Chappelka, A H; Somers, G L; Renfro, J R
2007-10-01
Incidence and severity of ozone-induced foliar symptoms on tall milkweed (Asclepias exaltata L.) along selected trails in Great Smoky Mountains National Park (GRSM) were determined by two surveys/season conducted from 1992 through 1996. Overall incidence was 73%, and was 84%, 44%, 90%, 58%, and 82% for 1992-1996, respectively for the same clusters. Average incidence was 61% and 84% for the 1st and 2nd surveys, respectively. Seasonal comparisons showed two distinct injury groupings regarding incidence and severity of injury: 1992, 1994 and 1996 (high injury); 1993 and 1995 (low injury). No discernible patterns were observed between symptomatic and asymptomatic plants regarding height, herbivory or flowering. Regression analyses indicated no differentiation in foliar symptoms regarding topographic position, aspect, slope or elevation over the 5-year study period. Our findings indicate other micro-site or genetic factors may control ozone sensitivity of tall milkweed in GRSM.
Pocius, V M; Debinski, D M; Pleasants, J M; Bidne, K G; Hellmich, R L; Brower, L P
2017-01-01
Abstract The population of monarch butterflies east of the Rocky Mountains has experienced a significant decline over the past 20 yr. In order to increase monarch numbers in the breeding range, habitat restoration that includes planting milkweed plants is essential. Milkweeds in the genus Asclepias and Cynanchum are the only host plants for larval monarch butterflies in North America, but larval performance and survival across nine milkweeds native to the Midwest is not well documented. We examined development and survival of monarchs from first-instar larval stages to adulthood on nine milkweed species native to Iowa. The milkweeds included Asclepias exaltata (poke milkweed) (Gentianales: Apocynaceae), Asclepias hirtella (tall green milkweed) (Gentianales: Apocynaceae), Asclepias incarnata (swamp milkweed) (Gentianales: Apocynaceae), Asclepias speciosa (showy milkweed) (Gentianales: Apocynaceae), Asclepias sullivantii (prairie milkweed) (Gentianales: Apocynaceae), Asclepias syriaca (common milkweed) (Gentianales: Apocynaceae), Asclepias tuberosa (butterfly milkweed) (Gentianales: Apocynaceae), Asclepias verticillata (whorled milkweed) (Gentianales: Apocynaceae), and Cynanchum laeve (honey vine milkweed) (Gentianales: Apocynaceae). In greenhouse experiments, fewer larvae that fed on Asclepias hirtella and Asclepias sullivantii reached adulthood compared with larvae that fed on the other milkweed species. Monarch pupal width and adult dry mass differed among milkweeds, but larval duration (days), pupal duration (days), pupal mass, pupal length, and adult wet mass were not significantly different. Both the absolute and relative adult lipids were different among milkweed treatments; these differences are not fully explained by differences in adult dry mass. Monarch butterflies can survive on all nine milkweed species, but the expected survival probability varied from 30 to 75% among the nine milkweed species. PMID:28961914
Pocius, V M; Debinski, D M; Pleasants, J M; Bidne, K G; Hellmich, R L; Brower, L P
2017-10-01
The population of monarch butterflies east of the Rocky Mountains has experienced a significant decline over the past 20 yr. In order to increase monarch numbers in the breeding range, habitat restoration that includes planting milkweed plants is essential. Milkweeds in the genus Asclepias and Cynanchum are the only host plants for larval monarch butterflies in North America, but larval performance and survival across nine milkweeds native to the Midwest is not well documented. We examined development and survival of monarchs from first-instar larval stages to adulthood on nine milkweed species native to Iowa. The milkweeds included Asclepias exaltata (poke milkweed) (Gentianales: Apocynaceae), Asclepias hirtella (tall green milkweed) (Gentianales: Apocynaceae), Asclepias incarnata (swamp milkweed) (Gentianales: Apocynaceae), Asclepias speciosa (showy milkweed) (Gentianales: Apocynaceae), Asclepias sullivantii (prairie milkweed) (Gentianales: Apocynaceae), Asclepias syriaca (common milkweed) (Gentianales: Apocynaceae), Asclepias tuberosa (butterfly milkweed) (Gentianales: Apocynaceae), Asclepias verticillata (whorled milkweed) (Gentianales: Apocynaceae), and Cynanchum laeve (honey vine milkweed) (Gentianales: Apocynaceae). In greenhouse experiments, fewer larvae that fed on Asclepias hirtella and Asclepias sullivantii reached adulthood compared with larvae that fed on the other milkweed species. Monarch pupal width and adult dry mass differed among milkweeds, but larval duration (days), pupal duration (days), pupal mass, pupal length, and adult wet mass were not significantly different. Both the absolute and relative adult lipids were different among milkweed treatments; these differences are not fully explained by differences in adult dry mass. Monarch butterflies can survive on all nine milkweed species, but the expected survival probability varied from 30 to 75% among the nine milkweed species. © The Author 2017. Published by Oxford University Press on behalf
James, David G.; Seymour, Lorraine; Lauby, Gerry; Buckley, Katie
2016-01-01
Native plant and beneficial insect associations are relatively unstudied yet are important in native habitat restoration programs for improving and sustaining conservation biological control of arthropod pests in agricultural crops. Milkweeds (Asclepias spp.) are currently the focus of restoration programs in the USA aimed at reversing a decline in populations of the milkweed-dependent monarch butterfly (Danaus plexippus); however, little is known of the benefits of these plants to other beneficial insects. Beneficial insects (predators, parasitoids, pollinators) attracted to two milkweed species (Asclepias speciosa, Asclepias fascicularis) in central Washington State, WA, USA were identified and counted on transparent sticky traps attached to blooms over five seasons. Combining all categories of beneficial insects, means of 128 and 126 insects per trap were recorded for A. speciosa and A. fascicularis, respectively. Predatory and parasitic flies dominated trap catches for A. speciosa while parasitic wasps were the most commonly trapped beneficial insects on A. fascicularis. Bees were trapped commonly on both species, especially A. speciosa with native bees trapped in significantly greater numbers than honey bees. Beneficial insect attraction to A. speciosa and A. fascicularis was substantial. Therefore, these plants are ideal candidates for habitat restoration, intended to enhance conservation biological control, and for pollinator conservation. In central Washington, milkweed restoration programs for enhancement of D. plexippus populations should also provide benefits for pest suppression and pollinator conservation. PMID:27367733
James, David G; Seymour, Lorraine; Lauby, Gerry; Buckley, Katie
2016-06-29
Native plant and beneficial insect associations are relatively unstudied yet are important in native habitat restoration programs for improving and sustaining conservation biological control of arthropod pests in agricultural crops. Milkweeds (Asclepias spp.) are currently the focus of restoration programs in the USA aimed at reversing a decline in populations of the milkweed-dependent monarch butterfly (Danaus plexippus); however, little is known of the benefits of these plants to other beneficial insects. Beneficial insects (predators, parasitoids, pollinators) attracted to two milkweed species (Asclepias speciosa, Asclepias fascicularis) in central Washington State, WA, USA were identified and counted on transparent sticky traps attached to blooms over five seasons. Combining all categories of beneficial insects, means of 128 and 126 insects per trap were recorded for A. speciosa and A. fascicularis, respectively. Predatory and parasitic flies dominated trap catches for A. speciosa while parasitic wasps were the most commonly trapped beneficial insects on A. fascicularis. Bees were trapped commonly on both species, especially A. speciosa with native bees trapped in significantly greater numbers than honey bees. Beneficial insect attraction to A. speciosa and A. fascicularis was substantial. Therefore, these plants are ideal candidates for habitat restoration, intended to enhance conservation biological control, and for pollinator conservation. In central Washington, milkweed restoration programs for enhancement of D. plexippus populations should also provide benefits for pest suppression and pollinator conservation.
Souza, Lara; Neufeld, Howard S; Chappelka, Arthur H; Burkey, Kent O; Davison, Alan W
2006-05-01
The goals of this study were to document the development of ozone-induced foliar injury, on a leaf-by-leaf basis, and to develop ozone exposure relationships for leaf cohorts and individual tall milkweeds (Asclepias exaltata L.) in Great Smoky Mountains National Park. Plants were classified as either ozone-sensitive or insensitive based on the amount of foliar injury. Sensitive plants developed injury earlier in the season and to a greater extent than insensitive plants. Older leaf cohorts were more likely to belong to high injury classes by the end of each of the two growing seasons. In addition, leaf loss was more likely for older cohorts (2000) and lower leaf positions (2001) than younger cohorts and upper leaves, respectively. Most leaves abscised without prior ozone-like stippling or chlorosis. Failure to take this into account can result in underestimation of the effects of ozone on these plants.
Shannon C.K. Straub; Mark Fishbein; Tatyana Livshult; Zachary Foster; Matthew Parks; Kevin Weitemier; Richard C. Cronn; Aaron Liston
2011-01-01
Milkweeds (Asclepias L.) have been extensively investigated in diverse areas of evolutionary biology and ecology; however, there are few genetic resources available to facilitate and compliment these studies. This study explored how low coverage genome sequencing of the common milkweed (Asclepias syriaca L.) could be useful in...
USDA-ARS?s Scientific Manuscript database
The common milkweed is of the family Asclepiadaceae which comprises over 200 genera and 2500 species including Asclepias syriaca L and its near relatives, A. speciosa and A. tuberosa. Asclepias syriaca, or the common milkweed, is a perennial that is native to the Americas and is so named because of...
The common milkweed (Asclepias syriaca): A new industrial crop
USDA-ARS?s Scientific Manuscript database
Asclepias syriaca L. (the common milkweed) is a perennial plant occurring east of the Rockies in the United States, but particularly east of the Mississippi River and from Southern Canada to Mexico. The plant has many unsavory given names by frustrated farmers including “the Wheat Farmers Nightmare...
The untold story of the common Milkweed (Asclepias syriaca): A new industrial crop
USDA-ARS?s Scientific Manuscript database
The common milkweed (Asclepias syriaca L.) is a perennial shrub that is native to the Americas from coast to coast, but particularly abundant east of the Mississippi River and from Southern Canada to Mexico. The plant has been given many nonglamorous names by frustrated farmers including “The Wheat...
Demography and monitoring of Welsh's milkweed (Asclepias welshii) at Coral Pink Sand Dunes
Brent C. Palmer; L. Armstrong
2001-01-01
Results are presented of a 12-year monitoring program on the Coral Pink Sand Dunes and Sand Hills populations of the threatened Welsh's milkweed, Asclepias welshii N & P Holmgren. The species is an early sera1 member of the dune flora, colonizing blowouts and advancing with shifting dunes. When an area stabilizes and other vegetation encroaches, A. welshii is...
Cytotoxic principles from the formosan milkweed, Asclepias curassavica.
Roy, Michael C; Chang, Fang-Rong; Huang, Hsiao-Chu; Chiang, Michael Y-N; Wu, Yang-Chang
2005-10-01
A series of cardenolides and related compounds have been isolated from the aerial parts and roots of the ornamental milkweed, Asclepias curassavica. Their structures were determined by spectroscopic and chemical methods. Among them, three derivatives of calactinic acid methyl ester (13-15), 19-nor-16 alpha-acetoxy-10 beta-hydroxyasclepin (16), 20 beta,21-dihydroxypregna-4,6-dien-3-one (19), and 3,4-seco-urs-20(30)-en-3-oic acid (22) are new compounds. The relative configuration of calactinic acid methyl ester (12) has been confirmed by X-ray diffraction analysis on its derivative 13. Most of the cardenolides obtained showed pronounced cytotoxicity against four cancer cell lines (IC(50) 0.01 to 2.0 microg/mL).
Kabat, Susan M; Dick, Christopher W; Hunter, Mark D
2010-05-01
Microsatellite primers were developed for the common milkweed, Asclepias syriaca L., to assist in genet identification and the analysis of spatial genetic structure. Using an enrichment cloning protocol, eight microsatellite loci were isolated and characterized in a Michigan population of A. syriaca. The primers amplified di- and trinucleotide repeats with 4-13 alleles per locus. The primers will be useful for studies of clonality and gene flow in natural populations.
Agrawal, Anurag A; Hastings, Amy P; Patrick, Eamonn T; Knight, Anna C
2014-07-01
Despite the recognition that phytohormonal signaling mediates induced responses to herbivory, we still have little understanding of how such signaling varies among closely related species and may generate herbivore-specific induced responses. We studied closely related milkweeds (Asclepias) to link: 1) plant damage by two specialist chewing herbivores (milkweed leaf beetles Labidomera clivicolis and monarch caterpillars Danaus plexippus); 2) production of the phytohormones jasmonic acid (JA), salicylic acid (SA), and abscisic acid (ABA); 3) induction of defensive cardenolides and latex; and 4) impacts on Danaus caterpillars. We first show that A. syriaca exhibits induced resistance following monarch herbivory (i.e., reduced monarch growth on previously damaged plants), while the defensively dissimilar A. tuberosa does not. We next worked with a broader group of five Asclepias, including these two species, that are highly divergent in defensive traits yet from the same clade. Three of the five species showed herbivore-induced changes in cardenolides, while induced latex was found in four species. Among the phytohormones, JA and ABA showed specific responses (although they generally increased) to insect species and among the plant species. In contrast, SA responses were consistent among plant and herbivore species, showing a decline following herbivore attack. Jasmonic acid showed a positive quantitative relationship only with latex, and this was strongest in plants damaged by D. plexippus. Although phytohormones showed qualitative tradeoffs (i.e., treatments that enhanced JA reduced SA), the few significant individual plant-level correlations among hormones were positive, and these were strongest between JA and ABA in monarch damaged plants. We conclude that: 1) latex exudation is positively associated with endogenous JA levels, even among low-latex species; 2) correlations among milkweed hormones are generally positive, although herbivore damage induces a
USDA-ARS?s Scientific Manuscript database
The population of monarch butterflies east of the Rocky Mountains has experienced a significant decline over the past twenty years. In order to increase monarch numbers in the breeding range, habitat restoration that includes planting milkweed plants is essential. Milkweeds in the genus Asclepias ...
Phylogenetic trends in phenolic metabolism of milkweeds (Asclepias): evidence for escalation.
Agrawal, Anurag A; Salminen, Juha-Pekka; Fishbein, Mark
2009-03-01
Although plant-defense theory has long predicted patterns of chemical defense across taxa, we know remarkably little about the evolution of defense, especially in the context of directional phylogenetic trends. Here we contrast the production of phenolics and cardenolides in 35 species of milkweeds (Asclepias and Gomphocarpus). Maximum-likelihood analyses of character evolution revealed three major patterns. First, consistent with the defense-escalation hypothesis, the diversification of the milkweeds was associated with a trend for increasing phenolic production; this pattern was reversed (a declining evolutionary trend) for cardenolides, toxins sequestered by specialist herbivores. Second, phylogenetically independent correlations existed among phenolic classes across species. For example, coumaric acid derivatives showed negatively correlated evolution with caffeic acid derivatives, and this was likely driven by the fact that the former are used as precursors for the latter. In contrast, coumaric acid derivatives were positively correlated with flavonoids, consistent with competition for the precursor p-coumaric acid. Finally, of the phenolic classes, only flavonoids showed correlated evolution (positive) with cardenolides, consistent with a physiological and evolutionary link between the two via malonate. Thus, this study presents a rigorous test of the defense-escalation hypothesis and a novel phylogenetic approach to understanding the long-term persistence of physiological constraints on secondary metabolism.
2011-01-01
Background Milkweeds (Asclepias L.) have been extensively investigated in diverse areas of evolutionary biology and ecology; however, there are few genetic resources available to facilitate and compliment these studies. This study explored how low coverage genome sequencing of the common milkweed (Asclepias syriaca L.) could be useful in characterizing the genome of a plant without prior genomic information and for development of genomic resources as a step toward further developing A. syriaca as a model in ecology and evolution. Results A 0.5× genome of A. syriaca was produced using Illumina sequencing. A virtually complete chloroplast genome of 158,598 bp was assembled, revealing few repeats and loss of three genes: accD, clpP, and ycf1. A nearly complete rDNA cistron (18S-5.8S-26S; 7,541 bp) and 5S rDNA (120 bp) sequence were obtained. Assessment of polymorphism revealed that the rDNA cistron and 5S rDNA had 0.3% and 26.7% polymorphic sites, respectively. A partial mitochondrial genome sequence (130,764 bp), with identical gene content to tobacco, was also assembled. An initial characterization of repeat content indicated that Ty1/copia-like retroelements are the most common repeat type in the milkweed genome. At least one A. syriaca microread hit 88% of Catharanthus roseus (Apocynaceae) unigenes (median coverage of 0.29×) and 66% of single copy orthologs (COSII) in asterids (median coverage of 0.14×). From this partial characterization of the A. syriaca genome, markers for population genetics (microsatellites) and phylogenetics (low-copy nuclear genes) studies were developed. Conclusions The results highlight the promise of next generation sequencing for development of genomic resources for any organism. Low coverage genome sequencing allows characterization of the high copy fraction of the genome and exploration of the low copy fraction of the genome, which facilitate the development of molecular tools for further study of a target species and its relatives
Straub, Shannon C K; Fishbein, Mark; Livshultz, Tatyana; Foster, Zachary; Parks, Matthew; Weitemier, Kevin; Cronn, Richard C; Liston, Aaron
2011-05-04
Milkweeds (Asclepias L.) have been extensively investigated in diverse areas of evolutionary biology and ecology; however, there are few genetic resources available to facilitate and compliment these studies. This study explored how low coverage genome sequencing of the common milkweed (Asclepias syriaca L.) could be useful in characterizing the genome of a plant without prior genomic information and for development of genomic resources as a step toward further developing A. syriaca as a model in ecology and evolution. A 0.5× genome of A. syriaca was produced using Illumina sequencing. A virtually complete chloroplast genome of 158,598 bp was assembled, revealing few repeats and loss of three genes: accD, clpP, and ycf1. A nearly complete rDNA cistron (18S-5.8S-26S; 7,541 bp) and 5S rDNA (120 bp) sequence were obtained. Assessment of polymorphism revealed that the rDNA cistron and 5S rDNA had 0.3% and 26.7% polymorphic sites, respectively. A partial mitochondrial genome sequence (130,764 bp), with identical gene content to tobacco, was also assembled. An initial characterization of repeat content indicated that Ty1/copia-like retroelements are the most common repeat type in the milkweed genome. At least one A. syriaca microread hit 88% of Catharanthus roseus (Apocynaceae) unigenes (median coverage of 0.29×) and 66% of single copy orthologs (COSII) in asterids (median coverage of 0.14×). From this partial characterization of the A. syriaca genome, markers for population genetics (microsatellites) and phylogenetics (low-copy nuclear genes) studies were developed. The results highlight the promise of next generation sequencing for development of genomic resources for any organism. Low coverage genome sequencing allows characterization of the high copy fraction of the genome and exploration of the low copy fraction of the genome, which facilitate the development of molecular tools for further study of a target species and its relatives. This study represents a first
Rasmann, Sergio; Agrawal, Anurag A; Cook, Susan C; Erwin, Alexis C
2009-09-01
Theory has long predicted allocation patterns for plant defense against herbivory, but only recently have both above- and belowground plant defenses been considered simultaneously. Milkweeds in the genus Asclepias are a classic chemically defended clade of plants with toxic cardenolides (cardiac glycosides) and pressurized latex employed as anti-herbivore weapons. Here we combine a comparative approach to investigate broadscale patterns in allocation to root vs. shoot defenses across species with a species-specific experimental approach to identify the consequences of defense allocational shifts on a specialist herbivore. Our results show phylogenetic conservatism for inducibility of shoot cardenolides by an aboveground herbivore, with only four closely related tropical species showing significant induction; the eight temperate species examined were not inducible. Allocation to root and shoot cardenolides was positively correlated across species, and this relationship was maintained after accounting for phylogenetic nonindependence. In contrast to long-standing theoretical predictions, we found no evidence for a trade-off between constitutive and induced cardenolides; indeed the two were positively correlated across species in both roots and shoots. Finally, specialist root and shoot herbivores of common milkweed (A. syriaca) had opposing effects on latex production, and these effects had consequences for caterpillar growth consistent with latex providing resistance. Although cardenolides were not affected by our treatments, A. syriaca allocated 40% more cardenolides to shoots over roots. We conclude that constitutive and inducible defenses are not trading off across plant species, and shoots of Asclepias are more inducible than roots. Phylogenetic conservatism cannot explain the observed patterns of cardenolide levels across species, but inducibility per se was conserved in a tropical clade. Finally, given that above- and belowground herbivores can systemically
Agrawal, Anurag A; Fishbein, Mark; Jetter, Reinhard; Salminen, Juha-Pekka; Goldstein, Jessica B; Freitag, Amy E; Sparks, Jed P
2009-08-01
The leaf surface is the contact point between plants and the environment and plays a crucial role in mediating biotic and abiotic interactions. Here, we took a phylogenetic approach to investigate the function, trade-offs, and evolution of leaf surface traits in the milkweeds (Asclepias). Across 47 species, we found trichome densities of up to 3000 trichomes cm(-2) and epicuticular wax crystals (glaucousness) on 10 species. Glaucous species had a characteristic wax composition dominated by very-long-chain aldehydes. The ancestor of the milkweeds was probably a glaucous species, from which there have been several independent origins of glabrous and pubescent types. Trichomes and wax crystals showed negatively correlated evolution, with both surface types showing an affinity for arid habitats. Pubescent and glaucous milkweeds had a higher maximum photosynthetic rate and lower stomatal density than glabrous species. Pubescent and glaucous leaf surfaces impeded settling behavior of monarch caterpillars and aphids compared with glabrous species, although surface types did not show consistent differentiation in secondary chemistry. We hypothesize that pubescence and glaucousness have evolved as alternative mechanisms with similar functions. The glaucous type, however, appears to be ancestral, lost repeatedly, and never regained; we propose that trichomes are a more evolutionarily titratable strategy.
