Porcine Cysticercosis in the Eastern Cape Province, South Africa  

PubMed Central

There is a high prevalence of Taenia solium taeniosis/cysticercosis in humans and pigs in the Eastern Cape Province (ECP) of South Africa. The objective of this study was to identify risk factors of porcine cysticercosis in select districts of the ECP. Data were collected in 2003 by interviewing 217 pig producers from the area. Blood samples were collected from 261 of their pigs, which were tested using two enzyme-linked immunosorbent assays (ELISA) for the presence of antibodies to cysticercosis. Frequencies of both owner- and pig-level characteristics were determined. For pig-level analysis, all bivariable and multivariable associations were determined using the surveylogistic procedure of the SAS/STAT® software to accommodate for the intraclass correlation that exists for clusters of pigs within one owner and for clusters of owners within a district. All tests for significance were performed at the ??=?0.05 level, and adjusted odds ratios (aOR) and 95% confidence intervals (CI) were determined. Among the respondents, 48% of their households lacked a latrine, 98% slaughtered pigs at home, and 99% indicated that meat inspection services were not available. On bivariable analysis, there was a significant association between porcine infection and district (p?=?0.003), breed (p?=?0.041) and the absence of a latrine (p?=?0.006). On multivariable analysis, the absence of a latrine was the only variable significantly associated with porcine infection (aOR?=?1.89; 95% CI?=?1.07, 3.35) (p?=?0.028). The increased odds of porcine infection with households lacking a latrine contributes to our understanding of the transmission of this parasite in the ECP. Determining and addressing the risk factors for T. solium infection can potentially lower the very high prevalence in humans and pigs in this endemic area.

Krecek, Rosina Claudia; Mohammed, Hamish; Michael, Lynne Margaret; Schantz, Peter Mullineaux; Ntanjana, Lulama; Morey, Liesl; Werre, Stephen Rakem; Willingham, Arve Lee

2012-01-01

222

The Hamster Model for Identification of Specific Antigens of Taenia solium Tapeworms  

PubMed Central

Humans acquire taeniasis by ingesting pork meat infected with Taenia solium cysticerci, which are the only definitive hosts of the adult stage (tapeworm) and responsible for transmitting the human and porcine cysticercosis. Hence, detection of human tapeworm carriers is a key element in the development of viable strategies to control the disease. This paper presents the identification of specific antigens using sera from hamsters infected with T. solium tapeworms analyzed by western blot assay with crude extracts (CEs) and excretion-secretion antigens (E/S Ag) obtained from T. solium cysticerci and tapeworms and extracts from other helminthes as controls. The hamster sera infected with T. solium tapeworms recognized specific bands of 72, 48, 36, and 24?kDa, in percentages of 81, 81, 90, and 88%, respectively, using the T. solium tapeworms E/S Ag. The antigens recognized by these hamster sera could be candidates to improve diagnosis of human T. solium taeniasis.

Ochoa-Sanchez, Alicia; Jimenez, Lucia; Landa, Abraham

2011-01-01

223

Short Communication: In Vitro Efficacy Testing of Praziquantel, Ivermectin, and Oxfendazole against Taenia Solium Cysts  

PubMed Central

Oxfendazole is recommended as the drug of choice for treating porcine cysticercosis. The drug does not kill brain cysts and is not registered for use in pigs. Latest its safety in the recommended dose has been questioned. The aim of this study was to investigate two alternative anthelminthics. The efficacy of praziquantel and ivermectin was compared to oxfendazole In Vitro on Taenia solium. Cysts of T. solium were isolated from infected pork and incubated in culture media together with the drugs. The degree of evagination was used as effect measurement and determined after 6 hours. Praziquantel had a half maximal effective concentration (EC50) of value 0.006 ± 0.001??g/mL. Ivermectin did not show any impact on the evagination in concentrations from 0.001 to 30??g/mL and neither did oxfendazole in concentrations from 0.001 to 50??g/mL.

Cederberg, S.; Sikasunge, C. S.; Andersson, A.; Johansen, M. V.

2012-01-01

224

A possible nuclear DNA marker to differentiate the two geographic genotypes of Taenia solium tapeworms.  

PubMed

Cysticercosis caused by infection with embryonated eggs of the pork tapeworm Taenia solium is an important cause of neurological disease worldwide. Based on the phylogenetic analysis of mitochondrial DNA, the pathogen has been divided into two geographic clades, corresponding to Afro-American and Asian genotypes. In this study the genotyping of T. solium was carried out by using the nuclear DNA sequences of the immunodiagnostic antigen genes Ag1V1 and Ag2. The two geographic genotypes were supported by the Ag2 sequences, especially showing unique substitutions in each of the genotypes. It seems likely that the Ag2 may be a novel nuclear DNA marker to distinguish the two geographic genotypes of T. solium. PMID:21109020

Sato, Marcello Otake; Sako, Yasuhito; Nakao, Minoru; Wandra, Toni; Nakaya, Kazuhiro; Yanagida, Tetsuya; Ito, Akira

2010-11-23

225

A rare presentation of intracranial cysticercosis involving the cerebellopontine angle.  

PubMed

Intracranial cysticercosis involving the cerebellopontine angle (CPA) is rare. Here we report a patient with intracranial cysticercosis in the left CPA; the initial diagnosis of the lesion was epidermoid cyst or cystic glioma. The patient subsequently underwent total lesion removal through a left suboccipital approach; however, postoperative histopathological examination showed the tumor to be an intracranial cysticercosis. The patient's symptoms improved dramatically after microsurgery and praziquantel administration. Rare infection caused by cysticercosis involving the CPA should be highlighted in the differential diagnosis of intracranial space-occupying lesions. PMID:23477872

Song, Laijun; Guo, Fuyou; Ma, Siqi; Song, Zhenyu; Wu, Lixin; Sun, Hongwei

2013-03-07

226

Solitary thoracic vertebral body cysticercosis presenting with progressive compressive myelopathy.  

PubMed

Common bony spinal pathologies that could present with progressive spasticity include vertebral body tumors or chronic infections of the spine. Cysticercosis of the spine commonly has an intramedullary occurrence. The authors discuss the presentation and management of a rare case of solitary vertebral cysticercosis that presented with lower-limb spasticity and sphincter involvement. PMID:23414003

Furtado, Sunil V; Dadlani, Ravi; Ghosal, Nandita; Rao, Arun S

2013-02-15

227

Characterization of the 8-Kilodalton Antigens of Taenia solium Metacestodes and Evaluation of Their Use in an Enzyme-Linked Immunosorbent Assay for Serodiagnosis  

PubMed Central

The Western blot for cysticercosis, which uses lentil lectin purified glycoprotein (LLGP) antigens extracted from the metacestode of Taenia solium, has been the “gold standard” serodiagnostic assay since it was first described in 1989. We report that the diagnostic antigens at 14, 18, and 21 kDa, as well as some larger disulfide-bonded antigens, are actually all members of a very closely related family of proteins, the 8-kDa antigens. The genes for 18 unique, mature proteins have been identified. Nine of these were chemically synthesized and tested in an enzyme-linked immunosorbent assay with a battery of defined serum samples, including 32 cysticercosis-positive serum samples reactive with the 8-kDa antigens of LLGP on Western blotting, 34 serum samples from patients with other parasitic infections, and 15 normal human serum samples. One of the 8-kDa antigens, TsRS1, is 100% sensitive and 100% specific. TsRS1 will be one component of a cocktail of three to four synthetic or recombinant antigens, based on the diagnostic bands of the Western blot, which will be used for the serodiagnosis of cysticercosis.

Hancock, Kathy; Khan, Azra; Williams, Fatima B.; Yushak, Melinda L.; Pattabhi, Sowmya; Noh, John; Tsang, Victor C. W.

2003-01-01

228

Use of expressed sequence tags as an alternative approach for the identification of Taenia solium metacestode excretion/secretion proteins  

PubMed Central

Background Taenia solium taeniasis/cysticercosis is a zoonotic helminth infection mainly found in rural regions of Africa, Asia and Latin America. In endemic areas, diagnosis of cysticercosis largely depends on serology, but these methods have their drawbacks and require improvement. This implies better knowledge of the proteins secreted and excreted by the parasite. In a previous study, we used a custom protein database containing protein sequences from related helminths to identify T. solium metacestode excretion/secretion proteins. An alternative or complementary approach would be to use expressed sequence tags combined with BLAST and protein mapping to supercontigs of Echinococcus granulosus, a closely related cestode. In this study, we evaluate this approach and compare the results to those obtained in the previous study. Findings We report 297 proteins organized in 106 protein groups based on homology. Additional classification was done using Gene Ontology information on biological process and molecular function. Of the 106 protein groups, 58 groups were newly identified, while 48 groups confirmed previous findings. Blast2GO analysis revealed that the majority of the proteins were involved in catalytic activities and binding. Conclusions In this study, we used translated expressed sequence tags combined with BLAST and mapping strategies to both confirm and complement previous research. Our findings are comparable to recent studies on other helminth genera like Echinococcus, Schistosoma and Clonorchis, indicating similarities between helminth excretion/secretion proteomes.

2013-01-01

229

Development and evaluation of flow through assay for detection of antibodies against porcine cysticercosis.  

PubMed

A flow through assay (FTA) was developed on cellulose acetate membrane for the serodiagnosis of porcine cysticercosis using cyst fluid (CFA) and whole cyst antigens (WCA) of Taenia solium metacestode. The assay consisted of antigen of T. solium metacestode coated onto membrane, mounted on a flow-through test device to provide assay capture matrix. The optimum concentration of coating antigen was 250 ng. The protein A colloidal gold conjugate served as antigen-antibody detecting reagent. A total of 225 serum samples were tested using two antigens. Results were better with CFA (96.0% sensitivity; 96.0% specificity) compared to WCA (92.0% sensitivity; 96.0% specificity). The test was also compared with enzyme-linked immunosorbent assay. The ELISA showed 96 per cent sensitivity with both the antigens whereas; the specificity was 96 and 92 per cent with CFA and WCA respectively. The sensitivity and specificity of flow through assay agrees closely with those of the ELISA. The cross-reaction was observed in one out of eight hydatidosis positive pigs (12.5%) with CFA by both the assays. The highest diagnostic accuracy (96%) was obtained with CFA-FTA and CFA-ELISA. For its high sensitivity and sporadic cross-reactions, CFA-FTA appears to be suitable for practical use at field level without instrumentation. PMID:21602782

Sreedevi, C; Hafeez, Md; Subramanyam, K V; Anand Kumar, P; Chengalva Rayulu, V

2011-04-01

230

Successful immunization of naturally reared pigs against porcine cysticercosis with a recombinant oncosphere antigen vaccine  

PubMed Central

Taenia solium causes cysticercosis in pigs and taeniasis and neurocysticercosis in humans. Oncosphere antigens have proven to be effective as vaccines to protect pigs against an experimental infection with T. solium. A pair-matched vaccination trial field, using a combination of two recombinant antigens, TSOL16 and TSOL18, was undertaken in rural villages of Peru to evaluate the efficacy of this vaccine under natural conditions. Pairs of pigs (n = 137) comprising one vaccinated and one control animal, were allocated to local villagers. Animals received two vaccinations with 200 ?g of each of TSOL16 and TSOL18, plus 5 mg Quil-A. Necropsies were performed 7 months after the animals were distributed to the farmers. Vaccination reduced 99.7% and 99.9% (p < 0.01) the total number of cysts and the number of viable cysts, respectively. Immunization with the TSOL16–TSOL18 vaccines has the potential to control T. solium transmission in areas where the disease is endemic, reducing the source for tapeworm infections in humans.

Jayashi, Cesar M.; Kyngdon, Craig T.; Gauci, Charles G.; Gonzalez, Armando E.; Lightowlers, Marshall W.

2012-01-01

231

Echinococcosis and cysticercosis in Asia: evaluation of the modern technology for epidemiological study.  

PubMed

The recent emergence of zoonotic parasitic diseases of public health importance represents a growing global concern. Among zoonotic helminthic diseases, both echinococcosis and cysticercosis are the most serious diseases threatening human life. Neurocysticercosis (NCC) caused by ingestion of eggs of the pork tapeworm, Taenia solium, is spreading worldwide and not rare even in Muslim or Jewish communities. Alveolar echinococcosis (AE) caused by the proliferation of metacestodes of the fox tapeworm, Echinococcus multilocularis, is the most potentially lethal parasitic infection of the non-tropical northern hemisphere, whereas cystic echinococcosis (CE) caused by the proliferation of metacestodes of the dog tapeworm, E. granulosus, has rather a cosmopolitan distribution. As the life cycles of T. solium, E. multilocularis and E. granulosus are completed through predator-prey interactions, including humans, it is crucial to interrupt the cycle for control of these zoonotic cestodiases. Both NCC and CE are expected to be eradicable, since the principal life cycles of T. solium and E. granulosus are maintained between humans and pigs and between dogs and herbivorous domestic animals, respectively. In contrast, AE is perhaps not eradicable, since the life cycle of E. multilocularis is maintained between wild foxes and rodents. Modern technologies, including imaging, immunology and molecular biology, have been applied for epidemiological surveys. In the present review, we introduce such technologies applied in Japan, China and Indonesia, and point out the problems that need to be solved for control of these three zoonotic cestodiases. PMID:19238666

Ito, Akira; Yamasaki, Hiroshi; Nakao, Minoru; Sako, Yasuhito; Nakaya, Kazuhiro; Mamuti, Wulamu; Xiao, Ning; Sato, Marcello O; Ishikawa, Yuji

2003-01-01

232

A Histopathological Study On Human Cysticercosis.  

PubMed

A study was made on 258 cases of cysticercosis, that were examined and diagnosed at the Department of Pathology, College of Medicine, Seoul National University during a period of 9 years from 1968 to 1976 inclusive. There were a total of 35,363 surgical specimens examined during the same period, thus revealing the relative frequency ratio of cysticercosis among surgical accessions to be 0.73%. The common sites of involvement of cysticercosis were skeletal muscle, subcutaneous tissue, breast, brain and eye in decreasing order of frequency. Painless palpable nodules were the most common initial presentation clinically. Histopathological staging was attempted based on the host tissue reaction and worm morphology. It was arbitrarily classified into early, intermediate and late stages. In general the morphology of the parasite consisted of a well preserved and compact calcospherules with intact subcuticular muscle layer in the early stage, showing a progressive deterioration of parasitic structures, finally undergoing resorptive process or mummification. The host tissue reation in the early stage was characterized by a diffuse epithelioid cell proliferation with lymphocytic and eosinophilic infiltration without capsule formation. The intermediate stage consisted of a diffuse histiocytic proliferation with well formed outer collagen capsule. The latestage revealed mostly thinned out, well collagenized capsule with scanty lymphocytic infiltration. The parasite in the well formed cyst as usually distorted and often mummified. But the hooklets were relatively preserved up to the late stage. These finding suggest that the host tissue reacts to the cysticercus worm in fairly uniform fashion, and this fashion appears to have a sequence, i.e., violent lymphohistiocytic response in the initial phase of infection, and undergoing a gradual fibrotic (encapsulating) self-limiting course, finally being stabilized by a dense, acelluar collagen capsule or collapse and absorption. PMID:12902773

Chi, Hyun Sook; Chi, Je Geun

1978-12-01

233

Immunodiagnostic tools for human and porcine cysticercosis  

Microsoft Academic Search

Abstract The development,of improved immunodiagnostic,tools has contributed,to our knowledge,on the importance,of taeniosis\\/cysticercosis by,enabling,sero-epidemiological surveys and,community-based,studies to be carried out. Immunodiagnostic,techniques include detection methods,for specific antibodies and,for circulating parasite antigen in serum,or cerebrospinal,fluid. The antigens used in immunoblot,and,enzyme-linked immunosorbent,assay (ELISA) for antibody,detection hav ee volved from,crude extracts to highly purified specific fractions and recombinant,antigens of the glycoprotein family, increasing both the

Pierre Dorny; Jef Brandt; Andre Zoli; Stanny Geerts

2003-01-01

234

Mechanisms of hydrocephalus in cerebral cysticercosis: implications for therapy  

SciTech Connect

Patients with hydrocephalus secondary to cerebral cysticercosis are a highly heterogeneous group. The mechanisms of hydrocephalus in these patients are multiple. Intraventricular cysts may be found in the 3rd and 4th ventricles, the sylvian aqueduct, and the foramen of Monro. Intraventricular cysts can be suspected when the 3rd and 4th ventricles or aqueduct remain enlarged despite shunting. Intraventricular contrast medium demonstrates the presence of the parasites. The intraventricular cysts should be removed surgically. Hydrocephalus due to cisternal cysticercosis can be diagnosed by isotope cisternography. These patients should receive shunts, but the long term prognosis is probably poor. Guidelines for the management of hydrocephalus due to cysticercosis are suggested.

Estanol, B.; Kleriga, E.; Loyo, M.; Mateos, H.; Lombardo, L.; Gordon, F.; Saguchi, A.F.

1983-08-01

235

Macrophage migration inhibitory factor plays a critical role in mediating protection against the helminth parasite Taenia crassiceps.  

PubMed

To determine the role of endogenous migration inhibitory factor (MIF) in regulation of immune response during murine cysticercosis caused by the helminth parasite Taenia crassiceps, we analyzed the course of T. crassiceps infection in MIF(-/-) BALB/c mice. MIF(-/-) mice were highly susceptible to T. crassiceps and developed significantly higher parasite loads compared to similarly infected MIF(+/+) mice. Throughout the course of infection, Taenia crassiceps soluble antigen-stimulated spleen cells from both MIF(+/+) and MIF(-/-) mice produced significant and comparable levels of interleukin-4 (IL-4), but those from MIF(-/-) mice produced significantly more IL-13, as well as gamma interferon (IFN-gamma), suggesting that the susceptibility of MIF(-/-) mice to T. crassiceps was not due to the lack of IFN-gamma production. Interestingly, low levels of both total and specific immunoglobulin G2a were observed in MIF(-/-) cysticercotic mice despite the high IFN-gamma levels; in addition, peritoneal macrophages obtained from T. crassiceps-infected MIF(-/-) mice at different time points failed to respond efficiently to stimulation in vitro with lipopolysaccharide plus IFN-gamma and produced significantly lower levels of IL-12, tumor necrosis factor alpha, and NO compared to those from MIF(+/+) mice. These findings demonstrate that MIF plays a critical role in mediating protection against T. crassiceps in vivo. Moreover, these findings also suggest that impaired macrophage function rather than the lack of Th1 development may be responsible for mediating susceptibility to T. crassiceps. PMID:12595439

Rodríguez-Sosa, Miriam; Rosas, Lucia E; David, John R; Bojalil, Rafael; Satoskar, Abhay R; Terrazas, Luis I

2003-03-01

236

Transmission dynamics of Echinococcus granulosus, Taenia hydatigena and Taenia ovis in sheep in uruguay  

Microsoft Academic Search

A base-line survey was carried out on the transmission dynamics of Echinococcus granulosus, Taenia hydatigena and Taenia ovis in sheep in the Department of Florida, Uruguay. Mean life expectancy at birth of the sheep population in this Department was estimated at 3.5 and 4.8 years for male and female sheep, respectively. Both intensity and prevalence of E. granulosus infection increased

P. A. Cabrera; G. Haran; U. Benavidez; S. Valledor; G. Perera; S. Lloyd; M. A. Gemmell; M. Baraibar; A. Morana; J. Maissonave; M. Carballo

1995-01-01

237

Multifocal Cysticercosis with Optical Coherence Tomography Findings in a Child  

PubMed Central

We herein report a case with multifocal cysticercosis – sub-conjunctival cysticercus cyst, sub-retinal cysticercosis, and neurocysticercosis in a child. The optical coherence tomography (OCT) findings of the sub-retinal cysticercus cyst are reported. He was treated with anti-helminthic drugs and oral prednisolone followed by surgical removal of the sub-retinal cyst. He subsequently underwent silicone oil removal with lens aspiration and intraocular lens implantation maintaining stable vision

Agarwal, Manisha; Jha, Vivek; Chaudhary, Somendra P.; Singh, Ashok K.

2012-01-01

238

Relationship between Serum Antibodies and Taenia solium Larvae Burden in Pigs Raised in Field Conditions  

PubMed Central

Background Serological tests have been used for the diagnosis of Taenia solium infection in pigs. However, those serological results do not necessarily correlate with the actual infection burden after performing pig necropsy. This study aimed to evaluate the Electro Immuno Transfer Blot (EITB) seropositivity with infection burden in naturally infected pigs. Methodology/Principal Findings In an endemic area of Peru, 476 pigs were sampled. Seroprevalence was 60.5±4.5% with a statistically higher proportion of positive older pigs (>8 months) than young pigs. The logistic model showed that pigs >8 month of age were 2.5 times more likely to be EITB-positive than ?8 months. A subset of 84 seropositive pigs were necropsied, with 45.2% (38/84) positive to 1–2 bands, 46.4% (39/84) to 3 bands, and 8.3% (7/84) to 4+ bands. 41 out of 84 positive pigs were negative to necropsy (48.8%) and 43 (51%) had one or more cysts (positive predictive value). Older pigs showed more moderate and heavy infection burdens compared to younger pigs. In general, regardless of the age of the pig, the probability of having more cysts (parasite burden) increases proportionally with the number of EITB bands. Conclusions/Significance The probability of being necropsy-positive increased with the number of bands, and age. Therefore, the EITB is a measure of exposure rather than a test to determine the real prevalence of cysticercosis infection.

Gavidia, Cesar M.; Verastegui, Manuela R.; Garcia, Hector H.; Lopez-Urbina, Teresa; Tsang, Victor C. W.; Pan, William; Gilman, Robert H.; Gonzalez, Armando E.

2013-01-01

239

Vaccine development against the Taenia solium parasite: The role of recombinant protein expression in Escherichia coli.  

PubMed

Taenia solium is a zoonotic parasite that causes cysticercosis. The parasite is a major cause of human disease in impoverished communities where it is transmitted to humans from pigs which act as intermediate hosts. Vaccination of pigs to prevent transmission of T. solium to humans is an approach that has been investigated to control the disease. A recombinant vaccine antigen, TSOL18, has been remarkably successful at reducing infection of pigs with T. solium in several experimental challenge trials. The vaccine has been shown to eliminate transmission of naturally acquired T. solium in a field trial conducted in Africa. We recently reported that the vaccine was also effective in a field trial conducted in Peru. The TSOL18 recombinant antigen for each of these trials has been produced by expression in Escherichia coli. Here we discuss research that has been undertaken on the TSOL18 antigen and related antigens with a focus on improved methods of preparation of recombinant TSOL18 and optimized expression in Escherichia coli. PMID:23196744

Gauci, Charles; Jayashi, César; Lightowlers, Marshall W

2012-11-29

240

Transcriptome analysis of Taenia solium cysticerci using Open Reading Frame ESTs (ORESTES)  

PubMed Central

Background Human infection by the pork tapeworm Taenia solium affects more than 50 million people worldwide, particularly in underdeveloped and developing countries. Cysticercosis which arises from larval encystation can be life threatening and difficult to treat. Here, we investigate for the first time the transcriptome of the clinically relevant cysticerci larval form. Results Using Expressed Sequence Tags (ESTs) produced by the ORESTES method, a total of 1,520 high quality ESTs were generated from 20 ORESTES cDNA mini-libraries and its analysis revealed fragments of genes with promising applications including 51 ESTs matching antigens previously described in other species, as well as 113 sequences representing proteins with potential extracellular localization, with obvious applications for immune-diagnosis or vaccine development. Conclusion The set of sequences described here will contribute to deciphering the expression profile of this important parasite and will be informative for the genome assembly and annotation, as well as for studies of intra- and inter-specific sequence variability. Genes of interest for developing new diagnostic and therapeutic tools are described and discussed.

Almeida, Carolina R; Stoco, Patricia H; Wagner, Glauber; Sincero, Thais CM; Rotava, Gianinna; Bayer-Santos, Ethel; Rodrigues, Juliana B; Sperandio, Maisa M; Maia, Antonio AM; Ojopi, Elida PB; Zaha, Arnaldo; Ferreira, Henrique B; Tyler, Kevin M; Davila, Alberto MR; Grisard, Edmundo C; Dias-Neto, Emmanuel

2009-01-01

241

A review of taeniasis and cysticercosis in the Lao People's Democratic Republic  

Microsoft Academic Search

Taeniasis and cysticercosis are important but underreported parasitic zoonoses in the Lao People's Democratic Republic (Lao PDR). Reports of human and pig cysticercosis are rather limited and based largely on anecdotal evidence. To date, no structured surveys of disease prevalence or incidence have been reported. However, one unpublished pilot survey of pig cysticercosis in a slaughterhouse in northern Laos estimated

James Conlan; Syseng Khounsy; Phouth Inthavong; Stanley Fenwick; Stuart Blacksell; R. C. Andrew Thompson

2008-01-01

242

Recent advances in serodiagnosis for cysticercosis.  

PubMed

Neurocysticercosis (NCC) caused by infection with the larval stage of Taenia solium is an important cause of neurological disease worldwide. Up to the present, many studies on characterizing species-specific antigens of T. solium have been done and several high quality antigens for serodiagnosis are available. Hence the research on serodiagnosis has been shifted to the next phase, stable production of diagnostic antigens using molecular techniques. In order to establish an enzyme-linked immunosorbent assay (ELISA) using recombinant proteins, we carried out molecular cloning and identified four diagnostic antigen candidates (Ag1, Ag1V1, Ag2, and Ag2V1). Recombinant proteins, except Ag2V1, were successfully expressed using an Escherichia coli expression system. Immunoblot analysis using NCC patient sera detected recombinant proteins. But as reactivity to rAg1 was too weak, Ag1 was not suitable for the immunodiagnosis antigen. Therefore Ag1V1 and Ag2 were chosen for ELISA antigens and Ag1V1/Ag2 chimeric protein was expressed. Of 49 serum samples from NCC patients confirmed to be seropositive by immunoblot analysis, 44 (89.7%) were positive by ELISA. Serum samples from patients with other parasitic infections did not recognized Ag1V1/Ag2 chimeric protein. Ag1V1/Ag2 chimeric protein obtained in this study is of value for differential immunodiagnosis. PMID:12041613

Sako, Y; Ito, A

2001-01-01

243

Language Deficits in a Bilingual Child with Cerebral Cysticercosis.  

ERIC Educational Resources Information Center

|Presents a case report of cysticercosis (a parasitic infestation which results in inflammation of the brain, eye, muscles, liver, and lung tissues) and the resulting language pathology in a nine-year-old Mexican American girl who is bilingual in Spanish and English. (SED)|

McMenamin, Jerry

1984-01-01

244

Veterinary Public Health activities at FAO Cysticercosis, Echinococcosis and Trichinellosis  

Microsoft Academic Search

In many developing and transition countries, parasitic zoonoses such as cysticercosis, echinococcosis and trichinellosis, cause serious human suffering and considerable losses in livestock and human productivity, thus posing a significant hindrance to economic development. Although, effective and reliable tools for the diagnosis, prevention and control of parasitic zoonoses are now available, their implementation has not always been successful in many

C. Eddi; J. Lubroth; W. Amanfu; J Domenech

245

Veterinary public health activities at FAO: Cysticercosis and echinococcosis  

Microsoft Academic Search

In many developing and transition countries, parasitic zoonoses such as cysticercosis and echinococcosis cause serious human suffering and considerable losses in agricultural and human productivity, thus posing a significant hindrance to their development. Although, effective and reliable tools for the diagnosis, prevention and control of parasitic zoonoses are now available, their implementation has not always been successful in many countries.

Carlos Eddi; de Balogh Katalin; Lubroth Juan; Amanfu William; Speedy Andrew; Battaglia Daniela; Domenech Joseph

2006-01-01

246

Soft tissue cysticercosis - Ultrasonographic spectrum of the disease.  

PubMed

This case series emphasizes the role of USG in the diagnosis of isolated soft tissue cysticercosis. We assessed its value for identifying features such as the location of the cyst, the presence or absence of abscess, and the presence or absence of a scolex within the cyst. Three USG patterns were seen and are described. PMID:21431036

Naik, Deepti; Srinath, Mg; Kumar, Ashok

2011-01-01

247

Porcine Cysticercosis and Risk Factors in The Gambia and Senegal  

PubMed Central

During a stratified cross-sectional survey, 1705 pigs were sampled from 279 randomly selected households, 63 randomly selected communities and villages, from four study areas in The Gambia and Senegal during the period October 2007 to January 2008. Porcine cysticercosis prevalence detected by tongue inspection at animal level per study area ranged from 0.1% to 1.0%. Using an antigen-detection ELISA the seroprevalence of cysticercosis at both community/village and animal levels for the four selected study areas is: Western region 80.0% (95%CI: 52.4%–93.6%) and 4.8% (95%CI: 3.4%–6.5%), Bignona 86.7% (95%CI: 59.8%–96.6%) and 8.9% (95%CI: 5.0%–15.5%), Kolda 82.4% (95%CI: 46.8%–96.1%) and 13.2% (95%CI: 10.8%–16.0%), and Ziguinchor 81.3% (95%CI: 43.5%–96.1%) and 6.4% (95%CI: 4.0%–10.1%), respectively. No risk factors for cysticercosis were found significant in this study. This study proved that porcine cysticercosis is endemic and distributed widely in the study areas though its incidence might be suppressed by the generalised use of toilets and latrines in the study areas.

Secka, Arss; Marcotty, Tanguy; De Deken, Redgi; Van Marck, Eric; Geerts, Stanny

2010-01-01

248

Isolation of Diagnostic Glycoproteins to Taenia Solium, Immunoblot-Assay and Method for the Detection of Human Cysticercosis.  

National Technical Information Service (NTIS)

The present invention is directed to a method for diagnosing active human neurocysticercosis utilizing an immunoblot assay which comprises: detecting the presence of antibodies in the serum or cerebrospinal fluid of a human to be diagnosed, wherein said a...

V. C. W. Tsang J. A. Brand A. E. Boyer M. Wilson P. M. Schantz

1988-01-01

249

The highly antigenic 53/25 kDa Taenia solium protein fraction with cathepsin-L like activity is present in the oncosphere/cysticercus and induces non-protective IgG antibodies in pigs  

PubMed Central

Cathepsin L-like proteases are secreted by several parasites including Taenia solium. The mechanism used by T. solium oncospheres to degrade and penetrate the intestine and infect the host is incompletely understood. It is assumed that intestinal degradation is driven by the proteolytic activity of enzymes secreted by the oncosphere. Blocking the proteolytic activity by an antibody response would prevent the oncosphere penetration and further infection. Serine and cysteine proteases including chymotrypsin, trypsin, elastase, and cathepsin L, are secreted by T. solium and Taenia saginata oncospheres when cultured in vitro, being potential vaccine candidates. However, the purification of a sufficient quantity of proteases secreted by oncospheres to conduct a vaccine trial is costly and lengthy. A 53/25 kDa cathepsin L-like fraction partially purified from T. solium cyst fluid was described previously as an important antigen for immunodiagnostics. In this study we found that this antigen is present in the T. solium oncosphere and is also secreted by the cysticercus. This protein fraction was tested for its ability to protect pigs against an oral challenge with T. solium oncospheres in a vaccine trial. IgG antibodies against the 53/25 kDa cathepsin L-like protein fraction were elicited in the vaccinated animals but did not confer protection.