Coexistence of three specialist aphids on common milkweed, Asclepias syriaca.
Smith, R A; Mooney, K A; Agrawal, A A
2008-08-01
Coexistence of host-specific herbivores on plants is believed to be governed by interspecific interactions, but few empirical studies have systematically unraveled these dynamics. We investigated the role of several factors in promoting coexistence among the aphids Aphis nerii, Aphis asclepiadis, and Myzocallis asclepiadis that all specialize on common milkweed (Asclepias syriaca). Competitive exclusion is thought to occur when interspecific competition is stronger than intraspecific competition. Consequently, we investigated whether predators, mutualists, or resource quality affected the strength of intra- vs. interspecific competition among aphids in factorial manipulations of competition with exposure to predation, ants, and variable plant genotypes in three separate experiments. In the predation x competition experiment, predators reduced aphid per capita growth by 66%, but the strength of intra- and interspecific competition did not depend on predators. In the ants x competition experiment, ants reduced per capita growth of A. nerii and M. asclepiadis (neither of which were mutualists with ants) by approximately one-half. In so doing, ants ameliorated the negative effects of these competitors on ant-tended A. asclepiadis by two-thirds, representing a novel benefit of ant-aphid mutualism. Nevertheless, ants alone did not explain the persistence of competitively inferior A. asclepiadis as, even in the presence of ants, interspecific competition remained stronger than intraspecific competition. In the plant genotype x competition experiment, both A. asclepiadis and M. asclepiadis were competitively inferior to A. nerii, with the strength of interspecific competition exceeding that of intraspecific competition by 83% and 23%, respectively. Yet these effects differed among milkweed genotypes, and there were one or more plant genotypes for each aphid species where coexistence was predicted. A synthesis of our results shows that predators play little or no role in
Propagating native milkweeds for restoring monarch butterfly habitat
Thomas D. Landis; R. Kasten Dumroese
2015-01-01
The number of monarch butterflies, charismatic nomads of North America, is rapidly declining. Milkweeds (Asclepias spp.), which are the sole food source for monarch caterpillars, have also experienced a decline throughout the breeding range of this butterfly. Milkweeds can be grown from seeds or vegetatively from root cuttings or rhizomes. Seed germination is often...
Zehnder, Caralyn B; Hunter, Mark D
2007-11-01
Induced plant responses to leaf-chewing insects have been well studied, but considerably less is known about the effects of phloem-feedings insects on induction. In a set of laboratory experiments, we examined density-dependent induction by the milkweed-oleander aphid, Aphis nerii, of putative defenses in four milkweed species (Asclepias incarnata, Asclepias syriaca, Asclepias tuberosa, and Asclepias viridis). We hypothesized that high aphid density would lead to increased cardenolide expression in species with low constitutive levels of cardenolides (e.g., A. tuberosa), but that there would be no induction in high constitutive cardenolide species (e.g., A. viridis). Based on previous studies, we did not expect cardenolide induction in A. incarnata. Contrary to our predictions, we observed feeding-induced declines of cardenolide concentrations in A. viridis. Cardenolide concentrations did not respond to aphid feeding in the other three milkweed species. Aphids also caused reductions in biomass accumulation by two of four Asclepias species, A. viridis and A. incarnata. High aphid density led to a decrease in A. viridis foliar nitrogen concentration. However, aphids had no effect on the defensive chemistry, growth, or nutritional quality of either A. syriaca or A. tuberosa. Our results highlight that congeneric plant species may respond differently to the same levels of herbivore damage.
Pellissier, Loïc; Litsios, Glenn; Fishbein, Mark; Salamin, Nicolas; Agrawal, Anurag A; Rasmann, Sergio
2016-02-01
Given the dual role of many plant traits to tolerate both herbivore attack and abiotic stress, the climatic niche of a species should be integrated into the study of plant defense strategies. Here we investigate the impact of plant reproductive strategy and components of species' climatic niche on the rate of chemical defense evolution in the milkweeds using a common garden experiment of 49 species. We found that across Asclepias species, clonal reproduction repeatedly evolved in lower temperature conditions, in species generally producing low concentrations of a toxic defense (cardenolides). Additionally, we found that rates of cardenolide evolution were lower for clonal than for nonclonal species. We thus conclude that because the clonal strategy is based on survival, long generation times, and is associated with tolerance of herbivory, it may be an alternative to toxicity in colder ecosystems. Taken together, these results indicate that the rate of chemical defense evolution is influenced by the intersection of life-history strategy and climatic niches into which plants radiate. © 2015 The Authors. New Phytologist © 2015 New Phytologist Trust.
Delaney, K J; Haile, F J; Peterson, R K D; Higley, L G
2008-10-01
Insect herbivory has variable consequences on plant physiology, growth, and reproduction. In some plants, herbivory reduces photosynthetic rate (Pn) activity on remaining tissue of injured leaves. We sought to better understand the influence of leaf injury on Pn of common milkweed, Asclepias syriaca (Asclepiadaceae), leaves. Initially, we tested whether Pn reductions occurred after insect herbivory or mechanical injury. We also (1) examined the duration of photosynthetic recovery, (2) compared mechanical injury with insect herbivory, (3) studied the relationship between leaf Pn with leaf injury intensity, and (4) considered uninjured leaf compensatory Pn responses neighboring an injured leaf. Leaf Pn was significantly reduced on mechanically injured or insect-fed leaves in all reported experiments except one, so some factor(s) (cardiac glycoside induction, reproductive investment, and water stress) likely interacts with leaf injury to influence whether Pn impairment occurs. Milkweed tussock moth larval herbivory, Euchaetes egle L. (Arctiidae), impaired leaf Pn more severely than mechanical injury in one experiment. Duration of Pn impairment lasted > 5 d to indicate high leaf Pn sensitivity to injury, but Pn recovery occurred within 13 d in one experiment. The degree of Pn reduction was more severe from E. egle herbivory than similar levels of mechanical tissue removal. Negative linear relationships characterized leaf Pn with percentage tissue loss from single E. egle-fed leaves and mechanically injured leaves and suggested that the signal to trigger leaf Pn impairment on remaining tissue of an injured leaf was amplified by additional tissue loss. Finally, neighboring uninjured leaves to an E. egle-fed leaf had a small (approximately 10%) degree of compensatory Pn to partly offset tissue loss and injured leaf Pn impairment.
Rasmann, Sergio; Agrawal, Anurag A
2011-06-01
Specialization is common in most lineages of insect herbivores, one of the most diverse groups of organisms on earth. To address how and why specialization is maintained over evolutionary time, we hypothesized that plant defense and other ecological attributes of potential host plants would predict the performance of a specialist root-feeding herbivore (the red milkweed beetle, Tetraopes tetraophthalmus). Using a comparative phylogenetic and functional trait approach, we assessed the determinants of insect host range across 18 species of Asclepias. Larval survivorship decreased with increasing phylogenetic distance from the true host, Asclepias syriaca, suggesting that adaptation to plant traits drives specialization. Among several root traits measured, only cardenolides (toxic defense chemicals) correlated with larval survival, and cardenolides also explained the phylogenetic distance effect in phylogenetically controlled multiple regression analyses. Additionally, milkweed species having a known association with other Tetraopes beetles were better hosts than species lacking Tetraopes herbivores, and milkweeds with specific leaf area values (a trait related to leaf function and habitat affiliation) similar to those of A. syriaca were better hosts than species having divergent values. We thus conclude that phylogenetic distance is an integrated measure of phenotypic and ecological attributes of Asclepias species, especially defensive cardenolides, which can be used to explain specialization and constraints on host shifts over evolutionary time.
Stoepler, Teresa M; Edge, Andrea; Steel, Anna; O'Quinn, Robin L; Fishbein, Mark
2012-03-01
Exceptions to the ideal of complete reproductive isolation between species are commonly encountered in diverse plant, animal, and fungal groups, but often the causative ecological processes are poorly understood. In flowering plants, the outcome of hybridization depends in part on the effectiveness of pollinators in interspecific pollen transport. In the Asclepias exaltata and A. syriaca (Apocynaceae) hybrid zone in Shenandoah National Park, Virginia, extensive introgression has been documented. The objectives of this study were to (1) determine the extent of pollinator overlap among A. exaltata, A. syriaca, and their hybrids and (2) identify the insect taxa responsible for hybridization and introgression. We observed focal plants of parental species and hybrids to measure visitation rate, visit duration, and per-visit pollinia removal and deposition, and we calculated pollinator effectiveness and importance. Visitation rates varied significantly between the 2 yr of the study. Overall, Apis mellifera, Bombus sp., and Epargyreus clarus were the most important pollinators. However, Bombus sp. was the only visitor that was observed to both remove and insert pollinia for both parent species as well as hybrids. We conclude that Bombus may be a key agent of hybridization and introgression in these sympatric milkweed populations, and hybrids are neither preferred nor selected against by pollinators. Thus, we have identified a potential mechanism for how hybrids act as bridges to gene flow between A. exaltata and A. syriaca. These results provide insights into the breakdown of prezygotic isolating mechanisms.
Identification of triterpenes from milkweed (Asclepias syriaca).
Háznagy-Radnai, Erzsébet; Wéber, Edit; Czigle, Szilvia; Máthé, Imre
2012-09-01
The chloroform extract of Asclepias syriaca stem were investigated. Three triterpenes were isolated by TLC, VLC, and preparative chromatography, and their structures established by one and two-dimensional NMR spectroscopy. Lupenyl acetate has been isolated for the first time from A. syriaca; this is thefirst representative of a triterpene bearing a lupane skeleton in this species. In addition, alpha-amyrin acetate and alpha-amyrin butyrate were isolated.
Antioxidation behavior of milkweed oil 4-hydroxy-3-methyoxycinnamate esters in phospholipid bilayers
USDA-ARS?s Scientific Manuscript database
Milkweed (Asclepia syriaca) has seed oil that is rich in polyunsaturated triacylglycerides that contain olefinic groups. The olefinic groups can be chemically oxidized to form either epoxy or polyhydroxy triacylglycerides that can be esterified with trans-4-hydroxy-3-methoxoycinnamic acid, commonly...
Bergweiler, Chris; Manning, William J; Chevone, Boris I
2008-03-01
Stomatal conductance and net photosynthesis of common milkweed (Asclepias syriaca L.) plants in two different soil moisture regimes were directly quantified and subsequently modeled over an entire growing season. Direct measurements captured the dynamic response of stomatal conductance to changing environmental conditions throughout the day, as well as declining gas exchange and carbon assimilation throughout the growth period beyond an early summer maximum. This phenomenon was observed in plants grown both with and without supplemental soil moisture, the latter of which should theoretically mitigate against harmful physiological effects caused by exposure to ozone. Seasonally declining rates of stomatal conductance were found to be substantial and incorporated into models, making them less susceptible to the overestimations of effective exposure that are an inherent source of error in ozone exposure indices. The species-specific evidence presented here supports the integration of dynamic physiological processes into flux-based modeling approaches for the prediction of ozone injury in vegetation.
Harry-O'kuru, Rogers E; Biresaw, Girma; Cermak, Steven C; Gordon, Sherald H; Vermillion, Karl
2011-05-11
Most industrial lubricants are derived from nonrenewable petroleum-based sources. As useful as these lubricants are, their unintended consequences are the pollution of the Earth's environment as a result of the slow degradation of the spent materials. Native seed oils, on the other hand, are renewable and are also biodegradable in the environment, but these oils often suffer a drawback in having lower thermal stability and a shorter shelf life because of the intrinsic -C═C- unsaturation in their structures. This drawback can be overcome, yet the inherent biodegradative property retained, by appropriate derivatization of the oil. Pursuant to this, this study investigated derivatized polyhydroxy milkweed oil to assess its suitability as lubricant. The milkweed plant is a member of the Asclepiadaceae, a family with many genera including the common milkweeds, Asclepias syriaca L., Asclepias speciosa L., Asclepias tuberosa L., etc. The seeds of these species contain mainly C-18 triglycerides that are highly unsaturated, 92%. The olefinic character of this oil has been chemically modified by generating polyhydroxy triglycerides (HMWO) that show high viscosity and excellent moisturizing characteristics. In this work, HMWO have been chemically modified by esterifying their hydroxyl groups with acyl groups of various chain lengths (C2-C5). The results of investigation into the effect of the acyl derivatives' chemical structure on kinematic and dynamic viscosity, oxidation stability, cold-flow (pour point, cloud point) properties, coefficient of friction, wear, and elastohydrodynamic film thickness are discussed.
Agrawal, Anurag A; Kearney, Emily E; Hastings, Amy P; Ramsey, Trey E
2012-07-01
Plant responses to herbivory and light competition are often in opposing directions, posing a potential conflict for plants experiencing both stresses. For sun-adapted species, growing in shade typically makes plants more constitutively susceptible to herbivores via reduced structural and chemical resistance traits. Nonetheless, the impact of light environment on induced resistance has been less well-studied, especially in field experiments that link physiological mechanisms to ecological outcomes. Accordingly, we studied induced resistance of common milkweed (Asclepias syriaca, a sun-adapted plant), and linked hormonal responses, resistance traits, and performance of specialist monarch caterpillars (Danaus plexippus) in varying light environments. In natural populations, plants growing under forest-edge shade showed reduced levels of resistance traits (lower leaf toughness, cardenolides, and trichomes) and enhanced light-capture traits (higher specific leaf area, larger leaves, and lower carbon-to-nitrogen ratio) compared to paired plants in full sun. In a field experiment repeated over two years, only milkweeds growing in full sun exhibited induced resistance to monarchs, whereas plants growing in shade were constitutively more susceptible and did not induce resistance. In a more controlled field experiment, plant hormones were higher in the sun (jasmonic acid, salicylic acid, abscisic acid, indole acidic acid) and were induced by herbivory (jasmonic acid and abscisic acid). In particular, the jasmonate burst following herbivory was halved in plants raised in shaded habitats, and this correspondingly reduced latex induction (but not cardenolide induction). Thus, we provide a mechanistic basis for the attenuation of induced plant resistance in low resource environments. Additionally, there appears to be specificity in these interactions, with light-mediated impacts on jasmonate-induction being stronger for latex exudation than cardenolides.
USDA-ARS?s Scientific Manuscript database
The effects of seed cooking and oil processing conditions on functional properties of milkweed seed proteins were determined to identify potential value-added uses for the meal. Milkweed seeds were flaked and then cooked in the seed conditioner at 82°C for 30, 60 or 90 min. Oil was extracted by scre...
Evolutionary assembly of the milkweed fauna: cytochrome oxidase I and the age of Tetraopes beetles.
Farrell, B D
2001-03-01
The insects that feed on the related plant families Apocynaceae and Asclepiadaceae (here collectively termed "milkweeds") comprise a "component community" of highly specialized, distinctive lineages of species that frequently sequester toxic cardiac glycosides from their host plants for defense against predators and are thus often aposematic, advertising their consequent unpalatability. Such sets of specialized lineages provide opportunities for comparative studies of the rate of adaptation, diversification, and habitat-related effects on molecular evolution. The cerambycid genus Tetraopes is the most diverse of the new world milkweed herbivores and the species are generally host specific, being restricted to single, different species of Asclepias, more often so than most other milkweed insects. Previous work revealed correspondence between the phylogeny of these beetles and that of their hosts. The present study provides analyses of near-complete DNA sequences for Tetraopes and relatives that are used to establish a molecular clock and temporal framework for Tetraopes evolution with their milkweed hosts. Copyright 2001 Academic Press.
Winnick, Theodore; Davis, Alva R.; Greenberg, David M.
1940-01-01
1. A study has been made of the properties of a hitherto unreported proteolytic enzyme from the latex of the milkweed, Asclepias speciosa. The new protease has been named asclepain by the authors. 2. The results of chemical, diffusion, and denaturation tests indicate that asclepain is a protein. 3. Like papain, asclepain dots milk and digests most proteins, particularly if they are dissolved in concentrated urea solution. Unlike papain, asclepain did not clot blood. 4. The activation and inhibition phenomena of asclepain resemble those of papain, and seem best explained on the assumption that free sulfhydryl in the enzyme is necessary for proteolytic activity. The sulfhydryl of asclepain appears more labile than that of papain. 5. The measurement of pH-activity curves of asclepain on casein, ovalbumin, hemoglobin, edestin, and ovovitellin showed no definite digestion maxima for most of the undenatured proteins, while in urea solution there were well defined maxima near pH 7.0. Native hemoglobin and ovovitellin were especially undigestible, while native casein was rapidly attacked. 6. Temperature-activity curves were determined for asclepain on hemoglobin, casein, and milk solutions. The optimum temperature was shown to increase with decreasing time of digestion. PMID:19873154
Shannon C.K. Straub; Richard C. Cronn; Christopher Edwards; Mark Fishbein; Aaron Liston
2013-01-01
Horizontal gene transfer (HGT) of DNA from the plastid to the nuclear and mitochondrial genomes of higher plants is a common phenomenon; however, plastid genomes (plastomes) are highly conserved and have generally been regarded as impervious to HGT. We sequenced the 158 kb plastome and the 690 kb mitochondrial genome of common milkweed (Asclepias syriaca [Apocynaceae...
The Isolation of Rubber from Milkweed Leaves. An Introductory Organic Chemistry Lab
NASA Astrophysics Data System (ADS)
Volaric, Lisa; Hagen, John P.
2002-01-01
We present an introductory organic chemistry lab in which students isolate rubber from the leaves of milkweed plants (Asclepias syriaca). Students isolated rubber with a recovery of 2.4 ± 1.8% and 1.8 ± 0.7% for the microscale and macroscale procedures, respectively. Infrared spectra of their products were compared with the spectrum of synthetic rubber, cis-polyisoprene. Students tested for elasticity of their product by twisting it on a spatula and pulling; all students found some degree of elasticity.
Generalised pollination systems for three invasive milkweeds in Australia.
Ward, M; Johnson, S D
2013-05-01
Because most plants require pollinator visits for seed production, the ability of an introduced plant species to establish pollinator relationships in a new ecosystem may have a central role in determining its success or failure as an invader. We investigated the pollination ecology of three milkweed species - Asclepias curassavica, Gomphocarpus fruticosus and G. physocarpus - in their invaded range in southeast Queensland, Australia. The complex floral morphology of milkweeds has often been interpreted as a general trend towards specialised pollination requirements. Based on this interpretation, invasion by milkweeds contradicts the expectation than plant species with specialised pollination systems are less likely to become invasive that those with more generalised pollination requirements. However, observations of flower visitors in natural populations of the three study species revealed that their pollination systems are essentially specialised at the taxonomic level of the order, but generalised at the species level. Specifically, pollinators of the two Gomphocarpus species included various species of Hymenoptera (particularly vespid wasps), while pollinators of A. curassavica were primarily Lepidoptera (particularly nymphalid butterflies). Pollinators of all three species are rewarded with copious amounts of highly concentrated nectar. It is likely that successful invasion by these three milkweed species is attributable, at least in part, to their generalised pollinator requirements. The results of this study are discussed in terms of how data from the native range may be useful in predicting pollination success of species in a new environment. © 2012 German Botanical Society and The Royal Botanical Society of the Netherlands.
Seed dormancy and germination vary within and among species of milkweeds
Kaye, Thomas N; Sandlin, Isaac J; Bahm, Matt A
2018-01-01
Abstract Pollinators in general and monarch butterflies in particular are in decline due to habitat loss. Efforts to restore habitats for insects that rely on specific plant groups as larvae or adults depend on the ability of practitioners to grow and produce these plants. Monarch larvae feed exclusively on milkweed species, primarily in the genus Asclepias, making propagation and restoration of these plants crucial for habitat restoration. Seed germination protocols for milkweeds are not well established, in part due to the large number of milkweed species and conflicting reports of seed dormancy in the genus. We tested for seed dormancy and the optimum period of cold stratification in 15 populations of A. speciosa and 1–2 populations of five additional species, including A. asperula, A. fascicularis, A. subulata, A. subverticillata and A. syriaca. We exposed seeds to cold (5 °C) moist conditions for 0, 2, 4, 6 and 8 weeks and then moved them to 15 °C/25 °C alternating temperatures. In A. speciosa, dormancy was detected in eight populations, and this dormancy was broken by 2–4 weeks of cold stratification. The remaining seven populations showed no dormancy. Seed dormancy was also detected in two populations of A. fascicularis (broken by 4–6 weeks of cold stratification) and a single population of A. syriaca (broken by 2 weeks of cold stratification). No dormancy was detected in A. asperula, A. subulata or A. subverticillata. Seed dormancy appears to be widespread in the genus (confirmed in 15 species) but can vary between populations even within the same species. Variation in seed dormancy and cold stratification requirements within and among Asclepias species suggests local adaptation and maternal environments may drive seedling ecology, and that growers should watch for low germination and use cold stratification as needed to maximize seed germination and retain genetic variability in restored populations. PMID:29593856
Lemoine, Nathan P
2015-01-01
Climate change can profoundly alter species' distributions due to changes in temperature, precipitation, or seasonality. Migratory monarch butterflies (Danaus plexippus) may be particularly susceptible to climate-driven changes in host plant abundance or reduced overwintering habitat. For example, climate change may significantly reduce the availability of overwintering habitat by restricting the amount of area with suitable microclimate conditions. However, potential effects of climate change on monarch northward migrations remain largely unknown, particularly with respect to their milkweed (Asclepias spp.) host plants. Given that monarchs largely depend on the genus Asclepias as larval host plants, the effects of climate change on monarch northward migrations will most likely be mediated by climate change effects on Asclepias. Here, I used MaxEnt species distribution modeling to assess potential changes in Asclepias and monarch distributions under moderate and severe climate change scenarios. First, Asclepias distributions were projected to extend northward throughout much of Canada despite considerable variability in the environmental drivers of each individual species. Second, Asclepias distributions were an important predictor of current monarch distributions, indicating that monarchs may be constrained as much by the availability of Asclepias host plants as environmental variables per se. Accordingly, modeling future distributions of monarchs, and indeed any tightly coupled plant-insect system, should incorporate the effects of climate change on host plant distributions. Finally, MaxEnt predictions of Asclepias and monarch distributions were remarkably consistent among general circulation models. Nearly all models predicted that the current monarch summer breeding range will become slightly less suitable for Asclepias and monarchs in the future. Asclepias, and consequently monarchs, should therefore undergo expanded northern range limits in summer months
Induced responses to herbivory and jasmonate in three milkweed species.
Rasmann, Sergio; Johnson, M Daisy; Agrawal, Anurag A
2009-11-01
We studied constitutive and induced defensive traits (latex exudation, cardenolides, proteases, and C/N ratio) and resistance to monarch caterpillars (Danaus plexippus) in three closely related milkweed species (Asclepias angustifolia, A. barjoniifolia and A. fascicularis). All traits showed significant induction in at least one of the species. Jasmonate application only partially mimicked the effect of monarch feeding. We found some correspondence between latex and cardenolide content and reduced larval growth. Larvae fed cut leaves of A. angustifolia grew better than larvae fed intact plants. Addition of the cardenolide digitoxin to cut leaves reduced larval growth but ouabain (at the same concentration) had no effect. We, thus, confirm that latex and cardenolides are major defenses in milkweeds, effective against a specialist herbivore. Other traits such as proteases and C/N ratio additionally may be integrated in the defense scheme of those plants. Induction seems to play an important role in plants that have an intermediate level of defense, and we advocate incorporating induction as an additional axis of the plant defense syndrome hypothesis.
Lemoine, Nathan P.
2015-01-01
Climate change can profoundly alter species’ distributions due to changes in temperature, precipitation, or seasonality. Migratory monarch butterflies (Danaus plexippus) may be particularly susceptible to climate-driven changes in host plant abundance or reduced overwintering habitat. For example, climate change may significantly reduce the availability of overwintering habitat by restricting the amount of area with suitable microclimate conditions. However, potential effects of climate change on monarch northward migrations remain largely unknown, particularly with respect to their milkweed (Asclepias spp.) host plants. Given that monarchs largely depend on the genus Asclepias as larval host plants, the effects of climate change on monarch northward migrations will most likely be mediated by climate change effects on Asclepias. Here, I used MaxEnt species distribution modeling to assess potential changes in Asclepias and monarch distributions under moderate and severe climate change scenarios. First, Asclepias distributions were projected to extend northward throughout much of Canada despite considerable variability in the environmental drivers of each individual species. Second, Asclepias distributions were an important predictor of current monarch distributions, indicating that monarchs may be constrained as much by the availability of Asclepias host plants as environmental variables per se. Accordingly, modeling future distributions of monarchs, and indeed any tightly coupled plant-insect system, should incorporate the effects of climate change on host plant distributions. Finally, MaxEnt predictions of Asclepias and monarch distributions were remarkably consistent among general circulation models. Nearly all models predicted that the current monarch summer breeding range will become slightly less suitable for Asclepias and monarchs in the future. Asclepias, and consequently monarchs, should therefore undergo expanded northern range limits in summer months
Obregón, Walter D; Liggieri, Constanza S; Trejo, Sebastian A; Avilés, Francesc X; Vairo-Cavalli, Sandra E; Priolo, Nora S
2009-01-01
Latices from Asclepias spp are used in wound healing and the treatment of some digestive disorders. These pharmacological actions have been attributed to the presence of cysteine proteases in these milky latices. Asclepias curassavica (Asclepiadaceae), "scarlet milkweed" is a perennial subshrub native to South America. In the current paper we report a new approach directed at the selective biochemical and molecular characterization of asclepain cI (acI) and asclepain cII (acII), the enzymes responsible for the proteolytic activity of the scarlet milkweed latex. SDS-PAGE spots of both purified peptidases were digested with trypsin and Peptide Mass Fingerprints (PMFs) obtained showed no equivalent peptides. No identification was possible by MASCOT search due to the paucity of information concerning Asclepiadaceae latex cysteine proteinases available in databases. From total RNA extracted from latex samples, cDNA of both peptidases was obtained by RT-PCR using degenerate primers encoding Asclepiadaceae cysteine peptidase conserved domains. Theoretical PMFs of partial polypeptide sequences obtained by cloning (186 and 185 amino acids) were compared with empirical PMFs, confirming that the sequences of 186 and 185 amino acids correspond to acI and acII, respectively. N-terminal sequences of acI and acII, characterized by Edman sequencing, were overlapped with those coming from the cDNA to obtain the full-length sequence of both mature peptidases (212 and 211 residues respectively). Alignment and phylogenetic analysis confirmed that acI and acII belong to the subfamily C1A forming a new group of papain-like cysteine peptidases together with asclepain f from Asclepias fruticosa. We conclude that PMF could be adopted as an excellent tool to differentiate, in a fast and unequivocal way, peptidases with very similar physicochemical and functional properties, with advantages over other conventional methods (for instance enzyme kinetics) that are time consuming and afford less
Insect Feeding Deterrents in Endophyte-Infected Tall Fescue †
Johnson, M. C.; Dahlman, D. L.; Siegel, M. R.; Bush, L. P.; Latch, G. C. M.; Potter, D. A.; Varney, D. R.
1985-01-01
The presence of an endophytic fungus, Acremonium coenophialum, in tall fescue (Festuca arundinacea) deterred aphid feeding by Rhopalosiphum padi and Schizaphis graminum. Both species of aphid were unable to survive when confined to endophyte-infected tall fescue plants. Feeding deterrents and toxic factors to R. padi and Oncopeltus fasciatus, large milkweed bug, were primarily associated with a methanol extract obtained when endophyte-infected tall fescue seed was serially extracted with hexane, ethyl acetate, and methanol. The concentrations of pyrrolizidine alkaloids were determined to be 30 to 100 times greater in the methanol extract than in the hexane and ethyl acetate extracts. PMID:16346751
Tillman, P G; Carpenter, J E
2014-04-01
In peanut-cotton farmscapes in Georgia, the stink bugs Nezara viridula (L.) and Chinavia hilaris (Say) (Hemiptera: Pentatomidae) and the leaffooted bug, Leptoglossus phyllopus (L.) (Hemiptera: Coreidae), disperse at crop-to-crop interfaces to feed on bolls in cotton. The main objective of this study was to determine whether insecticide-free tropical milkweed (Asclepias curassavica L.), a nectar-producing plant, can increase parasitism of these bugs by Trichopoda pennipes (F.) (Diptera: Tachinidae) and provide nectar to monarch butterflies and insect pollinators in these farmscapes. Peanut-cotton plots with and without flowering milkweed plants were established in 2009 and 2010. Adult T. pennipes, monarch butterflies, honey bees, and native insect pollinators readily fed on floral nectar of milkweed. Monarch larvae feeding on milkweed vegetation successfully developed into pupae. In 2009, N. viridula was the primary host of T. pennipes in cotton, and parasitism of this pest by the parasitoid was significantly higher in milkweed cotton (61.6%) than in control cotton (13.3%). In 2010, parasitism of N. viridula, C. hilaris, and L. phyllopus by T. pennipes was significantly higher in milkweed cotton (24.0%) than in control cotton (1.1%). For both years of the study, these treatment differences were not owing to a response by the parasitoid to differences in host density, because density of hosts was not significantly different between treatments. In conclusion, incorporation of milkweed in peanut-cotton plots increased stink bug parasitism in cotton and provided nectar to insect pollinators and monarch butterflies.
USDA-ARS?s Scientific Manuscript database
This study determined the effects of oil processing conditions on functional properties of milkweed seed proteins to evaluate their potential for value-added uses. Flaked milkweed seeds were cooked at 82 degrees C (180 degrees F) for 30, 60 or 90 min in the seed conditioner, and then screw-pressed ...
2014-01-01
Background Animals fertilize thousands of angiosperm species whose floral-display sizes can significantly influence pollinator behavior and plant reproductive success. Many studies have measured the interactions among pollinator behavior, floral-display size, and plant reproductive success, but few studies have been able to separate the effects of pollinator behavior and post-pollination processes on angiosperm sexual reproduction. In this study, we utilized the highly self-incompatible pollinium-pollination system of Asclepias syriaca (Common Milkweed) to quantify how insect visitors influenced male reproductive success measured as pollen removal, female reproductive success measured as pollen deposition, and self-pollination rate. We also determined how floral-display size impacts both visitor behavior and self-pollination rate. Results Four insect taxonomic orders visited A. syriaca: Coleoptera, Diptera, Hymenoptera, and Lepidoptera. We focused on three groups of visitor taxa within two orders (Hymenoptera and Lepidoptera) with sample sizes large enough for quantitative analysis: Apis mellifera (Western Honey Bee), Bombus spp. (bumble bees) and lepidopterans (butterflies and moths). Qualitatively, lepidopterans had the highest pollinator importance values, but the large variability in the lepidopteran data precluded meaningful interpretation of much of their behavior. The introduced A. mellifera was the most effective and most important diurnal pollinator with regard to both pollen removal and pollen deposition. However, when considering the self-incompatibility of A. syriaca, A. mellifera was not the most important pollinator because of its high self-pollination rate as compared to Bombus spp. Additionally, the rate of self-pollination increased more rapidly with the number of flowers per inflorescence in A. mellifera than in the native Bombus spp. Conclusions Apis mellifera’s high rate of self-pollination may have significant negative effects on both male
Howard, Aaron F; Barrows, Edward M
2014-06-23
Animals fertilize thousands of angiosperm species whose floral-display sizes can significantly influence pollinator behavior and plant reproductive success. Many studies have measured the interactions among pollinator behavior, floral-display size, and plant reproductive success, but few studies have been able to separate the effects of pollinator behavior and post-pollination processes on angiosperm sexual reproduction. In this study, we utilized the highly self-incompatible pollinium-pollination system of Asclepias syriaca (Common Milkweed) to quantify how insect visitors influenced male reproductive success measured as pollen removal, female reproductive success measured as pollen deposition, and self-pollination rate. We also determined how floral-display size impacts both visitor behavior and self-pollination rate. Four insect taxonomic orders visited A. syriaca: Coleoptera, Diptera, Hymenoptera, and Lepidoptera. We focused on three groups of visitor taxa within two orders (Hymenoptera and Lepidoptera) with sample sizes large enough for quantitative analysis: Apis mellifera (Western Honey Bee), Bombus spp. (bumble bees) and lepidopterans (butterflies and moths). Qualitatively, lepidopterans had the highest pollinator importance values, but the large variability in the lepidopteran data precluded meaningful interpretation of much of their behavior. The introduced A. mellifera was the most effective and most important diurnal pollinator with regard to both pollen removal and pollen deposition. However, when considering the self-incompatibility of A. syriaca, A. mellifera was not the most important pollinator because of its high self-pollination rate as compared to Bombus spp. Additionally, the rate of self-pollination increased more rapidly with the number of flowers per inflorescence in A. mellifera than in the native Bombus spp. Apis mellifera's high rate of self-pollination may have significant negative effects on both male and female reproductive successes
Weitemier, Kevin; Straub, Shannon C K; Fishbein, Mark; Liston, Aaron
2015-01-01
Despite knowledge that concerted evolution of high-copy loci is often imperfect, studies that investigate the extent of intragenomic polymorphisms and comparisons across a large number of species are rarely made. We present a bioinformatic pipeline for characterizing polymorphisms within an individual among copies of a high-copy locus. Results are presented for nuclear ribosomal DNA (nrDNA) across the milkweed genus, Asclepias. The 18S-26S portion of the nrDNA cistron of Asclepias syriaca served as a reference for assembly of the region from 124 samples representing 90 species of Asclepias. Reads were mapped back to each individual's consensus and at each position reads differing from the consensus were tallied using a custom perl script. Low frequency polymorphisms existed in all individuals (mean = 5.8%). Most nrDNA positions (91%) were polymorphic in at least one individual, with polymorphic sites being less frequent in subunit regions and loops. Highly polymorphic sites existed in each individual, with highest abundance in the "noncoding" ITS regions. Phylogenetic signal was present in the distribution of intragenomic polymorphisms across the genus. Intragenomic polymorphisms in nrDNA are common in Asclepias, being found at higher frequency than any other study to date. The high and variable frequency of polymorphisms across species highlights concerns that phylogenetic applications of nrDNA may be error-prone. The new analytical approach provided here is applicable to other taxa and other high-copy regions characterized by low coverage genome sequencing (genome skimming).