Zimic, Mirko; Pajuelo, Monica; Gilman, Robert H.; Gutierrez, Andres H.; Rueda, Luis D.; Flores, Myra; Chile, Nancy; Verastegui, Manuela; Gonzalez, Armando; Garcia, Hector H.; Sheen, Patricia

2011-01-01

250

Detection of Taenia solium taeniasis coproantigen is an early indicator of treatment failure for taeniasis.  

PubMed

Taenia solium causes taeniasis and cysticercosis, a zoonotic complex associated with a significant burden of epilepsy in most countries. Reliable diagnosis and efficacious treatment of taeniasis are needed for disease control. Currently, cure can be confirmed only after a period of at least 1 month, by negative stool microscopy. This study assessed the performance of detection by a coproantigen enzyme-linked immunosorbent assay (CoAg-ELISA) for the early evaluation of the efficacy of antiparasitic treatment of human T. solium taeniasis. We followed 69 tapeworm carriers who received niclosamide as standard treatment. Stool samples were collected on days 1, 3, 7, 15, 30, and 90 after treatment and were processed by microscopy and CoAg-ELISA. The efficacy of niclosamide was 77.9% (53/68). Thirteen patients received a second course of treatment and completed the follow-up. CoAg-ELISA was therefore evaluated for a total of 81 cases (68 treatments, 13 retreatments). In successful treatments (n = 64), the proportion of patients who became negative by CoAg-ELISA was 62.5% after 3 days, 89.1% after 7 days, 96.9% after 15 days, and 100% after 30 days. In treatment failures (n = 17), the CoAg-ELISA result was positive for 70.6% of patients after 3 days, 94.1% after 7 days, and 100% after 15 and 30 days. Only 2 of 17 samples in cases of treatment failure became positive by microscopy by day 30. The presence of one scolex, but not multiple scolices, in posttreatment stools was strongly associated with cure (odds ratio [OR], 52.5; P < 0.001). CoAg-ELISA is useful for the assessment of treatment failure in taeniasis. Early assessment at day 15 would detect treatment failure before patients become infective. PMID:22336287

Bustos, Javier A; Rodriguez, Silvia; Jimenez, Juan A; Moyano, Luz M; Castillo, Yesenia; Ayvar, Viterbo; Allan, James C; Craig, Philip S; Gonzalez, Armando E; Gilman, Robert H; Tsang, Victor C W; Garcia, Hector H

2012-02-15

251

Detection of Taenia solium Taeniasis Coproantigen Is an Early Indicator of Treatment Failure for Taeniasis  

PubMed Central

Taenia solium causes taeniasis and cysticercosis, a zoonotic complex associated with a significant burden of epilepsy in most countries. Reliable diagnosis and efficacious treatment of taeniasis are needed for disease control. Currently, cure can be confirmed only after a period of at least 1 month, by negative stool microscopy. This study assessed the performance of detection by a coproantigen enzyme-linked immunosorbent assay (CoAg-ELISA) for the early evaluation of the efficacy of antiparasitic treatment of human T. solium taeniasis. We followed 69 tapeworm carriers who received niclosamide as standard treatment. Stool samples were collected on days 1, 3, 7, 15, 30, and 90 after treatment and were processed by microscopy and CoAg-ELISA. The efficacy of niclosamide was 77.9% (53/68). Thirteen patients received a second course of treatment and completed the follow-up. CoAg-ELISA was therefore evaluated for a total of 81 cases (68 treatments, 13 retreatments). In successful treatments (n = 64), the proportion of patients who became negative by CoAg-ELISA was 62.5% after 3 days, 89.1% after 7 days, 96.9% after 15 days, and 100% after 30 days. In treatment failures (n = 17), the CoAg-ELISA result was positive for 70.6% of patients after 3 days, 94.1% after 7 days, and 100% after 15 and 30 days. Only 2 of 17 samples in cases of treatment failure became positive by microscopy by day 30. The presence of one scolex, but not multiple scolices, in posttreatment stools was strongly associated with cure (odds ratio [OR], 52.5; P < 0.001). CoAg-ELISA is useful for the assessment of treatment failure in taeniasis. Early assessment at day 15 would detect treatment failure before patients become infective.

Bustos, Javier A.; Rodriguez, Silvia; Jimenez, Juan A.; Moyano, Luz M.; Castillo, Yesenia; Ayvar, Viterbo; Allan, James C.; Craig, Philip S.; Gonzalez, Armando E.; Gilman, Robert H.; Tsang, Victor C. W.

2012-01-01

252

Specificity of a coproantigen ELISA test for fasciolosis: lack of cross-reactivity with Paramphistomum cervi and Taenia hydatigena.  

PubMed

A commercial coproantigen ELISA test for fasciolosis, based on the use of MM3 monoclonal antibody for antigen capture, was investigated for possible cross-reactivity with Paramphistomum cervi, a trematode that commonly infects cattle and sheep grazing in fluke-infested pasture in Ireland. Histological sections of adult and immature Fasciola hepatica and P cervi were incubated with MM3 monoclonal antibody, and its binding to tissue-localised coproantigen was subsequently visualised by immunocytochemistry. In a related study, the soluble antigenic fractions derived from homogenates of P cervi adults and Taenia hydatigena metacestodes were tested for cross-reactivity with MM3 monoclonal antibody in an antigen-capture ELISA, using known F hepatica-positive and F hepatica-negative ovine faecal samples as natural controls. It was found that, while intense immunocytochemical labelling was located over the gastrodermis and gut contents of adult and immature F hepatica, sections of adult and immature P cervi were unlabelled. In the ELISA tests, the soluble fractions of F hepatica reacted strongly with MM3 monoclonal antibody, but those of P cervi and T hydatigena gave negative results. These findings support the specificity of the coproantigen ELISA test for fasciolosis in areas where paramphistomosis and cysticercosis are liable to occur singly or as coinfections with F hepatica. PMID:23077134

Kajugu, P-E; Hanna, R E B; Edgar, H W; Forster, F I; Malone, F E; Brennan, G P; Fairweather, I

2012-10-17

253

Ultrastructure of the spermatozoon of Taeniarhynchus saginatus (syn. Taenia saginata) (Goeze, 1782) Weinland, 1858 (Cestoda, Taeniidae) an intestinal parasite of human.  

PubMed

The mature Taeniarhynchus saginatus spermatozoon exhibits an apical cone of electron-dense material and one helicoidal crest-like body roughly 50 nm thick. The axoneme is of the 9 +?"1" Trepaxonemata pattern. It is surrounded by a periaxonemal sheath of electron-dense material. The cytoplasm is electron lucent and divided into compartments by intracytoplasmic walls of electron-dense material in regions III and IV. The nucleus is an electron-dense cord 60-90 nm thick coiled in a spiral around the axoneme. It reaches the posterior extremity of the gamete where the axoneme is disorganized and is accompanied on all its posterior length by the nucleus. To our knowledge, such a posterior extremity has never been described before in a cyclophyllidean cestode. PMID:20981444

Bâ, Aïssatou; Bâ, Cheikh Tidiane; Quilichini, Yann; Dieng, Thérèse; Marchand, Bernard

2010-10-28

254

Solitary cysticercosis of the biceps brachii in a vegetarian: a rare and unusual pseudotumor  

Microsoft Academic Search

We report a 40-year-old man with cysticercosis presenting as a solitary tumor in the biceps brachii muscle. Physical examination revealed an intramuscular mass and magnetic resonance imaging suggested a cyst. The histologic diagnosis was a cysticercus. Such solitary presentation of muscular cysticercosis is extremely rare with only a handful of sporadic reports in the literature.

Ibrahim Fikry Abdelwahab; Michael J. Klein; George Hermann; Mohammed Abdul-Quader

2003-01-01

255

Human Taeniasis in the Republic of Korea: Hidden or Gone?  

PubMed Central

History and current status of human taeniasis in the Republic of Korea, due to Taenia solium, Taenia asiatica, and Taenia saginata, are briefly reviewed. Until the 1980s, human taeniasis had been quite common in various localities of Korea. A study from 1924 reported 12.0% egg prevalence in fecal examinations. Thereafter, the prevalence of Taenia spp. ranged from 3% to 14% depending on the time and locality. Jeju-do, where pigs were reared in a conventional way, was the highest endemic area of taeniasis. An analysis of internal transcribed spacer 2 and mitochondrial cytochrome c oxidase 1 genes of 68 taeniasis cases reported from 1935 to 2005 in Korea by a research group revealed the relative occurrence of the 3 Taenia spp. as follows: T. solium (4.4%), T. asiatica (75.0%), and T. saginata (20.6%). However, national surveys on intestinal helminths conducted every 5 years on randomly selected people revealed that the Taenia egg prevalence dropped from 1.9% in 1971 to 0.02% in 1997 and finally to 0.0% in 2004. With the exception of 3 egg-positive cases reported in 2008 and 2 worm-proven cases in 2011, no more cases have been officially recorded. Based on these surveys and also on other literature, it can be concluded that taeniasis has virtually disappeared from Korea, although a few sporadic cases may remain hidden. Human cysticercosis is also expected to disappear within a couple of decades in Korea.

2013-01-01

256

Vaccination with recombinant oncosphere antigens reduces the susceptibility of sheep to infection with Taenia multiceps  

Microsoft Academic Search

Taenia multiceps is a cestode parasite, the larval stage of which encysts in the brain of sheep, goats and cattle causing an often fatal condition. The parasite also causes zoonotic infections in humans. Homologues of the recombinant oncosphere vaccine antigens from Taenia ovis and other Taenia species were identified in T. multiceps. Sequencing of the associated T. multiceps genes and

Charles Gauci; Gulay Vural; Taraneh Öncel; Antonio Varcasia; Veronica Damian; Craig T. Kyngdon; Philip S. Craig; Garry A. Anderson; Marshall W. Lightowlers

2008-01-01

257

The key steroidogenic enzyme 3beta-hydroxysteroid dehydrogenase in Taenia solium and Taenia crassiceps (WFU).  

PubMed

Larval and adult stages of Taenia solium and Taenia crassiceps WFU strain were analyzed by histochemical and biochemical methods to determine the existence of steroid pathways. The presence of the key enzyme 3beta-hydroxisteroid-dehydrogenase (3beta-HSD) was examined in frozen sections of cysticerci obtained from mice and segments of tapeworms obtained from the intestine of hamsters. 3beta-HSD activity was detected by nitroblue-tetrazolium products after incubation with dehydroepiandrosterone, androstendiol, or pregnenolone. Tapeworm tissues exhibited 3beta-HSD activity in the subtegumentary areas of the neck and immature proglottids following incubation with androstendiol, as well as surrounding the testes in mature proglottids. T. solium cysticerci exhibited 3beta-HSD activity in the subtegumentary tissues. The synthesis of steroid hormones involving the activity of 3beta-HSD was studied in cysticerci or tapeworms incubated in the presence of tritiated steroid precursors. The culture media were analyzed by thin layer chromatography and showed synthesis of androstendiol, testosterone, and 17beta-estradiol by cysticerci, androstendiol, and 17beta-estradiol by tapeworms. The results strongly suggest the activity of 3beta-HSD in taeniid parasites that have at least a part of the enzymatic chain required for androgen and estrogen synthesis and that the enzymes are present in the larval stage and from the early strobilar stages to the mature proglottids. PMID:18626663

Fernández Presas, Ana María; Valdez, Ricardo A; Willms, Kaethe; Romano, Marta C

2008-07-15

258

Immunoregulation by Taenia crassiceps and Its Antigens  

PubMed Central

Taenia crassiceps is a cestode parasite of rodents (in its larval stage) and canids (in its adult stage) that can also parasitize immunocompromised humans. We have studied the immune response elicited by this helminth and its antigens in mice and human cells, and have discovered that they have a strong capacity to induce chronic Th2-type responses that are primarily characterized by high levels of Th2 cytokines, low proliferative responses in lymphocytes, an immature and LPS-tolerogenic profile in dendritic cells, the recruitment of myeloid-derived suppressor cells and, specially, alternatively activated macrophages. We also have utilized the immunoregulatory capabilities of this helminth to successfully modulate autoimmune responses and the outcome of other infectious diseases. In the present paper, we review the work of others and ourselves with regard to the immune response induced by T. crassiceps and its antigens, and we compare the advances in our understanding of this parasitic infection model with the knowledge that has been obtained from other selected models.

Peon, Alberto N.; Espinoza-Jimenez, Arlett; Terrazas, Luis I.

2013-01-01

259

Hox genes from the tapeworm Taenia asiatica (Platyhelminthes: Cestoda).  

PubMed

Hox genes are important in forming the anterior-posterior body axis pattern in the early developmental stage of animals. The conserved nature of the genomic organization of Hox genes is well known in diverse metazoans. To understand the Hox gene architecture in human-infecting Taenia tapeworms, we conducted a genomic survey of the Hox gene using degenerative polymerase chain reaction primers in Taenia asiatica. Six Hox gene orthologs from 276 clones were identified. Comparative analysis revealed that T. asiatica has six Hox orthologs, including two lab/Hox1, two Hox3, one Dfd/Hox4, and one Lox2/Lox4. The results suggest that Taenia Hox genes may have undergone independent gene duplication in two Hox paralogs. The failure to detect Post1/2 orthologs in T. asiatica may suggest that sequence divergence or the secondary loss of the posterior genes has occurred in the lineage leading to the cestode and trematode. PMID:17265186

Kim, Kyu-Heon; Lee, Yong Seok; Jeon, Hyeong-Kyu; Park, Joong-Ki; Kim, Chang-Bae; Eom, Keeseon S

2007-04-01

260

Phage-Displayed T-Cell Epitope Grafted into Immunoglobulin Heavy-Chain Complementarity-Determining Regions: an Effective Vaccine Design Tested in Murine Cysticercosis  

PubMed Central

A new type of immunogenic molecule was engineered by replacing all three complementarity-determining-region (CDR) loops of the human immunoglobulin (Ig) heavy-chain variable (VH) domain with the Taenia crassiceps epitope PT1 (PPPVDYLYQT) and by displaying this construct on the surfaces of M13 bacteriophage. When BALB/c mice were immunized with such phage particles (PIgphage), a strong protection against challenge infection in very susceptible female hosts was obtained. When specifically stimulated, the in vivo-primed CD4+ and CD8+ T cells isolated from mice immunized with PT1, both as a free peptide and as the PIgphage construct, proliferated in vitro, indicating efficient epitope presentation by both major histocompatibility complex class II and class I molecules in the specifically antigen-pulsed macrophages used as antigen-presenting cells. These data demonstrate the immunogenic potential of recombinant phage particles displaying CDR epitope-grafted Ig VH domains and establish an alternative approach to the design of an effective subunit vaccine for prevention of cysticercosis. The key advantage of this type of immunogen is that no adjuvant is required for its application. The proposed strategy for immunogen construction is potentially suitable for use in any host-pathogen interaction.

Manoutcharian, Karen; Terrazas, Luis Ignacio; Gevorkian, Goar; Acero, Gonzalo; Petrossian, Pavel; Rodriguez, Miriam; Govezensky, Tzipe

1999-01-01

261

[Late epilepsy in cerebral cysticercosis. 2 cases confirmed by tomodensitometry].  

PubMed

Invasion of the central nervous system by the larvae of Tenia Solium classically leads to severe illness. In some instances, however, the course is protracted and benign. The authors report on two patients with cysticercosis cerebri, revealed by delayed seizures without cerebral hypertension or any other manifestation. Computerized tomography established the diagnosis by demonstrating calcifications disseminated throughout the cerebral parenchyma. Such calcifications result from encapsulation of dead larvae. The possible diversity of the anatomic lesions caused directly or indirectly by the parasite explains why clinical manifestations are polymorphic. Diagnostic procedures are discussed. PMID:6306778

Roswag, D; Vigeral, P; Der Agopian, P; Loison, F

1983-03-24

262

The computed tomographic appearance of cerebral cysticercosis in adults and children  

SciTech Connect

The computed tomographic (CT) scans of 45 patients (30 adults, 15 children) with cerebral cysticercosis were reviewed. These patients had undergone complete diagnostic evaluations including skin tests, laboratory tests, plain skull radiography, radionuclide brain scanning, CT, and cerebral angiography. All of these tests were unrewarding except CT and the indirect hemagglutination tests on the serum. A classification of cerebral cysticercosis based on the location of the lesions in the brain and the CT appearance was developed. Cerebral cysticercosis can be diagnosed by CT findings when there is also a history of seizures and of the patient having lived in an area where the disease is endemic.

Byrd, S.E.; Locke, G.E.; Biggers, S.; Percy, A.K.

1982-09-01

263

Respiration Studies and Glucose Absorption Kinetics of Taenia Crassiceps Larvae.  

National Technical Information Service (NTIS)

Istope-labeled glucose was used to study the kinetics of glucose entry into the tissues of taenia crassiceps larvae. The rate of absorption decreased after 3 to 5 min of incubation and the rate fitted an adsorption isotherm. Galactose competitively inhibi...

K. D. Murrell

1968-01-01

264

Selective indications for the use of praziquantel in the treatment of brain cysticercosis.  

PubMed Central

The selective use of praziquantel for the treatment of brain cysticercosis in human beings is described, based upon the results of clinical tests conducted during a 2 year period. Forty patients with clinical diagnosis of cysticercosis, confirmed and documented by CT, were treated. They are divided into four groups, representative of the various forms of the disease. The results assessed by clinical evaluation and sequential CT, give a ten point criterion of the indications for praziquantel. Images

Vasconcelos, D; Cruz-Segura, H; Mateos-Gomez, H; Zenteno Alanis, G

1987-01-01

265

Serological Studies of Neurologic Helminthic Infections in Rural Areas of Southwest Cameroon: Toxocariasis, Cysticercosis and Paragonimiasis  

PubMed Central

Background Both epilepsy and paragonimiasis had been known to be endemic in Southwest Cameroon. A total of 188 people (168 and 20 with and without symptoms confirmed by clinicians, respectively, 84.6% under 20 years old) were selected on a voluntary basis. Among 14 people (8.3%) with history of epilepsy, only one suffered from paragonimiasis. Therefore, we challenged to check antibody responses to highly specific diagnostic recombinant antigens for two other helminthic diseases, cysticercosis and toxocariasis, expected to be involved in neurological diseases. Soil-transmitted helminthic infections were also examined. Methodology/Principal Findings Fecal samples were collected exclusively from the 168 people. Eggs of Ascaris lumbricoides, Trichuris trichiura and hookworms were found from 56 (33.3%), 72 (42.8%), and 19 (11.3%) persons, respectively. Serology revealed that 61 (36.3%), 25 (14.9%) and 2 (1.2%) of 168 persons showed specific antibody responses to toxocariasis, paragonimiasis and cysticercosis, respectively. By contrast, 20 people without any symptoms as well as additional 20 people from Japan showed no antibody responses. Among the 14 persons with epilepsy, 5 persons were seropositive to the antigen specific to Toxocara, and one of them was simultaneously positive to the antigens of Paragonimus. The fact that 2 children with no history of epilepsy were serologically confirmed to have cysticercosis strongly suggests that serological survey for cysticercosis in children is expected to be useful for early detection of asymptomatic cysticercosis in endemic areas. Conclusions/Significance Among persons surveyed, toxocariasis was more common than paragonimiasis, but cysticercosis was very rare. However, the fact that 2 children were serologically confirmed to have cysticercosis was very important, since it strongly suggests that serology for cysticercosis is useful and feasible for detection of asymptomatic cysticercotic children in endemic areas for the early treatment.

Nkouawa, Agathe; Sako, Yasuhito; Itoh, Sonoyo; Kouojip-Mabou, Alida; Nganou, Christ Nadege; Saijo, Yasuaki; Knapp, Jenny; Yamasaki, Hiroshi; Nakao, Minoru; Nakaya, Kazuhiro; Moyou-Somo, Roger; Ito, Akira

2010-01-01

266

Serodiagnostic reliability of single-step enriched low-molecular weight proteins of Taenia solium metacestode of American and Asian isolates.  

PubMed

The low-molecular weight proteins (LMWPs) of Taenia solium metacestode (TsM) constituted pertinent serodiagnostic antigens for cysticercosis. We established a novel single-step purification of the LMWPs from TsM cyst fluid (CF). When the CF was precipitated with trichloroacetic acid/acetone mixture at the final concentrations of 5 and 50%, most LMWPs (ranging 7-38kDa) remained in the supernatant fraction. Sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE) and immunoblot analyses revealed that the LMWPs consisted mainly with the previously reported subunit proteins of the 120- and 150-kDa antigen complexes. Serum samples from neurocysticercosis (NC) and other helminthic infections, as well as those from healthy controls were tested by both immunoblotting and micro-ELISA. In 135 cases of active stage NC patients, 132 cases (97.7%) showed positive reactions. Serum samples from other helminthic diseases (n=125) and healthy controls (n=100) exhibited no positive reactions except for cystic echinococcosis, of which 12% (3/25 cases) exhibited low levels of cross-reactivity. The LMWPs from different geographical regions (Korea and Mexico) showed diagnostic sensitivity and specificity of 97.7% and 98.7% against active stage NC. Our single-step separation method for the LMWPs provided excellent performance with easy applicability and high reproducibility, which has a great benefit for preparation of potent antigen in endemic areas. PMID:20801471

Lee, E-G; Bae, Y-A; Kim, S-H; Díaz-Camacho, S P; Nawa, Y; Kong, Y

2010-10-01

267

Seroprevalence of major bovine-associated zoonotic infectious diseases in the Lao People's Democratic Republic.  

PubMed

Bovine-associated zoonotic infectious diseases pose a significant threat to human health in the Lao People's Democratic Republic (Lao PDR). In all, 905 cattle and buffalo serum samples collected in northern Lao PDR in 2006 were used to determine seroprevalence of five major bovine zoonotic infectious diseases that included Taenia saginata cysticercosis, bovine tuberculosis, Q-fever, bovine brucellosis, and bovine leptospirosis. Five enzyme-linked immunosorbent assays (ELISAs) were used to test for the presence of antibodies to the diseases, except Taenia saginata, for which we tested for the presence of Taenia metacestode circulating antigens. The overall highest prevalence was for T. saginata (46.4%), with lower prevalence for Q-fever (4%), leptospirosis (3%), tuberculosis (1%), and brucellosis (0.2%). Although there were no significant differences in the proportion of seroprevalence between sex and age of the animals sampled, there were significant differences between the provincial distributions. Further studies are required to determine the seroprevalence of these infections in other locations in Lao PDR, as well as other animal species including humans, in order to develop effective prevention and control strategies. This is the first study to investigate the prevalence of bovine zoonotic infectious agents in the Lao PDR. Positivity was demonstrated for all diseases investigated, with the highest prevalence for T. saginata antigen and Coxiella burnetti antibodies. For T. saginata, there were significant differences in the provincial distribution. Approximately 16% seroprevalence of Coxiella burnetti was noted in Xayabuly Province; however, there are no clear reasons why this was the case, and further studies are required to determine risk factors associated with this observation. PMID:22651388

Vongxay, Khamphouth; Conlan, James V; Khounsy, Syseng; Dorny, Pierre; Fenwick, Stanley; Thompson, R C Andrew; Blacksell, Stuart D

2012-05-31

268

Cysticercosis of the central nervous system: clinical and therapeutic considerations.  

PubMed Central

In a group of forty cases of cysticercosis of the central nervous system, 59% presented with intracranial hypertension due to obstructive hydrocephalus. Ventricular or cisternal cysts, and chronic cysticercus meningitis were the most common causes of hydrocephalus. Seizures occurred in 40% of the patients, in one-half of them in association with CT-detected parenchymatous cysts. In 20% of the cases progressive mental deterioration was the main clinical feature, at times associated with hydrocephalus. CT scan provided the highest diagnostic yield, being abnormal in 90% of cases. Long term prognosis was poor, with a mortality rate of 38% over a 40-month follow-up period. The most common cause of death (60%) was meningitis. CSF shunting is the treatment of choice for hydrocephalus, irrespective of its mechanism. Surgical resection is indicated in some cases with a single superficial (cortical) or posterior fossa cyst. Supratentorial cysts carry a relatively benign prognosis. Images

Torrealba, G; Del Villar, S; Tagle, P; Arriagada, P; Kase, C S

1984-01-01

269

Development of Taenia pisiformis in golden hamster (Mesocricetus auratus)  

PubMed Central

The life cycle of Taenia pisiformis includes canines as definitive hosts and rabbits as intermediate hosts. Golden hamster (Mesocricetus auratus) is a rodent that has been successfully used as experimental model of Taenia solium taeniosis. In the present study we describe the course of T. pisiformis infection in experimentally infected golden hamsters. Ten females, treated with methyl-prednisolone acetate were infected with three T. pisiformis cysticerci each one excised from one rabbit. Proglottids released in faeces and adults recovered during necropsy showed that all animals were infected. Eggs obtained from the hamsters' tapeworms, were assessed for viability using trypan blue or propidium iodide stains. Afterwards, some rabbits were inoculated with eggs, necropsy was performed after seven weeks and viable cysticerci were obtained. Our results demonstrate that the experimental model of adult Taenia pisiformis in golden hamster can replace the use of canines in order to study this parasite and to provide eggs and adult tapeworms to be used in different types of experiments.

2011-01-01

270

Molecular discrimination of taeniid cestodes.  

PubMed

DNA approaches are now being used routinely for accurate identification of Echinococcus and Taenia species, subspecies and strains, and in molecular epidemiological surveys of echinococcosis/taeniasis in different geographical settings and host assemblages. The publication of the complete sequences of the mitochondrial (mt) genomes of E. granulosus, E. multilocularis, T. solium and Asian Taenia, and the availability of mtDNA sequences for a number of other taeniid genotypes, has provided additional genetic information that can be used for more in depth phylogenetic and taxonomic studies of these parasites. This very rich sequence information has provided a solid molecular basis, along with a range of different biological, epidemiological, biochemical and other molecular-genetic criteria, for revising the taxonomy of the genus Echinococcus and for estimating the evolutionary time of divergence of the various taxa. Furthermore, the accumulating genetic data has allowed the development of PCR-based tests for unambiguous identification of Echinococcus eggs in the faeces of definitive hosts and in the environment. Molecular phylogenies derived from mtDNA sequence comparisons of geographically distributed samples of T. solium provide molecular evidence for two genotypes, one being restricted to Asia, with the other occurring in Africa and America. Whether the two genetic forms of T. solium differ in important phenotypic characteristics remains to be determined. As well, minor DNA sequence differences have been reported between isolates of T. saginata and Asian Taenia. There has been considerable discussion over a number of years regarding the taxonomic position of Asian Taenia and whether it should be regarded as a genotype, strain, subspecies or sister species of T. saginata. The available molecular genetic data do not support independent species status for Asian Taenia and T. saginata. What is in agreement is that both taxa are closely related to each other but distantly related to T. solium. This is important in public health terms as it predicts that cysticercosis in humans attributable to Asian Taenia does not occur, because cysticercosis is unknown in T. saginata. PMID:16337179

McManus, Donald P

2005-12-05

271

Molecular identification of Taenia spp. in the Eurasian lynx (Lynx lynx) from Finland.  

PubMed

Cestodes of the genus Taenia are parasites of mammals, with mainly carnivores as definitive and herbivores as intermediate hosts. Various medium-sized cats, Lynx spp., are involved in the life cycles of several species of Taenia. The aim of the present study was to identify Taenia tapeworms in the Eurasian lynx (Lynx lynx) from Finland. In total, 135 tapeworms from 72 lynx were subjected to molecular identification based on sequences of 2 mtDNA regions, the cytochrome c oxidase subunit 1 and the NADH dehydrogenase subunit 1 genes. Available morphological characters of the rostellar hooks and strobila were compared. Two species of Taenia were found: T. laticollis (127 samples) and an unknown Taenia sp. (5 samples). The latter could not be identified to species based on mtDNA, and the rostellar hooks were short relative to those described among other Taenia spp. recorded in felids from the Holarctic region. In the phylogenetic analyses of mtDNA sequences, T. laticollis was placed as a sister species of T. macrocystis, and the unknown Taenia sp. was closely related to T. hydatigena and T. regis. Our analyses suggest that these distinct taeniid tapeworms represent a putative new species of Taenia. The only currently recognized definitive host is L. lynx and the intermediate host is unknown. PMID:23347590

Lavikainen, A; Haukisalmi, V; Deksne, G; Holmala, K; Lejeune, M; Isomursu, M; Jokelainen, P; Näreaho, A; Laakkonen, J; Hoberg, E P; Sukura, A

2013-01-25

272

Cysticercosis: hooked by a hooklet on fine needle aspiration cytology-a case report.  

PubMed

Cysticercosis is a systemic parasitic disease caused by the larval form of cestode T. solium. It has a worldwide distribution and is potentially harmful with variable clinical manifestations. The patient most commonly presents with subcutaneous and muscle involvement in the form of nodular lesions. The other most commonly involved sites include eye, brain, bladder wall, and heart. Cysticercosis can be diagnosed on serology, and radiologically but confirmatory diagnosis is based on histopathological examination of the involved tissue biopsy specimen. Fine needle aspiration cytology is a useful low-cost outpatient procedure tool for preoperative diagnosis of cysticercosis and is absolutely essential for diagnosis of the parasitic lesions in a peripheral hospital, one like ours. PMID:24024052

Sawhney, Manav; Agarwal, Shubhra

2013-08-19

273

Cysticercosis: Hooked by a Hooklet on Fine Needle Aspiration Cytology--A Case Report  

PubMed Central

Cysticercosis is a systemic parasitic disease caused by the larval form of cestode T. solium. It has a worldwide distribution and is potentially harmful with variable clinical manifestations. The patient most commonly presents with subcutaneous and muscle involvement in the form of nodular lesions. The other most commonly involved sites include eye, brain, bladder wall, and heart. Cysticercosis can be diagnosed on serology, and radiologically but confirmatory diagnosis is based on histopathological examination of the involved tissue biopsy specimen. Fine needle aspiration cytology is a useful low-cost outpatient procedure tool for preoperative diagnosis of cysticercosis and is absolutely essential for diagnosis of the parasitic lesions in a peripheral hospital, one like ours.

Sawhney, Manav; Agarwal, Shubhra

2013-01-01

274

Alternative splicing and sequence diversity of transcripts from the oncosphere stage of Taenia solium with homology to the 45W antigen of Taenia ovis  

Microsoft Academic Search

Genes and transcripts which show homology to the host-protective 45W antigen of Taenia ovis have been cloned from the human parasite Taenia solium. The T. solium genes cloned in this study (TSO45) show conserved genomic structural features which are also features of the T. ovis 45W gene family. The TSO45 genes consist of a four exon and three intron structure.