Straub, Shannon C.K.; Fishbein, Mark; Liston, Aaron
2015-01-01
Despite knowledge that concerted evolution of high-copy loci is often imperfect, studies that investigate the extent of intragenomic polymorphisms and comparisons across a large number of species are rarely made. We present a bioinformatic pipeline for characterizing polymorphisms within an individual among copies of a high-copy locus. Results are presented for nuclear ribosomal DNA (nrDNA) across the milkweed genus, Asclepias. The 18S-26S portion of the nrDNA cistron of Asclepias syriaca served as a reference for assembly of the region from 124 samples representing 90 species of Asclepias. Reads were mapped back to each individual’s consensus and at each position reads differing from the consensus were tallied using a custom perl script. Low frequency polymorphisms existed in all individuals (mean = 5.8%). Most nrDNA positions (91%) were polymorphic in at least one individual, with polymorphic sites being less frequent in subunit regions and loops. Highly polymorphic sites existed in each individual, with highest abundance in the “noncoding” ITS regions. Phylogenetic signal was present in the distribution of intragenomic polymorphisms across the genus. Intragenomic polymorphisms in nrDNA are common in Asclepias, being found at higher frequency than any other study to date. The high and variable frequency of polymorphisms across species highlights concerns that phylogenetic applications of nrDNA may be error-prone. The new analytical approach provided here is applicable to other taxa and other high-copy regions characterized by low coverage genome sequencing (genome skimming). PMID:25653903
Study on the seed production and germination dynamic of common milkweed (Asclepias syriaca L.).
Sárkány, S E; Lehoczky, E; Nagy, P
2008-01-01
The common milkweed causes considerable damages on the agricultural and nature conservation areas. The area occupied by this weed is continuously bigger. The common milkweed is spread over North-America between the 35th and 50th degree of western Latitude and 60th 103rd degree of longitude. Millions of hectares are polluted by this weed in the United States. Important is its spread also in Asia (Iraq), in Europe (Carpathian Basin, Poland, Bulgaria, Switzerland, France, Austria, Germany), as well as in the area of the former Soviet Union (Belorussia, The Baltic Countries, Caucasus, and the Ukraine). Though the basic biological characters of this plant are well known, still its control is a significant problem, the damages increase on the areas occupied by this weed. We collect seed samples from several Hungarian areas in 2007. After the sampling we determined the average sprout length and the number of follicle as well as the average seed numbers in the follicle. We determined also the weight of thousand seeds of the resultant seed samples. At natural circumstances the seedlings appear at a soil temperature of 15 degrees C during the end of April and first week of May. Under Laboratory circumstances the dormancy of the seeds ceases continuously from November on, germinate at a temperature of 20-30 degrees C, the maximum germination can be achieved in the first part of April. At January we started germination examinations with the seeds in Petri dish, among laboratory condition.
Cytotoxicity of cardenolides and cardenolide glycosides from Asclepias curassavica.
Li, Jun-Zhu; Qing, Chen; Chen, Chang-Xiang; Hao, Xiao-Jiang; Liu, Hai-Yang
2009-04-01
A new cardenolide, 12beta,14beta-dihydroxy-3beta,19-epoxy-3alpha-methoxy-5alpha-card-20(22)-enolide (6), and a new doubly linked cardenolide glycoside, 12beta-hydroxycalotropin (13), together with eleven known compounds, coroglaucigenin (1), 12beta-hydroxycoroglaucigenin (2), calotropagenin (3), desglucouzarin (4), 6'-O-feruloyl-desglucouzarin (5), calotropin (7), uscharidin (8), asclepin (9), 16alpha-hydroxyasclepin (10), 16alpha-acetoxycalotropin (11), and 16alpha-acetoxyasclepin (12), were isolated from the aerial part of ornamental milkweed, Asclepias curassavica and chemically elucidated through spectral analyses. All the isolates were evaluated for their cytotoxic activity against HepG2 and Raji cell lines. The results showed that asclepin (9) had the strongest cytotoxic activity with an IC(50) value of 0.02 microM against the two cancer cell lines and the new compound 13 had significant cytotoxic activity with IC(50) values of 0.69 and 1.46 microM, respectively.
Thilagavathi, G; Praba Karan, C; Das, Dipayan
2018-08-01
This work reports on a series of thermally-bonded, hybrid and oil-sorbent nonwovens developed from binary and tertiary mixing of cotton, kapok, and three varieties of milkweed fibers (Asclepias Syriaca, Calotropis Procera and Calotropis Gigantea) and polypropylene fibers. The physical and chemical properties of the fibers were investigated to examine their oleophilic character. It was observed that all the fiber surfaces were covered with natural wax. Further, kapok and milkweed fibers were found to have less cell wall thickness and high void ratio. Oil sorption and retention characteristics of these fibers were studied in loose fibrous form as well as in structured assembly form (thermally-bonded nonwovens) using high density oil and diesel oil. The effects of fiber diameter, fiber cross-sectional shape, fiber surface area and porosity on the oil sorption behavior were discussed. An excellent and a selective oil sorption behavior of milkweed fibers (Calotropis Procera and Calotropis Gigantea) blended with cotton and polypropylene fibers were observed. The maximum oil sorption capacity of the developed thermal bonded nonwoven was 40.16 g/g for high density (HD) oil and 23.00 g/g for diesel oil. Further, a high porosity combined with high surface area played a major role in deciding the oil sorption and retention characteristics. Copyright © 2018 Elsevier Ltd. All rights reserved.
Analysis and optimization of a synthetic milkweed floral attractant for mosquitoes.
Otienoburu, Philip E; Ebrahimi, Babak; Phelan, P Larry; Foster, Woodbridge A
2012-07-01
A pentane extract of flowers of common milkweed, Asclepias syriaca (Asclepiadaceae), elicited significant orientation from both male and female Culex pipiens in a dual-port flight olfactometer. Analysis of the extract by gas chromatography-mass spectrometry revealed six major constituents in order of relative abundance: benzaldehyde, (E)-β-ocimene, phenylacetaldehyde, benzyl alcohol, nonanal, and (E)-2-nonenal. Although not all were collected from the headspace profile of live flowers, a synthetic blend of these six compounds, when presented to mosquitoes in the same levels and proportions that occur in the extract, elicited a response comparable to the extract. Subtractive behavioral bioassays demonstrated that a three-component blend consisting of benzaldehyde, phenylacetaldehyde, and (E)-2-nonenal was as attractive as the full blend. These findings suggest the potential use of synthetic floral-odor blends for monitoring or control of both male and female disease-vectoring mosquitoes.
Petschenka, Georg; Agrawal, Anurag A
2015-11-07
Insect resistance to plant toxins is widely assumed to have evolved in response to using defended plants as a dietary resource. We tested this hypothesis in the milkweed butterflies (Danaini) which have progressively evolved higher levels of resistance to cardenolide toxins based on amino acid substitutions of their cellular sodium-potassium pump (Na(+)/K(+)-ATPase). Using chemical, physiological and caterpillar growth assays on diverse milkweeds (Asclepias spp.) and isolated cardenolides, we show that resistant Na(+)/K(+)-ATPases are not necessary to cope with dietary cardenolides. By contrast, sequestration of cardenolides in the body (as a defence against predators) is associated with the three levels of Na(+)/K(+)-ATPase resistance. To estimate the potential physiological burden of cardenolide sequestration without Na(+)/K(+)-ATPase adaptations, we applied haemolymph of sequestering species on isolated Na(+)/K(+)-ATPase of sequestering and non-sequestering species. Haemolymph cardenolides dramatically impair non-adapted Na(+)/K(+)-ATPase, but had systematically reduced effects on Na(+)/K(+)-ATPase of sequestering species. Our data indicate that major adaptations to plant toxins may be evolutionarily linked to sequestration, and may not necessarily be a means to eat toxic plants. Na(+)/K(+)-ATPase adaptations thus were a potential mechanism through which predators spurred the coevolutionary arms race between plants and insects. © 2015 The Author(s).
Petschenka, Georg; Agrawal, Anurag A.
2015-01-01
Insect resistance to plant toxins is widely assumed to have evolved in response to using defended plants as a dietary resource. We tested this hypothesis in the milkweed butterflies (Danaini) which have progressively evolved higher levels of resistance to cardenolide toxins based on amino acid substitutions of their cellular sodium–potassium pump (Na+/K+-ATPase). Using chemical, physiological and caterpillar growth assays on diverse milkweeds (Asclepias spp.) and isolated cardenolides, we show that resistant Na+/K+-ATPases are not necessary to cope with dietary cardenolides. By contrast, sequestration of cardenolides in the body (as a defence against predators) is associated with the three levels of Na+/K+-ATPase resistance. To estimate the potential physiological burden of cardenolide sequestration without Na+/K+-ATPase adaptations, we applied haemolymph of sequestering species on isolated Na+/K+-ATPase of sequestering and non-sequestering species. Haemolymph cardenolides dramatically impair non-adapted Na+/K+-ATPase, but had systematically reduced effects on Na+/K+-ATPase of sequestering species. Our data indicate that major adaptations to plant toxins may be evolutionarily linked to sequestration, and may not necessarily be a means to eat toxic plants. Na+/K+-ATPase adaptations thus were a potential mechanism through which predators spurred the coevolutionary arms race between plants and insects. PMID:26538594
Single gene control of postzygotic self-incompatibility in poke milkweed, Asclepias exaltata L.
Lipow, S R; Wyatt, R
2000-01-01
Most individuals of Asclepias exaltata are self-sterile, but all plants lack prezygotic barriers to self-fertilization. To determine whether postzygotic rejection of self-fertilized ovules is due to late-acting self-incompatibility or to extreme, early acting inbreeding depression, we performed three diallel crosses among self-sterile plants related as full-sibs. The full-sibs segregated into four compatibility classes, suggesting that late acting self-incompatibility is controlled by a single gene (S-locus). Crosses between plants sharing one or both alleles at the S-locus are incompatible. An additional diallel cross was done among full-sib progeny from a cross of a self-sterile and a self-fertile plant. These progeny grouped into two compatibility classes, and plants within classes displayed varying levels of self-fertility. This suggests that the occasional self-fertility documented in natural pollinations is caused by pseudo-self-fertility alleles that alter the functioning of the S-locus. PMID:10655239
Vannette, Rachel L; Hunter, Mark D; Rasmann, Sergio
2013-01-01
Below-ground (BG) symbionts of plants can have substantial influence on plant growth and nutrition. Recent work demonstrates that mycorrhizal fungi can affect plant resistance to herbivory and the performance of above- (AG) and BG herbivores. Although these examples emerge from diverse systems, it is unclear if plant species that express similar defensive traits respond similarly to fungal colonization, but comparative work may inform this question. To examine the effects of arbuscular mycorrhizal fungi (AMF) on the expression of chemical resistance, we inoculated 8 species of Asclepias (milkweed)-which all produce toxic cardenolides-with a community of AMF. We quantified plant biomass, foliar and root cardenolide concentration and composition, and assessed evidence for a growth-defense tradeoff in the presence and absence of AMF. As expected, total foliar and root cardenolide concentration varied among milkweed species. Importantly, the effect of mycorrhizal fungi on total foliar cardenolide concentration also varied among milkweed species, with foliar cardenolides increasing or decreasing, depending on the plant species. We detected a phylogenetic signal to this variation; AMF fungi reduced foliar cardenolide concentrations to a greater extent in the clade including A. curassavica than in the clade including A. syriaca. Moreover, AMF inoculation shifted the composition of cardenolides in AG and BG plant tissues in a species-specific fashion. Mycorrhizal inoculation changed the relative distribution of cardenolides between root and shoot tissue in a species-specific fashion, but did not affect cardenolide diversity or polarity. Finally, a tradeoff between plant growth and defense in non-mycorrhizal plants was mitigated completely by AMF inoculation. Overall, we conclude that the effects of AMF inoculation on the expression of chemical resistance can vary among congeneric plant species, and ameliorate tradeoffs between growth and defense.
Vannette, Rachel L.; Hunter, Mark D.; Rasmann, Sergio
2013-01-01
Below-ground (BG) symbionts of plants can have substantial influence on plant growth and nutrition. Recent work demonstrates that mycorrhizal fungi can affect plant resistance to herbivory and the performance of above- (AG) and BG herbivores. Although these examples emerge from diverse systems, it is unclear if plant species that express similar defensive traits respond similarly to fungal colonization, but comparative work may inform this question. To examine the effects of arbuscular mycorrhizal fungi (AMF) on the expression of chemical resistance, we inoculated 8 species of Asclepias (milkweed)—which all produce toxic cardenolides—with a community of AMF. We quantified plant biomass, foliar and root cardenolide concentration and composition, and assessed evidence for a growth-defense tradeoff in the presence and absence of AMF. As expected, total foliar and root cardenolide concentration varied among milkweed species. Importantly, the effect of mycorrhizal fungi on total foliar cardenolide concentration also varied among milkweed species, with foliar cardenolides increasing or decreasing, depending on the plant species. We detected a phylogenetic signal to this variation; AMF fungi reduced foliar cardenolide concentrations to a greater extent in the clade including A. curassavica than in the clade including A. syriaca. Moreover, AMF inoculation shifted the composition of cardenolides in AG and BG plant tissues in a species-specific fashion. Mycorrhizal inoculation changed the relative distribution of cardenolides between root and shoot tissue in a species-specific fashion, but did not affect cardenolide diversity or polarity. Finally, a tradeoff between plant growth and defense in non-mycorrhizal plants was mitigated completely by AMF inoculation. Overall, we conclude that the effects of AMF inoculation on the expression of chemical resistance can vary among congeneric plant species, and ameliorate tradeoffs between growth and defense. PMID:24065971
Min, Byoung-Eun; Feldman, Tracy S; Ali, Akhtar; Wiley, Graham; Muthukumar, Vijay; Roe, Bruce A; Roossinck, Marilyn; Melcher, Ulrich; Palmer, Michael W; Nelson, Richard S
2012-02-01
Native virus-plant interactions require more understanding and their study will provide a basis from which to identify potential sources of emerging destructive viruses in crops. A novel tymovirus sequence was detected in Asclepias viridis (green milkweed), a perennial growing in a natural setting in the Tallgrass Prairie Preserve (TGPP) of Oklahoma. It was abundant within and frequent among A. viridis plants and, to varying extents, within other dicotyledonous and one grass (Panicum virgatum) species obtained from the TGPP. Extracts from A. viridis containing the sequence were infectious to a limited number of species. The virus genome was cloned and determined to be closely related to Kennedya yellow mosaic virus. The persistence of the virus within the Oklahoma A. viridis population was monitored for five successive years. Virus was present in a high percentage of plants within representative areas of the TGPP in all years and was spreading to additional plants. Virus was present in regions adjacent to the TGPP but not in plants sampled from central and south-central Oklahoma. Virus was present in the underground caudex of the plant during the winter, suggesting overwintering in this tissue. The RNA sequence encoding the virus coat protein varied considerably between individual plants (≈3%), likely due to drift rather than selection. An infectious clone was constructed and the virus was named Asclepias asymptomatic virus (AsAV) due to the absence of obvious symptoms on A. viridis.
Survey of Key Monarch Habitat Areas along Roadways in Central and North Florida
DOT National Transportation Integrated Search
2017-08-01
Roadsides in North and Central Florida harbor a large number of milkweed populations important to the monarch butterfly. A total of 303 roadway locations had one or more plants of the target species Asclepias humistrata (pinewoods milkweed) or Asclep...
Straub, Shannon C K; Cronn, Richard C; Edwards, Christopher; Fishbein, Mark; Liston, Aaron
2013-01-01
Horizontal gene transfer (HGT) of DNA from the plastid to the nuclear and mitochondrial genomes of higher plants is a common phenomenon; however, plastid genomes (plastomes) are highly conserved and have generally been regarded as impervious to HGT. We sequenced the 158 kb plastome and the 690 kb mitochondrial genome of common milkweed (Asclepias syriaca [Apocynaceae]) and found evidence of intracellular HGT for a 2.4-kb segment of mitochondrial DNA to the rps2-rpoC2 intergenic spacer of the plastome. The transferred region contains an rpl2 pseudogene and is flanked by plastid sequence in the mitochondrial genome, including an rpoC2 pseudogene, which likely provided the mechanism for HGT back to the plastome through double-strand break repair involving homologous recombination. The plastome insertion is restricted to tribe Asclepiadeae of subfamily Asclepiadoideae, whereas the mitochondrial rpoC2 pseudogene is present throughout the subfamily, which confirms that the plastid to mitochondrial HGT event preceded the HGT to the plastome. Although the plastome insertion has been maintained in all lineages of Asclepiadoideae, it shows minimal evidence of transcription in A. syriaca and is likely nonfunctional. Furthermore, we found recent gene conversion of the mitochondrial rpoC2 pseudogene in Asclepias by the plastid gene, which reflects continued interaction of these genomes.
Milkweed control by food imprinted rabbits.
Ducs, Anita; Kazi, Andrea; Bilkó, Ágnes; Altbäcker, Vilmos
2016-09-01
Many species of invasive plants are spreading out rapidly in Europe. The common milkweed occupies increasingly more area. Being poisonous, most animals will not graze on it however rabbits would be an effective organism for the biological control of milkweed. Rabbit kittens can learn the maternal diet in various ways. They prefer aromatic foods which their mother had eaten during pregnancy or lactation period, -even if it is poisonous- but they can also learn the maternal diet from the fecal pellets deposited by the mother into the nest during the nursing events. The present study was aimed to investigate if rabbit kittens can learn that the common milkweed is a potential food also. In the first 10days of their lives kits got fecal pellets originating from individuals having fed on common milkweed previously. When weaned on day 28 postpartum, these pups preferred the milkweed in the 3-way food choice test, opposite to the control group. Most surprisingly in a second experiment it was also shown that the common milkweed was also preferred by the kittens if their mother ate it not during, but one month before pregnancy. Copyright © 2016 Elsevier B.V. All rights reserved.