Charles G. Gauci; Marshall W. Lightowlers

2001-01-01

275

Verifying Elimination Programs with a Special Emphasis on Cysticercosis Endpoints and Postelimination Surveillance  

PubMed Central

Methods are needed for determining program endpoints or postprogram surveillance for any elimination program. Cysticercosis has the necessary effective strategies and diagnostic tools for establishing an elimination program; however, tools to verify program endpoints have not been determined. Using a statistical approach, the present study proposed that taeniasis and porcine cysticercosis antibody assays could be used to determine with a high statistical confidence whether an area is free of disease. Confidence would be improved by using secondary tests such as the taeniasis coproantigen assay and necropsy of the sentinel pigs.

Handali, Sukwan; Pawitan, Yudi

2012-01-01

276

Cysticercosis of the nervous system. Treatment by means of specific internal radiation.  

PubMed

Five hundred patients with cysticercosis of the nervous system were evaluated by scanning that used anti-Cysticercus antibodies labeled with indium 113. The same antibodies, labeled with iodine 131, were used for radioimmunotreatment. Ninety-six percent of the patients had good or excellent results, whereas only 4% had poor results. None of the patients showed intolerance or radiotoxicity during three months of clinical and laboratory follow-up. The diagnosis, treatment, and prognosis of cysticercosis of the nervous system are dramatically changing, due to the development of anti-Cysticercus antibodies labeled with radionuclides. PMID:7224913

Skromne-Kadlubik, G; Celis, C

1981-05-01

277

A survey of bovine cysticercosis\\/human taeniosis in Northern Turkana District, Kenya  

Microsoft Academic Search

Bovine cysticercosis is a zoonosis that is mainly of socioeconomic and public health importance. A survey of this disease was carried out in Northern Turkana District, Kenya to estimate the prevalence through both serology and meat inspection, to determine the prevalence of the adult tapeworm in the human definitive host, and to determine risk factors for cattle seropositivity. This information

Lucas L. Asaava; Phillip M. Kitala; Peter B. Gathura; Mark O. Nanyingi; Gerald Muchemi; Esther Schelling

2009-01-01

278

The seroprevalence of cysticercosis, malaria, and Trypanosoma cruzi among North Carolina migrant farmworkers.  

PubMed Central

A seroprevalence study of cysticercosis, Trypanosoma cruzi, and plasmodia species and screening for active malaria was conducted among a randomly selected group of 138 Hispanic and Haitian migrant farmworkers. A random sample of labor camps in eastern North Carolina was selected. Blood samples were tested by Indirect Fluorescent Antibody techniques for plasmodial antibody and by enzyme-linked immunosorbent assay (ELISA) for cysticerci and T. cruzi antibodies. Questionnaires collected demographic data and medical history of the workers and family. Blood films stained with Leukostat stain were examined for plasmodia species. The seroprevalence of cysticercosis was 10 percent, T. cruzi 2 percent, and plasmodia species 4.4 percent. One case of active malaria (Plasmodium vivax) was demonstrated. The clinical significance of seropositivity was not determined, but these results suggest that a small but significant number of farmworkers are infected with cysticercosis, T. cruzi, and malaria. Migrant health clinicians should be aware of the possible presence of these infections. Greater observance and enforcement of sanitation regulations in farmwork is needed to prevent transmission of cysticercosis.

Ciesielski, S; Seed, J R; Estrada, J; Wrenn, E

1993-01-01

279

Brain parenchymal, subarachnoid racemose, and intraventricular cysticercosis in an Indian man  

PubMed Central

The coexistence of brain parenchymal cysts at various stages of evolution, both intraventricular and subarachnoid racemose, is reported in a patient with neurocysticercosis. The condition has a variety of presentations, depending on the location of the cyst. This case is of particular interest because of the rarity of this condition in India.???Keywords: brain parenchymal cyst; cysticercosis; albendazole

Ghosh, D; Dubey, T; Prabhakar, S

1999-01-01

280

Influence of Gender on Cardiac and Encephalic Inflammation in the Elderly with Cysticercosis: A Case Control Study  

PubMed Central

Background. The present study explores the influence of the host's age and gender upon the inflammatory infiltrate. We aimed to quantify the inflammatory infiltrate caused by cysticercosis, which is related to aging, in the heart and in the encephalon. Methods. 75 autopsy protocols with cysticercosis diagnosis from department of pathology at a university hospital from 1970 to 2008 were reviewed. Two groups were formed: elderly with cysticercosis and nonelderly with cysticercosis. We used KS-300 (Kontron-Zeiss) software for morphometric analysis of the inflammation. Results. The elderly had an average of 3.1 ± 2.5 cysticerci, whereas the non-elderly had 2.7 ± 3.8 parasites. The non-elderly group with cysticercosis had significantly more inflammation, both cardiac and encephalic, than the elderly group. The elderly females with cysticercosis had more cardiac and encephalic inflammation. Conclusions. In this study, we showed that the non-elderly had significantly more cardiac and encephalic inflammation than the elderly, and that such inflammatory infiltrate decreases with age and depends upon the evolutionary stage of the cysticercus. Furthermore, there are differences concerning gender in the intensity of the inflammatory response due to cysticerci in the heart and brain parenchyma during senescence. Even during this period, women continue to have a more intense response to the parasitosis.

Cavellani, Camila Lourencini; Correa, Rosana Rosa Miranda; Ferraz, Mara Lucia Fonseca; Rocha, Laura Penna; Faleiros, Ana Carolina Guimaraes; Lino Junior, Ruy de Souza; dos Reis, Marlene Antonia; Teixeira, Vicente de Paula Antunes

2012-01-01

281

Cu,Zn superoxide dismutase: cloning and analysis of the Taenia solium gene and Taenia crassiceps cDNA.  

PubMed

Cytosolic Cu,Zn superoxide dismutase (Cu,Zn-SOD) catalyzes the dismutation of superoxide (O(2)(-)) to oxygen and hydrogen peroxide (H(2)O(2)) and plays an important role in the establishment and survival of helminthes in their hosts. In this work, we describe the Taenia solium Cu,Zn-SOD gene (TsCu,Zn-SOD) and a Taenia crassiceps (TcCu,Zn-SOD) cDNA. TsCu,Zn-SOD gene that spans 2.841 kb, and has three exons and two introns; the splicing junctions follow the GT-AG rule. Analysis in silico of the gene revealed that the 5'-flanking region has three putative TATA and CCAAT boxes, and transcription factor binding sites for NF1 and AP1. The transcription start site was a C, located at 22 nucleotides upstream of the translation start codon (ATG). Southern blot analysis showed that TcCu,Zn-SOD and TsCu,Zn-SOD genes are encoded by a single copy. The deduced amino acid sequences of TsCu,Zn-SOD gene and TcCu,Zn-SOD cDNA reveal 98.47% of identity, and the characteristic motives, including the catalytic site and ?-barrel structure of the Cu,Zn-SOD. Proteomic and immunohistochemical analysis indicated that Cu,Zn-SOD does not have isoforms, is distributed throughout the bladder wall and is concentrated in the tegument of T. solium and T. crassiceps cysticerci. Expression analysis revealed that TcCu,Zn-SOD mRNA and protein expression levels do not change in cysticerci, even upon exposure to O(2)(-) (0-3.8 nmol/min) and H(2)O(2) (0-2mM), suggesting that this gene is constitutively expressed in these parasites. PMID:22019409

Parra-Unda, Ricardo; Vaca-Paniagua, Felipe; Jiménez, Lucia; Landa, Abraham

2011-10-12

282

The marketing of cysticercotic pigs in the Sierra of Peru. The Cysticercosis Working Group in Peru.  

PubMed Central

In Peru pork supplied through regulated slaughterhouses is primarily restricted to the large cities on the coast. Approximately 65% of the pork consumed in the country is obtained through informal channels that are not inspected or supervised. The pathways via which pigs are commercialized were studied in Huancayo, a city in the Peruvian Sierra where cysticercosis is endemic. Official purchase, slaughter, and market records were reviewed. Also, direct surveys and participant observation were carried out at two local live pig markets and at two informal meat markets. Pigs were not processed in local slaughterhouses; instead, they were butchered informally. The proportion of cysticercotic pigs detected by tongue examination ranged from 14% to 25% of the total sold. Since cysticercotic pigs and pork are sold through informal markets, surveys of abattoirs and meat markets are not a reliable way to monitor the prevalence of porcine cysticercosis in Peru. We estimate that 48% of the pork traded informally and 23% of the total pork consumed in Huancayo is derived from pigs that are infected with cysticercosis.

1993-01-01

283

Complexities in using sentinel pigs to study Taenia solium transmission dynamics under field conditions.  

PubMed

The transmission dynamics of the pork tapeworm, Taenia solium, remain a matter of research and debate. In a longitudinal field study performed in southeastern Nepal, 18 sentinel pigs were serologically monitored to study the field kinetics of Taenia antigens and anti-T. solium antibodies. At the end of the twelve months' study period, necropsy was performed and suspected lesions were subjected to molecular identification of the Taenia species. The study generated new hypotheses on the transmission dynamics of Taenia spp. and exposed crucial complexities in the use of sentinel pigs in longitudinal field studies. Sentinel pigs can be useful epidemiological tools, but their use should be thoroughly planned before initiating a study and carefully monitored throughout the course of the study. Important aspects to be considered are those affecting the pig's susceptibility to infection, such as passive immunity, age, hormonal levels, and infection with competing Taenia species. In addition, serological test results should be interpreted considering possible cross-reactions and with proper understanding of the significance of a positive test result. PMID:23298565

Devleesschauwer, Brecht; Aryal, Arjun; Tharmalingam, Jayaraman; Joshi, Durga Datt; Rijal, Suman; Speybroeck, Niko; Gabriël, Sarah; Victor, Bjorn; Dorny, Pierre

2012-12-23

284

Mitochondrial Thioredoxin-Glutathione Reductase from Larval Taenia crassiceps (Cysticerci)  

PubMed Central

Mitochondrial thioredoxin-glutathione reductase was purified from larval Taenia crassiceps (cysticerci). The preparation showed NADPH-dependent reductase activity with either thioredoxin or GSSG, and was able to perform thiol/disulfide exchange reactions. At 25°C specific activities were 437 ± 27 mU mg?1 and 840 ± 49 mU mg?1 with thioredoxin and GSSG, respectively. Apparent Km values were 0.87 ± 0.04??M, 41 ± 6??M and 19 ± 10??M for thioredoxin, GSSG and NADPH, respectively. Thioredoxin from eukaryotic sources was accepted as substrate. The enzyme reduced H2O2 in a NADPH-dependent manner, although with low catalytic efficiency. In the presence of thioredoxin, mitochondrial TGR showed a thioredoxin peroxidase-like activity. All disulfide reductase activities were inhibited by auranofin, suggesting mTGR is dependent on selenocysteine. The reductase activity with GSSG showed a higher dependence on temperature as compared with the DTNB reductase activity. The variation of the GSSG- and DTNB reductase activities on pH was dependent on the disulfide substrate. Like the cytosolic isoform, mTGR showed a hysteretic kinetic behavior at moderate or high GSSG concentrations, but it was less sensitive to calcium. The enzyme was able to protect glutamine synthetase from oxidative inactivation, suggesting that mTGR is competent to contend with oxidative stress.

Guevara-Flores, Alberto; del Arenal, Irene P.; Mendoza-Hernandez, Guillermo; Pardo, Juan Pablo; Flores-Herrera, Oscar; Rendon, Juan L.

2010-01-01

285

Prevalence of Taenia multiceps in sheep in northern Jordan.  

PubMed

From March 1996 to February 1997, slaughtered-sheeps' heads were examined for the metacestode of Taenia multiceps. Out of 451 sheep heads, only 12 (3%) were infested. All cysts but one were in the age group 0.5-2.5 years old, with prevalence of 10% (11 of 108). Eleven of 12 infested heads were found during the spring and autumn seasons. Out of 95 flocks involved in questionnaire survey unrelated to the abattoir survey, all the farmers reported the existence of the clinical signs known for coenurosis and described it in locally known names and diseases. Twenty-five of them had recent cases that were diagnosed by the veterinarian as coenurosis cases. Each flock reported one or two cases at the time of survey. A variety of clinical signs were reported from these cases (n = 42). These included circling (86%), head pressing (52%), blindness (29%) and paresis (40%). Coenurosis is a sheep-health problem and an important cause of sheep culling in Jordan. PMID:12383656

Abo-Shehada, Mahmoud N; Jebreen, Eyad; Arab, Baker; Mukbel, Rami; Torgerson, Paul R

2002-10-15

286

Taenia solium cysticerci synthesize androgens and estrogens in vitro.  

PubMed

Cysticerci from Taenia solium develop in the pig muscle and cause severe diseases in humans. Here we report on the capacity of T. solium cysticerci to synthesize sex steroid hormones. T. solium cysticerci were dissected from infected pork meat. Parasites were incubated for different periods in culture media plus antibiotics and tritiated steroid precursors. Blanks and parasite culture media were extracted and analyzed by thin-layer chromatography (TLC) in two different solvent systems. In some experiments, the scoleces were incubated separately. Results showed that T. solium cysticerci transform [(3)H]androstenedione to [(3)H]testosterone in a time-dependent manner. The production was confirmed in two different solvent systems. The incubation with [(3)H]testosterone yielded only small amounts of [(3)H]androstenedione. The recrystallization procedure further demonstrated that the metabolite identified by TLC was testosterone. The isolated scoleces incubated in the presence of [(3)H]androstenedione yielded [(3)H]testosterone and small quantities of [(3)H]17beta-estradiol. The results reported here demonstrate that T. solium cysticerci have the capacity to synthesize steroid hormones. PMID:16416116

Valdéz, R A; Jiménez, P; Cartas, A L; Gómez, Y; Romano, M C

2006-01-14

287

Ultrastructural reconstruction of Taenia ovis oncospheres from serial sections.  

PubMed

The cellular organisation of Taenia ovis oncospheres is interpreted from ultrathin serial sections and transmission electron microscopy following high pressure freezing and freeze-substitution. The surface of a hatched, non-activated T. ovis oncosphere is covered by an oncospheral membrane below which is the tegument bearing microvilli. The basal lamina of the tegument is underlain by broad bands of peripheral somatic musculature. Three pairs of hooks and associated muscles are present in the somatophoric third of the oncosphere. Approximately 19 cells of seven different types were identified which include: (i) a quadri-nucleated syncytium of penetration gland type 1 containing two lateral pairs of cell bodies interconnected by narrow cytoplasmic bridges (PG1); (ii) a quadri-nucleated syncytium of penetration gland type 2 (PG2); (iii) a single-nucleated median mesophoric gland cell; (iv) 10 somatic cells; (v) two germinative cells; (vi) two nerve cells; and (vii) a pair of median somatophoric cells. This study provides a clear understanding of the morphology of T. ovis oncospheres and forms the basis for further investigations into the biology of taeniid oncospheres. PMID:20478311

Jabbar, Abdul; Crawford, Simon; M?ocicki, Daniel; Swiderski, Zdzis?aw P; Conn, David B; Jones, Malcolm K; Beveridge, Ian; Lightowlers, Marshall W

2010-05-15

288

Molecular variation of Taenia solium in the world.  

PubMed

Complete nucleotide sequences of the mitochondrial cytochrome b (Cytb) and cytochrome c oxidase subunit I (CO I) genes from various isolates of Taenia solium were examined. Eleven isolates were analyzed; two isolates from China, two isolates from Indonesia, one isolate each from India, Thailand, Mexico, Ecuador, Peru, Mozambique and Tanzania. In both genes, two isolates from Indonesia shared the same sequences. Similarly, the isolate from Mexico shared same sequences with that from Peru, and the isolate from Mozambique shared same sequences with that from Tanzania. Phylogenetic trees inferred from different mitochondrial genes yielded almost the same topology. Both the UPGMA and NJ-trees were also very similar. These trees indicate that T. solium may be diverged to 2 genetic groups; isolates from Asia form one group and isolates from Africa and Latin America belong to the other. It seems that T. solium prevalent in Africa and in Latin America shares the related origin and has recently been introduced to each area, perhaps with domestic pigs or human. PMID:12041611

Okamoto, M; Nakao, M; Sako, Y; Ito, A

2001-01-01

289

Cysticercosis of the central nervous system with amyotrophic lateral sclerosis: case report and review of the literature  

PubMed Central

A case is described in which the clinical and pathological features of amyotrophic lateral sclerosis (ALS) occurred in a patient with cysticercosis of the central nervous system and associated pachymeningitis of the cervical spinal cord. This is an extremely rare finding. The patient also presented the two symptom complexes more commonly encountered in this condition: focal and generalized epilepsy, and signs of obstructive hydrocephalus. The literature relevant to this case, and to cysticercosis in Great Britain, is briefly reviewed. The case described adds to the concept of motor neurone disease as a syndrome rather than a disease entity of undetermined aetiology. Images

Kahn, Pauline

1972-01-01

290

A superoxide dismutase of metacestodes of Taenia taeniaeformis.  

PubMed

Superoxide dismutase was purified from Taenia taeniaeformis metacestodes by sequential ion exchange chromatography on quaternary-amino-ethyl-cellulose, gel filtration chromatography on ACA 44 and ion exchange chromatography on DEAE-cellulose, followed by chromatofocusing on polybuffer exchanger 94. This isolation procedure resulted in the detection of a single protein-staining band on alkaline gels, coincident with enzyme activity. We have, however, detected what appear to be two peaks of enzyme activity within this single protein-staining band. Sodium dodecyl sulfate-polyacrylamide gel electrophoresis using gradient slab gels and analysis under reducing conditions, resulted in the detection of only one protein at an apparent Mr of 16,600, while analysis under non-reducing conditions, gave a single protein of an apparent Mr of 64,000. The isoelectric point of the purified protein is 6.6. Boiling for 3 min completely destroyed the enzyme, whereas incubation for 2 h at 37 degrees C resulted in the loss of 56% of the enzymic activity. Incubation with 10 mM KCN resulted in 83% inhibition of the enzyme. We have detected up to 168 U ml-1 of enzyme activity in the cyst fluid surrounding the parasite in situ. This is the first instance in which any parasite superoxide dismutase has been purified to apparent homogeneity. Parasite-mediated enzymic destruction of superoxide anion can not only protect against oxygen toxicity as a result of normal parasite respiratory processes but also may serve as yet another mechanism used by tissue-dwelling parasites to evade host immunologic attack. PMID:3960056

Leid, R W; Suquet, C M

1986-03-01

291

Taenia taeniaeformis: Fate and proliferation of mucosal cells during gastric hyperplasia in larvae infected rats  

Microsoft Academic Search

Fate and proliferation of gastric mucosal cells during hyperplasia of Taenia taeniaeformis eggs inoculated Wistar rats were investigated using PCNA immunohistochemistry, BrdU labeling and other histopathologic staining techniques. Results revealed marked cell proliferation in gastric corpus and antral mucosa of infected rats as evidenced by increased lengths of proliferative zones and indices of BrdU labeling. The gastropathy in corpus was

J. T. Lagapa; Y. Oku; N. Nonaka; M. Kamiya

2008-01-01

292

First record of Taenia ovis krabbei muscle cysts in muskoxen from Greenland.  

PubMed

A first record of Taenia ovis krabbei muscle cysts in a muskoxen (Ovibos moschatus) from the Kangerlussuaq population in West Greenland suggests that introduced muskoxen now contributes to the transmission of this parasite in addition to previous observations from caribou (Rangifer tarandus). Muskoxen and caribou are the only wild ungulates in Greenland. PMID:21955737

Raundrup, Katrine; Al-Sabi, Mohammad Nafi Solaiman; Kapel, Christian Moliin Outzen

2011-09-12

293

The Lar Gibbon as Definitive and Intermediate Host of Taenia Solium.  

National Technical Information Service (NTIS)

Man is generally considered to be the only definitive host for Taenia solium. The host-parasite relationship for the bladderworm stage is not as specific and several intermediate hosts are known. By chance, it was found that the white-handed gibbon (Hylob...

F. C. Cadigan J. S. Stanton P. Tanticharoenyos V. Chaicumpa

1967-01-01

294

Review article Multiple genotypes of Taenia solium *\\/ramifications for diagnosis, treatment and control  

Microsoft Academic Search

Mitochondrial DNA sequences of Taenia solium have fully been analyzed. Analysis of the full length of cytochrome c oxidase subunit 1 (1620 bp) and cytochrome b (1068 bp) genes of T. solium , isolated from Asia (China, Thailand, Indonesia and India), from Latin America (Mexico, Ecuador, Bolivia, Peru and Brazil) and from Africa (Tanzania, Mozambique and Cameroon), has revealed that

Akira Ito; Hiroshi Yamasaki; Minoru Nakao; Yasuhito Sako; Munehiro Okamoto; Marcello O. Sato; Kazuhiro Nakaya; Sri S. Margono; Takashi Ikejima; Ayub A. Kassuku; Sonia M. S. Afonso; Washington Benitez Ortiz; Agustin Plancarte; Andre Zoli; Stanny Geerts; Philip S. Craig

295

Echinococcus and Taenia spp. from captive mammals in the United Kingdom.  

PubMed

Taeniid tapeworms which include Echinococcus and Taenia spp. are obligatory parasites of mammals with pathogenicity usually related to the larval stages of the life cycle. Two species (or genotypes) of Echinococcus, E. granulosus sensu stricto and E. equinus, as well as several Taenia spp. are endemic in the UK. Here we report on the occurrence of larval cystic stages of Echinococcus and Taenia spp. in captive mammals in the UK. Using molecular techniques we have identified E. granulosus (G1 genotype) in a guenon monkey and a Philippine spotted deer; E. equinus in a zebra and a lemur; E. ortleppi in a Philippine spotted deer; E. multilocularis in a macaque monkey and Taenia polyacantha in jumping rats. To the best of our knowledge this is the first report of E. multilocularis in a captive primate translocated to the UK. As far as we know these are the first reports of E. equinus in a primate (lemur) and in a zebra; as well as E. granulosus (G1 genotype) and E. ortleppi in a cervid translocated to the UK. These infections and implications of the potential establishment of exotic species of cestodes are discussed. PMID:22763348

Boufana, B; Stidworthy, M F; Bell, S; Chantrey, J; Masters, N; Unwin, S; Wood, R; Lawrence, R P; Potter, A; McGarry, J; Redrobe, S; Killick, R; Foster, A P; Mitchell, S; Greenwood, A G; Sako, Y; Nakao, M; Ito, A; Wyatt, K; Lord, B; Craig, P S

2012-06-01

296

Genetic similarity between cysticerci of Taenia solium isolated from human brain and from pigs  

Microsoft Academic Search

Mitochondrial (mt) cox1 and ribosomal ITS1 DNA sequences from Taenia solium cysticercus isolates from pigs and cysticerci (racemose and cellulose types) from patients with neurocysticercosis were amplified by the polymerase chain reaction (PCR). The amplicons were sequenced in order to determine the genetic relationship between these types of cysticerci. Phylogenetic trees were constructed and evolutionary distances were calculated. ITS1 and

Araceli Consuelo Hinojosa-Juarez; Miguel Sandoval-Balanzario; Donald Peter McManus; Amalia Monroy-Ostria

2008-01-01

297

Solitary neurocysticercosis case caused by Asian genotype of Taenia solium confirmed by mitochondrial DNA analysis.  

PubMed

A Japanese woman presenting with neurologic symptoms was presumptively diagnosed with neurocysticercosis based on imaging findings. Hooklets in the scolex of the resected lesion were not confirmed through histopathological observation. However, the illness was confirmed by mitochondrial DNA analysis to be a solitary neurocysticercosis case caused by the Asian genotype of Taenia solium. PMID:15297559

Yamasaki, Hiroshi; Matsunaga, Shigeo; Yamamura, Koji; Chang, Chia-Cheng; Kawamura, Shunji; Sako, Yasuhito; Nakao, Minoru; Nakaya, Kazuhiro; Ito, Akira

2004-08-01

298

Mitochondrial genetic code in cestodes  

Microsoft Academic Search

The flatworm mitochondrial genetic code, which has been used for all species of the Platyhelminthes, is mainly characterized by AUA codon for isoleucine, AAA codon for asparagine and UAA codon for tyrosine. In eight species of cestodes (Echinococcus multilocularis, Echinococcus granulosus, Taenia solium, Taenia saginata, Taenia hydatigena, Taenia crassiceps, Hymenolepis nana and Mesocestoides corti), the cytochrome c oxidase subunit I

Minoru Nakao; Yasuhito Sako; Noriko Yokoyama; Masahito Fukunaga; Akira Ito

2000-01-01

299

Molecular identification of Taenia spp. in wolves (Canis lupus), brown bears (Ursus arctos) and cervids from North Europe and Alaska.  

PubMed

Taenia tapeworms of Finnish and Swedish wolves (Canis lupus) and Finnish brown bears (Ursus arctos), and muscle cysticerci of Svalbard reindeer (Rangifer tarandus platyrhynchus), Alaskan Grant's caribou (Rangifer tarandus granti) and Alaskan moose (Alces americanus) were identified on the basis of the nucleotide sequence of a 396 bp region of the mitochondrial cytochrome c oxidase subunit 1 gene. Two species were found from wolves: Taenia hydatigena and Taenia krabbei. The cysticerci of reindeer, caribou and one moose also represented T. krabbei. Most of the cysticercal specimens from Alaskan moose, however, belonged to an unknown T. krabbei-like species, which had been reported previously from Eurasian elks (Alces alces) from Finland. Strobilate stages from two bears belonged to this species as well. The present results suggest that this novel Taenia sp. has a Holarctic distribution and uses Alces spp. as intermediate and ursids as final hosts. PMID:21571090

Lavikainen, Antti; Laaksonen, Sauli; Beckmen, Kimberlee; Oksanen, Antti; Isomursu, Marja; Meri, Seppo

2011-05-06

300

DNA content of hepatocyte and erythrocyte nuclei of the spined loach ( Cobitis taenia L.) and its polyploid forms  

Microsoft Academic Search

We analyzed the DNA content of hepatocyte and erythrocyte nuclei of the spined loach Cobitis taenia (diploid) and its allopolyploid forms. Twenty triploid females and one tetraploid were used. At least 20,000 hepatocyte and\\u000a erythrocyte nuclei were acquired and analyzed by flow cytometry. C. taenia erythrocyte nuclei contain 3.15 ± 0.21 pg of DNA and the hepatocyte nuclei 4.45 ± 0.46 pg of DNA. Triploid Cobitis

Dorota Juchno; Bozena Lackowska; Alicja Boron; Wincenty Kilarski

2010-01-01

301

Cysticercosis of the central nervous system. I. Surgical treatment of cerebral cysticercosis: a 23 years experience in the Hospital das Clínicas of Ribeirão Preto Medical School.  

PubMed

Cysticercosis is the most frequent parasitosis of the nervous system and nowadays it is widespread through the world. Despite the development of anticysticercal drugs (praziquantel and albendazole), their efficacy is more marked in cases with parenchymal active cysts and they do not prevent complications such as hydrocephalus. Thus, many patients with neurocysticercosis require surgical intervention, generally of palliative nature, but that may occasionally produce a cure. The clinical outcome of 180 patients with cerebral cysticercosis who underwent surgical treatment form 1970 to 1993 was analyzed. Surgical treatment was performed to control increased ICP in 177 patients and due to local compression of cranial nerves or brainstem in five. Some patients had more than one surgical procedure, totalizing 287 interventions. Increased intracranial pressure (ICP) was caused by hydrocephalus in 91%, by intracranial mass lesion (tumoral form) in 6.2% and by pseudotumor cerebri (pseudotumoral form) in 2.8% of the case. Based on the pathophysiological mechanisms of intracranial hypertension identified through conventional CT-scan, ventriculography, cysternotomography, ventriculotomography and MRI, different surgical approaches were indicated. Patients with tumoral form were submitted to direct approach and cyst removal and generally they had benefits from this procedure. Patients with pseudotumoral form whose clinical treatment failure underwent decompressive craniectomies and had a poor outcome (40% of good results). Direct removal of ventricular/cisternal cysts and/or ventriculoatrial/peritoneal shunting (VA/VPS) was performed in patients with hydrocephalus. Removal of free ventricular cysts in patients who had no ependimitis/arachnoiditis generally allowed a good outcome. Patients with adherent cysts and inflammatory process needed a VA/VPS posteriorly and the outcome was not so good. One hundred thirty-two patients were submitted to VA/VPS (109 as the first procedure and 23 after another surgical treatment). The VA/VPS was effective to control increased ICP, despite many complications observed mainly during the two first postoperative years. After this period the surviving patients generally had a better outcome. The patients submitted to cyst removal due to local compression of cranial nerves/brainstem generally had good results. Based on the experience acquired with the management of these patients we present our recent policy for the treatment of patients with neurocisticercosis. PMID:7826245

Colli, B O; Martelli, N; Assirati Júnior, J A; Machado, H R; Salvarani, C P; Sassoli, V P; Forjaz, S V

1994-06-01

302

The role of the Tasmanian devil in the epizootiology of ovine cysticercosis and echinococcosis.  

PubMed

Tasmanian devils were fed infective cystic material of Taenia ovis, T. hydatigena and Echinococcus granulosus and later killed and examined for adult tapeworms. No infections with T. ovis were found after feeding 23 cysts to 8 devils. T. hydatigena were recovered from 5 to 41 devils and 10 worms established after feeding 417 cysticerci. No E. granulosus were recovered from any of 3 devils. Specimens of T. hydatigena appeared to develop as well in devils as in dogs. From these and previous results devils could be successful hosts to T. hydatigena and T. ovis. A survey of 320 devils failed to detect any natural infections with any of these 3 species. PMID:1035096

Gregory, G G

1976-10-01

303

Calcium antagonism by cobalt ions on contraction of guinea-pig taenia coli.  

PubMed

In guinea-pig taenia coli, cobalt ions (Co2+) inhibited the tonic response to a highly concentrated K+ solution (high-K+, 40 mM) more strongly than the phasic response. Co2+ displaced Ca2+ concentration-response curves to the right, inhibited the increase in tissue calcium content caused by high-K+, and inhibited Ca2+ binding at low affinity sites more than at high affinity sites. After treatment with Co2+, the tonic tension caused by high-K+ was not restored by a wash with normal medium, but it was restored by a wash with EDTA. The cobalt remaining in muscles was almost completely eliminated after a 20-30 min wash with EDTA. The results suggest that Co2+ binds chiefly to the surface membrane of taenia coli. Co2+ probably reduced the tension in response to high-K+ mainly by inhibiting Ca2+ influx rather than by affecting Ca2+ release. PMID:1361529

Nasu, T

1992-11-01

304

Isolation and identification of lignans from Caulis Bambusae in Taenia with antioxidant properties.  

PubMed

Caulis Bambusae in Taenia is a medicinal preparation from Bambusa tuldoides Munro consisting of skinless slices of the stem (bamboo shavings) and used as a traditional health food in tea, wine, and soup in Asia. Three novel lignans, (-)-7'-epi-lyoniresinol 4,9'-di-O-?-D-glucopyranoside (7), (-)-lyoniresinol 4,9'-di-O-?-D-glucopyranoside (8), bambulignan A (10), and seven known lignan compounds (1-6 and 9) were isolated from Caulis Bambusae in Taenia. The structures of the lignans were determined by detailed spectroscopic analysis (HRESIMS, HSQC, HMBC, NOE). All the isolated lignans were tested for antioxidant activities by DPPH and FARP assays. The results showed that the compounds (+)-lyoniresinol 9'-O-?-D-glucopyranoside (1) and (-)-7'-epi-lyoniresinol 9'-O-?-D- glucopyranoside (9) have strong free radical scavenging activity and reducing power. PMID:23578339

Sun, Jia; Yu, Jin; Zhang, Pei-Cheng; Tang, Feng; Yue, Yong-De; Yang, Ya-Nan; Feng, Zi-Ming; Guo, Xue-Feng

2013-05-06

305

Molecular Detection and Characterization of Goat Isolate of Taenia hydatigena in Turkey  

PubMed Central

The aim of this study was to provide molecular detection and characterization of the goat isolate of Taenia hydatigena from Ankara province of Turkey. For this purpose, PCR amplification of small subunit ribosomal RNA (rrnS) and partial sequencing of mitochondrial cytochrome c oxidase subunit 1 (mt-CO1) genes were performed in a one-month-old dead goat. According to rrnS-PCR results, parasites were identified as Taenia spp., and partial sequence of mt-CO1 gene was corresponding to T. hydatigena. At the end of the study, we concluded that molecular tools can be used to define species of parasites in cases where the key morphologic features cannot be detected. Nucleotide sequence data of Turkish goat isolate of T. hydatigena was submitted to GenBank for other researchers interested in this subject. By this study, molecular detection and characterization of T. hydatigena was done for the first time in Turkey.

Utuk, Armagan Erdem; Piskin, Fatma Cigdem

2012-01-01

306

Gastric hyperplasia and parietal cell loss in Taenia taeniaeformis inoculated immunodeficient mice  

Microsoft Academic Search

Immunodeficient mice were studied to determine their suitability as models in investigating the role of Taenia taeniaeformis larval products in the development of gastric hyperplasia. Recombinant active gene 2 (RAG2)-deficient and severe combined immune-deficient (SCID) mice were studied as candidate animal models. RAG2-deficient mice inoculated orally with T. taeniaeformis eggs developed gastric hyperplasia with alcian blue-periodic acid-Schiff-positive cell proliferation similar

Jose Trinipil Lagapa; Kenjiro Konno; Yuzaburo Oku; Nariaki Nonaka; Mamoru Ito; Masao Kamiya

2002-01-01

307

Long-Lasting Actions of Bay K 8644 on Responses of Guinea Pig Taenia Coli  

Microsoft Academic Search

1.Bay K 8644, a dihydropyridine Ca2+ agonist, (10?6 M), induced strong rhythmic contractions in taenia coli and induced a contracture after about 5.5 hr of the application. Increases in Bay K 8644 concentrations prolonged the period of rhythmic contractions and slowed the onset of the contracture.2.Nifedipine, a dihydropyridine Ca2+ antagonist, inhibited the delayed contracture to Bay K 8644 more than

T. Nasu; M. Sasaki; H. Shibata

1998-01-01

308

Nucleic acid vaccination of sheep: Use in combination with a conventional adjuvanted vaccine against Taenia ovis  

Microsoft Academic Search

This report describes the use of a nucleic acid vaccine in a large outbred animal species both alone and in combination with a conventionally adjuvanted vaccine. The gene encoding a host-protective antigen (45W) from the sheep parasite Taenia ovis was cloned into the expression vector pcDNA3 and the resultant plasmid termed pcDNA3-45W. Eleven of 15 sheep injected either intramuscularly or

JS Rothel; JG Waterkeyn; RA Strugnell; PR Wood; H-F Seow; J Vadolas; MW Lightowlers

1997-01-01

309

Molecular cloning, characterization, and immunolocalization of two lactate dehydrogenase homologous genes from Taenia solium  

Microsoft Academic Search

Two novel genes encoding lactate dehydrogenase A (LDHA) and B (LDHB) homologues, respectively, were identified from the cDNA\\u000a libraries of adult Taenia solium (T. solium). The two deduced amino acid sequences both show more than 50% identity to the homologues for Danio rerio, Xenopus laevis, Schistosoma japonicum, Sus scrofa, Homo sapiens, et al. The identity of the amino acid sequence

Wuying Du; Fengyu Hu; Yabo Yang; Dong Hu; Xuchu Hu; Xinbing Yu; Jin Xu; Jialin Dai; Xinjiang Liao; Jiang Huang

310

Isolation of Neurocysticercosis-Related Antigens from a Genomic Phage Display Library of Taenia solium  

Microsoft Academic Search

In this study, the authors have generated a tapeworm Taenia solium genomic DNA expression library where foreign peptides\\/ proteins were fused to N-termini of M13 cpVIII and expressed at a high copy number on the phage surface, and they showed that this library may be used in bioselection against antipathogen immune sera, allowing the identification of disease-related antigens recognizing antibodies

Erik González; Yetzi Robles; Tzipe Govezensky; Raul J. Bobes; Goar Gevorkian; Karen Manoutcharian

2010-01-01

311

Protection against Asiatic Taenia solium Induced by a Recombinant 45W-4B Protein  

Microsoft Academic Search

Taenia solium is a great threat not only to human health but also to the pig-raising industry. Oncospheral stage-specific 45W proteins are good candidates for the development of anticysticercosis vaccines. In this study, a recombinant 45W-4B protein was highly produced and used for vaccination. Two animal trials resulted in a significant reduction in parasite burden induced by the definite protein

Xuenong Luo; Yadong Zheng; Junling Hou; Shaohua Zhang; Xuepeng Cai

2009-01-01

312

The incidence of human cysticercosis in a rural community of Eastern Zambia.  

PubMed

A community-based longitudinal study was performed in the Eastern Province of Zambia, in which repeated serological samplings were done to determine the incidence of human cysticercosis. Three sampling rounds were carried out at six months intervals. A total of 867 participants presented for all three samplings. All samples were tested for the presence of cysticercus antigens using a monoclonal antibody-based enzyme-linked immunosorbent assay (sero-Ag-ELISA), while a randomly selected sub-sample of 161 samples from each sampling round was tested for specific antibodies using a commercial enzyme-linked immunoelectrotransfer blot (EITB) assay. Stool samples (n?=?226) were also collected during the final round of sampling for taeniosis diagnosis by coprology and coproantigen ELISA. Cysticercosis seroprevalence varied from 12.2% to 14.5% (sero-Ag) and from 33.5% to 38.5% (sero-Ab) during the study period. A taeniosis prevalence of 11.9% was determined. Incidence rates of 6300 (sero-Ag, per 100000 persons-year) and 23600 (sero-Ab, per 100000 persons-year) were determined. Seroreversion rates of 44% for sero-Ag and 38.7% for sero-Ab were recorded over the whole period. In conclusion, this study has shown the dynamic nature of T. solium infections; many of the people at risk become (re)infected due to the high environmental contamination, with a high number turning seronegative within a year after infection. An important number of infections probably never fully establish, leading to transient antibody responses and short-term antigen presence. PMID:23556026

Mwape, Kabemba E; Phiri, Isaac K; Praet, Nicolas; Speybroeck, Niko; Muma, John B; Dorny, Pierre; Gabriël, Sarah

2013-03-21

313

[Investigation on Taenia sp. infection in Midu County of Yunnan Province].  

PubMed

The current status and species of Taenia sp. were investigated in Midu County by sedimentation method to examine eggs of Taenia sp. in stool, questionnairing as well as deworming by areca-pumpkin seeds in October-December, 2010. The infection rate of Taenia sp. was 15.7% (65/414). Among the positives, it was fairly high in the age groups of 40- and 50-, being 24% (21/85) and 26% (15/57), respectively. 26 cases with positive stool examination and 47 cases with a history of discharging proglottids were treated. Adult worms were collected from all 26 egg positive cases and 23 persons discharging proglottids. The highest number of adult worms expelled was 11 in a woman, 2 worms from another villager, but only one worm each from all other cases. 15 tapeworms with scolex and mature proglottids were examined and morphologically identified as T. asiatia. The high prevalence was related to the residents' dietetic habits (eg. eating raw pork and liver) , behaviour (eg. defecating in field) , and the egg-contaminated environment (eg. by untreated feces). PMID:22908811

Fang, Wen; Liu, Hong-Kun; Li, Ke-Rong; Luo, Hua; Xu, Xin; Chen, Feng; Li, Rong; Liu, Ji-Bing; Huang, Ming-Hao; Li, Su-Mei

2012-04-30

314

Postoncospheral development and cycle of Taenia polyacantha Leuckart, 1856 (Cestoda: Taeniidae). First part.  

PubMed

The postoncospheral development and cycle of Taenia polyacantha Leuckart, 1856, an holarctic species of cestode, were investigated in the laboratory as well as in the tundra of northern Alaska. Foxes, Alopex lapogus (L.) and Vulpes vulpes (L.), serve as final host of T. polyacantha; the northern vole, Microtus oeconomus (Pallas), and the brown lemming, Lemmus sibiricus (Kerr), are important as the intermediate host. As determined in experimentally infected voles and lemmings, the oncosphere of T. polyacantha transformed to a primary vesicle in the liver. On the 6th day postexposure, coinciding with its migration to the peritoneal cavity, the larval cestode consisted of a minute aggregation of secondary vesicles. By 9-10 days postexposure, the secondary vesicles dissociated, thereafter developing independently to infective cysticerci by 30-40 days postexposure. At an age of about 60 days, the infective larvae began to undergo further growth and morphological modification, which led to acquisition of some strobilar characteristics by the forebody. Such late transformation of a cysticercus to a more advanced form of larva is known otherwise only in Taenia martis (Zeder, 1803). Differences in numbers and sizes of rostellar hooks provided the basis for recognition of two taxa at the infraspecific level: Taenia p. polyacantha Leuckart, 1856, distributed in Eurasia to the south of the zone of tundra, and T. p. arctica ssp. nov., present throughout the holarctic tundra. Observations concerning interactions of T. polyacantha and its hosts are discussed. PMID:3059953

Rausch, R L; Fay, F H

1988-01-01

315

The first workshop towards the control of cestode zoonoses in Asia and Africa.  

PubMed

The first workshop towards the control of cestode zoonoses in Asia and Africa was held in Asahikawa Medical University, Japan on 15 and 16 Feb 2011. This meeting was fully supported by the Asian Science and Technology Strategic Cooperation Promotion Programs sponsored by the Special Coordination Funds for Promoting Science and Technology, the Ministry of Education Japan (MEXT) for 3 years from 2010 to Akira Ito. A total of 24 researchers from 9 countries joined together and discussed the present situation and problems towards the control of cestode zoonoses. As the meeting was simultaneously for the establishment of joint international, either bilateral or multilateral collaboration projects, the main purposes were directed to 1) how to detect taeniasis/cysticercosis infected patients, 2) how to differentiate Taenia solium from two other human Taenia species, T. saginata and T. asiatica, 3) how to evaluate T. asiatica based on the evidence of hybrid and hybrid-derived adult tapeworms from Thailand and China, 4) how to evaluate T. solium and T. hyaenae and other Taenia species from the wild animals in Ethiopia, and 5) how to detect echinococcosis patients and 6) how to differentiate Echinococcus species worldwide. Such important topics are summarized in this meeting report. PMID:21693001

Ito, Akira; Okamoto, Munehiro; Li, Tiaoying; Wandra, Toni; Dharmawan, Nyoman S; Swastika, Kadek I; Dekumyoy, Paron; Kusolsuk, Teera; Davvajav, Abmed; Davaasuren, Anu; Dorjsuren, Temuulen; Mekonnen, Sissay M; Negasi, Zerihun H; Yanagida, Tetsuya; Sako, Yasuhito; Nakao, Minoru; Nakaya, Kazuhiro; Lavikainen, Antti J; Nkouawa, Agathe; Mohammadzadeh, Tahereh

2011-06-21

316

The first workshop towards the control of cestode zoonoses in Asia and Africa  

PubMed Central

The first workshop towards the control of cestode zoonoses in Asia and Africa was held in Asahikawa Medical University, Japan on 15 and 16 Feb 2011. This meeting was fully supported by the Asian Science and Technology Strategic Cooperation Promotion Programs sponsored by the Special Coordination Funds for Promoting Science and Technology, the Ministry of Education Japan (MEXT) for 3 years from 2010 to Akira Ito. A total of 24 researchers from 9 countries joined together and discussed the present situation and problems towards the control of cestode zoonoses. As the meeting was simultaneously for the establishment of joint international, either bilateral or multilateral collaboration projects, the main purposes were directed to 1) how to detect taeniasis/cysticercosis infected patients, 2) how to differentiate Taenia solium from two other human Taenia species, T. saginata and T. asiatica, 3) how to evaluate T. asiatica based on the evidence of hybrid and hybrid-derived adult tapeworms from Thailand and China, 4) how to evaluate T. solium and T. hyaenae and other Taenia species from the wild animals in Ethiopia, and 5) how to detect echinococcosis patients and 6) how to differentiate Echinococcus species worldwide. Such important topics are summarized in this meeting report.

2011-01-01

317

Molecular Characterization of Taenia multiceps Isolates from Gansu Province, China by Sequencing of Mitochondrial Cytochrome C Oxidase Subunit 1  

PubMed Central

A total of 16 Taenia multiceps isolates collected from naturally infected sheep or goats in Gansu Province, China were characterized by sequences of mitochondrial cytochrome c oxidase subunit 1 (cox1) gene. The complete cox1 gene was amplified for individual T. multiceps isolates by PCR, ligated to pMD18T vector, and sequenced. Sequence analysis indicated that out of 16 T. multiceps isolates 10 unique cox1 gene sequences of 1,623 bp were obtained with sequence variation of 0.12-0.68%. The results showed that the cox1 gene sequences were highly conserved among the examined T. multiceps isolates. However, they were quite different from those of the other Taenia species. Phylogenetic analysis based on complete cox1 gene sequences revealed that T. multiceps isolates were composed of 3 genotypes and distinguished from the other Taenia species.

Li, Wen Hui; Jia, Wan Zhong; Qu, Zi Gang; Xie, Zhi Zhou; Luo, Jian Xun; Yin, Hong; Sun, Xiao Lin; Blaga, Radu

2013-01-01

318

Recent advances in basic and applied science for the control of taeniasis/cysticercosis in Asia.  

PubMed

Detection of seven specific bands by immunoblot (IB) using glycoproteins (GPs) purified by lentil-lectin affinity chromatography has been the gold-standard for neurocysticercosis (NCC) serodiagnosis since 1989. However, due to the presence of contaminants, it was impossible to apply the GPs to ELISA. Our group at Asahikawa Medical College (AMC) succeeded in purifying the GPs by preparative isoelectric focusing; these higher quality GPs were suitable for ELISA. Based on the results of both IB and ELISA testing, developed at AMC for a field survey in Irian Jaya, it became evident that that area had pandemic NCC. We found many NCC patients, pigs full of cysts, and one dog infected with two cysts: these findings were based on serology. Recently, we conducted another survey to detect of the worm carriers of T. solium. Three of the 38 local people were positive by copro-antigen specific to Taenia species; these three patients expelled segments of Taenia spp and these were confirmed as those of T. solium by mitochondrial DNA analysis. When viable eggs of any taeniid species could be obtained, they can be developed into metacestodes in NOD-scid mice; it then becomes possible to analyze morphological dynamics, metacestode antigenicity, the efficacy of new metacestocidal drugs, and mitochondrial DNA. Mitochondrial DNA analysis of the specimens obtained in Irian Jaya was compared with that of other isolates worldwide. T. solium is now divided into two genotypes: the Asian type, and the Africa-American type. Some aspects of the pathological differences between the Asian and Africa-American types and the antigenic components of these two types are discussed. PMID:12971481

Ito, A; Wandra, T; Subahar, R; Hamid, A; Yamasaki, H; Sako, Y; Mamuti, W; Okamoto, M; Nakaya, K; Nakao, M; Ishikawa, Y; Suroso, T; Craig, P S; Margono, S S

2002-01-01

319

Vaccination with recombinant oncosphere antigens reduces the susceptibility of sheep to infection with Taenia multiceps?  

PubMed Central

Taenia multiceps is a cestode parasite, the larval stage of which encysts in the brain of sheep, goats and cattle causing an often fatal condition. The parasite also causes zoonotic infections in humans. Homologues of the recombinant oncosphere vaccine antigens from Taenia ovis and other Taenia species were identified in T. multiceps. Sequencing of the associated T. multiceps genes and cloning of the encoding mRNA has revealed conserved features in the genes and proteins. The T. multiceps oncosphere proteins, designated Tm16 and Tm18, contain a predicted secretory signal and fibronectin type III domain. The recombinant Tm16 and Tm18 proteins were successfully expressed in Escherichia coli as fusion proteins with GST. The antigens, formulated with Quil A adjuvant, were tested in a vaccine trial in sheep. The antigens stimulated immunity in sheep against challenge infection with T. multiceps eggs. Five of nine control sheep died due to a challenge infection with T. multiceps whereas none of 20 vaccinated animals died as a result of the parasite challenge (P = 0.001). In addition, vaccination with the Tm16 protein, or Tm16 plus Tm18, induced significant protection against the number of parasites encysting in the brain as a result of the challenge infection (P = 0.023, P = 0.015, respectively). No clear relationship was apparent between the level of specific serum antibody in vaccinated animals and either the presence or absence of parasites or the number of parasites that occurred in some of the vaccinated animals. We believe this study is the first description of recombinant vaccine-related investigations for T. multiceps. The recombinant oncosphere antigens identified may allow development of effective vaccination strategies against T. multiceps infection in sheep. They raise the potential for the development of a combined vaccine with the Echinococcus granulosus EG95 antigen for prevention of T. multiceps as well as preventing the transmission of cystic hydatid disease.

Gauci, Charles; Vural, Gulay; Oncel, Taraneh; Varcasia, Antonio; Damian, Veronica; Kyngdon, Craig T.; Craig, Philip S.; Anderson, Garry A.; Lightowlers, Marshall W.

2008-01-01

320

Taenia crassiceps WFU cysticerci synthesize corticosteroids in vitro: metyrapone regulates the production.  

PubMed

Taenia solium and Taenia crassiceps WFU cysticerci and tapeworms have the ability to synthesize sex steroid hormones and have a functional 3?-hydroxisteroid dehydrogenase. Corticosteroids (CS) like corticosterone and dexamethasone have been shown to stimulate in vitro estrogen production by Taenia crassiceps WFU cysticerci. The aim of this work was to study the ability of T. crassiceps WFU cysticerci to synthesize corticosteroids, and the effect of the inhibitor metyrapone on the CS synthesis. For this purpose T. crassiceps WFU cysticerci were obtained from the abdominal cavity of mice, thoroughly washed and pre-incubated in multiwells for 24 h in DMEM plus antibiotics/antimycotics. The tritiated CS precursor progesterone ((3)H-P4) was added to the culture media and parasites cultured for different periods. Blanks containing the culture media plus the (3)H-P4 were simultaneously incubated. Blanks and parasite culture media were ether extracted and analyzed by thin layer chromatography (TLC) in two different solvent systems. Corticosterone production was measured in the culture media by RIA. In some experiments metyrapone (0.1-0.5 mM) was added for 24, 48 or 72 h. Results showed that cysticerci mainly synthesized tritiated 11-deoxy corticosterone (DOC) and small amounts of corticosterone that was also detected by RIA. Small amounts of (3)H-11-deoxy cortisol were also found. Corticosteroid synthesis was time dependent. The addition of metyrapone significantly inhibited tritiated DOC, deoxycortisol and corticosterone synthesis. These results show for the first time that parasites have the capacity to synthesize CS that is modulated by metyrapone. Data suggest that DOC is the main corticosteroid in the parasites. PMID:22321721

Valdez, R A; Hinojosa, L; Gómez, Y; Willms, K; Romano, M C

2012-02-02

321

Purification, properties, and kinetic studies of cytoplasmic malate dehydrogenase from Taenia solium cysticerci  

Microsoft Academic Search

Malate dehydrogenase (l-malate: NAD oxidoreductase, EC 1.1.1.37) from the cytoplasm of Taenia solium cysticerci (cMDHTs) was purified 48-fold through a four-step procedure involving salt fractionation, ionic exchange, and dye affinity chromatography.\\u000a cMDHTs had a native M\\u000a r of 64,000, while the corresponding value per subunit, obtained under denaturing conditions, was 32,000. The enzyme is partially\\u000a positive, with an isoelectric point

Agustín Plancarte; Gabriela Nava; Guillermo Mendoza-Hernández

2009-01-01

322

Molecular identification of Taenia serialis coenurosis in a wild Ethiopian gelada (Theropithecus gelada).  

PubMed

Since morphological identification of a larval Taeniid in geladas (Theropithecus gelada) has produced inconsistent results, genetic information is pivotal for species identification. Nuclear and mitochondrial DNA from a coenurus in a wild gelada were compared to published sequences from multiple Taeniid species, confirming the identification of this parasite as Taenia serialis. A demographic analysis finds age to be a strong predictor of coenuri. Tapeworms rarely employ primates as intermediate hosts, and the presence of T. serialis in a wild gelada population may indicate a substantial ecological shift in this parasite's life cycle. PMID:24050944

Schneider-Crease, India A; Snyder-Mackler, Noah; Jarvey, Julie C; Bergman, Thore J

2013-08-29

323

Potential existence of a sylvatic cycle of Taenia ovis krabbei in Patagonia, Argentina.  

PubMed

Red deer (Cervus elaphus) were introduced in southern Latin America about a century ago and characteristics of the invasion raise concerns over their epidemiological role for various diseases. We report on the possible occurrence of Taenia ovis krabbei established in a sylvatic cycle in Patagonia. Hook characters, size, appearance, and location of a cysticercus from a wild red deer are consistent with Taenia ovis ovis or T. o. krabbei. Although it is not possible to differentiate between T. o. ovis and T. o. krabbei on morphological grounds with certainty, several biological characteristics indicate the cysticercus may belong to T. o. krabbei. Red deer have been reported to be refractory to T. o. ovis infection whereas other potential intermediate hosts like cattle, goats, pigs and sheep have been shown to be refractory to T. o. krabbei. Other native ungulates sympatric with red deer in Patagonia include Lama guanicoe and the endangered huemul deer (Hippocamelus bisulcus). Possible or known definitive hosts include native felids like Puma concolor, Felis colocolo, F. guigna and canids like Dusicyon griseus, D. culpaeus, and domestic dogs. PMID:16289565

Flueck, Werner T; Jones, Arlene

2005-11-11

324

Tamoxifen treatment in hamsters induces protection during taeniosis by Taenia solium.  

PubMed

Human neurocysticercosis by Taenia solium is considered an emergent severe brain disorder in developing and developed countries. Discovery of new antiparasitic drugs has been recently aimed to restrain differentiation and establishment of the T. solium adult tapeworm, for being considered a central node in the disease propagation to both pigs and humans. Tamoxifen is an antiestrogenic drug with cysticidal action on Taenia crassiceps, a close relative of T. solium. Thus, we evaluated the effect of tamoxifen on the in vitro evagination and the in vivo establishment of T. solium. In vitro, tamoxifen inhibited evagination of T. solium cysticerci in a dose-time dependent manner. In vivo, administration of tamoxifen to hamsters decreased the intestinal establishment of the parasite by 70%, while recovered tapeworms showed an 80% reduction in length, appearing as scolices without strobilar development. Since tamoxifen did not show any significant effect on the proliferation of antigen-specific immune cells, intestinal inflammation, and expression of Th1/Th2 cytokines in spleen and duodenum, this drug could exert its antiparasite actions by having direct detrimental effects upon the adult tapeworm. These results demonstrate that tamoxifen exhibits a strong cysticidal and antitaeniasic effect on T. solium that should be further explored in humans and livestock. PMID:23509701

Escobedo, Galileo; Palacios-Arreola, M Isabel; Olivos, Alfonso; López-Griego, Lorena; Morales-Montor, Jorge

2012-12-20

325

Light and electron-microscopic immunochemical analysis of nerve fibre types innervating the taenia of the guinea-pig caecum  

Microsoft Academic Search

The present work was undertaken to determine by immunocytochemical methods which of the putative enteric neurotransmitters are contained in axons supplying the guinea-pig taenia coli and what proportion of axons is accounted for by the presence of these substances. Numerous fibres displayed immunoreactivity for dynorphin (DYN), enkephalin (ENK), ?-aminobutyric acid (GABA), nitric oxide synthase (NOS), substance P (SP) and vasoactive

J. B. Furness; S. Pompolo; C. W. R. Shuttleworth; D. E. Burleigh

1992-01-01

326

Taenia crassiceps : Fatty acids oxidation and alternative energy source in in vitro cysticerci exposed to anthelminthic drugs  

Microsoft Academic Search

Cysticerci metabolic studies demonstrate alternative pathways responsible for its survival, such as energy sources, fatty acids oxidation and excretion of ?-hydroxybutirate, which indicates the capability of energy production from proteins. The aim of this study was to detect alternative metabolic pathways for energy production and its end products in Taenia crassiceps cysticerci in vitro exposed to praziquantel and albendazole, in

Marina Clare Vinaud; Cirlane Silva Ferreira; Ruy de Souza Lino Junior; José Clecildo Barreto Bezerra

2009-01-01

327

Tension maintenance, calcium content and energy production of the taenia of the guinea-pig caecum under hypoxia.  

PubMed Central

When potassium (45.4 mM) was applied to isolated taenia of guinea-pig caecum, the muscle developed a rapid phasic and sustained tonic tension during aerobic conditions bubbled with 95% O2:5% CO2. Under hypoxic conditions bubbled with 95% N2:5% CO2, the taenia lost its ability to respond to high potassium with sustained tonic contraction, although it still showed rapid phasic contraction. Raising the glucose concentration from 5.5 to 55.5 mM in the presence of high potassium during hypoxia caused development of a sustained contraction which was 50% that of the muscle in aerobic conditions. In the presence of high potassium, the ATP content of the taenia decreased in hypoxia, but increased with increasing glucose concentration. When the taenia was exposed to hypoxic conditions, the amount of lactate released from the muscle increased. Raising the glucose concentration caused a further increase in lactate release in the presence of high potassium under hypoxia. Good correlations (gamma greater than 0.9) were observed between tension development, the ATP content and lactate release of the taenia in the presence of high potassium under hypoxia when the glucose concentration was varied between 5.5 and 55.5 mM. The total calcium content was increased by the presence of high potassium under aerobic conditions and the increase was abolished when the muscle was exposed to hypoxic conditions. Under hypoxia the total calcium content was not increased by raising the glucose concentration in the presence of high potassium. The cellular calcium content of the taenia, determined by the lanthanum method, was increased in the presence of high potassium under aerobic and hypoxic conditions, but the content was smaller in hypoxic conditions than in aerobic conditions. Under hypoxic conditions, raising the glucose concentration in the presence of high potassium did not affect the cellular calcium content. These results suggest that under hypoxic conditions the potassium-induced sustained contraction of the taenia is increased by raising the glucose concentration owing to increased ATP production through the glycolytic pathway, but not through mechanisms increasing the intracellular Ca concentration.

Ishida, Y; Takagi, K; Urakawa, N

1984-01-01

328

Effects of hypoxia on high-energy phosphagen content, energy metabolism and isometric force in guinea-pig taenia caeci.  

PubMed Central

1. Previously, Ishida, Takagi & Urakawa (1984) reported that, in the presence of high K+ (45.4 mM) under hypoxia (95% N2-5% CO2 bubbling), tension and ATP content of the smooth muscle of the guinea-pig taenia caeci increased concomitantly when the glucose concentration was raised. Tension and energy metabolism of the taenia seemed to be closely correlated. In the present experiments, we investigated the metabolic changes during the relaxation phase after the taenia was exposed to hypoxia in the presence of high K+ by measuring the content of phosphagen, inorganic phosphate (Pi) and lactate in the tissue. Oxygen consumption and lactate release from the tissue were also determined to estimate the rate of ATP synthesis. 2. Under hypoxic conditions, high-K(+)-induced tension decreased to one-tenth of maximum in aerobic conditions (95% O2-5% CO2 bubbling); increasing the calcium concentration from 2.5 to 10 mM had no effect. To test receptor-associated stimuli, carbachol or histamine (both 5 microM) had little effect on tension in hypoxia. The calcium ionophore A23187 (10 microM) also did not produce any significant contraction in the presence of high K+ under hypoxia. 3. Hypoxia in the presence of high K+ elicited a rapid decrease in phosphocreatine, approximately in parallel with the decrease in tension. The ATP content decreased gradually while Pi content increased. Lactate content increased rapidly and then partially decreased. 4. The rate of ATP synthesis estimated from the oxygen consumption and lactate release of the taenia was linearly correlated with tension development under aerobic and hypoxic conditions. 5. These results suggest that the decrease in tension of the taenia observed under hypoxic conditions is due to an inhibition of energy metabolism, and not due to an oxygen-sensing step in excitation-contraction coupling.

Ishida, Y; Paul, R J

1990-01-01

329

Epidemiological survey of swine cysticercosis using ante-mortem and post-mortem examination tests in the southern highlands of Tanzania  

Microsoft Academic Search

Pig keeping is known to be popular in the regions of the southern highlands zone (Mbeya, Iringa and Ruvuma) of Tanzania where more than 60% of pigs under the small-scale production system are raised. However, no epidemiological surveys on porcine cysticercosis have been conducted in the zone in spite of unofficial reports indicating the disease to be a widespread problem.

M. E. Boa; E. A. Mahundi; A. A. Kassuku; A WILLINGHAMIII; N. C. Kyvsgaard

2006-01-01

330

A case-control study of risk factors for bovine cysticercosis in Danish cattle herds.  

PubMed

Bovine cysticercosis (BC) is a zoonotic, parasitic infection in cattle. Under the current EU meat inspection regulation, every single carcass from all bovines above 6 weeks of age is examined for BC. This method is costly and makes more sense in countries with higher number of BC-infected animals than in countries with few lightly infected cases per year. The aim of the present case-control study was to quantify associations between potential herd-level risk factors and BC in Danish cattle herds. Risk factors can be used in the design of a risk-based meat inspection system targeted towards the animals with the highest risk of BC. Cases (n = 77) included herds that hosted at least one animal diagnosed with BC at meat inspection, from 2006 to 2010. Control herds (n = 231) consisted of randomly selected herds that had not hosted any animals diagnosed with BC between 2004 and 2010. The answers from a questionnaire and register data from the Danish Cattle Database were grouped into meaningful variables and used to investigate the risk factors for BC using a multivariable logistic regression model. Case herds were almost three times more likely than control herds to let all or most animals out grazing. Case herds were more than five times more likely than control herds to allow their animals access to risky water sources with sewage treatment plant effluent in proximity. Case herds were also more likely to share machinery or hire contractors than control herds. The risk decreased with increasing herd size probably because the larger herds generally tend to keep cattle indoors in Denmark. The results are useful to guide future data recording that can be supplied by the farmer as food chain information and then be used for differentiated meat inspection in low- and high-risk groups, enabling development of risk-based meat inspection systems. PMID:22862807

Calvo-Artavia, F F; Nielsen, L R; Dahl, J; Clausen, D M; Graumann, A M; Alban, L

2012-08-02

331

Recombinant S3Pvac-phage anticysticercosis vaccine: Simultaneous protection against cysticercosis and hydatid disease in rural pigs.  