Straub, Shannon C.K.; Cronn, Richard C.; Edwards, Christopher; Fishbein, Mark; Liston, Aaron
2013-01-01
Horizontal gene transfer (HGT) of DNA from the plastid to the nuclear and mitochondrial genomes of higher plants is a common phenomenon; however, plastid genomes (plastomes) are highly conserved and have generally been regarded as impervious to HGT. We sequenced the 158 kb plastome and the 690 kb mitochondrial genome of common milkweed (Asclepias syriaca [Apocynaceae]) and found evidence of intracellular HGT for a 2.4-kb segment of mitochondrial DNA to the rps2–rpoC2 intergenic spacer of the plastome. The transferred region contains an rpl2 pseudogene and is flanked by plastid sequence in the mitochondrial genome, including an rpoC2 pseudogene, which likely provided the mechanism for HGT back to the plastome through double-strand break repair involving homologous recombination. The plastome insertion is restricted to tribe Asclepiadeae of subfamily Asclepiadoideae, whereas the mitochondrial rpoC2 pseudogene is present throughout the subfamily, which confirms that the plastid to mitochondrial HGT event preceded the HGT to the plastome. Although the plastome insertion has been maintained in all lineages of Asclepiadoideae, it shows minimal evidence of transcription in A. syriaca and is likely nonfunctional. Furthermore, we found recent gene conversion of the mitochondrial rpoC2 pseudogene in Asclepias by the plastid gene, which reflects continued interaction of these genomes. PMID:24029811
Corneal Toxicity Following Exposure to Asclepias Tuberosa
Mikkelsen, Lauge Hjorth; Hamoudi, Hassan; Gül, Cigdem Altuntas; Heegaard, Steffen
2017-01-01
Purpose: To present a case of corneal toxicity following exposure to milky plant latex from Asclepias tuberosa. Methods: A 70-year-old female presented with blurred vision and pain in her left eye after handling an Ascepias tuberosa. Clinical examination revealed a corneal stromal oedema with small epithelial defects. The corneal endothelium was intact and folds in Descemets membrane were observed. The oedema was treated with chloramphenicol, dexamethasone and scopolamine. Results: The corneal oedema had appeared after corneal exposure to the plant, Asclepias tuberosa, whose latex contains cardenolides that inhibit the Na+/ K+-ATPase in the corneal endothelium. The oedema resolved after 96 hours. After nine months the best corrected visual acuity was 20/20. Conclusion: Corneal toxicity has previously been reported for plants of the Asclepias family. This is a rare case describing severe corneal toxicity caused by exposure to latex from Asclepias tuberosa. Handling of plants of the Asclepias family should be kept as a differential diagnosis in cases of acute corneal toxicity. PMID:28400886
Corneal Toxicity Following Exposure to Asclepias Tuberosa.
Mikkelsen, Lauge Hjorth; Hamoudi, Hassan; Gül, Cigdem Altuntas; Heegaard, Steffen
2017-01-01
To present a case of corneal toxicity following exposure to milky plant latex from Asclepias tuberosa. A 70-year-old female presented with blurred vision and pain in her left eye after handling an Ascepias tuberosa . Clinical examination revealed a corneal stromal oedema with small epithelial defects. The corneal endothelium was intact and folds in Descemets membrane were observed. The oedema was treated with chloramphenicol, dexamethasone and scopolamine. The corneal oedema had appeared after corneal exposure to the plant, Asclepias tuberosa , whose latex contains cardenolides that inhibit the Na + / K + -ATPase in the corneal endothelium. The oedema resolved after 96 hours. After nine months the best corrected visual acuity was 20/20. Corneal toxicity has previously been reported for plants of the Asclepias family. This is a rare case describing severe corneal toxicity caused by exposure to latex from Asclepias tuberosa . Handling of plants of the Asclepias family should be kept as a differential diagnosis in cases of acute corneal toxicity.
Livshultz, Tatyana; Mead, Jerry V; Goyder, David J; Brannin, Michelle
2011-12-01
Climate change that increases mortality of plants and pollinators can create mate-finding Allee effects and thus act as a strong selective force on floral morphology. Milkweeds (Secamonoideae and Asclepiadoideae; Apocynaceae) are typically small plants of seasonally dry habitats, with pollinia and high pollen-transfer efficiency. Their sister group (tribe Baisseeae and Dewevrella) is mostly comprised of giant lianas of African rainforests, with pollen in monads. Comparison of the two groups motivated a new hypothesis: milkweeds evolved in the context of African aridification and the shifting of rainforest to dry forest. Pollinia and high pollen-transfer efficiency may have been adaptations that alleviated mate-finding Allee effects generated by high mortality during droughts. We formally tested whether milkweeds have a drier climate niche by comparing milkweeds with plesiomorphic traits (Secamonoideae) and the milkweed sister group in continental Africa. We georeferenced specimens of the milkweed sister group and Secamonoideae in continental Africa, extracted 19 climatic variables from the Worldclim model, conducted factor analysis to identify correlated suites of variables, and compared the frequency distributions of the two lineages relative to each factor. The distributions of Secamonoideae and the milkweed sister group differed significantly relative to four factors, each correlated with a distinct suite of climate parameters: (1) air temperature (Secamonoideae: cooler), (2) total and (3) summer precipitation (Secamonoideae: drier), and (4) temperature seasonality and isothermality (Secamonoideae: more seasonal and less isothermal). Secamonoideae in continental Africa inhabit drier, cooler sites than do the milkweed sister group, consistent with a shift from rainforests to dry forests in a cooling climate.
Thompson, K A; Cory, K A; Johnson, M T J
2017-06-01
Evolutionary biologists have long sought to understand the ecological processes that generate plant reproductive diversity. Recent evidence indicates that constitutive antiherbivore defences can alter natural selection on reproductive traits, but it is unclear whether induced defences will have the same effect and whether reduced foliar damage in defended plants is the cause of this pattern. In a factorial field experiment using common milkweed, Asclepias syriaca L., we induced plant defences using jasmonic acid (JA) and imposed foliar damage using scissors. We found that JA-induced plants experienced selection for more inflorescences that were smaller in size (fewer flowers), whereas control plants only experienced a trend towards selection for larger inflorescences (more flowers); all effects were independent of foliar damage. Our results demonstrate that induced defences can alter both the strength and direction of selection on reproductive traits, and suggest that antiherbivore defences may promote the evolution of plant reproductive diversity. © 2017 European Society For Evolutionary Biology. Journal of Evolutionary Biology © 2017 European Society For Evolutionary Biology.
Ward, Megan; Johnson, Steven D; Zalucki, Myron P
2013-04-01
One of the essential requirements for an introduced plant species to become invasive is an ability to reproduce outside the native range, particularly when initial populations are small. If a reproductive Allee effect is operating, plants in small populations will have reduced reproductive success relative to plants in larger populations. Alternatively, if plants in small populations experience less competition for pollination than those in large populations, they may actually have higher levels of reproductive success than plants in large populations. To resolve this uncertainty, we investigated how the per capita fecundity of plants was affected by population size in three invasive milkweed species. Field surveys of seed production in natural populations of different sizes but similar densities were conducted for three pollinator-dependent invasive species, namely Asclepias curassavica, Gomphocarpus fruticosus and G. physocarpus. Additionally, supplemental hand-pollinations were performed in small and large populations in order to determine whether reproductive output was limited by pollinator activity in these populations. Reproductive Allee effects were not detected in any of the study species. Instead, plants in small populations exhibited remarkably high levels of reproductive output compared to those in large populations. Increased fruit production following supplemental hand-pollinations suggested that the lower reproductive output of naturally pollinated plants in large populations is a consequence of pollen limitation rather than limitation due to abiotic resources. This is consistent with increased intraspecific competition for pollination amongst plants in large populations. It is likely that the invasion of these milkweed species in Australia has been enhanced because plants in small founding populations experience less intraspecific competition for pollinators than those in large populations, and thus have the ability to produce copious amounts of
Long-term trends in midwestern milkweed abundances and their relevance to monarch butterfly declines
Zaya, David N.; Pearse, Ian; Spyreas, Gregory
2017-01-01
Declines in monarch butterfly populations have prompted investigation into the sensitivity of their milkweed host plants to land-use change. Documented declines in milkweed abundance in croplands have spurred efforts to promote milkweeds in other habitats. Nevertheless, our current understanding of milkweed populations is poor. We used a long-term plant survey from Illinois to evaluate whether trends in milkweed abundance have caused monarch decline and to highlight the habitat-management practices that promote milkweeds. Milkweed abundance in natural areas has not declined precipitously, although when croplands are considered, changes in agricultural weed management have led to a 68% loss of milkweed available for monarchs across the region. Midsuccessional plant communities with few invasive species provide optimal milkweed habitat. The augmentation of natural areas and the management of existing grasslands, such as less frequent mowing and woody- and exotic-species control, may replace some of the milkweed that has been lost from croplands.
Honey bees are the dominant diurnal pollinator of native milkweed in a large urban park.
MacIvor, James Scott; Roberto, Adriano N; Sodhi, Darwin S; Onuferko, Thomas M; Cadotte, Marc W
2017-10-01
In eastern North America, the field milkweed, Asclepias syriaca L. (Asclepiadaceae), is used in planting schemes to promote biodiversity conservation for numerous insects including the endangered monarch butterfly, Danaus plexippus (Linnaeus) (Nymphalidae). Less is known about its pollinators, and especially in urban habitats where it is planted often despite being under increasing pressure from invasive plant species, such as the related milkweed, the dog-strangling vine (DSV), Vincetoxicum rossicum (Kleopow) Barbar. (Asclepiadaceae). During the A. syriaca flowering period in July 2016, we surveyed bees in open habitats along a DSV invasion gradient and inspected 433 individuals of 25 bee species in 12 genera for pollinia: these were affixed to bees that visited A. syriaca for nectar and contain pollen packets that are vectored (e.g., transferred) between flowers. Of all bees sampled, pollinia were found only on the nonindigenous honeybee, Apis mellifera (43% of all bees identified), as well as one individual bumblebee, Bombus impatiens Cresson. Pollinia were recorded from 45.2% of all honeybees collected. We found no relationship between biomass of DSV and biomass of A. syriaca per site. There was a significant positive correlation between A. syriaca biomass and the number of pollinia, and the proportion vectored. No relationship with DSV biomass was detected for the number of pollinia collected by bees but the proportion of vectored pollinia declined with increasing DSV biomass. Although we find no evidence of DSV flowers attracting potential pollinators away from A. syriaca and other flowering plants, the impacts on native plant-pollinator mutualisms relate to its ability to outcompete native plants. As wild bees do not appear to visit DSV flowers, it could be altering the landscape to one which honeybees are more tolerant than native wild bees.
Winnick, Theodore; Davis, Alva R.; Greenberg, David M.
1940-01-01
1. The kinetics of milk clotting by asclepain, the protease of Asclepias speciosa, were investigated. At higher concentrations of enzyme, the clotting time was inversely proportional to the enzyme concentration. 2. The digestion of casein and hemoglobin in 6.6 M urea by asclepain follows the second order reaction rate. The rate was roughly second order for casein in water. 3. Evaluation of the nature of the enzyme-substrate intermediate indicates that one molecule of asclepain combines with one molecule of casein or hemoglobin in urea solution. 4. Inhibition by the reaction products was deduced from the fact that the digestion velocity of hemoglobin in urea solution varied with the asclepain concentration in agreement with the Schütz-Borissov rule. PMID:19873155
Mebs, Dietrich; Wunder, Cora; Toennes, Stefan W
2017-06-01
Butterflies of the genus Danaus are known to sequester toxic cardenolides from milkweed host plants (Apocynaceae). In particular, Danaus plexippus efficiently sequesters and stores these compounds, whereas D. chrysippus, is considered to poorly sequester cardenolides. To estimate its sequestration capability compared with that of D. plexippus, larvae of both species were jointly reared on Asclepias curassavica and the major cardenolides of the host plant, calotropin and calactin, were analyzed in adults sampled at different time intervals after eclosion. Both cardenolides were detected in body and wings of D. plexippus. Whereas the calotropin-concentration remained constant over a period of 24 days, that of calactin steadily decreased. In the body, but not in the wings of D. chrysippus, calactin only was detected in low amounts, which was then almost completely lost during the following 8 days after eclosion, suggesting that in contrast to D. plexippus, cardenolides seem to be less important for that butterfly's defence against predators. Copyright © 2017 Elsevier Ltd. All rights reserved.
Zhang, Rong-Rong; Tian, Hai-Yan; Tan, Ya-Fang; Chung, Tse-Yu; Sun, Xiao-Hui; Xia, Xue; Ye, Wen-Cai; Middleton, David A; Fedosova, Natalya; Esmann, Mikael; Tzen, Jason T C; Jiang, Ren-Wang
2014-11-28
Five new cardenolide lactates (1–5) and one new dioxane double linked cardenolide glycoside (17) along with 15 known compounds (6–16 and 18–21) were isolated from the ornamental milkweed Asclepias curassavica. Their structures were elucidated by extensive spectroscopic methods (IR, UV, MS, 1D- and 2D-NMR). The molecular structures and absolute configurations of 1–3 and 17 were further confirmed by single-crystal X-ray diffraction analysis. Simultaneous isolation of dioxane double linked cardenolide glycosides (17–21) and cardenolide lactates (1–5) provided unique chemotaxonomic markers for this genus. Compounds 1–21 were evaluated for the inhibitory activities against DU145 prostate cancer cells. The dioxane double linked cardenolide glycosides showed the most potent cytotoxic effect followed by normal cardenolides and cardenolide lactates, while the C21 steroids were non-cytotoxic. Enzymatic assay established a correlation between the cytotoxic effects in DU145 cancer cells and the Ki for the inhibition of Na(+),K(+)-ATPase. Molecular docking analysis revealed relatively strong H-bond interactions between the bottom of the binding cavity and compounds 18 or 20, and explained why the dioxane double linked cardenolide glycosides possessed higher inhibitory potency on Na(+),K(+)-ATPase than the cardenolide lactate.
Thermogravimetric analysis and fast pyrolysis of Milkweed.
Kim, Seung-Soo; Agblevor, Foster A
2014-10-01
Pyrolysis of Milkweed was carried out in a thermogravimetric analyzer and a bubbling fluidized bed reactor. Total liquid yield of Milkweed pyrolysis was between 40.74% and 44.19 wt% between 425 °C and 550 °C. The gas yield increased from 27.90 wt% to 33.33 wt% with increasing reaction temperature. The higher heating values (HHV) of the Milkweed bio-oil were relatively high (30.33-32.87 MJ/kg) and varied with reaction temperature, feeding rate and fluidization velocity. The selectivity for CO2 was highest within non-condensable gases, and the molar ratio of CO2/CO was about 3 at the different reaction conditions. The (13)C NMR analysis, of the bio-oil showed that the relative concentration carboxylic group and its derivatives was higher at 425 °C than 475 °C, which resulted in slightly higher oxygen content in bio-oil. The pH of aqueous phase obtained at 475 °C was 7.37 which is the highest reported for any lignocellulosic biomass pyrolysis oils. Copyright © 2014 Elsevier Ltd. All rights reserved.
Evolution at the tips: Asclepias phylogenomics and new perspectives on leaf surfaces.
Fishbein, Mark; Straub, Shannon C K; Boutte, Julien; Hansen, Kimberly; Cronn, Richard C; Liston, Aaron
2018-03-01
Leaf surface traits, such as trichome density and wax production, mediate important ecological processes such as anti-herbivory defense and water-use efficiency. We present a phylogenetic analysis of Asclepias plastomes as a framework for analyzing the evolution of trichome density and presence of epicuticular waxes. We produced a maximum-likelihood phylogeny using plastomes of 103 species of Asclepias. We reconstructed ancestral states and used model comparisons in a likelihood framework to analyze character evolution across Asclepias. We resolved the backbone of Asclepias, placing the Sonoran Desert clade and Incarnatae clade as successive sisters to the remaining species. We present novel findings about leaf surface evolution of Asclepias-the ancestor is reconstructed as waxless and sparsely hairy, a macroevolutionary optimal trichome density is supported, and the rate of evolution of trichome density has accelerated. Increased sampling and selection of best-fitting models of evolution provide more resolved and robust estimates of phylogeny and character evolution than obtained in previous studies. Evolutionary inferences are more sensitive to character coding than model selection. © 2018 The Authors. American Journal of Botany is published by Wiley Periodicals, Inc. on behalf of the Botanical Society of America.
Field responses of Prunus serotina and Asclepias syriaca to ozone around southern Lake Michigan
Bennett, J.P.; Jepsen, E.A.; Roth, J.A.
2006-01-01
Higher ozone concentrations east of southern Lake Michigan compared to west of the lake were used to test hypotheses about injury and growth effects on two plant species. We measured approximately 1000 black cherry trees and over 3000 milkweed stems from 1999 to 2001 for this purpose. Black cherry branch elongation and milkweed growth and pod formation were significantly higher west of Lake Michigan while ozone injury was greater east of Lake Michigan. Using classification and regression tree (CART) analyses we determined that departures from normal precipitation, soil nitrogen and ozone exposure/peak hourly concentrations were the most important variables affecting cherry branch elongation, and milkweed stem height and pod formation. The effects of ozone were not consistently comparable with the effects of soil nutrients, weather, insect or disease injury, and depended on species. Ozone SUM06 exposures greater than 13 ppm-h decreased cherry branch elongation 18%; peak 1-h exposures greater than 93 ppb reduced milkweed stem height 13%; and peak 1-h concentrations greater than 98 ppb reduced pod formation 11% in milkweed. Decreased cherry branch elongation, milkweed stem height and pod production, and foliar injury on both species occurred at sites around southern Lake Michigan at ozone exposures of 13 SUM06 ppm-h and 93a??98 ppb peak hourly.
Field responses of Prunus serotina and Asclepias syriaca to ozone around southern Lake Michigan.
Bennett, J P; Jepsen, E A; Roth, J A
2006-07-01
Higher ozone concentrations east of southern Lake Michigan compared to west of the lake were used to test hypotheses about injury and growth effects on two plant species. We measured approximately 1000 black cherry trees and over 3000 milkweed stems from 1999 to 2001 for this purpose. Black cherry branch elongation and milkweed growth and pod formation were significantly higher west of Lake Michigan while ozone injury was greater east of Lake Michigan. Using classification and regression tree (CART) analyses we determined that departures from normal precipitation, soil nitrogen and ozone exposure/peak hourly concentrations were the most important variables affecting cherry branch elongation, and milkweed stem height and pod formation. The effects of ozone were not consistently comparable with the effects of soil nutrients, weather, insect or disease injury, and depended on species. Ozone SUM06 exposures greater than 13 ppm-h decreased cherry branch elongation 18%; peak 1-h exposures greater than 93 ppb reduced milkweed stem height 13%; and peak 1-h concentrations greater than 98 ppb reduced pod formation 11% in milkweed.
Monarch butterfly oviposition preference supports a diversity of milkweed species on the landscape
USDA-ARS?s Scientific Manuscript database
Over the past two decades, the population of monarch butterflies east of the Rocky Mountains has experienced a significant decline in overwintering numbers. Habitat restoration that includes planting milkweeds is essential to boost monarch numbers within the breeding range. Milkweeds are the only ho...