PubMed

This paper provides macroscopic and histological evidence on the statistically significant protective effects of S3Pvac-phage vaccination against porcine cysticercosis and hydatidosis. The study included 391 rustically bred pigs (187 vaccinated and 204 controls). Vaccination significantly reduced the prevalence of cysticercosis by 61.7%. Vaccination also significantly reduced by 56.1% the prevalence of hydatidosis caused by Echinococcus granulosus in pigs. The presence of the vaccine epitopes in both cestodes is probably involved in the cross-protection observed. Increased inflammation was found in 5% of cysticerci recovered from controls, versus 24% from vaccinated pigs (P<0.01). Hydatid cysts were non-inflammatory in either group. Vaccination was effective to prevent one single disease, but it failed to prevent the simultaneous infections with both parasites in a same pig. The widening of the S3Pvac-phage vaccine protective repertoire to include hydatidosis is a convenient feature that should reduce the prevalence of two frequent zoonoses that affect rustic porcine breading with a single action. Thus, the costs of two different vaccination programs would be reduced to a single one with significant reduction in both zoonoses. PMID:21251758

Morales, Julio; de Aluja, Aline S; Martínez, Jose Juan; Hernández, Marisela; Rosas, Gabriela; Villalobos, Nelly; Hernández, Beatriz; Blancas, Abel; Manoutcharian, Karen; Gevorkian, Goar; Cervantes, Jacquelynne; Díaz, Alicia; Fleury, Agnes; Fragoso, Gladis; Larralde, Carlos; Sciutto, Edda

2010-10-27

332

Epidemiology of Taenia solium in Nepal: is it influenced by the social characteristics of the population and the presence of Taenia asiatica?  

PubMed

The transmission of the zoonotic pork tapeworms Taenia solium and T. asiatica depends on a combination of specific risk factors, such as open defecation, backyard pig raising and the consumption of raw or undercooked pork and viscera. A community-based survey was conducted among 289 households in south-eastern Nepal to study the heterogeneity of these risk factor frequencies as a function of the social composition of the population. The frequency of open defecation, backyard pig raising and pork consumption differed significantly (P < 0.005) among the different coexisting caste and ethnic groups. In the same survey, the taeniosis prevalence was examined among the different groups. Tapeworm carriers were identified at a high prevalence among the Dum, one of the most disadvantaged communities of Nepal. A PCR-RFLP assay revealed that all collected tapeworm specimens were T. asiatica, a species thus far not known to occur in South Asia. These results can help to understand the epidemiology of T. solium in Nepal, which appears to be more complex than thought so far. PMID:22643112

Devleesschauwer, Brecht; Aryal, Arjun; Joshi, Durga Datt; Rijal, Suman; Sherchand, Jeevan Bahadur; Praet, Nicolas; Speybroeck, Niko; Duchateau, Luc; Vercruysse, Jozef; Dorny, Pierre

2012-05-30

333

Permeability studies on taeniid metacestodes: II. Antibody-mediated effects on membrane permeability in larvae of Taenia taeniaeformis and Taenia crassiceps.  

PubMed

Incubation in immune rat serum (IRS) was shown to increase the rate of absorption of 125I RNase-A but not 125I BSA by larvae of Taenia taeniaeformis and T. crassiceps. This effect required a heat labile factor in serum, and partial activity could be restored in heat-treated IRS by adding normal rat serum (NRS) as a source of complement. In addition, the effectiveness of IRS in altering permeability was shown to be dependent on the concentration of functional complement. Both live and dead larvae incubated in NRS rapidly depleted hemolytic complement levels in the surrounding medium. Immunoglobulin fractions from IRS separated by anion exchange chromatography and and gel filtration were tested in the presence of excess complement for their ability to affect uptake of 125I RNase-A. Enhanced permeability was observed in larvae incubated in each fraction. The results show that antibodies in conjunction with complement are capable of disrupting larval permeability control in vitro. The observation that larvae were able to restore normal control as complement levels declined suggests that the parasites may overcome this immunologic effector mechanism by interfering with complement function. PMID:859087

Hustead, S T; Williams, J F

1977-04-01

334

Diagnosis of Neurocysticercosis by Detection of Taenia solium DNA Using a Global DNA Screening Platform  

PubMed Central

Neurocysticercosis is caused by Taenia solium infection of the brain. Diagnosis is most often made by visualization of the parasitic scolex by magnetic resonance imaging of the brain or by characteristic neuroimaging findings with serologic test results positive for T. solium. A patient who presents with a solitary brain lesion usually poses a diagnostic dilemma, because the differential diagnosis often includes neurocysticercosis and other infections or neoplasm. Although the sensitivity of serologic testing for T. solium approaches 100% in patients with multiple intraparenchymal cysts, the sensitivity of testing for patients with solitary cysts is <50%, which makes serologic testing a less useful diagnostic tool for patients with solitary central nervous system (CNS) lesions. We describe 2 patients with solitary CNS lesions who received a neurocysticercosis diagnosis after identification of T. solium DNA in brain biopsy tissue with use of a global DNA screening platform. Global screening is a promising tool for the diagnosis of CNS infection, especially when traditional diagnostic tools are insensitive.

Harrington, Amanda T.; Creutzfeldt, Claire J.; SenGupta, Dhruba J.; Hoogestraat, Daniel R.; Zunt, Joseph R.; Cookson, Brad T.

2009-01-01

335

[The influence of Taenia taeniaeformis larval infection on morphometrical parameters of muskrat (Ondatra zibethicus)].  

PubMed

An investigation aimed to check the influence of Taenia taeniaeformis larvae on morphometrical parameters of muskrat (Ondatra zibethicus) was carried. A total of 30 animals were hunted down in upper Vistula river basin in south Poland, then measured, weighed and dissected. Statistical comparison were done using U Mann-Whitney test. T. taeniaeformis larvae--cysticercus fasciolaris was found in the liver of 24 muskrats (80%). Significant differences between infected and non infected animals are reported, as regards their body mass, total length, abdomen circumference (p < 0.01) and also in body length (total minus tail length), head length, or chest and neck circumference (p < 0.05). The effect of infection on both muskrat condition and the presence of adult cestodes in definitive hosts are discussed. PMID:20707301

Kowal, Jerzy; Nosa?, Pawe?; Adamczyk, Ireneusz; Korna?, S?awomir; Wajdzik, Marek; Tomek, Andrzej

2010-01-01

336

A phylogenetic hypothesis for the distribution of two genotypes of the pig tapeworm Taenia solium worldwide.  

PubMed

Genetic polymorphism was determined among 13 isolates of Taenia solium from various regions using PCR-amplified sequences of 2 mitochondrial genes: cytochrome c oxidase subunit 1 and cytochrome b. The 2 phylogenies obtained were similar to each other regardless of the genes examined. The isolates from Asia (China, Thailand, Irian Jaya and India) formed a single cluster, whereas the isolates from Latin America (Mexico, Peru, Ecuador, Bolivia and Brazil) combined with those from Africa (Tanzania, Mozambique and Cameroon) to form an additional cluster. These results and historical data of swine domestication, distribution of pigs and colonization suggest that T. solium was introduced recently into Latin America and Africa from different regions of Europe during the colonial age, which started 500 years ago, and that the tapeworm of another origin independently spread in Asian countries. PMID:12118722

Nakao, M; Okamoto, M; Sako, Y; Yamasaki, H; Nakaya, K; Ito, A

2002-06-01

337

Hypoxia-induced inhibition of calcium channels in guinea-pig taenia caeci smooth muscle cells.  

PubMed Central

1. The effects of hypoxia on whole-cell current in single smooth muscle cells and on a high K(+)-induced contraction of strips of the guinea-pig taenia caeci were studied. 2. In physiological salt solution (PSS) and K(+)-based pipette solution, hypoxia (PO2 = 20 mmHg) reversibly inhibited both the inward Ca2+ current (ICa) and outward Ca(2+)-activated K+ current (IK(Ca)) components of the whole-cell current. 3. In PSS and Cs(+)-based pipette solution, hypoxia reversibly suppressed ICa by 30 +/- 5% at 0 mV. 4. When Ba2+ was used as a charge carrier, the IBa was suppressed by hypoxia in a potential-dependent manner, with the maximum of 40 +/- 7% at +10 mV. Alterations of concentrations of EGTA, GDB beta S or ATP in the pipette solution did not change the inhibitory effects of hypoxia on ICa and IBa. 5. In PSS with 2 mM CaCl2 replaced by CoCl2, hypoxia did not affect the Ca2+ influx-independent potassium current. 6. In cells voltage clamped at -20 mV hypoxia reversibly inhibited the spontaneous transient outward currents. 7. The response of high K(+)-contracted taenia caeci to hypoxia was composed of an initial rapid relaxation followed by a small transient contraction and slow relaxation. The transient contraction was blocked by atropine (1-10 microM), while relaxations were unaffected by atropine and guanethidine (10 microM). 8. The results show that hypoxia reversibly inhibits ICa and secondarily suppresses IK(Ca) due to decreased Ca2+ influx through Ca2+ channels. 9. It is suggested that inhibition of ICa was responsible for the rapid relaxation, whereas transient contraction may have been due to release of acetylcholine from nerve terminals upon hypoxia.

Rekalov, V; Juranek, I; Malekova, L; Bauer, V

1997-01-01

338

Quantitative screening for anticestode drugs based on changes in baseline enzyme secretion by Taenia crassiceps.  

PubMed

Neurocysticercosis (NCC), an infection of the brain with the larval stage of the Taenia solium tapeworm, is responsible for an estimated one-third of adult-onset epilepsy cases in regions of the world where it is endemic. Currently, anthelmintic drugs used for treatment of NCC are only partially effective, and there is, therefore, a pressing need for new therapeutic agents. Discovery of new anthelmintics with activity against T. solium has been limited by the lack of suitable sensitive assays that allow high-throughput screening. Using an in vitro culture system with Taenia crassiceps metacestodes, we demonstrate that changes in secretion of parasite-associated alkaline phosphatase (AP) and phosphoglucose isomerase (PGI) can be used to detect and quantify anthelmintic effects of praziquantel (PZQ), a drug with activity against T. solium. We applied two enzyme release assays to screen for anti-T. crassiceps activity in nonconventional antiparasitic drugs and demonstrate that nitazoxanide and artesunate induced release of both AP and PGI in differing time- and dose-related patterns. Furthermore, imatinib, a tyrosine kinase inhibitor previously reported to have parasiticidal activity against Schistosoma mansoni, also induced release of both AP and PGI in a dose-dependent manner, similar in pattern to that observed with the other anthelmintics. We also evaluated release of ATP into cyst supernatants as an indicator of drug effects but did not see any differences between treated and untreated cysts. These data provide the basis for rapid and quantitative screening assays for testing for anthelmintic activity in candidate anticestode agents. PMID:23229489

Mahanty, Siddhartha; Madrid, Elise M; Nash, Theodore E

2012-12-10

339

Epidemiologic and economic evaluation of risk-based meat inspection for bovine cysticercosis in Danish cattle.  

PubMed

Under the current EU meat inspection regulation, every single carcase from all bovines above 6 weeks of age has to be examined for bovine cysticercosis (BC). This is time-consuming, costly, and is of limited value in countries with low prevalence. The aim of this study was to develop a stochastic simulation model for analysis of tentative risk-based meat inspection systems for BC in Danish cattle with regard to system sensitivity (SSSe), specificity and potential monetary benefits compared to the current system, which has an estimated SSSe of 15%. The relevant risk factors used to construct three alternative scenario trees were identified from previous Danish risk factor studies (1) gender, (2) grazing and (3) access to risky water sources. Thus, females, animals that had been grazing or animals with access to risky water sources were considered high-risk and would be subjected to invasive inspection at meat inspection. All animals in the low-risk groups (i.e. males, non-grazing or no access to risky water sources, respectively) would be subjected to visual inspection only. It was assumed that half of the cattle were slaughtered in abattoirs that would be able to reorganise the work at the slaughterline, allowing them to do with one meat inspector less. All abattoirs would gain on the price of sold uncut beef from the masseter muscles from visually inspected cattle. Under these assumptions, using gender and grazing were preferable due to them having SSSe only slightly lower than the current system, and highest effectiveness ratios, but they had a lower net economic effect (NEE) than the scenario using risky water sources. Using gender to differentiate high and low-risk groups was judged preferable over grazing due to feasibility, because the information is readily available at the slaughter line. The exact total NEE for the cattle sector depends on how many and which of the abattoirs that would be able to reorganise the work at the slaughter line to save money on inspection of the head of carcases. Overall, the SSSe was low in all scenarios leading to undetected BC-positive cattle both in the current meat inspection and under the investigated risk-based meat inspection systems. Therefore, improving the sensitivity of the methods used for inspection of high-risk cattle would be beneficial. PMID:23182031

Calvo-Artavia, F F; Nielsen, L R; Alban, L

2012-11-22

340

Efecto de algunos agentes físicos y químicos sobre el metacéstodo de Taenia solium presente en carne adobada y chorizo  

Microsoft Academic Search

Rivera-Guerrero MI, Sánchez-Rueda L, Rodríguez-Bataz E, Martínez-Villalobos AN, Martínez-Maya JJ. Efecto de algunos agentes físicos y químicos sobre el metacéstodo de Taenia solium presente en carne adobada y chorizo. Salud Publica Mex 2004;46:425-429. El texto completo en inglés de este artículo está disponible en: http:\\/\\/www.insp.mx\\/salud\\/index.html Resumen Objetivo. Evaluar el efecto de diferentes temperaturas y tiempos, así como de algunos condimentos

Ma Isabel Rivera-Guerrero; Leticia Sánchez-Rueda

2004-01-01

341

Identification and cDNA cloning of two novel low molecular weight host-protective antigens from Taenia ovis oncospheres  

Microsoft Academic Search

Oncosphere antigens of Taenia ovis were solubilised in sodium dodecyl sulphate and separated by electrophoresis in polyacrylamide gels (SDS-PAGE). Antigen-containing gel fractions cut from the region covering 18–12 kDa were shown to be highly immunogenic in sheep challenge experiments. Specific antisera against 2 candidate antigens at 18 and 16 kDa were used to screen a cDNA library prepared from T.

G. B. L. Harrison; D. D. Heath; R. P. Dempster; C. Gauci; S. E. Newton; W. G. Cameron; C. M. Robinson; S. B. Lawrence; M. W. Lightowlers; M. D. Rickard

1996-01-01

342

Cloning, sequencing and functional expression of cytosolic malate dehydrogenase from Taenia solium: Purification and characterization of the recombinant enzyme  

Microsoft Academic Search

We report herein the complete coding sequence of a Taenia solium cytosolic malate dehydrogenase (TscMDH). The cDNA fragment, identified from the T. solium genome project database, encodes a protein of 332 amino acid residues with an estimated molecular weight of 36517Da. For recombinant expression, the full length coding sequence was cloned into pET23a. After successful expression and enzyme purification, isoelectrofocusing

Gabriela Nava; Juan P. Laclette; Raúl Bobes; Julio C. Carrero; Horacio Reyes-Vivas; Sergio Enriquez-Flores; Guillermo Mendoza-Hernández; Agustín Plancarte

2011-01-01

343

Phylogenetic relationships within Echinococcus and Taenia tapeworms (Cestoda: Taeniidae): an inference from nuclear protein-coding genes.  

PubMed

The family Taeniidae of tapeworms is composed of two genera, Echinococcus and Taenia, which obligately parasitize mammals including humans. Inferring phylogeny via molecular markers is the only way to trace back their evolutionary histories. However, molecular dating approaches are lacking so far. Here we established new markers from nuclear protein-coding genes for RNA polymerase II second largest subunit (rpb2), phosphoenolpyruvate carboxykinase (pepck) and DNA polymerase delta (pold). Bayesian inference and maximum likelihood analyses of the concatenated gene sequences allowed us to reconstruct phylogenetic trees for taeniid parasites. The tree topologies clearly demonstrated that Taenia is paraphyletic and that the clade of Echinococcus oligarthrus and Echinococcusvogeli is sister to all other members of Echinococcus. Both species are endemic in Central and South America, and their definitive hosts originated from carnivores that immigrated from North America after the formation of the Panamanian land bridge about 3 million years ago (Ma). A time-calibrated phylogeny was estimated by a Bayesian relaxed-clock method based on the assumption that the most recent common ancestor of E. oligarthrus and E. vogeli existed during the late Pliocene (3.0 Ma). The results suggest that a clade of Taenia including human-pathogenic species diversified primarily in the late Miocene (11.2 Ma), whereas Echinococcus started to diversify later, in the end of the Miocene (5.8 Ma). Close genetic relationships among the members of Echinococcus imply that the genus is a young group in which speciation and global radiation occurred rapidly. PMID:21907295

Knapp, Jenny; Nakao, Minoru; Yanagida, Tetsuya; Okamoto, Munehiro; Saarma, Urmas; Lavikainen, Antti; Ito, Akira

2011-08-28

344

Steroid synthesis by Taenia crassiceps WFU cysticerci is regulated by enzyme inhibitors.  

PubMed

Cysticerci and tapeworms from Taenia crassiceps WFU, ORF and Taenia solium synthesize sex-steroid hormones in vitro. Corticosteroids increase the 17?-estradiol synthesis by T. crassiceps cysticerci. T. crassiceps WFU cysticerci synthesize corticosteroids, mainly 11-deoxycorticosterone (DOC). The aim of this work was to investigate whether classical steroidogenic inhibitors modify the capacity of T. crassiceps WFU cysticerci to synthesize corticosteroids and sex steroid hormones. For this purpose, T. crassiceps WFU cysticerci were obtained from the abdominal cavity of mice, pre-cultured for 24h in DMEM+antibiotics/antimycotics and cultured in the presence of tritiated progesterone ((3)H-P4), androstendione ((3)H-A4), or dehydroepiandrosterone ((3)H-DHEA) plus different doses of the corresponding inhibitors, for different periods. Blanks with the culture media adding the tritiated precursors were simultaneously incubated. At the end of the incubation period, parasites were separated and media extracted with ether. The resulting steroids were separated by thin layer chromatography (TLC). Data were expressed as percent transformation of the tritiated precursors. Results showed that after 2h of exposure of the cysticerci to 100 ?M formestane, the (3)H-17?-estradiol synthesis from tritiated androstenedione was significantly inhibited. The incubation of cysticerci in the presence of (3)H-DHEA and danazol (100 nM) resulted in (3)H-androstenediol accumulation and a significant reduction of the 17?-estradiol synthesis. The cysticerci (3)H-DOC synthesis was significantly inhibited when the parasites were cultured in the presence of different ketoconazole dosis. The drug treatments did not affect parasite's viability. The results of this study showed that corticosteroid and sex steroid synthesis in T. crassiceps WFU cysticerci can be modified by steroidogenic enzyme inhibitors. As was shown previously by our laboratory and others, parasite survival and development depends on sex steroids, therefore the inhibition of their synthesis is a good starting point exploited in situations where the inhibition of steroidogenesis could help to control the infection for the development of new treatments, or replacement of the usual therapy in resistant parasite infections. We raise the possibility that these drug actions may be beneficially. PMID:23608546

Aceves-Ramos, A; Valdez, R A; Gaona, B; Willms, K; Romano, M C

2013-04-20

345

Diffusion and distribution of dimethyl sulphoxide in the isolated guinea-pig taenia coli  

PubMed Central

1. The diffusion of the cryoprotective non-electrolyte dimethyl sulphoxide (DMSO) in the isolated guinea-pig taenia coli at 37, 25 and 0° C has been studied using [35S]DMSO. 2. Within 1 hr after immersion at 37° C in Krebs solution containing 20% (w/v) DMSO and trace amounts of [35S]DMSO, the non-electrolyte was distributed uniformly throughout a volume equivalent to the total initial water content of the muscle. 3. The kinetics of efflux of [35S]DMSO from muscles at constant volume were analysed on the basis of two models: one incorporated radial diffusion in extracellular fluid with simultaneous permeation into the cells, the other involved only radial diffusion in homogeneous cylinders of tissue having no internal barriers to diffusion; the former was found to give a better representation of the efflux kinetics. 4. If it was assumed that the rate of diffusion of DMSO in the extracellular space of taenia coli was the same as that in the bathing medium, the values of the extracellular space and the permeability of smooth muscle to DMSO, obtained from the analysis of the efflux kinetics, were 454 ± 19 ml./kg and 2·36 ± 0·05 × 10-6 cm sec-1 at 37° C. 5. The activation energy for the transfer of DMSO across the surface of the cell was estimated to be 6·0 kcal/mole at 37° C, 6·6 kcal/mole at 25° C and 11·6 kcal/mole at 0° C, indicating either that the equivalent pore radius of the cells decreased with temperature or that the cell permeability represented the sum of two fluxes, one through the aqueous pores of the cell and the other through the lipid phase of the cell membrane, each with a different energy of activation. 6. A net flux of water across the surface of the cells, superimposed on the efflux of DMSO, markedly affected the rate of diffusion of the non-electrolyte out of the whole tissue; however, it was considered that an analysis of the efflux kinetics was not possible under these conditions. 7. These results provide a basis for methods which will be used to investigate the possibility of preserving tissue in unfrozen aqueous media at sub-zero temperatures.

Elford, B. C.

1970-01-01

346

Caffeine and Excitation-Contraction Coupling in the Guinea Pig Taenia Coli  

PubMed Central

The effects of caffeine (0.2–10 mM) on the electrical and mechanical activities of guinea pig taenia coli were investigated with the double sucrose-gap method. Caffeine evoked a small tension with a latency of 20–30 sec, then phasic contraction developed and finally relaxation. The initial tension development also appeared in the Na-free solution without any marked changes in the membrane potential and membrane resistance. The phasic contraction disappeared in the Na-free solution. The relaxation in the presence of caffeine was accompanied by depolarization block of the spike generation. The minimum concentration of Ca ion needed to evoke the tension development by the caffeine was 10-7 M. Caffeine also potentiated the twitch tension below a concentration of 5 mM either in the Na-free solution or at low temperature (5°C). NO3- and Br- showed a similar response to caffeine on the potentiation of the twitch tension at low temperature.

Ito, Y.; Kuriyama, H.

1971-01-01

347

Characterization of the carbohydrate components of Taenia solium oncosphere proteins and their role in the antigenicity.  

PubMed

This study examines the carbohydrate composition of Taenia solium whole oncosphere antigens (WOAs), in order to improve the understanding of the antigenicity of the T. solium. Better knowledge of oncosphere antigens is crucial to accurately diagnose previous exposure to T. solium eggs and thus predict the development of neurocysticercosis. A set of seven lectins conjugates with wide carbohydrate specificity were used on parasite fixations and somatic extracts. Lectin fluorescence revealed that D-mannose, D-glucose, D-galactose and N-acetyl-D-galactosamine residues were the most abundant constituents of carbohydrate chains on the surface of T. solium oncosphere. Lectin blotting showed that posttranslational modification with N-glycosylation was abundant while little evidence of O-linked carbohydrates was observed. Chemical oxidation and enzymatic deglycosylation in situ were performed to investigate the immunoreactivity of the carbohydrate moieties. Linearizing or removing the carbohydrate moieties from the protein backbones did not diminish the immunoreactivity of these antigens, suggesting that a substantial part of the host immune response against T. solium oncosphere is directed against the peptide epitopes on the parasite antigens. Finally, using carbohydrate probes, we demonstrated for the first time that the presence of several lectins on the surface of the oncosphere was specific to carbohydrates found in intestinal mucus, suggesting a possible role in initial attachment of the parasite to host cells. PMID:23982308

Arana, Yanina; Verastegui, Manuela; Tuero, Iskra; Grandjean, Louis; Garcia, Hector H; Gilman, Robert H

2013-08-28

348

Fatty acid compositions of Taenia solium metacestode and its surrounding tissues.  

PubMed

Fatty acids (FAs) are the main energy sources of living organisms and are the major components of cellular and organelle membranes. Their compositions also affect the flexibility/rigidity of cells and cell vitality. The Taenia solium metacestode (TsM) causes neurocysticercosis (NC), which is one of the most common helminthic infections of the central nerve system. We investigated the FA composition of the cyst fluid (CF) and parenchyma of the TsM, together with those of the granuloma and swine tissue surrounding the granuloma. The FA fractions of the TsM CF and swine tissue showed a composition and proportional contents comparable to each other, in which C18:0 (stearic acid), C18:1n9c (oleic acid), C20:4 (arachidonic acid) and C16:0 (palmitic acid) constituted the major fractions. However, the relative amount of individual FAs of the TsM parenchyma and granuloma differed from those of TsM CF and swine tissue, which contained enriched C16:0 and a lower amount of C20:4. Saturated FAs were the major constituents in parenchyma and granuloma, 50.4% and 46.1%, respectively. Conversely, monounsaturated FAs were the major constituents of CF and swine tissue, 38.7% and 40.3%, respectively. Our results strongly suggest that host-derived FAs might translocate across the parasite syncytial membrane and be stored in the CF. PMID:22971473

Kim, Seon-Hee; Bae, Young-An; Nam, Jin-Sik; Yang, Yichao; Nawa, Yukifumi; Kong, Yoon

2012-08-29

349

Characterization of a monoclonal antibody that specifically inhibits triosephosphate isomerase activity of Taenia solium.  

PubMed

In the present study, we obtained and characterized partially a monoclonal antibody (4H11D10B11 mAb) against triosephosphate isomerase from Taenia solium (TTPI). This antibody recognized the enzyme by both ELISA and western blot and was able to inhibit its enzymatic activity in 74%. Moreover, the antigen-binding fragments (Fabs), products of digestion of the monoclonal antibody with papain, retained almost the same inhibitory effect. We determined the binding site by ELISA; synthetic peptides containing sequences from different non-conserved regions of the TTPI were confronted to the 4H11D10B11 mAb. The epitope recognized by the monoclonal antibody was located on peptide TTPI-56 (ATPAQAQEVHKVVRDWIRKHVDAGIADKARI), and an analysis of mimotopes, obtained with the 4H11D10B11 mAb, suggests that the epitope spans the sequence WIRKHVDAGIAD, residues 193-204 of the enzyme. This epitope is located within helix 6, next to loop 6, an essential active loop during catalysis. The antibody did not recognize triosephosphate isomerase from man and pig, definitive and intermediary hosts of T. solium, respectively. Furthermore, it did not bind to the catalytic site, since kinetic analysis demonstrated that inhibition had a non-competitive profile. PMID:23707345

Víctor, Sanabria-Ayala; Yolanda, Medina-Flores; Araceli, Zavala-Carballo; Lucía, Jiménez; Abraham, Landa

2013-05-21

350

In vivo albendazole treatment of Taenia crassiceps cysticerci strain WFU: proliferation, damage, and recovery.  

PubMed

Taenia crassiceps has been widely experimented as a model for in vitro and in vivo studies on drug responses. The purpose of this study was to treat BALB/c mice infected with T. crassiceps strain WFU with commercially available albendazole and to analyze the reduction in parasite infrapopulations. Here, we describe the reduction and apparent damage of T. crassicceps WFU cysticerci in infected mice after antihelminthic drug treatment and subsequent inoculation of those treated parasites into a naïve host. We were able to reduce significantly the parasite counts to 33 and 48 % after albendazole treatment for 20 or 25 days and compared with the untreated mice. We also observed morphological damage such as the partial blebbing in the tegument and parenchyma of treated parasites, as well as disorganized musculature and the loss of cell membranes in subtegumental tissue section. However, larvae from albendazole-treated mice inoculated into the next host were able to become re-established in the next murine host due, probably, to the survival of proliferative parasite cells. PMID:24005476

Zurabian, R; Aguilar-Vega, L; Terrones Vargas, E; Cervera Hernández, M E; Willms, K; Ruíz-Velasco Acosta, S

2013-09-05

351

Seroprevalence of antibodies against Taenia solium cysticerci among refugees resettled in United States.  

PubMed

Neurocysticercosis (NCC) is a disease caused by central nervous system infection by the larval stage of the pork tapeworm, Taenia solium. In developing countries, NCC is a leading cause of adult-onset epilepsy. Case reports of NCC are increasing among refugees resettled to the United States and other nations, but the underlying prevalence among refugee groups is unknown. We tested stored serum samples from the Centers for Disease Control and Prevention Migrant Serum Bank for antibodies against T. solium cysts by using the enzyme-linked immunoelectrotransfer blot. Seroprevalence was high among all 4 populations tested: refugees from Burma (23.2%), Lao People's Democratic Republic (18.3%), Bhutan (22.8%), and Burundi (25.8%). Clinicians caring for refugee populations should suspect NCC in patients with seizure, chronic headache, or unexplained neurologic manifestations. Improved understanding of the prevalence of epilepsy and other associated diseases among refugees could guide recommendations for their evaluation and treatment before, during, and after resettlement. PMID:22377408

O'Neal, Seth E; Townes, John M; Wilkins, Patricia P; Noh, John C; Lee, Deborah; Rodriguez, Silvia; Garcia, Hector H; Stauffer, William M

2012-03-01

352

Taenia crassiceps Infection Does Not Influence the Development of Experimental Rheumatoid Arthritis  

PubMed Central

It was previously reported by our group that infection with Taenia crassiceps reduces incidence and severity of inflammatory and autoimmune experimental diseases like type 1 diabetes and experimental autoimmune encephalomyelitis. In this research, we set out to study whether infection with T. crassiceps would affect the development of experimental rheumatoid arthritis (RA). We found that mice infected with the parasite and induced with experimental RA showed similar clinical scores as the noninfected experimental RA group; systemic cytokines were not affected while anti-CII Abs were higher in the infected group. Histological evaluation showed damage in both infected and noninfected experimental RA-induced groups and although some surface molecules such as PDL-2 and MR which are associated with immunomodulatory mechanisms were upregulated in the infected and RA-induced group as compared to the noninfected RA group, they did not exert any changes in the outcome of experimental RA. Thus, we determined that infection with T. crassiceps does not influence the outcome of experimental RA.

Ortiz-Flores, Aaxin M.; Ledesma-Soto, Yadira; Calleja, Elsa A.; Rodriguez-Sosa, Miriam; Juarez, Imelda; Terrazas, Luis I.

2013-01-01

353

Development of a Taenia ovis transmission model and an assessment of control strategies.  