Broyles, Steven B; Wyatt, Robert
1995-02-01
The evolution of large floral displays in hermaphroditic flowering plants has been attributed to natural selection acting to enhance male, rather than female, reproductive success. Proponents of the "pollen-donation hypothesis" have assumed that maternal resources, rather than levels of effective pollination, limit fruit set. We investigated the pollen-donation hypothesis in an experimental population of poke milkweed, Asclepias exaltata, where effective pollination did not limit fruit set. Specifically, we examined the effects of flower number per plant, and flower number per umbel on male reproductive success (number of fruits sired) and female reproductive success (number of fruits matured). In 1990, a paternity analysis was performed on fruits collected from 53 plants whose inflorescences were not manipulated. Flower number per plant was significantly correlated with male success, but not with plant gender. Flower number per plant was also significantly correlated with female success, but umbel number and stem number per plant together explained more than half (58%) the variation in female success. The percentage of fruit set was not significantly correlated with flower number per plant. Plants with large floral displays did not disproportionately increase in male reproductive success, relative to female success, as predicted by the pollen-donation hypothesis. In 1991, the effect of flower number per umbel on male and female reproductive success was investigated. Flower number per umbel was manipulated on four umbels per plant by removing flowers to leave 6, 12, or 18 flowers in each umbel. Plants with the largest umbels effectively pollinated twice as many flowers on other plants, but produced only 1.35 times as many fruits as plants with 6 and 12 flowers per umbel. Relative maleness of plants with large umbels was nearly twice that of small and medium umbels. Although these observations are consistent with the pollen-donation hypothesis at the level of umbels
Ramos, Bruna de Cássia Menezes; Rodríguez-Gironés, Miguel Angel; Rodrigues, Daniela
2017-08-08
The ability of insect visitors to learn to manipulate complex flowers has important consequences for foraging efficiency and plant fitness. We investigated learning by two butterfly species, Danaus erippus and Heliconius erato , as they foraged on the complex flowers of Asclepias curassavica , as well as the consequences for pollination. To examine learning with respect to flower manipulation, butterflies were individually tested during four consecutive days under insectary conditions. At the end of each test, we recorded the number of pollinaria attached to the body of each butterfly and scored visited flowers for numbers of removed and inserted pollinia. We also conducted a field study to survey D. erippus and H. erato visiting flowers of A. curassavica , as well as to record numbers of pollinaria attached to the butterflies' bodies, and surveyed A. curassavica plants in the field to inspect flowers for pollinium removal and insertion. Learning improves the ability of both butterfly species to avoid the nonrewarding flower parts and to locate nectar more efficiently. There were no experience effects, for either species, on the numbers of removed and inserted pollinia. Heliconius erato removed and inserted more pollinia than D. erippus . For both butterfly species, pollinium removal was higher than pollinium insertion. This study is the first to show that Danaus and Heliconius butterflies can learn to manipulate complex flowers, but this learning ability does not confer benefits to pollination in A. curassavica . © 2017 Botanical Society of America.
Anthropogenic Impacts on Mortality and Population Viability of the Monarch Butterfly.
Malcolm, Stephen B
2018-01-07
Monarch butterflies (Danaus plexippus) are familiar herbivores of milkweeds of the genus Asclepias, and most monarchs migrate each year to locate these host plants across North American ecosystems now dominated by agriculture. Eastern migrants overwinter in high-elevation forests in Mexico, and western monarchs overwinter in trees on the coast of California. Both populations face three primary threats to their viability: (a) loss of milkweed resources for larvae due to genetically modified crops, pesticides, and fertilizers; (b) loss of nectar resources from flowering plants; and (c) degraded overwintering forest habitats due to commercially motivated deforestation and other economic activities. Secondary threats to population viability include (d) climate change effects on milkweed host plants and the dynamics of breeding, overwintering, and migration; (e) the influence of invasive plants and natural enemies; (f) habitat fragmentation and coalescence that promote homogeneous, species-depleted landscapes; and (g) deliberate culture and release of monarchs and invasive milkweeds.
Hyb-Seq: combining target enrichment and genome skimming for plant phylogenomics
Kevin Weitemier; Shannon C.K. Straub; Richard C. Cronn; Mark Fishbein; Roswitha Schmickl; Angela McDonnell; Aaron Liston
2014-01-01
⢠Premise of the study: Hyb-Seq, the combination of target enrichment and genome skimming, allows simultaneous data collection for low-copy nuclear genes and high-copy genomic targets for plant systematics and evolution studies. ⢠Methods and Results: Genome and transcriptome assemblies for milkweed ( Asclepias syriaca ) were used to design enrichment probes for 3385...
Finch, Jessamine; Walck, Jeffrey L; Hidayati, Siti N; Kramer, Andrea T; Lason, Victoria; Havens, Kayri
2018-05-20
Species responses to climate change will be primarily driven by their environmental tolerance range, or niche breadth, with the expectation that broad niches will increase resilience. Niche breadth is expected to be greater in more heterogeneous environments and moderated by life history. Niche breadth also varies across life stage. Therefore, the life stage with the narrowest niche may serve as the best predictor of climatic vulnerability. To investigate the relationship between niche breadth, climate, and life stage we identify germination niche breadth for dormant and nondormant seeds in multiple populations of three milkweed (Asclepias) species. Complementary trials evaluated germination under conditions simulating historic and predicted future climate by varying cold-moist stratification temperature, length, and incubation temperature. Germination niche breadth was derived from germination evenness across treatments (Levins B n ), with stratified seeds considered less dormant than non-stratified seeds. Germination response varies significantly among species, populations, and treatments. Cold-moist stratification ≥ 4 weeks (1-3°C) followed by incubation at 25/15°C+ achieves peak germination for most populations. Germination niche breadth significantly expands following stratification and interacts significantly with latitude of origin. Interestingly, two species display a positive relationship between niche breadth and latitude, while the third presents a concave quadratic relationship. Germination niche breadth significantly varies by species, latitude, and population, suggesting an interaction between source climate, life history, and site-specific factors. Results contribute to our understanding of inter- and intraspecific variation in germination, underscore the role of dormancy in germination niche breadth, and have implications for prioritizing and conserving species under climate change. This article is protected by copyright. All rights reserved
Corn pollen deposition on milkweeds in and near cornfields.
Pleasants, J M; Hellmich, R L; Dively, G P; Sears, M K; Stanley-Horn, D E; Mattila, H R; Foster, J E; Clark, P; Jones, G D
2001-10-09
The density of corn pollen on leaves of milkweed plants inside and outside of cornfields was measured in several studies from different localities. The purpose was to obtain a representative picture of naturally occurring pollen densities to provide a perspective for laboratory and field studies of monarch larvae feeding on milkweed leaves with Bt corn pollen. Pollen density was highest (average 170.6 grains per cm(2)) inside the cornfield and was progressively lower from the field edge outward, falling to 14.2 grains per cm(2) at 2 m. Inside the cornfield, and for each distance from the field edge, a frequency distribution is presented showing the proportion of leaf samples with different pollen densities. Inside cornfields, 95% of leaf samples had pollen densities below 600 grains per cm(2) and the highest pollen density observed was 1400 grains per cm(2), which occurred in a study with a rainless anthesis period. All other studies had rainfall events during the anthesis period. A single rain event can remove 54-86% of the pollen on leaves. Leaves on the upper portion of milkweed plants, where young monarch larvae tend to feed, had only 30-50% of the pollen density levels of middle leaves.
Gowler, Camden D; Leon, Kristoffer E; Hunter, Mark D; de Roode, Jacobus C
2015-06-01
In tri-trophic systems, herbivores may benefit from their host plants in fighting parasitic infections. Plants can provide parasite resistance in two contrasting ways: either directly, by interfering with the parasite, or indirectly, by increasing herbivore immunity or health. In monarch butterflies, the larval diet of milkweed strongly influences the fitness of a common protozoan parasite. Toxic secondary plant chemicals known as cardenolides correlate strongly with parasite resistance of the host, with greater cardenolide concentrations in the larval diet leading to lower parasite growth. However, milkweed cardenolides may covary with other indices of plant quality including nutrients, and a direct experimental link between cardenolides and parasite performance has not been established. To determine if the anti-parasitic activity of milkweeds is indeed due to secondary chemicals, as opposed to nutrition, we supplemented the diet of infected and uninfected monarch larvae with milkweed latex, which contains cardenolides but no nutrients. Across three experiments, increased dietary cardenolide concentrations reduced parasite growth in infected monarchs, which consequently had longer lifespans. However, uninfected monarchs showed no differences in lifespan across treatments, confirming that cardenolide-containing latex does not increase general health. Our results suggest that cardenolides are a driving force behind plant-derived resistance in this system.
USDA-ARS?s Scientific Manuscript database
The flowers of milkweed species can produce a rich supply of nectar, and therefore, planting an insecticide-free milkweed habitat in agricultural farmscapes could possibly conserve monarch butterflies, bees and other insect pollinators, as well as enhance parasitism of insect pests. In peanut-cotton...
Acylated-oxypregnane glycosides from the roots of Asclepias syriaca.
Warashina, Tsutomu; Noro, Tadataka
2009-02-01
Twenty new pregnane glycosides were obtained from the roots of Asclepias syriaca L. (Asclepiadaceae). These glycosides were confirmed to contain ikemagenin, 12-O-nicotinoyllineolon, 5alpha,6-dihydroikemagenin, and 12-O-tigloylisolineolon, as their aglycones, using both spectroscopic and chemical methods.
Environmental Assessment for Southern Utah Relay Node Site NO. RN 8C919UT
1993-03-18
ambersnail Oxvloma haydeni kanabensis Mexican Spotted owl Strix occidentalis lucida We would like to bring to yoiir attention species which are candidates for... spotted owl (Strix occidentalis lucida), the Kanab ambersnail (Oxyloma haydeni kanabensis), and three plants: Welsh’s milkweed (Asclepias welshii), Jones...Hualapai, Yavapai-Apache, and Ute tribes, and the Navajo Nation . These tribes were notified, the GWEN project was explained, and information was
Thrombin like activity of Asclepias curassavica L. latex: action of cysteine proteases.
Shivaprasad, H V; Rajesh, R; Nanda, B L; Dharmappa, K K; Vishwanath, B S
2009-05-04
To validate the scientific basis of plant latex to stop bleeding on fresh cuts. Cysteine protease(s) from Asclepias curassavica (Asclepiadaceae) plant latex was assessed for pro-coagulant and thrombin like activities. A waxy material from the latex of Asclepias curassavica latex was removed by freezing and thawing. The resulted latex enzyme fraction was assayed for proteolytic activity using denatured casein as substrate. Its coagulant activity and thrombin like activity were determined using citrated plasma and pure fibrinogen, respectively. Inhibition studies were performed using specific protease inhibitors to know the type of protease. The latex enzyme fraction exhibited strong proteolytic activity when compared to trypsin and exerted pro-coagulant action by reducing plasma clotting time from 195 to 58 s whereas trypsin reduced clotting time marginally from 195 to 155 s. The pro-coagulant activity of this enzyme fraction was exerted by selectively hydrolyzing A alpha and B beta subunits of fibrinogen to form fibrin clot when pure fibrinogen was used as substrate as assessed by fibrinogen-agarose plate method and fibrinogen polymerization assay. Trypsin failed to induce any fibrin clot under similar conditions. The electrophoretic pattern of latex enzyme fraction-induced fibrin clot was very much similar to that of thrombin-induced fibrin clot and mimic thrombin like action. The proteolytic activity including thrombin like activity of Asclepias curassavica latex enzyme fraction was completely inhibited by iodoaceticacid (IAA). Cysteine proteases from Asclepias curassavica latex exhibited strong pro-coagulant action and were found to be specific in its action (Thrombin like). This could be the basis for the use of plant latex in pharmacological applications that justify their use as folk medicine.
Flavonoids in the leaves of Asclepias incarnata L.
Sikorska, Maria
2003-01-01
Seven flavonoid compounds: quercelin 3-O-beta-galactopyranoside, 3-O-beta-glucopyranoside, 3-O-arabinoside, 3-O-beta-glucopyranosyl (1-->2)-beta-galactopyranoside, 3-O-beta-xylopyranosyl (1-->2)-beta-galactopyranoside, 3-O-alpha-rhamnopyranosyl (1-->2)-beta-galactopyranoside and kaempferol 3-beta-glucopyranoside were isolated and identified from the leaves of Asclepias incarnata, L. (Asclepiadaceae).
Steroidal glycosides from the roots of Asclepias curassavica.
Warashina, Tsutomu; Noro, Tadataka
2008-03-01
Twenty-six new acylated-oxypregnane glycosides were obtained along with three known cardenolide glycosides from the roots of Asclepias curassavica (Asclepiadaceae). The new compounds were confirmed to contain 12-O-benzoylsarcostin, 12-O-benzoyldeacylmetaplexigenin, kidjolanin, and 12-O-benzoyltayloron, and one new acylated-oxypregnane, 12-O-(E)-cinnamoyltayloron, as their aglycones, using both spectroscopic and chemical methods.
A Walk in the "Tall, Tall Grass"
ERIC Educational Resources Information Center
Kaatz, Kathryn
2008-01-01
This inquiry-based lesson was inspired by Denise Fleming's book entitled, "In the Tall, Tall Grass" (1991). The author used the book and a real study of prairie grasses to teach kindergartners how to make careful observations and record what they see. In addition, they learn how to "draw as scientists." Here the author describes her class's yearly…
Design Task 7 - Guidelines on Modeling and Acceptance Values Task 8 - Input Ground Motions for Tall - Performance-Based Seismic Design Guidelines for Tall Buildings Task 12 - Quantification of seismic performance published Report No. 2017/06 titled: "Guidelines for Performance-Based Seismic Design of Tall Buildings
La Rosa, Raffica J; Conner, Jeffrey K
2017-01-01
Central questions in plant reproductive ecology are whether the functions of floral traits in hermaphrodites create conflict between sexes that could slow evolution, and whether individual floral traits function in pollinator attraction, efficiency, or both. We studied how floral traits affect pollinator visitation and efficiency, and how they affect male and female function and female fitness within and across three Asclepias species that differ in floral morphology. Using separate multiple regressions, we regressed pollen removal, deposition, and fruit number onto six floral traits. We also used path analyses integrating these variables with pollinator visitation data for two of the species to further explore floral function and its effects on fruit production. Most traits affected male pollination success only, and these effects often differed between species. The exception was increased slit length, which increased pollinia insertion in two of the species. There were no interspecific differences in the effects of the traits on female pollination success. All traits except horn reach affected pollination efficiency in at least one species, and horn reach and two hood dimensions were the only traits to affect pollinator attraction, but in just one species. Traits tended to function in only one sex, and more traits affected function through pollinator efficiency than through attraction. There was no significant link between female pollination success and female fitness in any of the three species; this pattern is consistent with fruit production not being limited by pollen deposition. © 2017 Botanical Society of America.
Wason, Elizabeth L; Hunter, Mark D
2014-02-01
Volatile organic chemical (VOC) emission by plants may serve as an adaptive plant defense by attracting the natural enemies of herbivores. For plant VOC emission to evolve as an adaptive defense, plants must show genetic variability for the trait. To date, such variability has been investigated primarily in agricultural systems, yet relatively little is known about genetic variation in VOCs emitted by natural populations of native plants. Here, we investigate intraspecific variation in constitutive and herbivore-induced plant VOC emission using the native common milkweed plant (Asclepias syriaca) and its monarch caterpillar herbivore (Danaus plexippus) in complementary field and common garden greenhouse experiments. In addition, we used a common garden field experiment to gauge natural enemy attraction to milkweed VOCs induced by monarch damage. We found evidence of genetic variation in the total constitutive and induced concentrations of VOCs and the composition of VOC blends emitted by milkweed plants. However, all milkweed genotypes responded similarly to induction by monarchs in terms of their relative change in VOC concentration and blend. Natural enemies attacked decoy caterpillars more frequently on damaged than on undamaged milkweed, and natural enemy visitation was associated with higher total VOC concentrations and with VOC blend. Thus, we present evidence that induced VOCs emitted by milkweed may function as a defense against herbivores. However, plant genotypes were equally attractive to natural enemies. Although milkweed genotypes diverge phenotypically in their VOC concentrations and blends, they converge into similar phenotypes with regard to magnitude of induction and enemy attraction.
Monitoring of BHT-quinone and BHT-CHO in the gas of capsules of Asclepias physocarpa.
Ma, Bing-Ji; Peng, Hua; Liu, Ji-Kai
2006-01-01
Three volatile components, namely benzoic acid ethyl ester (1), 2,6-di-tert-butyl-p-benzoquinone (BHT-quinone) (2), and 3,5-di-tert-butyl-4-hydroxybenzaldehyde (BHT-CHO) (3), were detected from the gas in the capsules of Asclepias physocarpa by means of GC/MS analysis. BHT-quinone and BHT-CHO as organic pollutants are the degradation products of the antioxidant 2,6-di-tert-butyl-4-methylphenol (BHT). Ground water, lake water and/or rain water are a source of BHT metabolites in the plant Asclepias physocarpa.
Milkweed Seed Dispersal: A Means for Integrating Biology and Physics.
ERIC Educational Resources Information Center
Bisbee, Gregory D.; Kaiser, Cheryl A.
1997-01-01
Describes an activity that integrates biology and physics concepts by experimenting with the seed dispersal of common milkweed or similar wind-dispersed seeds. Student teams collect seeds and measure several parameters, review principles of trajectory motion, perform experiments, and graph data. Students examine the ideas of…
Evolutionary trade-offs in plants mediate the strength of trophic cascades.
Mooney, Kailen A; Halitschke, Rayko; Kessler, Andre; Agrawal, Anurag A
2010-03-26
Predators determine herbivore and plant biomass via so-called trophic cascades, and the strength of such effects is influenced by ecosystem productivity. To determine whether evolutionary trade-offs among plant traits influence patterns of trophic control, we manipulated predators and soil fertility and measured impacts of a major herbivore (the aphid Aphis nerii) on 16 milkweed species (Asclepias spp.) in a phylogenetic field experiment. Herbivore density was determined by variation in predation and trade-offs between herbivore resistance and plant growth strategy. Neither herbivore density nor predator effects on herbivores predicted the cascading effects of predators on plant biomass. Instead, cascade strength was strongly and positively associated with milkweed response to soil fertility. Accordingly, contemporary patterns of trophic control are driven by evolutionary convergent trade-offs faced by plants.
Code of Federal Regulations, 2013 CFR
2013-04-01
... 21 Food and Drugs 3 2013-04-01 2013-04-01 false Tall oil. 186.1557 Section 186.1557 Food and Drugs... Substances Affirmed as GRAS § 186.1557 Tall oil. (a) Tall oil (CAS Reg. No. 8002-26-4) is essentially the sap... consists mainly of tall oil resin acids and tall oil fatty acids. (b) In accordance with § 186.1(b)(1), the...
Code of Federal Regulations, 2012 CFR
2012-04-01
... 21 Food and Drugs 3 2012-04-01 2012-04-01 false Tall oil. 186.1557 Section 186.1557 Food and Drugs... Substances Affirmed as GRAS § 186.1557 Tall oil. (a) Tall oil (CAS Reg. No. 8002-26-4) is essentially the sap... consists mainly of tall oil resin acids and tall oil fatty acids. (b) In accordance with § 186.1(b)(1), the...
Code of Federal Regulations, 2010 CFR
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Tall oil. 186.1557 Section 186.1557 Food and Drugs... Substances Affirmed as GRAS § 186.1557 Tall oil. (a) Tall oil (CAS Reg. No. 8002-26-4) is essentially the sap... consists mainly of tall oil resin acids and tall oil fatty acids. (b) In accordance with § 186.1(b)(1), the...
Code of Federal Regulations, 2011 CFR
2011-04-01
... 21 Food and Drugs 3 2011-04-01 2011-04-01 false Tall oil. 186.1557 Section 186.1557 Food and Drugs... Substances Affirmed as GRAS § 186.1557 Tall oil. (a) Tall oil (CAS Reg. No. 8002-26-4) is essentially the sap... consists mainly of tall oil resin acids and tall oil fatty acids. (b) In accordance with § 186.1(b)(1), the...
Petschenka, Georg; Fandrich, Steffi; Sander, Nils; Wagschal, Vera; Boppré, Michael; Dobler, Susanne
2013-09-01
Despite the monarch butterfly (Danaus plexippus) being famous for its adaptations to the defensive traits of its milkweed host plants, little is known about the macroevolution of these traits. Unlike most other animal species, monarchs are largely insensitive to cardenolides, because their target site, the sodium pump (Na(+)/K(+) -ATPase), has evolved amino acid substitutions that reduce cardenolide binding (so-called target site insensitivity, TSI). Because many, but not all, species of milkweed butterflies (Danaini) are associated with cardenolide-containing host plants, we analyzed 16 species, representing all phylogenetic lineages of milkweed butterflies, for the occurrence of TSI by sequence analyses of the Na(+)/K(+) -ATPase gene and by enzymatic assays with extracted Na(+)/K(+) -ATPase. Here we report that sensitivity to cardenolides was reduced in a stepwise manner during the macroevolution of milkweed butterflies. Strikingly, not all Danaini typically consuming cardenolides showed TSI, but rather TSI was more strongly associated with sequestration of toxic cardenolides. Thus, the interplay between bottom-up selection by plant compounds and top-down selection by natural enemies can explain the evolutionary sequence of adaptations to these toxins. © 2013 The Author(s). Evolution © 2013 The Society for the Study of Evolution.
American Hyperbole: The Tall Tale.
ERIC Educational Resources Information Center
Pavonetti, Linda M.; Combs, Christine M.
1999-01-01
Discusses the historic derivation and the format and characteristics of traditional tall tales, and modern adaptations of these stories. Describes a selection of tall tales for modern young adult readers; notes titles and authors of original tall tales and those with female heroes. Discusses the enduring appeal of traditional and modern tall…
Code of Federal Regulations, 2014 CFR
2014-04-01
... 21 Food and Drugs 3 2014-04-01 2014-04-01 false Tall oil. 186.1557 Section 186.1557 Food and Drugs....1557 Tall oil. (a) Tall oil (CAS Reg. No. 8002-26-4) is essentially the sap of the pine tree. It is obtained commercially from the waste liquors of pinewood pulp mills and consists mainly of tall oil resin...
New cardenolide and acylated lignan glycosides from the aerial parts of Asclepias curassavica.
Warashina, Tsutomu; Shikata, Kimiko; Miyase, Toshio; Fujii, Satoshi; Noro, Tadataka
2008-08-01
Three new cardenolide glycosides and six new acylated lignan glycosides were obtained along with nineteen known compounds from the aerial parts of Asclepias curassavica L. (Asclepiadaceae). The structure of each compound was determined based on interpretations of NMR and MS measurements and chemical evidence.
Tao, Leiling; Gowler, Camden D.; Ahmad, Aamina; Hunter, Mark D.; de Roode, Jacobus C.
2015-01-01
Host–parasite interactions are subject to strong trait-mediated indirect effects from other species. However, it remains unexplored whether such indirect effects may occur across soil boundaries and connect spatially isolated organisms. Here, we demonstrate that, by changing plant (milkweed Asclepias sp.) traits, arbuscular mycorrhizal fungi (AMF) significantly affect interactions between a herbivore (the monarch butterfly Danaus plexippus) and its protozoan parasite (Ophryocystis elektroscirrha), which represents an interaction across four biological kingdoms. In our experiment, AMF affected parasite virulence, host resistance and host tolerance to the parasite. These effects were dependent on both the density of AMF and the identity of milkweed species: AMF indirectly increased disease in monarchs reared on some species, while alleviating disease in monarchs reared on other species. The species-specificity was driven largely by the effects of AMF on both plant primary (phosphorus) and secondary (cardenolides; toxins in milkweeds) traits. Our study demonstrates that trait-mediated indirect effects in disease ecology are extensive, such that below-ground interactions between AMF and plant roots can alter host–parasite interactions above ground. In general, soil biota may play an underappreciated role in the ecology of many terrestrial host–parasite systems. PMID:26468247
Tao, Leiling; Gowler, Camden D; Ahmad, Aamina; Hunter, Mark D; de Roode, Jacobus C
2015-10-22
Host-parasite interactions are subject to strong trait-mediated indirect effects from other species. However, it remains unexplored whether such indirect effects may occur across soil boundaries and connect spatially isolated organisms. Here, we demonstrate that, by changing plant (milkweed Asclepias sp.) traits, arbuscular mycorrhizal fungi (AMF) significantly affect interactions between a herbivore (the monarch butterfly Danaus plexippus) and its protozoan parasite (Ophryocystis elektroscirrha), which represents an interaction across four biological kingdoms. In our experiment, AMF affected parasite virulence, host resistance and host tolerance to the parasite. These effects were dependent on both the density of AMF and the identity of milkweed species: AMF indirectly increased disease in monarchs reared on some species, while alleviating disease in monarchs reared on other species. The species-specificity was driven largely by the effects of AMF on both plant primary (phosphorus) and secondary (cardenolides; toxins in milkweeds) traits. Our study demonstrates that trait-mediated indirect effects in disease ecology are extensive, such that below-ground interactions between AMF and plant roots can alter host-parasite interactions above ground. In general, soil biota may play an underappreciated role in the ecology of many terrestrial host-parasite systems. © 2015 The Author(s).
Host Diet Affects the Morphology of Monarch Butterfly Parasites.
Hoang, Kevin; Tao, Leiling; Hunter, Mark D; de Roode, Jacobus C
2017-06-01
Understanding host-parasite interactions is essential for ecological research, wildlife conservation, and health management. While most studies focus on numerical traits of parasite groups, such as changes in parasite load, less focus is placed on the traits of individual parasites such as parasite size and shape (parasite morphology). Parasite morphology has significant effects on parasite fitness such as initial colonization of hosts, avoidance of host immune defenses, and the availability of resources for parasite replication. As such, understanding factors that affect parasite morphology is important in predicting the consequences of host-parasite interactions. Here, we studied how host diet affected the spore morphology of a protozoan parasite ( Ophryocystis elektroscirrha ), a specialist parasite of the monarch butterfly ( Danaus plexippus ). We found that different host plant species (milkweeds; Asclepias spp.) significantly affected parasite spore size. Previous studies have found that cardenolides, secondary chemicals in host plants of monarchs, can reduce parasite loads and increase the lifespan of infected butterflies. Adding to this benefit of high cardenolide milkweeds, we found that infected monarchs reared on milkweeds of higher cardenolide concentrations yielded smaller parasites, a potentially hidden characteristic of cardenolides that may have important implications for monarch-parasite interactions.
Ocular Toxicity Secondary to Asclepias physocarpa: The Balloon Plant.
Pina, Susana; Pedrosa, Catarina; Santos, Cristina; Feijóo, Bernardo; Pego, Peter; Vendrell, Cristina; Santos, Maria João; Prieto, Isabel
2014-01-01
We report a case of a 65-year-old woman with symptoms of blurred vision and ocular irritation a few hours after accidental contact of the right eye with Asclepias physocarpa milky latex. Observation showed a diffuse conjunctival hyperemia and stromal corneal edema with Descemet's membrane folds. Recovery was fast and apparently complete in less than one month. However, specular microscopy at 6-months follow-up showed an abnormal endothelial morphology as sequelae, suggesting this condition is not as innocuous as it has been suggested.
Ocular Toxicity Secondary to Asclepias physocarpa: The Balloon Plant
Pina, Susana; Pedrosa, Catarina; Santos, Cristina; Feijóo, Bernardo; Pego, Peter; Vendrell, Cristina; Santos, Maria João; Prieto, Isabel
2014-01-01
We report a case of a 65-year-old woman with symptoms of blurred vision and ocular irritation a few hours after accidental contact of the right eye with Asclepias physocarpa milky latex. Observation showed a diffuse conjunctival hyperemia and stromal corneal edema with Descemet's membrane folds. Recovery was fast and apparently complete in less than one month. However, specular microscopy at 6-months follow-up showed an abnormal endothelial morphology as sequelae, suggesting this condition is not as innocuous as it has been suggested. PMID:25105044
8,14-Secopregnane glycosides from the aerial parts of Asclepias tuberosa.
Warashina, Tsutomu; Noro, Tadataka
2009-07-01
Twenty pregnane glycosides, tuberoside A(1)-L(5), were isolated from the diethyl ether-soluble fraction of the MeOH extract from the aerial parts of Asclepias tuberosa (Asclepiadaceae). The pregnane glycosides were composed of 8,12;8,20-diepoxy-8,14-secopregnane as aglycon, and D-cymarose, D-oleandrose, D-digitoxose and/or D-glucose as the component sugars. Their structures were established using NMR spectroscopic analysis and chemical methodologies.
Hyb-Seq: Combining target enrichment and genome skimming for plant phylogenomics1
Weitemier, Kevin; Straub, Shannon C. K.; Cronn, Richard C.; Fishbein, Mark; Schmickl, Roswitha; McDonnell, Angela; Liston, Aaron
2014-01-01
• Premise of the study: Hyb-Seq, the combination of target enrichment and genome skimming, allows simultaneous data collection for low-copy nuclear genes and high-copy genomic targets for plant systematics and evolution studies. • Methods and Results: Genome and transcriptome assemblies for milkweed (Asclepias syriaca) were used to design enrichment probes for 3385 exons from 768 genes (>1.6 Mbp) followed by Illumina sequencing of enriched libraries. Hyb-Seq of 12 individuals (10 Asclepias species and two related genera) resulted in at least partial assembly of 92.6% of exons and 99.7% of genes and an average assembly length >2 Mbp. Importantly, complete plastomes and nuclear ribosomal DNA cistrons were assembled using off-target reads. Phylogenomic analyses demonstrated signal conflict between genomes. • Conclusions: The Hyb-Seq approach enables targeted sequencing of thousands of low-copy nuclear exons and flanking regions, as well as genome skimming of high-copy repeats and organellar genomes, to efficiently produce genome-scale data sets for phylogenomics. PMID:25225629
Rasmann, Sergio; Agrawal, Anurag A
2011-05-01
Attempts over the past 50 years to explain variation in the abundance, distribution and diversity of plant secondary compounds gave rise to theories of plant defense. Remarkably, few phylogenetically robust tests of these long-standing theories have been conducted. Using >50 species of milkweed (Asclepias spp.), we show that variation among plant species in the induction of toxic cardenolides is explained by latitude, with higher inducibility evolving more frequently at lower latitudes. We also found that: (1) the production of cardenolides showed positive-correlated evolution with the diversity of cardenolides, (2) greater cardenolide investment by a species is accompanied by an increase in an estimate of toxicity (measured as chemical polarity) and (3) instead of trading off, constitutive and induced cardenolides were positively correlated. Analyses of root and shoot cardenolides showed concordant patterns. Thus, milkweed species from lower latitudes are better defended with higher inducibility, greater diversity and added toxicity of cardenolides. © 2011 Blackwell Publishing Ltd/CNRS.
Komarnytsky, Slavko; Esposito, Debora; Rathinasabapathy, Thirumurugan; Poulev, Alexander; Raskin, Ilya
2013-02-27
Pregnane glycosides appear to modulate food intake by possibly affecting the hypothalamic feeding circuits; however, the mechanisms of the appetite-regulating effect of pregnane glycosides remain obscure. Here, we show that pregnane glycoside-enriched extracts from swamp milkweed Asclepias incarnata at 25-100 mg/kg daily attenuated food intake (up to 47.1 ± 8.5% less than controls) and body weight gain in rats (10% for males and 9% for females, respectively) by activating melanocortin signaling and inhibiting gastric emptying. The major milkweed pregnane glycoside, ikemagenin, exerted its appetite-regulating effect by decreasing levels of agouti-related protein (0.6-fold) but not NPY satiety peptides. Ikemagenin treatment also increased secretion of brain-derived neurotropic factor (BDNF) downstream of melanocortin receptors in the hypothalamus (1.4-fold) and in the C6 rat glioma cell culture in vitro (up to 6-fold). These results support the multimodal effects of pregnane glycosides on feeding regulation, which depends on the activity of the melanocortin signaling pathway and BDNF.
Verticillosides A-M: Polyoxygenated pregnane glycosides from Asclepias verticillata L.
Araya, Juan J; Binns, Franklin; Kindscher, Kelly; Timmermann, Barbara N
2012-06-01
As part of our ongoing effort to explore the chemical diversity of plants of the United States Midwest region, the isolation and identification of 13 pregnane glycosides named verticillosides A-M from Asclepias verticillata L. are reported. The structures of these compounds were elucidated by various spectroscopic techniques, including 1D and 2D NMR, IR, UV, and HRMS. The cytotoxicity of the isolates was evaluated against paired breast cell lines Hs578T (cancer) and Hs578Bst (normal), however, no significant growth inhibition was observed. Copyright © 2012 Elsevier Ltd. All rights reserved.
Tara Luna; R. Kasten Dumroese
2013-01-01
An international effort is under way to conserve populations of the monarch butterfly (Danaus plexippus L. [Lepidoptera: Nymphalidae]). Monarchs complete an impressive migration each year, flying from winter roosts on the California coast and the central mountains of Mexico to breeding areas throughout North America. Monarchs depend on habitats along their migratory...
Genotypic evaluation of tall fescue dihaploids by capillary electrophoresis
USDA-ARS?s Scientific Manuscript database
Recent innovations in tall fescue breeding and selection allow for the generation of dihaploid tall fescue lines. During the dihaploid generation process, two possible products can be generated. These being tall fescue hybrids generated from outcrossing and homozygous dihaploid tall fescue lines. As...
Cytotoxic cardiac glycosides and other compounds from Asclepias syriaca.
Araya, Juan J; Kindscher, Kelly; Timmermann, Barbara N
2012-03-23
Phytochemical investigation of the dried biomass of Asclepias syriaca afforded five new compounds (1-5), along with 19 known structures. Overall, the secondary metabolites isolated and identified from this plant showed a wide structural diversity including pentacyclic triterpenes, cardiac glycosides, flavonoid glycosides, lignans, a phenylethanoid, and a glycosylated megastigmane. In addition, the isolates were tested against the cancer breast cell line Hs578T, and those showing IC(50) values lower than 50 μM (1 and 6-9) were further investigated in three additional breast cancer cell lines (MCF-7, T47D, and Sk-Br-3) and the normal breast cell line Hs578Bst.
Genetic analysis of tall stature.
Kant, S G; Wit, J M; Breuning, M H
2005-01-01
Tall stature is less often experienced as an important problem than short stature. However, a correct diagnosis may be of eminent importance, especially when interventions are planned, or to know the natural history. Overgrowth can be caused by endocrine disorders and skeletal dysplasias, but also by several genetic syndromes. Despite a systematic diagnostic approach, there will be patients with tall stature who do not fit a known diagnosis. In this group of patients possibilities of genetic analysis do exist, but are not common practice. The FMR1 gene should be analyzed in patients with tall stature and mental retardation, and in these patients the NSD1 gene can be considered whenever some features of Sotos syndrome do exist. In tall patients without mental retardation and some features of Sotos or Beckwith-Wiedemann syndrome it may still be useful to look for mutations in the NSD1 gene, but also for changes in the 11p15 region. The various possibilities are discussed and placed in a flowchart. Copyright (c) 2005 S. Karger AG, Basel.
Restoring monarch butterfly habitat in the Midwestern US: 'All hands on deck'
Thogmartin, Wayne E.; Lopez-Hoffman, Laura; Rohweder, Jason; Diffendorfer, James E.; Drum, Ryan G.; Semmens, Darius J.; Black, Scott; Caldwell, Iris; Cotter, Donita; Drobney, Pauline; Jackson, Laura L.; Gale, Michael; Helmers, Doug; Hilburger, Steven B.; Howard, Elizabeth; Oberhauser, Karen S.; Pleasants, John M.; Semmens, Brice X.; Taylor, Orley R.; Ward, Patrick; Weltzin, Jake F.; Wiederholt, Ruscena
2017-01-01
The eastern migratory population of monarch butterflies (Danaus plexippus plexippus) has declined by >80% within the last two decades. One possible cause of this decline is the loss of ≥1.3 billion stems of milkweed (Asclepias spp.), which monarchs require for reproduction. In an effort to restore monarchs to a population goal established by the US Fish and Wildlife Service and adopted by Mexico, Canada, and the US, we developed scenarios for amending the Midwestern US landscape with milkweed. Scenarios for milkweed restoration were developed for protected area grasslands, Conservation Reserve Program land, powerline, rail and roadside rights of way, urban/suburban lands, and land in agricultural production. Agricultural land was further divided into productive and marginal cropland. We elicited expert opinion as to the biological potential (in stems per acre) for lands in these individual sectors to support milkweed restoration and the likely adoption (probability) of management practices necessary for affecting restoration. Sixteen of 218 scenarios we developed for restoring milkweed to the Midwestern US were at levels (>1.3 billion new stems) necessary to reach the monarch population goal. One of these scenarios would convert all marginal agriculture to conserved status. The other 15 scenarios converted half of marginal agriculture (730 million stems), with remaining stems contributed by other societal sectors. Scenarios without substantive agricultural participation were insufficient for attaining the population goal. Agricultural lands are essential to reaching restoration targets because they occupy 77% of all potential monarch habitat. Barring fundamental changes to policy, innovative application of economic tools such as habitat exchanges may provide sufficient resources to tip the balance of the agro-ecological landscape toward a setting conducive to both robust agricultural production and reduced imperilment of the migratory monarch butterfly.