PubMed

The metacestode stage of the tapeworm, Taenia ovis, causes cystic lesions in the skeletal and cardiac muscle of sheep, which can result in the condemnation of the entire carcass. In recent years, Canadian farms have seen a marked increase in the number of condemnations due to T. ovis. Mathematical transmission models provide a useful tool for predicting parasite transmission and for evaluating the efficacy of potential control options. To date, no model has been developed exclusively for T. ovis. In the work described here, a compartmental, deterministic transmission model was developed to better understand the transmission dynamics of T. ovis on Canadian sheep farms. The model was intended to be practical, and represent the transmission of infection burdens in lambs that result in carcass condemnation, or transmission to canids. All transmission parameters were obtained from the literature or, when unavailable, expert opinion. The model incorporated each stage of the parasite lifecycle using the most probable transmission route on Canadian sheep farms; including definitive host (guard dogs), intermediate host (pastured lambs), and environment. Based on literature, the model performed as expected, and provided a reasonable estimate of parasite prevalence in lambs. In addition, modeling allowed the efficacy of potential control options to be evaluated and compared. Model simulations suggested that infection risk in market lambs could be eliminated through the regular treatment of guardian dogs every fifth week with an appropriate cestocide, or through eliminating carcass consumption by guardian dogs. PMID:23993638

Dewolf, Bradley D; Poljak, Zvonimir; Peregrine, Andrew S; Jones-Bitton, Andria; Jansen, Jocelyn T; Menzies, Paula I

2013-08-08

354

Complete mitochondrial genomes of Taenia multiceps, T. hydatigena and T. pisiformis: additional molecular markers for a tapeworm genus of human and animal health significance  

PubMed Central

Background Mitochondrial genomes provide a rich source of molecular variation of proven and widespread utility in molecular ecology, population genetics and evolutionary biology. The tapeworm genus Taenia includes a diversity of tapeworm parasites of significant human and veterinary importance. Here we add complete sequences of the mt genomes of T. multiceps, T. hydatigena and T. pisiformis, to a data set of 4 published mtDNAs in the same genus. Seven complete mt genomes of Taenia species are used to compare and contrast variation within and between genomes in the genus, to estimate a phylogeny for the genus, and to develop novel molecular markers as part of an extended mitochondrial toolkit. Results The complete circular mtDNAs of T. multiceps, T. hydatigena and T. pisiformis were 13,693, 13,492 and 13,387 bp in size respectively, comprising the usual complement of flatworm genes. Start and stop codons of protein coding genes included those found commonly amongst other platyhelminth mt genomes, but the much rarer initiation codon GTT was inferred for the gene atp6 in T. pisiformis. Phylogenetic analysis of mtDNAs offered novel estimates of the interrelationships of Taenia. Sliding window analyses showed nad6, nad5, atp6, nad3 and nad2 are amongst the most variable of genes per unit length, with the highest peaks in nucleotide diversity found in nad5. New primer pairs capable of amplifying fragments of variable DNA in nad1, rrnS and nad5 genes were designed in silico and tested as possible alternatives to existing mitochondrial markers for Taenia. Conclusions With the availability of complete mtDNAs of 7 Taenia species, we have shown that analysis of amino acids provides a robust estimate of phylogeny for the genus that differs markedly from morphological estimates or those using partial genes; with implications for understanding the evolutionary radiation of important Taenia. Full alignment of the nucleotides of Taenia mtDNAs and sliding window analysis suggests numerous alternative gene regions are likely to capture greater nucleotide variation than those currently pursued as molecular markers. New PCR primers developed from a comparative mitogenomic analysis of Taenia species, extend the use of mitochondrial markers for molecular ecology, population genetics and diagnostics.

2010-01-01

355

Evidence that nitric oxide acts as an inhibitory neurotransmitter supplying taenia from the guinea-pig caecum  

PubMed Central

Nitric oxide synthase-containing nerve fibres are abundant within taenia of the guinea-pig caecum, but there is little previous evidence supporting a direct role for nitric oxide (NO) in responses to enteric inhibitory nerve stimulation. In this study we have attempted to identify an NO-dependent component of inhibitory transmission in isolated taenia coli.Isometric tension was recorded in the presence of atropine and guanethidine (both 1??M). Tone was raised with histamine (1??M), and intrinsic inhibitory neurons stimulated using either a nicotinic agonist (1,1-dimethyl-4-phenylpiperazinium iodide; DMPP) or electrical field stimulation (EFS).DMPP (1–100??M) produced concentration-dependent biphasic relaxations, comprising an initial peak relaxation followed by a sustained relaxation. Responses to DMPP were antagonized by tetrodotoxin (1??M) or apamin (0.3??M) and abolished by hexamethonium (300??M). L-nitro-arginine (L-NOARG; 100??M) and oxyhaemoglobin (2%) both significantly reduced sustained relaxations produced by DMPP.EFS (5?Hz, 30?s) also produced biphasic relaxations. Both L-NOARG and an inhibitor of soluble guanylate cyclase (ODQ, 1–10??M) reduced the sustained component of EFS responses.Two NO donors, sodium nitroprusside (SNP) and diethylenetriamine-nitric oxide adduct (DENO), produced concentration-dependent relaxations. Responses to SNP and DENO were antagonized by ODQ (1??M) and by apamin (0.3??M).These results suggest that NO contributes directly to a component of inhibitory transmission in guinea-pig taenia coli. The actions of NO appear to be mediated via cyclic GMP synthesis, and may involve activation of small conductance calcium activated K+ channels. A role for NO is most evident during sustained relaxations evoked by longer stimulus trains or chemical stimulation of intrinsic neurons.

Shuttleworth, C W R; Sweeney, K M; Sanders, K M

1999-01-01

356

Tribendimidine and Albendazole for Treating Soil-Transmitted Helminths, Strongyloides stercoralis and Taenia spp.: Open-Label Randomized Trial  

PubMed Central

Background Tribendimidine is an anthelminthic drug with a broad spectrum of activity. In 2004 the drug was approved by Chinese authorities for human use. The efficacy of tribendimidine against soil-transmitted helminths (Ascaris lumbricoides, hookworm, and Trichuris trichiura) has been established, and new laboratory investigations point to activity against cestodes and Strongyloides ratti. Methodology/Principal Findings In an open-label randomized trial, the safety and efficacy of a single oral dose of albendazole or tribendimidine (both drugs administered at 200 mg for 5- to 14-year-old children, and 400 mg for individuals ?15 years) against soil-transmitted helminths, Strongyloides stercoralis, and Taenia spp. were assessed in a village in Yunnan province, People's Republic of China. The analysis was on a per-protocol basis and the trial is registered with controlled-trials.com (number ISRCTN01779485). Both albendazole and tribendimidine were highly efficacious against A. lumbricoides and, moderately, against hookworm. The efficacy against T. trichiura was low. Among 57 individuals who received tribendimidine, the prevalence of S. stercoralis was reduced from 19.3% to 8.8% (observed cure rate 54.5%, p?=?0.107), and that of Taenia spp. from 26.3% to 8.8% (observed cure rate 66.7%, p?=?0.014). Similar prevalence reductions were noted among the 66 albendazole recipients. Taking into account “new” infections discovered at treatment evaluation, which were most likely missed pre-treatment due to the lack of sensitivity of available diagnostic approaches, the difference between the drug-specific net Taenia spp. cure rates was highly significant in favor of tribendimidine (p?=?0.001). No significant adverse events of either drug were observed. Conclusions/Significance Our results suggest that single-dose oral tribendimidine can be employed in settings with extensive intestinal polyparasitism, and its efficacy against A. lumbricoides and hookworm was confirmed. The promising results obtained with tribendimidine against S. stercoralis and Taenia spp. warrant further investigations. In a next step, multiple-dose schedules should be evaluated.

Steinmann, Peter; Zhou, Xiao-Nong; Du, Zun-Wei; Jiang, Jin-Yong; Xiao, Shu-Hua; Wu, Zhong-Xing; Zhou, Hui; Utzinger, Jurg

2008-01-01

357

Chinchilla laniger can be used as an experimental model for Taenia solium taeniasis.  

PubMed

Chinchilla laniger has been reported as an experimental definitive host for Taenia solium; however no information about its suitability and yield of gravid tapeworm proglottids containing viable and infective eggs has been published. In total 55 outbred female chinchillas were infected with 4 cysticerci each; hosts were immunodeppressed with 6 or 8 mg of methyl-prednisolone acetate every 14 days starting the day of infection and their discomfort was followed. Kinetics of coproantigen ELISA or expelled proglottids was used to define the infection status. Efficiency of tapeworm establishment was 21% and of parasite gravidity was 8%; chinchillas showed some degree of suffering along the infection. Viability of eggs obtained from gravid proglottids was tested comparing methods previously published, our results showed 62% viability with propidium iodide, 54% with trypan blue, 34% with neutral red, 30% by oncosphere activation and 7% with bromide 3-(4,5-dimetil-tiazol-2-il)-2,5-difenil-tetrazolio (MTT) reduction; no statistical differences were obtained between most techniques, except activation. Four piglets were infected with 50,000 eggs each, necropsy was performed 3 months later and, after counting the number of cysticerci recovered, the percentage of infection was similar to data obtained with T. solium eggs recovered from humans. Our results demonstrate that the experimental model of T. solium taeniasis in C. laniger is a good alternative for providing eggs and adult tapeworms to be used in different types of experiments; optimization of the model probably depends on the use of inbred hosts and on the reduction of infected animals' suffering. PMID:21723412

Maravilla, Pablo; Garza-Rodriguez, Adriana; Gomez-Diaz, Benjamin; Jimenez-Gonzalez, Diego Emiliano; Toral-Bastida, Elizabeth; Martinez-Ocaña, Joel; West, Brett; Molina, Nadia; Garcia-Cortes, Ramon; Kawa-Karasik, Simon; Romero-Valdovinos, Mirza; Avila-Ramirez, Guillermina; Flisser, Ana

2011-06-24

358

Annotation of the Transcriptome from Taenia pisiformis and Its Comparative Analysis with Three Taeniidae Species  

PubMed Central

Background Taenia pisiformis is one of the most common intestinal tapeworms and can cause infections in canines. Adult T. pisiformis (canines as definitive hosts) and Cysticercus pisiformis (rabbits as intermediate hosts) cause significant health problems to the host and considerable socio-economic losses as a consequence. No complete genomic data regarding T. pisiformis are currently available in public databases. RNA-seq provides an effective approach to analyze the eukaryotic transcriptome to generate large functional gene datasets that can be used for further studies. Methodology/Principal Findings In this study, 2.67 million sequencing clean reads and 72,957 unigenes were generated using the RNA-seq technique. Based on a sequence similarity search with known proteins, a total of 26,012 unigenes (no redundancy) were identified after quality control procedures via the alignment of four databases. Overall, 15,920 unigenes were mapped to 203 Kyoto Encyclopedia of Genes and Genomes (KEGG) pathways. Through analyzing the glycolysis/gluconeogenesis and axonal guidance pathways, we achieved an in-depth understanding of the biochemistry of T. pisiformis. Here, we selected four unigenes at random and obtained their full-length cDNA clones using RACE PCR. Functional distribution characteristics were gained through comparing four cestode species (72,957 unigenes of T. pisiformis, 30,700 ESTs of T. solium, 1,058 ESTs of Eg+Em [conserved ESTs between Echinococcus granulosus and Echinococcus multilocularis]), with the cluster of orthologous groups (COG) and gene ontology (GO) functional classification systems. Furthermore, the conserved common genes in these four cestode species were obtained and aligned by the KEGG database. Conclusion This study provides an extensive transcriptome dataset obtained from the deep sequencing of T. pisiformis in a non-model whole genome. The identification of conserved genes may provide novel approaches for potential drug targets and vaccinations against cestode infections. Research can now accelerate into the functional genomics, immunity and gene expression profiles of cestode species.

Yang, Deying; Fu, Yan; Wu, Xuhang; Xie, Yue; Nie, Huaming; Chen, Lin; Nong, Xiang; Gu, Xiaobin; Wang, Shuxian; Peng, Xuerong; Yan, Ning; Zhang, Runhui; Zheng, Wanpeng; Yang, Guangyou

2012-01-01

359

Immune response to different fractions of Taenia solium cyst fluid antigens in patients with neurocysticercosis.  

PubMed

The immunopathogenesis of neurocysticercosis (NCC) largely remains unknown. We analyzed the immune response to different fractions of Taenia solium cyst fluid antigens in patients with NCC. Lymphocytes were separated from 48 patients with NCC-related active epilepsy and 30 healthy controls. T. solium (isolated from pig muscles) antigens (crude lysate, CL; cyst wall, CW and cyst fluid, CF) at 20 ?g/well concentrations were used to stimulate the cells in a lymphocyte transformation test (LTT). Only CF antigen stimulated cell proliferation significantly greater than control (p<0.001), hence cyst fluid antigens were further studied. The CF antigens were electro-blotted on nitrocellulose membrane (NC), cut at 0.5 cm distance and particulate antigens were prepared. A total of 12 fractions, designated F1 to F12 according to molecular weight were tested in-vitro for LTT. After 72 h of stimulation by the different fractions, Th1 (IL-1?, TNF-?, IL-2) and Th2 (IL-4, IL-10) cytokine responses were determined in culture supernatants by ELISA. Low molecular weight fractions F1 through F4 (Mol. wt.<25 kDa) were found to be potent inducers of cytokines. Fractions F1, F3 and F4 induced the production of Th1 (IL-1?, TNF-?, IL-2), whereas F2 induced the production of Th2 (IL-4 and IL-10) cytokine. The study shows that the low molecular weight fractions of CF antigens are immuno-dominant. Most of these fractions (F1, F3, F4) induce strong Th1 immune response except F2 which induces Th2 response. Further studies are needed to identify the different antigens present in these fractions to determine the molecules responsible for the immune response. PMID:21115005

Amit, Prasad; Prasad, Kashi Nath; Kumar, Gupta Rakesh; Shweta, Tripathi; Sanjeev, Jha; Kumar, Paliwal Vimal; Mukesh, Tripathi

2010-11-26

360

Controlling Taenia solium in Nepal using the PRECEDE-PROCEED model.  

PubMed

Taenia solium is a predominant food-borne parasitic zoonosis (FBPZ) in Nepal. Using the PRECEDE framework, as defined by Green and Kreuter, we can identify the factors behind the high incidence of this disease. Armed with this information, we can define the actions necessary to control T. solium. In accordance with the first step of PRECEDE, social assessment, we set the goal of decreasing the potential for T. solium transmission in Nepal by the year 2003. This goal has yet to be endorsed by policy makers. However, an epidemiological assessment based on hospital data alone showed that T. solium is an endemic problem in urban Nepal that must be addressed. Based on behavioral and environmental assessments (Steps 1 and 2 of PRECEDE-PROCEED), we defined the following action objectives to be achieved by 2003: 1) Train meat producers and sellers to detect contaminated pork and avoid selling it, 2) Improve pig husbandry to limit the animals' access to human feces, 3) Construct hygienic model slaughterhouses. These improvements could control the meat-producing environment, thus limiting the potential for cross-carcass contamination and other hygiene deficiencies associated with the spread of T. solium. An educational and ecological assessment shows all predisposing, reinforcing and enabling factors are present in Nepal, consistent with PRECEDE requirements. While T. solium is clearly defined as a health problem according to PRECEDE, there remain significant hurdles to controlling it. These hurdles lie in administration and policy, where standardized law-enforcement and meat inspection practices are needed. Finally, the government of Nepal must assign high priority to T. solium control, as it is a preventable, yet prevalent disease. PMID:12041612

Joshi, D D; Poudyal, P M; Jimba, M; Mishra, P N; Neave, L A; Maharjan, M

2001-01-01

361

Effects of glucose removal and readmission on potassium contracture in the guinea-pig taenia coli.  

PubMed Central

The effects of removal and readmission of substrates on the K contracture were investigated in the guinea-pig taenia coli. When, after exposure to excess K in Ca-free and glucose-free medium, the readmission and removal of 2.4 mM-Ca were repeated at regular intervals, the Ca-induced contractions decreased progressively. The decrease was more marked in the late than in the early part of the tension response. The rate of O2 consumption decreased when the normal medium was replaced by glucose-free, Ca-free, excess-K solution, but substantially recovered following Ca readmission. ATP and creatine phosphate contents decreased during the Ca-induced contraction, but recovered partially during the subsequent relaxation in Ca-free solution. The effects of glucose removal were rapidly reversed when glucose or beta-hydroxybutyrate (beta-HB) were readmitted to the bathing solution. In the absence of Ca, readmission and removal of the substrates produced an insignificant change in O2 consumption, but the next Ca contraction was potentiated, the effect being stronger with glucose than beta-HB. When the tonic contraction evoked by 2.4 mM-Ca readmission had been abolished in glucose-free, high-K solution, a rise of the external Ca concentration to 10 mM, or 5 microM-carbachol, still produced a transient contraction. This suggests that the tonic contraction has disappeared partially because of diminished Ca influx. In glycogen-depleted preparations, the depolarization caused by carbachol, or by 20 mM-K, was increased and spike discharge initiated when glucose was readmitted.(ABSTRACT TRUNCATED AT 250 WORDS)

Ashoori, F; Takai, A; Tokuno, H; Tomita, T

1984-01-01

362

Current status of taeniasis in Thailand.  

PubMed

Taeniasis is prevalent in all regions of Thailand, except the South. Infections were more frequently found in males than females of any age from 7-83 years. Taenia saginata is the most common species throughout the country. Taenia asiatica was reported only in the province of Kanchanaburi in the Central region. Co-infections, with Taenia solium and T. asiatica or T. solium and T. saginata, were found. Hybridization between T. asiatica and T. saginata is evidence that co-infection is never found between these 2 species. Finding more than 1 worm in a single patient was not entirely rare. Genetic variation was found without correlation to its geographic distribution in T. saginata, whereas no variation was found in T. asiatica. PMID:23467328

Anantaphruti, Malinee Thairungroj

2013-02-18

363

Current Status of Taeniasis in Thailand  

PubMed Central

Taeniasis is prevalent in all regions of Thailand, except the South. Infections were more frequently found in males than females of any age from 7-83 years. Taenia saginata is the most common species throughout the country. Taenia asiatica was reported only in the province of Kanchanaburi in the Central region. Co-infections, with Taenia solium and T. asiatica or T. solium and T. saginata, were found. Hybridization between T. asiatica and T. saginata is evidence that co-infection is never found between these 2 species. Finding more than 1 worm in a single patient was not entirely rare. Genetic variation was found without correlation to its geographic distribution in T. saginata, whereas no variation was found in T. asiatica.

2013-01-01

364

[Cestode infections in Poland in 2008].  

PubMed

In the year 2008, 109 intestinal cestode infections were registered in Poland. Among them 69 were caused by Taenia saginata, 2 by T. solium, 30 by Taenia sp., 1 by Diphyllobothrium latum. Moreover, 28 cases of cystic echinococcosis were reported. The obtained results confirmed decreasing frequency of intestinal cestodoses in Poland. PMID:20731234

Waloch, Maria

2010-01-01

365

Serodiagnosis of human neurocysticercosis using antigenic components of Taenia solium metacestodes derived from the unbound fraction from jacalin affinity chromatography.  

PubMed

The aim of the present study was to analyse Taenia solium metacestode antigens that were derived from the unbound fraction of jacalin affinity chromatography and subsequent tert-octylphenoxy poly (oxyethylene) ethanol Triton X-114 (TX-114) partitioning in the diagnosis of human neurocysticercosis (NCC). Immunoassays were designed to detect T. solium-specific IgG antibodies by ELISA and immunoblot. Serum samples were collected from 132 individuals who were categorised as follows: 40 had NCC, 62 presented Taenia spp or other parasitic diseases and 30 were healthy individuals. The jacalin-unbound (J unbound ) fraction presented higher sensitivity and specificity rates than the jacalin-bound fraction and only this fraction was subjected to subsequent TX-114 partitioning, resulting in detergent (DJ unbound ) and aqueous (AJ unbound ) fractions. The ELISA sensitivity and specificity were 85% and 84.8% for J unbound , 92.5% and 93.5% for DJ unbound and 82.5% and 82.6% for AJ unbound . By immunoblot, the DJ unbound fraction showed 100% sensitivity and specificity and only serum samples from patients with NCC recognised the 50-70 kDa T. solium-specific components. We conclude that the DJ unbound fraction can serve as a useful tool for the differential immunodiagnosis of NCC by immunoblot. PMID:23778661

Machado, Gleyce Alves; Oliveira, Heliana Batista de; Gennari-Cardoso, Margareth Leitão; Mineo, José Roberto; Costa-Cruz, Julia Maria

2013-05-01

366

Ultrastructure of spermiogenseis and spermatozoa of Taenia parva Baer, 1926 (Cestoda, Cyclophyllidea, Taeniidae), a parasite of the common genet ( Genetta genetta )  

Microsoft Academic Search

We studied the ultrastructure of spermiogenesis and of the mature spermatozoon of Taenia parva, an intestinal cestode of the common genet, Genetta genetta. Spermiogenesis in T. parva is characterized by the growth of the axoneme externally to a cytoplasmic extension. After a slight rotation, the free flagellum fuses with the cytoplasmic extension. This pattern corresponds to type III spermiogenesis according

Papa Ndiaye; Jordi Miquel; Bernard Marchand

2002-01-01

367

Structural and Binding Properties of Two Paralogous Fatty Acid Binding Proteins of Taenia solium Metacestode  

PubMed Central

Background Fatty acid (FA) binding proteins (FABPs) of helminths are implicated in acquisition and utilization of host-derived hydrophobic substances, as well as in signaling and cellular interactions. We previously demonstrated that secretory hydrophobic ligand binding proteins (HLBPs) of Taenia solium metacestode (TsM), a causative agent of neurocysticercosis (NC), shuttle FAs in the surrounding host tissues and inwardly transport the FAs across the parasite syncytial membrane. However, the protein molecules responsible for the intracellular trafficking and assimilation of FAs have remained elusive. Methodology/Principal Findings We isolated two novel TsMFABP genes (TsMFABP1 and TsMFABP2), which encoded 133- and 136-amino acid polypeptides with predicted molecular masses of 14.3 and 14.8 kDa, respectively. They shared 45% sequence identity with each other and 15–95% with other related-members. Homology modeling demonstrated a characteristic ?-barrel composed of 10 anti-parallel ?-strands and two ?-helices. TsMFABP2 harbored two additional loops between ?-strands two and three, and ?-strands six and seven, respectively. TsMFABP1 was secreted into cyst fluid and surrounding environments, whereas TsMFABP2 was intracellularly confined. Partially purified native proteins migrated to 15 kDa with different isoelectric points of 9.2 (TsMFABP1) and 8.4 (TsMFABP2). Both native and recombinant proteins bound to 11-([5-dimethylaminonaphthalene-1-sulfonyl]amino)undecannoic acid, dansyl-DL-?-amino-caprylic acid, cis-parinaric acid and retinol, which were competitively inhibited by oleic acid. TsMFABP1 exhibited high affinity toward FA analogs. TsMFABPs showed weak binding activity to retinol, but TsMFABP2 showed relatively high affinity. Isolation of two distinct genes from an individual genome strongly suggested their paralogous nature. Abundant expression of TsMFABP1 and TsMFABP2 in the canal region of worm matched well with the histological distributions of lipids and retinol. Conclusions/Significance The divergent biochemical properties, physiological roles and cellular distributions of the TsMFABPs might be one of the critical mechanisms compensating for inadequate de novo FA synthesis. These proteins might exert harmonized or independent roles on lipid assimilation and intracellular signaling. The specialized distribution of retinol in the canal region further implies that cells in this region might differentiate into diverse cell types during metamorphosis into an adult worm. Identification of bioactive systems pertinent to parasitic homeostasis may provide a valuable target for function-related drug design.

Yang, Hyun-Jong; Shin, Joo-Ho; Diaz-Camacho, Sylvia Paz; Nawa, Yukifumi; Kang, Insug; Kong, Yoon

2012-01-01

368

Inward current in single smooth muscle cells of the guinea pig taenia coli  

PubMed Central

Using the tight-seal voltage-clamp method, the ionic currents in the enzymatically dispersed single smooth muscle cells of the guinea pig taenia coli have been studied. In a physiological medium containing 3 mM Ca2+, the cells are gently tapering spindles, averaging 201 (length) x 8 microns (largest diameter in center of cell), with a volume of 5 pl. The average cell capacitance is 50 pF, and the specific membrane capacitance 1.15 microF/cm2. The input impedance of the resting cell is 1-2 G omega. Spatially uniform voltage-control prevails after the first 400 microseconds. There is much overlap of the inward and outward currents, but the inward current can be isolated by applying Cs+ internally to block all potassium currents. The inward current is carried by Ca2+. Activation begins at approximately -30 mV, maximum ICa occurs at +10-+20 mV, and the reversal potential is approximately +75 mV. The Ca2+ channel is permeable to Sr2+ and Ba2+, and to Cs+ moving outwards, but not to Na+ moving inwards. Activation and deactivation are very rapid at approximately 33 degrees C, with time-constants of less than 1 ms. Inactivation has a complex time course, resolvable into three exponential components, with average time constants (at 0 mV) of 7, 45, and 400 ms, which are affected differently by voltage. Steady- state inactivation is half-maximal at -30 mV for all components combined, but -36 mV for the fast component and -26 and -23 mV for the other two components. The presence of multiple forms of Ca2+ channel is inferred from the inactivation characteristics, not from activation properties. Recovery of the fast channel occurs with a time-constant of 72 ms (at +10 mV). Ca2+ influx during an action potential can transfer approximately 9 pC of charge, which could elevate intracellular Ca2+ concentration adequately for various physiological functions.

1989-01-01

369

Heat production in chemically skinned smooth muscle of guinea-pig taenia coli.  

PubMed Central

1. The rate of heat production of chemically skinned guinea-pig taenia coli smooth muscle at 25 degrees C was measured using microcalorimetric techniques. 2. Muscle strips were mounted isometrically and incubated in solutions containing MgATP (3.2 mM) and phosphocreatine (PCr, 12 mM), pH 6.9. Activation was obtained by the injection of Ca2+ into the sample compartment of the calorimeter. 3. The heat production rate of the resting preparation (pCa 9) was 0.40 +/- 0.03 mW g-1 wet weight (n = 23). During maximal activation (pCa 4.8) the heat rate increased to 1.12 +/- 0.07 mW g-1 (mean +/- S.E.M., n = 15). With stepwise increase in [Ca2+] from pCa 9 to 4.8 the energetic cost of force maintenance tended to increase at higher [Ca2+]. 4. After activation by Ca2+, the heat production rate reached its maximum while force was still increasing. 5. Changing ionic strength from 90 to 150 mM had no effect on either basal or activated heat rate. Oligomycin, amphotericin B and the adenylate kinase inhibitor Ap5A had no effect on the basal heat rate. 6. Exchanging ATP in the incubation medium for inosine triphosphate (ITP) reduced the force and heat production after injection of Ca2+. The basal heat production was not lowered when ATP was exchanged for ITP. 7. The observed enthalpy change for PCr splitting at 25 degrees C (pH 6.9, ionic strength 90 mM) was -28 +/- 3 kJ mol-1 (mean +/- S.E.M., n = 9). After correction for the phosphate equilibrium, buffer reactions, and Mg2+ binding to PCr and HPO42-, the net enthalpy change is calculated to be -39 +/- 3 kJ mol-1. 8. Heat production in the skinned smooth muscle consists of one basal component present in relaxed muscle, and one component associated with contraction. The nature of the basal heat production is unclear but does not seem to involve turnover of phosphate on the myosin light chains. The increase in the energetic tension cost with increasing activation by Ca2+ has implications for the understanding of the contractile mechanism in smooth muscle.

Lonnbro, P; Hellstrand, P

1991-01-01

370

Disruption of the blood-brain barrier in pigs naturally infected with Taenia solium, untreated and after anthelmintic treatment.  

PubMed

Neurocysticercosis is a widely prevalent disease in the tropics that causes seizures and a variety into of neurological symptoms in most of the world. Experimental models are limited and do not allow assessment of the degree of inflammation around brain cysts. The vital dye Evans Blue (EB) was injected to 11 pigs naturally infected with Taenia solium cysts to visually identify the extent of disruption of the blood-brain barrier. A total of 369 cysts were recovered from the 11 brains and classified according to the staining of their capsules as blue or unstained. The proportion of cysts with blue capsules was significantly higher in brains from pigs that had received anthelmintic treatment 48 and 120h before the EB infusion, indicating a greater compromise of the blood-brain barrier due to treatment. The model could be useful for understanding the pathology of treatment-induced inflammation in neurocysticercosis. PMID:23684909

Guerra-Giraldez, Cristina; Marzal, Miguel; Cangalaya, Carla; Balboa, Diana; Orrego, Miguel Ángel; Paredes, Adriana; Gonzales-Gustavson, Eloy; Arroyo, Gianfranco; García, Hector H; González, Armando E; Mahanty, Siddhartha; Nash, Theodore E

2013-05-15

371

Identification of Taenia sp. in a natural human mummy (third century BC) from the Chehrabad salt mine in Iran.  

PubMed

Tapeworm eggs from the genus Taenia sp. were identified during the study of mummy remains dated to 2,286 ± 28 BP from the Chehrabad salt mine in northwestern Iran. The presence of tapeworm in this salt mine provides paleopathological information. Moreover, it brings new information on ancient diet, indicating the consumption of raw or undercooked meat. Cultural aspects as well as archaeozoological data are discussed in order to try to detail meat consumption. Paleoparasitological data are rare in the Middle East, and this case study presents the first recovery of parasites in ancient Iran. It constitutes the earliest evidence of ancient intestinal parasites in this country and contributes to the knowledge of gastrointestinal pathogens in the Near East. PMID:23240712

Nezamabadi, M; Mashkour, M; Aali, A; Stöllner, Th; Le Bailly, M

2012-12-15

372

Identification of Taenia sp. in a mummy from a Christian Necropolis in El-Deir, Oasis of Kharga, ancient Egypt.  

PubMed

For the first time, a palaeoparasitological study was performed on 12 mummies from a Christian cemetery excavated in El-Deir, Oasis of Kharga, Egypt. The analysis revealed the presence of a tapeworm, probably Taenia sp., in a single individual. The presence of just the presumed taeniid egg is surprising and raises the question of the relationship between residents of Egyptian oases and those residing in the Nile Valley. The result suggests information on the health status of the ancient oasis population and re-enforces a hypothesis regarding possible social stratification of the inhabitants. The work must be continued if we are to acquire additional knowledge dealing with life in ancient Egyptian oases. PMID:19681649

Le Bailly, Matthieu; Mouze, Sidonie; da Rocha, Gino Chaves; Heim, Jean-Louis; Lichtenberg, Roger; Dunand, Françoise; Bouchet, Françoise

2010-02-01

373

The effect of glucocorticoids on sex steroid synthesis in cultured Taenia crassiceps Wake Forest University (WFU) cysticerci.  

PubMed

We have shown previously that cultured Taenia crassiceps Wake Forest University (WFU) and Taenia solium cysticerci, as well as the adult worms, synthesize sex steroid hormones from [3H]steroid precursors and that androgens and oestrogens influence the in vitro development of the parasites. Glucocorticoids (GCs) are used to control the inflammation caused by T. solium cysticerci in the brain. These steroids stimulate oestrogen synthesis in several tissues. Since there is no information on the effect of GC on the endocrine function of cysticerci, we investigated the effect of natural and synthetic GCs on the synthesis of oestrogens in cultured T. crassiceps WFU cysticerci. The cysticerci were obtained from the peritoneal cavity of infected female BALB/c mice; the cysts were washed extensively and pre-cultured in Dulbecco's Modified Eagle's Medium (DMEM) plus antibiotics for 5 days. The parasites were further cultured with different doses of corticosterone, dexamethasone or the vehicle for 5 days. [3H]Dehydroepiandrosterone (3H-DHEA) was added to the media and the cysticerci were further incubated for 6 or 24 h. Media were then removed and the steroids ether-extracted. Aliquots of the media were seeded on silica gel plates and developed in solvent systems. Parasites incubated in the presence of 3H-DHEA synthesized [3H]androstenediol, [3H]testosterone and [3H]17?-oestradiol ([3H]17?-E2). The addition of 100 nm or higher corticosterone doses to the media increased [3H]17?-E2 synthesis fourfold after 24 h. Dexamethasone also increased [3H]17?-E2 synthesis. The experiments presented here show for the first time that corticosterone and the synthetic GC dexamethasone modulate the synthesis of oestrogens by cysticerci. PMID:22152276

Hinojosa, L; Valdez, R A; Salvador, V; Rodríguez, A G; Willms, K; Romano, M C

2011-12-12

374

Taenia taeniaeformis: effectiveness of staining oncospheres is related to both temperature of treatment and molecular weight of dyes utilized.  

PubMed

Methods to determine viability of taeniid oncospheres following treatments with potential lethality have practical application in efforts to control transmission. Here we investigated several methods, in lieu of infectivity studies, to assess oncosphere viability and determine lethal temperature treatment regimens. In the first experiment, a standard treatment to exshell oncospheres with 0.5% hypochlorite was assessed for influence on oncosphere recovery of Taenia taeniaeformis eggs. Recovery of eggs and exshelled oncospheres decreased with increasing time in hypochlorite, which indicated that hypochlorite can damage eggs and oncospheres, translating into potential overestimation of lethality of experimental treatments. Losses in hypochlorite were accentuated when eggs were pretreated at 75 degrees C, but not lower temperatures, including 65 degrees C, indicating a sharp threshhold between 65 degrees C and 75 degrees C where eggs and oncospheres became hypersensitive to subsequent hypochlorite treatment. To further investigate this change in relation to temperature, non-vital (acridine orange, AO) and vital (propidium iodide, PI; trypan blue, TB) dyes were used to assess staining of oncospheres (exshelled or not) under conditions ranging from room temperature up to 95 degrees C. The behaviors of dyes as related to internal staining of oncospheres were described using non-linear regression and a sigmoid four-parametric model to determine the inflection point (T50). Each of the dyes differed significantly in T50 estimates, e.g. AO (69.22+/-0.53), PI (73.89+/-0.52) and TB (79.43+/-0.45). For these dyes, the T50 increased in relation to the increasing molecular weight of the dyes. Collectively, the results suggested that barriers to chemical permeability exist in eggs that breakdown incrementally with increasing temperatures above 65 degrees C. This staining behavior and the likelihood that the temperatures involved are above a lethal threshhold clarify a basic limitation in the use of vital dyes to assess oncosphere viability. The results may be relevant to other Taenia spp. PMID:18063313

Chapalamadugu, Kalyan C; Busboom, Jan R; Nelson, Mark L; Hancock, Dale D; Tang, Juming; Jasmer, Douglas P

2007-10-26

375

Modulation by GABA(B) and delta opioid receptors of neurally induced responses in isolated guinea-pig taenia coli and human colonic circular muscle.  

PubMed

The GABA-ergic and opioid modulation of neurally induced muscle responses was studied in isolated guinea-pig taenia coli and human colonic circular muscle, using identical field stimulation parameters (rectangular pulses of 0.5 ms duration, 9 V x cm(-1) intensity, trains of 3 pulses at 0.5 Hz, repeated every 1/3/5 min). The stimulation-induced contractions were inhibited in both preparations by GABA and baclofen; the IC50 values in human colonic circular muscle were approximately 100 and 31.0 microM, respectively. In guinea-pig taenia coli, the inhibition by 10(-4) M GABA was dose-dependently reversed by 10(-4)-10(-3) M of GABA(B) receptor antagonist CGP 35348; antagonism by phaclofen was less effective in the same concentration range. In human colonic circular muscle, inhibition by 3 x 10(-5) M baclofen was fully reversed by 10(-3) M CGP 35348. With the exception of caecum, the delta 2 opioid receptor agonist deltorphin II was a potent inhibitor in human colonic circular muscle. 10(-8) M Deltorphin caused a 74.4 +/- 9.6% (n = 4) inhibition which was reversed by 10(-6) M of delta receptor selective peptide antagonist BOC-Tyr-Pro-Gly-Phe-Leu-Thr(OtBu). Deltorphin II was ineffective in guinea-pig taenia coli even at 10(-6) M; the same concentration caused an 84.3 +/- 7.9 (n = 4) inhibition in human preparations. It is concluded that: 1) GABA-ergic modulatory mechanisms are present both in human colonic circular muscle and guinea-pig taenia coli; 2) the GABA receptors involved are of type B; and 3) delta opioid receptor-mediated modulation functions only in human colonic circular muscle in regions other than the caecum. PMID:10791695

Makó, E; Rónai, A Z; Adám, G; Juhász, G; Ritter, L; Lestár, B; Crunelli, V

376

Evaluation of the efficacy of emodepside+praziquantel topical solution against cestode ( Dipylidium caninum, Taenia taeniaeformis , and Echinococcus multilocularis ) infections in cats  

Microsoft Academic Search

Emodepside+praziquantel topical solution was developed to provide broad–spectrum anthelmintic activity against gastrointestinal parasites in cats. Eight controlled studies were conducted to evaluate the efficacy of a topical solution of emodepside (3 mg\\/kg) and praziquantel (12 mg\\/kg) (Profender®, BayerAG, Leverkusen, Germany) against feline infections with three species of cestodes. Studies featured naturally acquired infections of Dipylidium caninum or Taenia taeniaeformis, or

S. D. Charles; G. Altreuther; C. R. Reinemeyer; J. Buch; T. Settje; L. Cruthers; D. J. Kok; D. D. Bowman; K. R. Kazacos; D. J. Jenkins; E. Schein

2005-01-01

377

Intracellular-free magnesium in the smooth muscle of guinea pig taenia caeci: a concomitant analysis for magnesium and pH upon sodium removal  

Microsoft Academic Search

This study is concerned with the regulation of intracellular-free Mg 2+ concentration ((Mg~+)i) in the smooth muscle of guinea pig taenia caeci. To assess an interaction of Ca 2+ on the Na§ Mg2§ mechanism (Na § Mg 2§ exchange), effects of Na + removal (N-methyl-n-glucamine substitution) were examined in Ca~+-containing solutions. As changes in pHi in Na+-free solutions perturb estimation

S. Nakayama; H. NOMURA; T. TOMITA

1994-01-01

378

Histochemical, pharmacological, biochemical and chromatographic evidence that pituitary adenylyl cyclase activating peptide is involved in inhibitory neurotransmission in the taenia of the guinea-pig caecum  

Microsoft Academic Search

The possibility that pituitary adenylyl cyclase-activating peptide (PACAP) is an inhibitory neurotransmitter has been investigated in the taenia of the guinea-pig caecum. The action of PACAP on muscle contractility and its ability to alter levels of adenosine-3? : 5?-cyclic monophosphate (cyclic AMP) and guanosine-3? : 5?-cyclic monophosphate (cyclic GMP) were investigated. PACAP-1-27 was an effective agonist, giving relaxations comparable in

Karen McConalogue; John B. Furness; Melinda A. Vremec; Jens J. Holst; Karen Tornøe; Philip D. Marley

1995-01-01

379

Occurrence and factors associated with bovine cysticercosis recorded in cattle at meat inspection in Denmark in 2004-2011.  

PubMed

Current EU regulation requires that every bovine carcass is examined for bovine cysticercosis (BC) at meat inspection. This is costly and might be superfluous at low BC prevalence. However, from a consumer view-point it may be important to identify and manage infected carcasses to avoid human infection. If relevant data could be effectively used to classify animals with respect to their risk of being infected, then the current meat inspection could be replaced by a more cost-effective system targeting high-risk animals. This study aimed to (1) describe the distribution of BC cases in the Danish cattle population, (2) estimate the animal level prevalence (3) provide descriptive statistics of potential risk factors for BC, and (4) determine attributable risks and fractions of selected risk factors potentially useful for a future risk-based meat inspection system. In total, 348 cases of BC were recorded among all cattle slaughtered (n=4,090,661) in Denmark between 2004 and 2011. The true animal level prevalence of BC was estimated to be 0.06%. The herd of origin of the cases were defined as the herd in which the animals spent most of their lifetimes. The detected cases were found to originate from 328 herds, with a maximum of two cases per herd indicating sporadic occurrence. Even though organic farming was associated with a higher risk (RR=1.9 in univariable analysis) of BC-positive animals being detected at slaughter, the population attributable fraction showed that only 5% of the animals with BC could be attributed to organic farming practices at the level of organic farming practiced in Denmark in the study period. Thus, organic farming status was not a suitable risk factor to use to target future risk-based meat inspection. However, 54% of the animals with BC in the cattle population were attributed to female gender. Increasing age at slaughter was also associated with high risk of BC. There may be overlaps between these effects in animals with multiple risk factors. Other underlying factors such as grazing patterns might explain the risk factors and attribution results found in this study. However, grazing practices are currently not recorded in the Danish cattle database. Therefore, animal level risk factors such as age and gender together with other risk factors such as grazing practices might be included as food chain information, required to be provided by the farmer prior to slaughter. The challenges and opportunities of this approach should be investigated further. PMID:23245844

Calvo-Artavia, F F; Nielsen, L R; Dahl, J; Clausen, D M; Alban, L

2012-12-11

380

Age, season and spatio-temporal factors affecting the prevalence of Echinococcus multilocularis and Taenia taeniaeformis in Arvicola terrestris  

PubMed Central

Background Taenia taeniaeformis and the related zoonotic cestode Echinococcus multilocularis both infect the water vole Arvicola terrestris. We investigated the effect of age, spatio-temporal and season-related factors on the prevalence of these parasites in their shared intermediate host. The absolute age of the voles was calculated based on their eye lens weights, and we included the mean day temperature and mean precipitation experienced by each individual as independent factors. Results Overall prevalences of E. multilocularis and T. taeniaeformis were 15.1% and 23.4%, respectively, in 856 A. terrestris trapped in the canton Zürich, Switzerland. Prevalences were lower in young (? 3 months: E. multilocularis 7.6%, T. taeniaeformis 17.9%) than in older animals (>7 months: 32.6% and 34.8%). Only 12 of 129 E. multilocularis-infected voles harboured protoscoleces. Similar proportions of animals with several strobilocerci were found in T. taeniaeformis infected voles of <5 months and ?5 months of age (12.8% and 11.9%). Multivariate analyses revealed strong spatio-temporal variations in prevalences of E. multilocularis. In one trapping area, prevalences varied on an exceptional high level of 40.6-78.5% during the whole study period. Low temperatures significantly correlated with the infection rate whereas precipitation was of lower importance. Significant spatial variations in prevalences were also identified for Taenia taeniaeformis. Although the trapping period and the meteorological factors temperature and precipitation were included in the best models for explaining the infection risk, their effects were not significant for this parasite. Conclusions Our results demonstrate that, besides temporal and spatial factors, low temperatures contribute to the risk of infection with E. multilocularis. This suggests that the enhanced survival of E. multilocularis eggs under cold weather conditions determines the level of infection pressure on the intermediate hosts and possibly also the infection risk for human alveolar echincoccosis (AE). Therefore, interventions against the zoonotic cestode E. multilocularis by deworming foxes may be most efficient if conducted just before and during winter.

2011-01-01

381

FAKTOR-FAKTOR YANG BERHUBUNGAN DENGAN KEJADIAN SISTISERKOSIS PADA PENDUDUK KECAMATAN WAMENA, KABUPATEN JAYAWIJAYA, PROPINSI PAPUA TAHUN 2002  

Microsoft Academic Search

Factors Associated With Occurrence of Cysticercosis Among Wamena People's, at Jayawijaya District, Papua Province, In 2002. Cysticercosis is a disease caused by the larva of Taenia solium, the pig tapeworm, whereas taeniasis solium is caused by the adult worm, which lives in the small human intestines. The prevalence of taeniasis\\/cysticercosis in Indonesia varies from 1.0% to 42.7% and until now

Wilfried H. Purba; Tri Yunis; Miko W; Akira Ito; Abdulbar Hamid; Rizal Subahar; Sri S. Margono

2003-01-01

382

Cloning and characterization of the fatty acid-binding protein gene from the protoscolex of Taenia multiceps.  

PubMed

Taenia multiceps (Cestoda: Taeniidae), a worldwide cestode parasite, is emerging as an important helminthic zoonosis due to serious or fatal central nervous system disease commonly known as coenurosis in domestic and wild ruminants including humans. Herein, a fatty acid-binding protein (FABP) gene was identified from transcriptomic data in T. multiceps. This gene, which contains a complete coding sequence, was amplified by reverse-transcriptase polymerase chain reaction. The corresponding protein, which was named TmFABP, had a molecular weight of 14 kDa, and subsequently was recombinantly expressed in Escherichia coli. The fusion protein was purified on Ni-NTA beads (Bio-Rad). Sodium dodecyl sulfate-polyacrylamide gel electrophoresis and Western blot analyses showed that the purified recombinant protein caused immunogenicity. Immunohistochemical studies showed that TmFABP was expressed at the tegumental level in the protoscolices and in the cells between the body wall and parenchyma layer of the cestode. In sections from gravid proglottids, intense staining was detected in the uterus and eggs. Based on this, TmFABP could be switched on during differentiation of germinative layers to protoscoleces and from metacestodes to adult worms. Taken together, our results already reported for T. multiceps suggest the possibility of TmFABP developing a vaccine to control and prevent coenurosis. PMID:23474657

Nie, Hua-Ming; Xie, Yue; Fu, Yan; Yang, Ying-Dong; Gu, Xiao-Bin; Wang, Shu-Xian; Peng, Xi; Lai, Wei-Ming; Peng, Xue-Rong; Yang, Guang-You

2013-03-09

383

Immune responses to a recombinant attenuated Salmonella typhimurium strain expressing a Taenia solium oncosphere antigen TSOL18.  

PubMed

A tapeworm, Taenia solium, remains a great threat to human health, particularly in developing countries. The life cycle of T. solium is thought to be terminated via vaccination of intermediate hosts. In this study, we constructed a recombinant attenuated Salmonella typhimurium live vaccine strain ?4558 expressing a TSOL18 antigen. SDS-PAGE and Western blot confirmed the expression of the interest protein and its antigenic property. The recombinant strain stably propagated in vitro, of which the growth was not reversely influenced by TSOL18 protein expressed. It was also shown that mice survived 10(12) CFU of S. typhimurium ?4558, while all mice infected with 10(7) CFU of the wild-type died within five days. The mouse experiment indicated that vaccine strain ?4558 induced a high titer of specific antibody for a long time. In contrast to the controls, the vaccinated mice had an obvious augment of CD4(+) and CD8(+) T lymphocytes and the percentage of helper CD4(+)/CD8(+) T lymphocytes was significantly increased (p<0.01). After oral administration, S. typhimurium ?4558 was first colonized mainly in the Peyer's patches and then predominantly in the mesenteric lymph nodes and spleens in the vaccinated mice. In addition, the high levels of specific anti-TSOL18 antibodies were also observed in pigs administrated with S. typhimurium ?4558. Collectively, these results demonstrate the possibility of use of an attenuated S. typhimurium strain as a vector to deliver protective antigens of T. solium. PMID:23219684

Ding, Juntao; Zheng, Yadong; Wang, Ying; Dou, Yongxi; Chen, Xiaoyu; Zhu, Xueliang; Wang, Shuai; Zhang, Shaohua; Liu, Zhenyong; Hou, Junling; Zhai, Junjun; Yan, Hongbin; Luo, Xuenong; Cai, Xuepeng

2012-12-06

384

In vitro analysis of albendazole sulfoxide enantiomers shows that (+)-(R)-albendazole sulfoxide is the active enantiomer against Taenia solium.  

PubMed

Albendazole is an anthelmintic drug widely used in the treatment of neurocysticercosis (NCC), an infection of the brain with Taenia solium cysts. However, drug levels of its active metabolite, albendazole sulfoxide (ABZSO), are erratic, likely resulting in decreased efficacy and suboptimal cure rates in NCC. Racemic albendazole sulfoxide is composed of ABZSO (+)-(R)- and (-)-(S) enantiomers that have been shown to differ in pharmacokinetics and activity against other helminths. The antiparasitic activities of racemic ABZSO and its (+)-(R)- and (-)-(S) enantiomers against T. solium cysts were evaluated in vitro. Parasites were collected from naturally infected pigs, cultured, and exposed to the racemic mixture or to each enantiomer (range, 10 to 500 ng/ml) or to praziquantel as a reference drug. The activity of each compound against cysts was assayed by measuring the ability to evaginate and inhibition of alkaline phosphatase (AP) and parasite antigen release. (+)-(R)-ABZSO was significantly more active than (-)-(S)-ABZSO in suppressing the release of AP and antigen into the supernatant in a dose- and time-dependent manner, indicating that most of the activity of ABZSO resides in the (+)-(R) enantiomer. Use of this enantiomer alone may lead to increased efficacy and/or less toxicity compared to albendazole. PMID:23229490

Paredes, Adriana; de Campos Lourenço, Tiago; Marzal, Miguel; Rivera, Andrea; Dorny, Pierre; Mahanty, Siddhartha; Guerra-Giraldez, Cristina; García, Hector H; Nash, Theodore E; Cass, Quezia B

2012-12-10

385

Immunological mechanisms involved in the protection against intestinal taeniosis elicited by oral immunization with Taenia solium calreticulin.  

PubMed

Oral immunization with functional recombinant Taenia solium calreticulin (rTsCRT) induces 37% reduction in tapeworm burden in the experimental model of intestinal taeniosis in hamsters. Furthermore, tapeworms recovered from vaccinated animals exhibit diminished length, being frequently found in more posterior parts of the small intestine. The aim of this study was to analyze the immunological mechanisms involved in protection in response to rTsCRT oral immunization. Hamsters were orally immunized with rTsCRT using cholera toxin (CT) as adjuvant, weekly for 4 weeks. Fifteen days after the last boost animals were challenged with four T. solium cysticerci. Reduction in the adult worm recovery and increased transcription of mRNA for IL-4 and IFN-? in the mucosa of rTsCRT+CT immunized animals were observed. Immunization also induced goblet cell hyperplasia in the mucosa surrounding the implantation site of the parasite. Specific IgG and IgA antibodies in serum and fecal supernatants were detected after the second immunization, being more pronounced after challenge. Our data suggest that oral vaccination with rTsCRT+CT regulates a local expression of IL-4 and IFN-?, stimulating secretion of IgA that, together with the increase of goblet cells and mucin production, could result in an unfavorable environment for T. solium promoting an impaired tapeworm development. PMID:22921496

Leon-Cabrera, Sonia; Cruz-Rivera, Mayra; Mendlovic, Fela; Romero-Valdovinos, Mirza; Vaughan, Gilberto; Salazar, Ana María; Avila, Guillermina; Flisser, Ana

2012-08-16

386

Kinetics of contraction in depolarized smooth muscle from guinea-pig taenia coli after photodestruction of nifedipine  

PubMed Central

The time course and kinetics of force development following activation by opening of L-type Ca2+ channels was investigated using photodestruction of the Ca2+ channel blocker nifedipine in smooth muscle from the guinea-pig taenia coli. In muscles activated using high K+ and Ca2+ and subsequently inhibited with nifedipine, photodestruction of the drug using a strong ultraviolet light flash initiated a rapid contraction. The force initiated by photodestruction of nifedipine reached near-maximal levels. This procedure eliminates diffusional delays and can thus be used to investigate the kinetics of depolarization-induced contractions. The rate of force development of contractions initiated by photodestruction of nifedipine was slower than that observed in maximally thiophosphorylated skinned fibres. This suggests the rate of force development is limited by activation steps in the activation cascade prior to the force generation of the cross-bridge system. The rate of force development and the plateau force were dependent on the extracellular [CaCl2] suggesting that the intracellular [Ca2+] determines the rate of phosphorylation and force development. The delay between illumination and increase in force was about 300 ms. The delay was similar at low and high extracellular [CaCl2] indicating that buffering by superficial sarcoplasmatic reticulum does not introduce a delay in force development following activation of Ca2+ channels in this muscle.

Malmqvist, Ulf; Arner, Anders

1999-01-01

387

Genotoxicity induced by Taenia solium and its reduction by immunization with calreticulin in a hamster model of taeniosis.  

PubMed

Genotoxicity induced by neurocysticercosis has been demonstrated in vitro and in vivo in humans. The adult stage of Taenia solium lodges in the small intestine and is the main risk factor to acquire neurocysticercosis, nevertheless its carcinogenic potential has not been evaluated. In this study, we determined the genotoxic effect of T. solium infection in the hamster model of taeniosis. In addition, we assessed the effect of oral immunization with recombinant T. solium calreticulin (rTsCRT) plus cholera toxin as adjuvant on micronuclei induction, as this protein has been shown to induce 33-44% protection in the hamster model of taeniosis. Blood samples were collected from the orbital venous plexus of noninfected and infected hamsters at different days postinfection, as well as from orally immunized animals, to evaluate the frequency of micronucleated reticulocytes as a measure of genotoxicity induced by parasite exposure and rTsCRT vaccination. Our results indicate that infection with T. solium caused time-dependent DNA damage in vivo and that rTsCRT immunization reduced the genotoxic damage induced by the presence of the tapeworms. PMID:23704053

Salazar, Ana María; Mendlovic, Fela; Cruz-Rivera, Mayra; Chávez-Talavera, Oscar; Sordo, Monserrat; Avila, Guillermina; Flisser, Ana; Ostrosky-Wegman, Patricia

2013-05-24

388

Neurocysticercosis: utilizing the cystic fluid antigen from Taenia solium metacestodes for diagnosis by IgG-ELISA.  

PubMed

Cystic fluid, which has antigenic properties of whole Taenia solium cysticerci, was used to discriminate neurocysticercosis cases and other parasitic infections, especially helminthiases. Twenty-one neurocysticercosis and several kinds of 22 different parasitic infections, including HIV cases (n=234) evaluated a 90.48% sensitivity and 86.32% specificity of indirect ELISA as follows: a low antigen concentration of 5 microg/ml. serum dilution of 1:400, conjugate dilution of 1:2,000 and a cut-off value of 0.349. Eight different helminthic infections (n = 25); echinococcosis (8/10), gnathostomiasis (6/8), strongyloidiasis (5/14), hookworm infection (1/18), angiostrongyliasis (2/25), opisthorchiasis (1/18), onchocercosis (1/3) and toxocariasis (1/6) were cross-reactive with this antigen. No serum antibody from other brain infections in the study gave a reaction with the antigen. In this study, the cystic fluid antigen gave high sensitivity of the test. However, the antigen contains various antigenic molecules able to bind with antibodies from several of the above helminthic sera, especially echinococcosis and gnathostomiasis. In Thailand, gnathostomiasis is one of the more famous tropical diseases but echinococcosis is quite rare. Cystic fluid antigen should be further investigated for its specific finding in diagnosis. PMID:11414454

Dekumyoy, P; Anantaphruti, M T; Nuamtanong, S; Watthanakulpanich, D; Waikagu, J; Danis, M

2000-01-01

389

Experimental studies on small hooks preceding large hooks in the growth and development of Taenia solium metacestodes.  

PubMed

In the present study, we have determined the growth and development pattern of rostellar hooklets of Taenia solium cysticerci (Zhengzhou and Harbin strains) in three pigs (1 SEM and 2 L-SEM strains) 89-196 days post experimental infection. A total of 3,675 cysticerci were collected from 3 pigs, 3,007 (82%) of 3,675 cysticerci were evaginated by enzyme method. 439 (15%) evaginated cysticerci were carefully examined and measured after dehydration, staining, and mounting on microscopic slides. Among 439 cysticerci, 234 (53%) had pair rostellar hooks, 88 (20%) with unpair hooks, 60 (14%) only small (outer row) hooks, and 57 (13%) no hooks including 34 hooks were completely dropped and 23 no hooks developed. The number ranged from 10 to 17 pairs for pair hooks and 1 to 29 for unpair ones. The length and width of rostallar hooks on the scolex of cysticerci were usually larger in the pig with longer infection time. Moreover, cysticerci with pair and unpair rostellar hooks had only small hooks and no hooks were present on their scolices. However, cysticerci with only large (inner row) hooks were not found. These findings indicate that the growth and development of small hooks precedes that of the large hooks in the formation of the two-row pattern rostellar hook in Cysticercus cellulosae. PMID:11556578

Fan, P C; Chung, W C; Guo, J X; Ma, X Y; Xu, Z J

2001-06-01

390

In Vitro Analysis of Albendazole Sulfoxide Enantiomers Shows that (+)-(R)-Albendazole Sulfoxide Is the Active Enantiomer against Taenia solium  

PubMed Central

Albendazole is an anthelmintic drug widely used in the treatment of neurocysticercosis (NCC), an infection of the brain with Taenia solium cysts. However, drug levels of its active metabolite, albendazole sulfoxide (ABZSO), are erratic, likely resulting in decreased efficacy and suboptimal cure rates in NCC. Racemic albendazole sulfoxide is composed of ABZSO (+)-(R)- and (?)-(S) enantiomers that have been shown to differ in pharmacokinetics and activity against other helminths. The antiparasitic activities of racemic ABZSO and its (+)-(R)- and (?)-(S) enantiomers against T. solium cysts were evaluated in vitro. Parasites were collected from naturally infected pigs, cultured, and exposed to the racemic mixture or to each enantiomer (range, 10 to 500 ng/ml) or to praziquantel as a reference drug. The activity of each compound against cysts was assayed by measuring the ability to evaginate and inhibition of alkaline phosphatase (AP) and parasite antigen release. (+)-(R)-ABZSO was significantly more active than (?)-(S)-ABZSO in suppressing the release of AP and antigen into the supernatant in a dose- and time-dependent manner, indicating that most of the activity of ABZSO resides in the (+)-(R) enantiomer. Use of this enantiomer alone may lead to increased efficacy and/or less toxicity compared to albendazole.

Paredes, Adriana; de Campos Lourenco, Tiago; Marzal, Miguel; Rivera, Andrea; Dorny, Pierre; Mahanty, Siddhartha; Guerra-Giraldez, Cristina; Garcia, Hector H.; Cass, Quezia B.

2013-01-01

391

Taenia taeniaeformis: early inflammatory response around developing metacestodes in the liver of resistant and susceptible mice II. Histochemistry and cytochemistry.  

PubMed

Female BALB/cJ (resistant), C3H/HeJ (intermediate resistant), and C3H/HeDub (susceptible) inbred mice, 4-5 wk old, were infected with Taenia taeniaeformis. Liver sections were stained for the enzymes acid phosphatase, beta-glucuronidase, and peroxidase. Eosinophils present around the parasite were identified by the ethanolic Congo red method. Possible gross changes in lipid metabolism in the hepatocytes surrounding the parasite were investigated with the Sudan black B method. The results of observations made by light microscopy were: (1) beta-glucuronidase activity above background levels was observed only in the hepatocytes around the parasite in BALB/cJ mice at 4, 5, and 6 days postinfection (PI); no reaction was observed in the other 2 strains of mice studied; (2) acid phosphatase activity was very strong at 2, 3, and 4 in the 3 strains of mice while this reactivity was weak at 5 and 6 days PI; (3) the cytoplasm of the hepatocytes around the metacestode stained more heavily with Sudan black B than other hepatocytes; and (4) the presence of eosinophils appearing at 3 days PI around the parasite in all 3 strains of mice was demonstrated by staining with Sudan black B, the substrate of peroxidase, and Congo red. Infected C3H/HeJ and BALB/cJ mice had higher numbers of liver eosinophils than infected C3H/HeDub mice throughout the observation time. The present results suggest 2 conclusions: (1) a parasite-liver interaction occurs as is evident by hepatocyte changes in beta-glucuronidase activity and Sudan black B staining, and (2) resistance to the early stages of T. taeniaeformis is associated with the appearance of eosinophils. PMID:2443633

Letonja, T; Hammerberg, C

1987-10-01

392

Geographical widespread of two lineages of Taenia solium due to human migrations: can population genetic analysis strengthen this hypothesis?  

PubMed

In this paper we discuss, with a new analysis of published data, the phylogenetic hypothesis of two genotypes of Taenia solium previously suggested. Sequences of mitochondrial (co1, cob, nad) and nuclear (18S+ITS1+5.8S, LMWA1 and LMWA2) T. solium DNA from Africa, Asia, Latin America, and Oceania deposited in GenBank international databases were analyzed for diversity and genetic structure. Overall, we found that percentages of polymorphic and informative sites were comparatively less in mitochondrial genes, and minimum or null values of nucleotide diversity and nucleotide polymorphism were also observed. Analysis of co1 populations showed two associations of particular interest: Asia/Latin America and Africa/Latin America; with minimal differentiation between them and a constant genetic flow. Bayesian phylogenetic trees built with the available sequences for co1+cob showed two clusters, one for Asia and another one for Africa/Latin America while with ribosomal sequences only one cluster was obtained that grouped Asian and Latin American populations. The haplotype network tree built using co1+cob showed two major clades, one clustering African and Latin American parasite populations and the other grouping Asian populations, hallmarking Mexican/Peruvian and the Indian populations as dispersion centers, respectively. The haplotype network tree built with ribosomal sequences exhibited Philippines and Peru/Mexico/Colombia as the two major dispersion centers, with several Latin American haplotypes diverging from the latter. Our results suggest that the gene flow within the different T. solium populations has the same dispersion pattern than the main maritime trade routes used between the XV and XIX centuries. PMID:19778639

Martinez-Hernandez, Fernando; Jimenez-Gonzalez, Diego Emiliano; Chenillo, Paola; Alonso-Fernandez, Cristina; Maravilla, Pablo; Flisser, Ana

2009-09-22

393

Taenia arctos n. sp. (Cestoda: Cyclophyllidea: Taeniidae) from its definitive (brown bear Ursus arctos Linnaeus) and intermediate (moose/elk Alces spp.) hosts.  

PubMed

Taenia arctos n. sp. (Cestoda: Cyclophyllidea: Taeniidae) is described from the brown bear Ursus arctos Linnaeus (definitive host) and moose/elk Alces spp. (intermediate hosts) from Finland (type-locality) and Alaska, USA. The independent status of the new species and the conspecificity of its adults and metacestodes have been recently confirmed by the mtDNA sequence data of Lavikainen et al. (2011; Parasitology International, 60, 289-295). Special reference is given to morphological differences between the new species and T. krabbei Moniez, 1879 (definitive hosts primarily canines for the latter), both of which use the moose/elk (Alces spp.) as intermediate hosts (the latter also uses Rangifer and perhaps other northern ruminants), and between the new species and T. ursina Linstow, 1893, both of which use the brown bear U. arctos as a definitive host. New morphological data are also provided for adults and cysticerci of T. krabbei. The analysis includes potentially useful morphometric features that have not been previously applied to Taenia spp. PMID:22002024

Haukisalmi, Voitto; Lavikainen, Antti; Laaksonen, Sauli; Meri, Seppo

2011-10-15

394

Synthetic peptide-targeted selection of phage display mimotopes highlights immunogenic features of ?-helical vs non-helical epitopes of Taenia solium paramyosin: Implications for parasite- and host-protective roles of the protein  

Microsoft Academic Search

Paramyosin of the pig-human parasite Taenia solium (TPmy) is a ?-helical protein located on the worm surface that is suggested to fulfill an immunomodulatory role protecting the parasite against host immune system. Besides, in challenging experiments the protein shows a vaccine potential. These observations imply that TPmy harbors antigenic determinants for each of these contrasting actions. However the suggestion was

Karlen G. Gazarian; Carlos F. Solis; Tatiana G. Gazarian; Merrill Rowley; Juan P. Laclette

395

Activation of P1- and P2Y-purinoceptors by ADP-ribose in the guinea-pig taenia coli, but not of P2X-purinoceptors in the vas deferens.  

PubMed Central

1. The activity of adenosine 5'-diphosphoribose (ADP-ribose), a ribosylated purine nucleotide, was investigated on the carbachol-contracted taenia coli, a tissue possessing P1- (A2) and P2Y-purinoceptors and on the guinea-pig vas deferens which possesses P2X-purinoceptors. 2. In the vas deferens, where ATP (1 microM-1 mM) produced concentration-dependent contractions, ADP-ribose was without effect at concentrations up to 1 mM. 3. In the taenia coli, ADP-ribose (0.1 microM-1 mM) produced concentration-dependent relaxations with a potency similar to that of adenosine, but less than that of ATP. The pD2 values for ADP-ribose, adenosine and ATP were 4.5 +/- 0.07 (27), 4.4 +/- 0.10 (9) and 5.5 +/- 0.14 (21), respectively. The time-course of the relaxations elicited by ADP-ribose was found to be significantly longer than that for ATP and significantly shorter than that for adenosine. 4. The P1-purinoceptor antagonist, 8-phenyltheophylline (5 microM), produced parallel rightward shifts in the concentration-response curves of the relaxations of the taenia coli elicited by ADP-ribose and adenosine but not ATP. 5. Dipyridamole (0.3 microM), a purine nucleoside uptake inhibitor, potentiated the responses to adenosine and ADP-ribose in the taenia coli. These potentiations were sensitive to 8-phenyltheophylline (5 microM). 6. Reactive blue 2, a P2Y-purinoceptor antagonist, antagonized the inhibitory responses of ADP-ribose and ATP in the taenia coli, without significantly altering the inhibitory responses of either adenosine or noradrenaline.(ABSTRACT TRUNCATED AT 250 WORDS)

Hoyle, C. H.; Edwards, G. A.

1992-01-01

396

Acute pancreatitis caused by tapeworm in the biliary tract.  

PubMed

Taeniasis is a helminthic infection endemic in southeast Asia, including Taiwan. Recent studies suggest that Asian Taenia is a new subspecies of Taenia saginata and has been renamed as Taenia saginata asiatica. It is usually asymptomatic or associated with only mild gastrointestinal symptoms. We report the case of a 52-year-old woman with acute epigastric pain and vomiting. Her levels of amylase and lipase were significantly elevated on admission. Gastrointestinal endoscopy showed proglottids of a tapeworm in the papilla of the duodenum. The epigastric pain subsided and the amylase and lipase levels decreased after removal of the tapeworm by endoscopy and anthelminthic treatment. Although parasites are not an uncommon cause of pancreatitis, especially in disease-endemic areas, it is rare for Taenia to cause acute pancreatitis. PMID:16103608

Liu, Yu-Min; Bair, Ming-Jong; Chang, Wen-Hsiung; Lin, Shee-Chan; Chan, Yu-Jan

2005-08-01

397

Force response to rapid length change during contraction and rigor in skinned smooth muscle of guinea-pig taenia coli.  

PubMed Central

1. Mechanical transients in fibre bundles of skinned smooth muscle of guinea-pig taenia coli at 21-22 degrees C were investigated by recording tension responses to length changes of up to 9%, complete within 0.3 ms. 2. The length-force relationship, recorded continuously during rapid stretch of a Ca(2+)-activated contracted muscle, was linear up to at least 2.5 times the isometric force, corresponding to a stretch of about 1%. The slope of the relationship (stiffness) increased with the velocity of stretch. 3. During rapid release (about 120 muscle lengths s-1) the length-force relationship was linear down to about 50% of the initial isometric force, reached at about 80 microseconds after the beginning of the release. At lower force the length-force relationship was concave upwards. The linear portion extrapolated to zero force at about -0.008 muscle lengths. In large releases the length-force plot approached the force baseline under an acute angle, and negative force was transiently exerted. 4. When the muscle was stretched back to the initial length after a shortening step, force transiently rose above the isometric force, but decayed back within a few milliseconds. Stiffness at the time of restretch was compared with that in the initial shortening step by plotting force vs. length, and was found to be decreased to 63% within 0.3 ms of a step to zero force. Stiffness decreased further with time at zero force, and after 256 ms was about 29% of the isometric value. 5. In rigor, caused by the introduction of ATP-free solution during the plateau of isometric contraction, fibre tension decreased to about 30% of the active tension, whereas stiffness relative to force increased; 82% of the initial stiffness in rigor was detected in a restretch immediately after a shortening step, decreasing to 59% at 256 ms. When the fibre was activated at suboptimal [Ca2+] to cause the same force as in rigor, stiffness was lower than in rigor and decreased more after a release. 6. After completion of a release-stretch cycle, stiffness was rapidly restored to the same value as in isometric contraction. Test stretches at different points in time after completion of the cycle revealed that most of the stiffness had been restored within 1 ms of the restretch, occurring concomitantly with a decay in force.(ABSTRACT TRUNCATED AT 400 WORDS)

Arheden, H; Hellstrand, P

1991-01-01

398

First paleoparasitological study of an embalming rejects jar found in Saqqara, Egypt.  

PubMed

For the first time, a jar of embalming rejects was studied in search for helminth parasite eggs. This kind of jar was used to put discarded material by Egyptian embalmers during mummification process. Ascaris lumbricoides and Taenia saginata eggs were found in the linen and strip fragment contents of the jar, dated of 2,715-2,656 years ago. PMID:12687770

Harter, Stéphanie; Le Bailly, Matthieu; Janot, Francis; Bouchet, Françoise

2003-01-01

399

Efficacy of Single-Dose and Triple-Dose Albendazole and Mebendazole against Soil-Transmitted Helminths and Taenia spp.: A Randomized Controlled Trial  

PubMed Central

Background The control of soil-transmitted helminth (STH) infections currently relies on the large-scale administration of single-dose oral albendazole or mebendazole. However, these treatment regimens have limited efficacy against hookworm and Trichuris trichiura in terms of cure rates (CR), whereas fecal egg reduction rates (ERR) are generally high for all common STH species. We compared the efficacy of single-dose versus triple-dose treatment against hookworm and other STHs in a community-based randomized controlled trial in the People's Republic of China. Methodology/Principal findings The hookworm CR and fecal ERR were assessed in 314 individuals aged ?5 years who submitted two stool samples before and 3–4 weeks after administration of single-dose oral albendazole (400 mg) or mebendazole (500 mg) or triple-dose albendazole (3×400 mg over 3 consecutive days) or mebendazole (3×500 mg over 3 consecutive days). Efficacy against T. trichiura, Ascaris lumbricoides, and Taenia spp. was also assessed. Albendazole cured significantly more hookworm infections than mebendazole in both treatment regimens (single dose: respective CRs 69% (95% confidence interval [CI]: 55–81%) and 29% (95% CI: 20–45%); triple dose: respective CRs 92% (95% CI: 81–98%) and 54% (95% CI: 46–71%)). ERRs followed the same pattern (single dose: 97% versus 84%; triple dose: 99.7% versus 96%). Triple-dose regimens outperformed single doses against T. trichiura; three doses of mebendazole – the most efficacious treatment tested – cured 71% (95% CI: 57–82%). Both single and triple doses of either drug were highly efficacious against A. lumbricoides (CR: 93–97%; ERR: all >99.9%). Triple dose regimens cured all Taenia spp. infections, whereas single dose applications cured only half of them. Conclusions/Significance Single-dose oral albendazole is more efficacious against hookworm than mebendazole. To achieve high CRs against both hookworm and T. trichiura, triple-dose regimens are warranted. Trial Registration www.controlled-trials.com ISRCTN47375023

Steinmann, Peter; Utzinger, Jurg; Du, Zun-Wei; Jiang, Jin-Yong; Chen, Jia-Xu; Hattendorf, Jan; Zhou, Hui; Zhou, Xiao-Nong

2011-01-01

400

The effect of gallamine, gallopamil and nifedipine on responses to acetylcholine and carbachol in the taenia of the guinea-pig caecum.  

PubMed Central

The effects of gallamine, gallopamil and nifedipine on isotonic contractions of the isolated taenia of the guinea-pig caecum produced by acetylcholine (ACh) or carbachol (CCh) were investigated. Gallamine (0.1 to 0.3 mM) inhibited contractions produced by CCh more than those produced by ACh. The difference was still present after pretreatment of the tissue with paraoxon (10 microM for 20 min) to inhibit cholinesterases or in experiments carried out in the presence of tetrodotoxin (0.3 microM) to exclude possible ganglionic stimulation by the agonists. Gallopamil or nifedipine selectively inhibited the tonic response to ACh in the absence or presence of paraoxon. The phasic response to ACh or the tonic response to CCh (0.1 or 1 microM) was much less affected. Reduction of the Ca2+ content of the bath medium reduced phasic and tonic responses to ACh more than the tonic response to CCh. These results suggest that there are differences in the interaction of ACh and CCh with muscarinic receptors in this muscle.

Mitchelson, F.; Ziegler, A.

1984-01-01

401

Altered T helper responses in CD40 and interleukin-12 deficient mice reveal a critical role for Th1 responses in eliminating the helminth parasite Taenia crassiceps.  

PubMed

A key feature of helminth infections is the induction of strong Th2-biased immune responses in their hosts. We have previously found that Th2-like responses mediate susceptibility to the helminth parasite Taenia crassiceps, probably by inhibiting Th1 responses required for the development of protective immunity against this parasite. Here we show that mice lacking interleukin-12p35 (IL-12p35-/-) following T. crassiceps infection, failed to mount a Th1 response, but developed a strong Th2-type response, produced higher levels of IgG1, IgE, interleukin-4, interleukin-5 as well as interleukin-13 than wild-type mice, and became highly susceptible to the larval stage of this cestode. In contrast, similarly-infected CD40 deficient BALB/c mice (CD40-/-) displayed impairment of both Th1 and Th2-type responses associated with low levels of interferon-gamma as well as IgE, interleukin-4, interleukin-5 and interleukin-13, but efficiently controlled T. crassiceps infection. Together, these findings suggest a detrimental role for Th2-biased responses during the larval stage of T. crassiceps infection. Furthermore, they also suggest a pivotal role for CD40 in developing Th2-type responses. PMID:12814650

Rodríguez-Sosa, Miriam; Satoskar, Abhay R; David, John R; Terrazas, Luis I

2003-07-01

402

The effect of hypo- and hypertonic solutions on volume and ion distribution of smooth muscle of guinea-pig taenia coli.  

PubMed

1. The intra- and extracellular spaces and ionic content of the taenia coli of the guinea-pig have been measured in a series of bathing solutions in which the tonicity varied from 0.5 to 3 times the tonicity of the normal Krebs solution.2. Equilibrium of the tissue in the experimental solution is reached within about 30 min.3. The absolute values of the parameters measured have been shown to depend on the blotting technique used. These differences were eliminated by expressing the results as a percentage of the values found in the normal Krebs solution.4. In hypertonic solutions the cell behaves as a perfect osmometer, the cell volume changing in proportion to the tonicity of the bathing medium. Only a small amount of cations is lost from the cells. A considerable amount of chloride is lost, making the postulation of its replacement by some other anions necessary in order to maintain electroneutrality of the intracellular solution.5. In hypotonic solutions the cells do not behave as predicted for a perfect osmometer. In 0.5 hypotonic solution an actual decrease in cell volume was observed associated with an increase of the extracellular space probably due to penetration of [(14)C]sorbitol into the cell. The intracellular ionic concentration was decreased. These findings suggest damage of the cell membrane.6. The observed hyperpolarization of the membrane in hypertonic solution can be explained by the increased intracellular potassium concentration. PMID:5639794

Brading, A F; Setekleiv, J

1968-03-01

403

Taenia taeniaeformis in rat favors protracted skin lesions caused by Sporothrix schenckii infection: Dectin-1 and IL-17 are dispensable for clearance of this fungus.  

PubMed

We occasionally found that cestode Taenia taeniaeformis in rats favored Sporothrix schenckii infection and survival, causing protracted cutaneous lesions. In this study, we compared the pathology and cytokines profile of rats co-infected with the two pathogens and infected with S. schenckii alone to explore underlying mechanisms. In the co-infection group, there was high expression of ?-glucan receptor Dectin-1 in the cutaneous lesions and no multinucleated giant cells, but in the S. schenckii infection group the opposite was observed. Cytokines profiles demonstrated an expected finding that IL-4, commonly expressed in helminth and fungus infection, is undetectable in the two infection groups. In the single fungal infection group, cytokines IFN-?, IL-10 and IL-17 kept increasing in the first few weeks of infection to a peak which was followed by gradual decrease. This study showed that Dectin-1 and IL-17, which were believed to be the major anti-fungus mechanisms, are Th2 independent and dispensable for clearance of S. schenckii infection, suggesting that S. schenckii has a different molecular recognition pattern and evokes anti-infection mechanisms other than Dectin-1 and IL-17. PMID:23285072

Zhang, Xiaohui; Zhang, Jing; Huang, Huaiqiu; Xue, Ruzeng; Hu, Xuchu; Li, Meirong; Zhong, Yi; Yuan, Liyan

2012-12-20

404

Taenia taeniaeformis in Rat Favors Protracted Skin Lesions Caused by Sporothrix schenckii Infection: Dectin-1 and IL-17 Are Dispensable for Clearance of This Fungus  

PubMed Central

We occasionally found that cestode Taenia taeniaeformis in rats favored Sporothrix schenckii infection and survival, causing protracted cutaneous lesions. In this study, we compared the pathology and cytokines profile of rats co-infected with the two pathogens and infected with S. schenckii alone to explore underlying mechanisms. In the co-infection group, there was high expression of ?-glucan receptor Dectin-1 in the cutaneous lesions and no multinucleated giant cells, but in the S. schenckii infection group the opposite was observed. Cytokines profiles demonstrated an expected finding that IL-4, commonly expressed in helminth and fungus infection, is undetectable in the two infection groups. In the single fungal infection group, cytokines IFN-?, IL-10 and IL-17 kept increasing in the first few weeks of infection to a peak which was followed by gradual decrease. This study showed that Dectin-1 and IL-17, which were believed to be the major anti-fungus mechanisms, are Th2 independent and dispensable for clearance of S. schenckii infection, suggesting that S. schenckii has a different molecular recognition pattern and evokes anti-infection mechanisms other than Dectin-1 and IL-17.

Huang, Huaiqiu; Xue, Ruzeng; Hu, Xuchu; Li, Meirong; Zhong, Yi; Yuan, Liyan

2012-01-01

405

Influence of geographical scale on the detection of density dependence in the host-parasite system, Arvicola terrestris and Taenia taeniaeformis.  

PubMed

Infection by the cestode Taenia taeniaeformis was investigated within numerous cyclic populations of the fossorial water vole Arvicola terrestris sampled during 4 years in Franche-Comté (France). The relative influence of different rodent demographic parameters on the presence of this cestode was assessed by considering (1) the demographic phase of the cycle; (2) density at the local geographical scale (<0.1 km2); (3) mean density at a larger scale (>10 km2). The local scale corresponded to the rodent population (intermediate host), while the large scale corresponded to the definitive host population (wild and feral cats). General linear models based on analyses of 1804 voles revealed the importance of local density but also of year, rodent age, season and interactions between year and season and between age and season. Prevalence was significantly higher in low vole densities than during local outbreaks. By contrast, the large geographical scale density and the demographic phase had less influence on infection by the cestode. The potential impacts of the cestode on the fitness of the host were assessed and infection had no effect on the host body mass, litter size or sexual activity of voles. PMID:16329763

Deter, J; Berthier, K; Chaval, Y; Cosson, J F; Morand, S; Charbonnel, N

2005-12-05

406

Inhibitory effect of PACAP(6-38) on relaxations induced by PACAP, VIP and non-adrenergic, non-cholinergic nerve stimulation in the guinea-pig taenia caeci  

Microsoft Academic Search

The effect of the pituitary adenylate cyclase activating polypeptide (PACAP) receptor antagonist PACAP(6-38) on the relaxant response to exogenous PACAP, vasoactive intestinal polypeptide (VIP) and non-adrenergic, non-cholinergic (NANC) nerve stimulation was tested in the guinea-pig taenia caeci, in the presence of atropine (10-6 M) and guanethidine (3᎒-6 M). PACAP(6-38) (3᎒-6 M) strongly inhibited sub-maximal relaxations evoked by exogenous PACAP (1-3᎒-8

L. Lénárd Jr.; Z. Lázár; R. Benkó; R. Szigeti; Z. Báthori; G. K. Tóth; B. Penke; L. Barthó

2000-01-01

407

[Clinical picture of cerebral cysticercosis].  

PubMed

The author studied 82 patients with brain cystocercosis (male--48 and females 34 cases). Cystocercosis was most frequently encountered in individuals from 21--50 years of age. The rural population constituted 74% while the urban--26%. The report contains data on the characteristic symptoms of brain cystocercosis and its differential diagnostical signs with brain tumors. Besides such states as epileptical, hypertensive, occlusional, psychopathological annd meningoencephalitic the authors distinguish the meningeal form which proceeds as a chronic remittent serous meningits. PMID:676603

Bel'man, E L; Kalkun, V R

1978-01-01

408

A dot-ELISA using a partially purified cathepsin-L-like protein fraction from Taenia solium cysticerci for the diagnosis of human neurocysticercosis  

PubMed Central

Human neurocysticercosis (NCC), caused by the cestode Taenia solium, is responsible for a significant amount of neurological morbidity and epilepsy in developing countries. The disease remains highly endemic in many areas, despite several efforts and interventions to control it. A simple, cheap and fast diagnostic assay that is suitable for use in field conditions is highly desired. In immunodiagnostics based on western immunoblots or standard ELISA, a cathepsin-L-like protein purified from the cysticercus fluid has previously performed well as an antigen. In a recent study in Peru, the same 53/25-kDa antigen was therefore used in the development of a dot-ELISA that could be employed for mass screenings under field conditions. The assay was standardized and tested not only against sera from a large group of NCC cases but also against sera from patients with other common parasitic infections, so that sensitivity and specificity could be assessed. For NCC, the assay gave better sensitivity in the detection of individuals with extraparenchymal cysts (94.4%–100%) or multiple parenchymal cysts (74.6%–80.0%) than in the detection of individuals with single parenchymal cysts (29.4%–45.1%). The assay also showed a high specificity for NCC (99.0%–100%), with a very low level of cross-reactivity with other parasitic infections. The dot-ELISA developed in this study is a highly specific, simple, cheap and rapid test for NCC that could be used under field conditions, even in the low-resource settings that are common in developing countries.

Pina, Ruby; Gutierrez, Andres H.; Gilman, Robert H.; Rueda, Daniel; Sifuentes, Cecilia; Flores, Myra; Sheen, Patricia; Rodriguez, Silvia; Garcia, Hector H.; Zimic, Mirko

2012-01-01

409

Comparison of the effects of some muscarinic agonists on smooth muscle function and phosphatidylinositol turnover in the guinea-pig taenia caeci.  

PubMed Central

1. The effects of the muscarinic agonists acetylcholine (ACh), carbachol (CCh), AHR-602, and McN-A-343 on contractility and on inositol phosphate accumulation in the presence of lithium were compared in the taenia of the guinea-pig caecum. 2. Compared to CCh, ACh was a full agonist for contraction but AHR-602 and McN-A-343 were partial agonists producing 80-85% of the maximal response to CCh. Similar to previous findings with CCh, tonic contractions produced by AHR-602 and McN-A-343 were less sensitive to inhibition by nifedipine or verapamil than tonic contractions to ACh. 3. CCh and ACh produced similar increases in inositol phosphate accumulation and the effect of CCh (0.1 mM) was inhibited by atropine (IC50 8.5 nM) and pirenzepine (IC50 450 nM). The accumulation of inositol phosphates in the presence of AHR-602 or McN-A-343 was not significantly different (P greater than 0.05) from basal levels. 4. A concentration of 0.2 mM AHR-602 produced a parallel shift of the concentration-response curve to CCh on inositol phosphate accumulation. The IC50 value for inhibition of CCh (0.1 mM) was greater than 50 fold higher than the EC50 value for contraction produced by the partial agonist. McN-A-343 (20 microM) produced a flattening of the concentration-response curve to CCh for inositol phosphate accumulation. 5. The results suggest that the increase in phosphatidylinositol turnover produced by muscarinic agonists, like the contractile response, involves an M2-muscarinic receptor. AHR-602 and McN-A-343 are partial agonists for the contractile response and while producing no significant increase in phosphatidylinositol turnover inhibit the response to CCh.

Gardner, A. L.; Choo, L. K.; Mitchelson, F.

1988-01-01

410

Regulation of the immune response to cestode infection by progesterone is due to its metabolism to estradiol  

Microsoft Academic Search

The aim of this work was to investigate the role of progesterone during Taenia crassiceps cysticercosis, and the immunological mechanisms involved in its effects, by relating progesterone treatment to whole parasite counts, to host humoral and cellular immune response, to the presence or absence of nuclear receptors to sex steroids in splenocytes, and to serum sex steroid levels in infected

José A. Vargas-Villavicencio; Carlos Larralde; Marco A. De León-Nava; Jorge Morales-Montor

2005-01-01

411

Neonatal exposure to estradiol induces resistance to helminth infection and changes in the expression of sex steroid hormone receptors in the brain and spleen in adult mice of both sexes  

Microsoft Academic Search

A single injection of 17?-estradiol administered to 4-day-old male and female mice increased the cellular immune response, and induced resistance to Taenia crassiceps cysticercosis as well as changes in the expression pattern of progesterone (PR) and estrogen receptor (ER) isoforms in the brain and splenocytes. Regardless of gender, when treated mice reached adulthood, they were highly resistant to infection. Female

Carolina Guzmán; Ignacio Camacho-Arroyo; Marco A. De León-Nava; Jorge Morales-Montor

2009-01-01

412

Current status of human taeniasis in Lao People's Democratic Republic.  

PubMed

Human taeniasis was investigated in Lao People's Democratic Republic (Lao PDR) between 2000 and 2011 as part of the nation's helminthiasis survey. A total of 55,038 inhabitants, including 29,846 school children, were examined using the Kato-Katz and scotch-tape anal swab method, and morphological observation of adult worms. Molecular identification of Taenia tapeworms was performed by multiplex PCR or DNA sequence analysis of the mitochondrial cox1 gene. Taenia eggs were present at a rate of 1.5% (845/55,038) in the subject population. Adult tapeworms were identified as T. solium or T. saginata by analyzing the collectable stool specimens (n=126). Three specimens identified as T. solium were found in Luang Prabang, while the remaining 123 specimens, which were T. saginata, were found in Bokeo, Bolikhamxay, Champasak, Houaphan, Khammouane, Luang Namta, Luang Prabang, Oudomxay, Phongsaly, Saysomboune, Saravane, Savannakhet, Xayaboury, Xekong, Xieng Khouang Province, and Vientiane Municipality. PMID:23710098

Jeon, Hyeong-Kyu; Yong, Tai-Soon; Sohn, Woon-Mok; Chai, Jong-Yil; Min, Duk-Young; Yun, Cheong-Ha; Rim, Han-Jong; Pongvongsa, Tiengkham; Banouvong, Virasack; Insisiengmay, Bounnaloth; Phommasack, Bounlay; Eom, Keeseon S

2013-04-25

413

Current Status of Human Taeniasis in Lao People's Democratic Republic  

PubMed Central

Human taeniasis was investigated in Lao People's Democratic Republic (Lao PDR) between 2000 and 2011 as part of the nation's helminthiasis survey. A total of 55,038 inhabitants, including 29,846 school children, were examined using the Kato-Katz and scotch-tape anal swab method, and morphological observation of adult worms. Molecular identification of Taenia tapeworms was performed by multiplex PCR or DNA sequence analysis of the mitochondrial cox1 gene. Taenia eggs were present at a rate of 1.5% (845/55,038) in the subject population. Adult tapeworms were identified as T. solium or T. saginata by analyzing the collectable stool specimens (n=126). Three specimens identified as T. solium were found in Luang Prabang, while the remaining 123 specimens, which were T. saginata, were found in Bokeo, Bolikhamxay, Champasak, Houaphan, Khammouane, Luang Namta, Luang Prabang, Oudomxay, Phongsaly, Saysomboune, Saravane, Savannakhet, Xayaboury, Xekong, Xieng Khouang Province, and Vientiane Municipality.

Jeon, Hyeong-Kyu; Yong, Tai-Soon; Sohn, Woon-Mok; Chai, Jong-Yil; Min, Duk-Young; Yun, Cheong-Ha; Rim, Han-Jong; Pongvongsa, Tiengkham; Banouvong, Virasack; Insisiengmay, Bounnaloth; Phommasack, Bounlay

2013-01-01

414

Sequence analysis of a gene family encoding Taenia ovis vaccine antigens expressed during embryogenesis of eggs 1 Note: Nucleotide sequence data reported in this paper are available in the EMBL, GenBank™ and DDJB data bases under the accession number(s)-U75739-42 1  

Microsoft Academic Search

The 45W vaccine antigen of the cestode parasite Taenia ovis is a member of a small gene family estimated to comprise six members. All six genes were cloned and characterised. Nucleotide sequence analysis of the different family members identified a set of closely related genes exhibiting between 75.2 and 98.6% DNA sequence homology. Intron\\/exon structure for the various genes constituting

Jacqueline Waterkeyn; Charles Gauci; Alan Cowman; Marshall Lightowlers

1997-01-01

415

Synthetic peptide-targeted selection of phage display mimotopes highlights immunogenic features of ?-helical vs non-helical epitopes of Taenia solium paramyosin: implications for parasite- and host-protective roles of the protein.  

PubMed

Paramyosin of the pig-human parasite Taenia solium (TPmy) is a ?-helical protein located on the worm surface that is suggested to fulfill an immunomodulatory role protecting the parasite against host immune system. Besides, in challenging experiments the protein shows a vaccine potential. These observations imply that TPmy harbors antigenic determinants for each of these contrasting actions. However the suggestion was not given a support from experimental data because respective epitopes have not been described thus far. To circumvent this difficulty, we use synthetic peptides with sequences of regions composed of ?-helical or linear structure to induce rabbit antibody responses for phage-display mapping of epitope core amino-acid sets. Antibodies to ?-helical regions were weak binders and M13 phage-displayed peptides selected by them from two different libraries exhibited no amino-acid similarities with the original protein site. In contrast, the antibodies produced in response to non-helical segment within ?-helical structure were better binders and selectors of perfect structural mimics of the protein site. This first phage display epitope analysis of TPmy supports the notion that the rod-like ?-helix, which encompasses over 90% of the total amino acids, may serve as an immunomodulatory shield that protects the parasite. Further, the seven non-helical segments of the TPmy molecule may represent the only anti-parasite discrete immunogenic epitopes whose representative mimotopes can be utilized in development of pure epitope vaccines. PMID:22015270

Gazarian, Karlen G; Solis, Carlos F; Gazarian, Tatiana G; Rowley, Merrill; Laclette, Juan P

2011-10-08

416

Neurocysticercosis in the infant of a pregnant mother with a tapeworm.  

PubMed

Taeniasis occurs after ingestion of undercooked pork infected with cysticerci. Most Taenia solium infections are mild; proglottids are rarely noticed in the feces. Cysticercosis develops with ingestion of eggs from a tapeworm carrier. Cysticercosis affects approximately 50 million people worldwide, and is seen mostly in Central and South America, sub-Saharan Africa, India, and Asia. We present a case of an 18-month-old child living in New York, who presented with seizures caused by neurocysticercosis. A family study found a 22-year-old mother, 7 months pregnant, positive for T. solium, which presented a management dilemma. PMID:19706913

Asnis, Deborah; Kazakov, Jordan; Toronjadze, Tamar; Bern, Caryn; Garcia, Hector H; McAuliffe, Isabel; Bishop, Henry; Lee, Lillian; Grossmann, Rami; Garcia, Minerva A; Di John, David

2009-09-01

417

Species identification after treatment for human taeniasis.  

PubMed

Identification of species of human tapeworms is crucial because the consequences of infection by Taenia solium and T saginata are very different. However, evacuation of species-identifiable tapeworms is uncommon and Taenia spp eggs are indistinguishable under the microscope. Treatment of taeniasis consists of niclosamide followed by a purgative. Recently, we adopted preniclosamide and postniclosamide electrolyte-polyethyleneglycol salt (EPS) purges to improve bowel cleaning. Retrospective comparison of traditional castor oil with EPS purge showed that recovery of the tapeworm scolex was significantly improved (20 of 68 vs none of 46, p=0.0001) in the EPS group. Furthermore, 42 of 68 (62%) individuals receiving EPS excreted identifiable gravid proglottids. EPS treatment helps the visual identification of Taenia spp. PMID:15043964

Jeri, Cesar; Gilman, Robert H; Lescano, Andres G; Mayta, Holger; Ramirez, Maria E; Gonzalez, Armando E; Nazerali, Rahim; Garcia, Hector H

2004-03-20

418

Infection of rats with Taenia taeniformis metacestodes increases hepatic CYP450, induces the activity of CYP1A1, CYP2B1 and COH isoforms and increases the genotoxicity of the procarcinogens benzo[a]pyrene, cyclophosphamide and aflatoxin B(1).  

PubMed

Infection of rat liver by Taenia taeniformis metacestodes produced an increase in total CYP450 content and induced activity of the CYP1A1, CYP2B1 and COH isoforms. Variations in activity and p450 total content were found with increasing time of infection. During increased activity of p450 isoforms, rats were challenged with carcinogens metabolized by the mentioned isozymes and an increased amount of genotoxic damage was found when benzo[a] pyrene, cyclophosphamide and aflatoxin B(1) were used. No change was seen in CYP2E1 activity. These results support previous findings regarding an increased susceptibility to genotoxic damage of infected organisms. PMID:12621079

Montero, Regina; Serrano, Luis; Dávila, Víctor M; Ito, Akira; Plancarte, Agustín

2003-03-01