Restoring monarch butterfly habitat in the Midwestern US: ‘all hands on deck’
NASA Astrophysics Data System (ADS)
Thogmartin, Wayne E.; López-Hoffman, Laura; Rohweder, Jason; Diffendorfer, Jay; Drum, Ryan; Semmens, Darius; Black, Scott; Caldwell, Iris; Cotter, Donita; Drobney, Pauline; Jackson, Laura L.; Gale, Michael; Helmers, Doug; Hilburger, Steve; Howard, Elizabeth; Oberhauser, Karen; Pleasants, John; Semmens, Brice; Taylor, Orley; Ward, Patrick; Weltzin, Jake F.; Wiederholt, Ruscena
2017-07-01
The eastern migratory population of monarch butterflies (Danaus plexippus plexippus) has declined by >80% within the last two decades. One possible cause of this decline is the loss of ≥1.3 billion stems of milkweed (Asclepias spp.), which monarchs require for reproduction. In an effort to restore monarchs to a population goal established by the US Fish and Wildlife Service and adopted by Mexico, Canada, and the US, we developed scenarios for amending the Midwestern US landscape with milkweed. Scenarios for milkweed restoration were developed for protected area grasslands, Conservation Reserve Program land, powerline, rail and roadside rights of way, urban/suburban lands, and land in agricultural production. Agricultural land was further divided into productive and marginal cropland. We elicited expert opinion as to the biological potential (in stems per acre) for lands in these individual sectors to support milkweed restoration and the likely adoption (probability) of management practices necessary for affecting restoration. Sixteen of 218 scenarios we developed for restoring milkweed to the Midwestern US were at levels (>1.3 billion new stems) necessary to reach the monarch population goal. One of these scenarios would convert all marginal agriculture to conserved status. The other 15 scenarios converted half of marginal agriculture (730 million stems), with remaining stems contributed by other societal sectors. Scenarios without substantive agricultural participation were insufficient for attaining the population goal. Agricultural lands are essential to reaching restoration targets because they occupy 77% of all potential monarch habitat. Barring fundamental changes to policy, innovative application of economic tools such as habitat exchanges may provide sufficient resources to tip the balance of the agro-ecological landscape toward a setting conducive to both robust agricultural production and reduced imperilment of the migratory monarch butterfly.
Safe Emergency Evacuation From Tall Structures
NASA Technical Reports Server (NTRS)
Stephan, E. S.
1984-01-01
Emergency egress system allows people to be evacuated quickly from tall structures. New emergency system applicable to rescues from fires in tall hotels and other buildings. System consists of basket on slide wire. Basket descends by gravity on sloped slide wire staked to ground.
What treatment for a child with tall stature?
Edouard, Thomas
2017-06-01
Tall stature is statistically defined as a height standard deviation score (SDS) above 2 for a given age, sex and population group. The most common cause of tall stature is constitutional (often familial) tall stature. However, underlying endocrine or genetic disorders must be considered as some of them may require specific treatment or management. In constitutional tall stature, healthy children are referred to discuss treatment aiming at reducing adult height. The indications of treatment are rare and usually discussed in girls with extremely tall stature (height SDS>4, corresponding to 185cm in girls). The treatment options for tall children are limited and concerns have been raised about their long-term safety. Indeed, recent studies have suggested that high-dose estrogens in adolescent girls may be associated with an increased risk of infertility, as well as increased risk of cancer. Surgical epiphysiodesis has also been reported to reduce adult height but this invasive procedure in healthy children can be questionable and further data on its safety profile are required. Copyright © 2017. Published by Elsevier Masson SAS.
Climate change and an invasive, tropical milkweed: an ecological trap for monarch butterflies.
Faldyn, Matthew J; Hunter, Mark D; Elderd, Bret D
2018-05-01
While it is well established that climate change affects species distributions and abundances, the impacts of climate change on species interactions has not been extensively studied. This is particularly important for specialists whose interactions are tightly linked, such as between the monarch butterfly (Danaus plexippus) and the plant genus Asclepias, on which it depends. We used open-top chambers (OTCs) to increase temperatures in experimental plots and placed either nonnative Asclepias curassavica or native A. incarnata in each plot along with monarch larvae. We found, under current climatic conditions, adult monarchs had higher survival and mass when feeding on A. curassavica. However, under future conditions, monarchs fared much worse on A. curassavica. The decrease in adult survival and mass was associated with increasing cardenolide concentrations under warmer temperatures. Increased temperatures alone reduced monarch forewing length. Cardenolide concentrations in A. curassavica may have transitioned from beneficial to detrimental as temperature increased. Thus, the increasing cardenolide concentrations may have pushed the larvae over a tipping point into an ecological trap; whereby past environmental cues associated with increased fitness give misleading information. Given the ubiquity of specialist plant-herbivore interactions, the potential for such ecological traps to emerge as temperatures increase may have far-reaching consequences. © 2018 by the Ecological Society of America.
Trends, Opportunities, and Challenges for Tall Wind Turbine and Tower Technologies
DOE Office of Scientific and Technical Information (OSTI.GOV)
Lantz, Eric; Roberts, Owen; Dykes, Katherine
This presentation summarizes recent analysis focused on characterizing the opportunity for Tall Wind technologies generally and for tall tower technologies specifically. It seeks to illuminate and explain the concept of Tall Wind, its impact on the wind industry to date, and the potential value of Tall Wind in the future. It also explores the conditions and locations under which the impacts of Tall Wind offer the most significant potential to increase wind technology performance. In addition, it seeks to examine the status of tall tower technology as a key sub-component of Tall Wind, focusing on the potential for continued innovationmore » in tubular steel wind turbine towers and the status and potential for a select set of alternative tall tower technologies.« less
Aardema, Matthew L.; Andolfatto, Peter
2016-01-01
Many distantly-related insect species are specialized feeders of cardenolide-containing host plants such as milkweed (Asclepias spp.). Studies have revealed frequent, parallel substitution of a functionally important amino acid substitution (N122H) in the alpha subunit of Na+,K+-ATPase (N122H) in many of these species. This substitution facilitates the ability of these insects to feed on their toxic hosts. Among milkweed butterflies of the genus Danaus, the previously established phylogeny for this group suggests that N122H arose independently and fixed in two distinct lineages. We re-evaluate this conclusion by examining Danaus phylogenetic relationships using >400 orthologous gene sequences assembled from transcriptome data. Our results indicate that the three Danaus species known to harbor the N122H substitution are more closely related than previously thought, consistent with a single, common origin for N122H. However, we also find evidence of both incomplete lineage sorting and post-speciation genetic exchange among these butterfly species, raising the possibility of collateral evolution of cardenolide-insensitivity in this species group. PMID:27405795
Komarnytsky, Slavko; Esposito, Debora; Rathinasabapathy, Thirumurugan; Poulev, Alexander; Raskin, Ilya
2013-01-01
Pregnane glycosides appear to modulate food intake by possibly affecting the hypothalamic feeding circuits; however, the mechanisms of the appetite-regulating effect of pregnane glycosides remain obscure. Here, we show that pregnane glycoside-enriched extracts from swamp milkweed Asclepias incarnata at 25–100 mg/kg daily attenuated food intake (up to 47.1 ± 8.5% less than controls) and body weight gain in rats (10% for males and 9% for females, respectively) by activating melanocortin signaling and inhibiting gastric emptying. The major milkweed pregnane glycoside, ikemagenin, exerted its appetite-regulating effect by decreasing levels of agouti-related protein (0.6-fold) but not NPY satiety peptides. Ikemagenin treatment also increased secretion of brain-derived neurotropic factor (BDNF) downstream of melanocortin receptors in the hypothalamus (1.4-fold) and in the C6 rat glioma cell culture in vitro (up to 6-fold). These results support the multimodal effects of pregnane glycosides on feeding regulation, which depends on the activity of the melanocortin signaling pathway and BDNF. PMID:23308358
USDA-ARS?s Scientific Manuscript database
In order to determine the degree of compatibility between Poly (lactic Acid) (PLA) and different biomaterials, PLA was compounded with milkweed fiber, a new crop oil seed. After oil extraction, the remaining cake retained approximately 10% residual oil and 47% protein. The pressed seed cake (10% mo...
Tall Fescue for the Twenty-first Century
USDA-ARS?s Scientific Manuscript database
Tall Fescue for the Twenty-first Century is a comprehensive monograph by experts from around the world about the science of tall fescue [Lolium arundinaceum (Schreb.) Darbysh. = Schedonorus arundinaceus (Schreb.) Dumort., formerly Fes¬tuca arundinacea Schreb. var. arundinacea] and its applications. ...
Investigation and management of tall stature.
Davies, Justin H; Cheetham, Tim
2014-08-01
Referral for an assessment of tall stature is much less common than for short stature. Although the commonest cause is an underlying familial tendency to tallness, there are important disorders that should be considered at the initial assessment. Distinguishing these conditions from normal variations of growth is the key objective when managing the child and family. In some children, further targeted investigations will be needed and in rare instances intervention to limit final height may be appropriate. This article discusses a structured approach to the assessment and management of a child with tall stature. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://group.bmj.com/group/rights-licensing/permissions.
USDA-ARS?s Scientific Manuscript database
Over the past two decades, the population of monarch butterflies east of the Rocky Mountains has experienced a significant decline. Habitat restoration within the summer breeding range is crucial to boost population numbers. Monarch butterfly larvae use milkweeds as their only host plant. However, l...
Laron, Zvi
2012-08-01
Constitutional tall stature can be anticipated from neonatal length (1) and measurement at age 4 and 8 years (2). Mainly of genetic origin (3) it has been shown that tall children and parents have high normal or higher than normal serum hGH and/or IGF-I levels. (4-6). Also in a healthy adult population a significant (p<0.005) association between height and serum IGF-I has been reported (7). These within normal variations in "healthy" individuals should be distinguished from "gigantism" due to excessive GHR-H or hGH secretion (8, 9) and other pathological conditions leading to tall stature (3).
Tall girls: the social shaping of a medical therapy.
Lee, Joyce M; Howell, Joel D
2006-10-01
During the latter half of the 20th century, estrogen therapy was administered to prevent otherwise healthy girls with tall stature from becoming tall adults by inhibiting further linear growth. We explore how decisions to treat tall girls with estrogen were influenced by both scientific knowledge and sociologic norms. Estrogen therapy represented the logical application of scientific knowledge regarding the role of estrogen for closure of the growth plates, but it also reflected prevailing societal and political beliefs about what it meant to be a tall girl. We discuss the rise and fall in popularity of this therapy and suggest that insight into the present-day treatment of short stature can be gained by comparing the use of estrogen therapy for tall girls with the use of growth hormone therapy for short boys. We suggest that this case study illustrates how scientific knowledge is always created and applied within a particular social context.
Los Angeles Tall Buildings Structural Design Council
Los Angeles Tall Buildings Structural Design Council Home News Archives Members Mailing Address LATBSDC c/o John A. Martin & Associates 950 South Grand Ave 4th Floor Los Angeles, CA 90015, USA Phone (213) 483-6490 Fax (213) 483-3084 Welcome Welcome to the Los Angeles Tall Buildings Structural Design
8,12;8,20-Diepoxy-8,14-secopregnane glycosides from the aerial parts of Asclepias tuberosa.
Warashina, Tsutomu; Noro, Tadataka
2010-02-01
Further study of constituents from the aerial parts of Asclepias tuberosa afforded twenty-two new steroidal glycosides along with tuberoside B(5) and G(5). These glycosides were confirmed to contain 8,12;8,20-diepoxy-8,14-secopregnanes, tuberogenin and its congeners, as their aglycones. The structure of each of these compounds was elucidated based on the interpretation of NMR and MS measurements and from chemical evidence.
Tall Fescue Alkaloids Bind Serotonin Receptors in Cattle
USDA-ARS?s Scientific Manuscript database
The serotonin (5HT) receptor 5HT2A is involved in the tall fescue alkaloid-induced vascular contraction in the bovine periphery. This was determined by evaluating the contractile responses of lateral saphenous veins biopsied from cattle grazing different tall fescue/endophyte combinations. The contr...
Coconut genome size determined by flow cytometry: Tall versus Dwarf types.
Freitas Neto, M; Pereira, T N S; Geronimo, I G C; Azevedo, A O N; Ramos, S R R; Pereira, M G
2016-02-11
Coconuts (Cocos nucifera L.) are tropical palm trees that are classified into Tall and Dwarf types based on height, and both types are diploid (2n = 2x = 32 chromosomes). The reproduction mode is autogamous for Dwarf types and allogamous for Tall types. One hypothesis for the origin of the Dwarf coconut suggests that it is a Tall variant that resulted from either mutation or inbreeding, and differences in genome size between the two types would support this hypothesis. In this study, we estimated the genome sizes of 14 coconut accessions (eight Tall and six Dwarf types) using flow cytometry. Nuclei were extracted from leaf discs and stained with propidium iodide, and Pisum sativum (2C = 9.07 pg DNA) was used as an internal standard. Histograms with good resolution and low coefficients of variation (2.5 to 3.2%) were obtained. The 2C DNA content ranged from 5.72 to 5.48 pg for Tall accessions and from 5.58 to 5.52 pg for Dwarf accessions. The mean genome sizes for Tall and Dwarf specimens were 5.59 and 5.55 pg, respectively. Among all accessions, Rennel Island Tall had the highest mean DNA content (5.72 pg), whereas West African Tall had the lowest (5.48 pg). The mean coconut genome size (2C = 5.57 pg, corresponding to 2723.73 Mbp/haploid set) was classified as small. Only small differences in genome size existed among the coconut accessions, suggesting that the Dwarf type did not evolve from the Tall type.
Water potential gradient in a tall sequoiadendron.
Tobiessen, P
1971-09-01
With an elevator installed in a 90-meter tall Sequoiadendron to collect the samples, xylem pressure potential measurements were made approximately every 15 meters along 60 meters of the tree's height. The measured gradient was about -0.8 bar per 10 meters of height, i.e., less than the hydrostatic gradient. Correction of the xylem pressure potential data by calibration against a thermocouple psychrometer confirmed this result. Similar gradients are described in the literature in tall conifers at times of low transpiration, although a different sampling technique was used. If the data in the present study and those supporting it are typical, they imply a re-evaluation of either the use of the pressure chamber to estimate water potential or the present theories describing water transport in tall trees.
Water Potential Gradient in a Tall Sequoiadendron
Tobiessen, Peter; Rundel, Philip W.; Stecker, R. E.
1971-01-01
With an elevator installed in a 90-meter tall Sequoiadendron to collect the samples, xylem pressure potential measurements were made approximately every 15 meters along 60 meters of the tree's height. The measured gradient was about −0.8 bar per 10 meters of height, i.e., less than the hydrostatic gradient. Correction of the xylem pressure potential data by calibration against a thermocouple psychrometer confirmed this result. Similar gradients are described in the literature in tall conifers at times of low transpiration, although a different sampling technique was used. If the data in the present study and those supporting it are typical, they imply a re-evaluation of either the use of the pressure chamber to estimate water potential or the present theories describing water transport in tall trees. PMID:16657786
Density estimates of monarch butterflies overwintering in central Mexico
Diffendorfer, Jay E.; López-Hoffman, Laura; Oberhauser, Karen; Pleasants, John; Semmens, Brice X.; Semmens, Darius; Taylor, Orley R.; Wiederholt, Ruscena
2017-01-01
Given the rapid population decline and recent petition for listing of the monarch butterfly (Danaus plexippus L.) under the Endangered Species Act, an accurate estimate of the Eastern, migratory population size is needed. Because of difficulty in counting individual monarchs, the number of hectares occupied by monarchs in the overwintering area is commonly used as a proxy for population size, which is then multiplied by the density of individuals per hectare to estimate population size. There is, however, considerable variation in published estimates of overwintering density, ranging from 6.9–60.9 million ha−1. We develop a probability distribution for overwinter density of monarch butterflies from six published density estimates. The mean density among the mixture of the six published estimates was ∼27.9 million butterflies ha−1 (95% CI [2.4–80.7] million ha−1); the mixture distribution is approximately log-normal, and as such is better represented by the median (21.1 million butterflies ha−1). Based upon assumptions regarding the number of milkweed needed to support monarchs, the amount of milkweed (Asclepias spp.) lost (0.86 billion stems) in the northern US plus the amount of milkweed remaining (1.34 billion stems), we estimate >1.8 billion stems is needed to return monarchs to an average population size of 6 ha. Considerable uncertainty exists in this required amount of milkweed because of the considerable uncertainty occurring in overwinter density estimates. Nevertheless, the estimate is on the same order as other published estimates. The studies included in our synthesis differ substantially by year, location, method, and measures of precision. A better understanding of the factors influencing overwintering density across space and time would be valuable for increasing the precision of conservation recommendations. PMID:28462031
Density estimates of monarch butterflies overwintering in central Mexico
Thogmartin, Wayne E.; Diffendorfer, James E.; Lopez-Hoffman, Laura; Oberhauser, Karen; Pleasants, John M.; Semmens, Brice X.; Semmens, Darius J.; Taylor, Orley R.; Wiederholt, Ruscena
2017-01-01
Given the rapid population decline and recent petition for listing of the monarch butterfly (Danaus plexippus L.) under the Endangered Species Act, an accurate estimate of the Eastern, migratory population size is needed. Because of difficulty in counting individual monarchs, the number of hectares occupied by monarchs in the overwintering area is commonly used as a proxy for population size, which is then multiplied by the density of individuals per hectare to estimate population size. There is, however, considerable variation in published estimates of overwintering density, ranging from 6.9–60.9 million ha−1. We develop a probability distribution for overwinter density of monarch butterflies from six published density estimates. The mean density among the mixture of the six published estimates was ∼27.9 million butterflies ha−1 (95% CI [2.4–80.7] million ha−1); the mixture distribution is approximately log-normal, and as such is better represented by the median (21.1 million butterflies ha−1). Based upon assumptions regarding the number of milkweed needed to support monarchs, the amount of milkweed (Asclepias spp.) lost (0.86 billion stems) in the northern US plus the amount of milkweed remaining (1.34 billion stems), we estimate >1.8 billion stems is needed to return monarchs to an average population size of 6 ha. Considerable uncertainty exists in this required amount of milkweed because of the considerable uncertainty occurring in overwinter density estimates. Nevertheless, the estimate is on the same order as other published estimates. The studies included in our synthesis differ substantially by year, location, method, and measures of precision. A better understanding of the factors influencing overwintering density across space and time would be valuable for increasing the precision of conservation recommendations.
Aardema, Matthew L; Andolfatto, Peter
2016-08-01
Many distantly related insect species are specialized feeders of cardenolide-containing host plants such as milkweed (Asclepias spp.). Previous studies have revealed frequent, parallel substitution of a functionally important amino acid substitution (N122H) in the alpha subunit of Na(+) ,K(+) -ATPase in a number of these species. This substitution facilitates the ability of these insects to feed on their toxic hosts and sequester cardenolides for their own use in defense. Among milkweed butterflies of the genus Danaus, the previously established phylogeny for this group suggests that N122H arose independently and fixed in two distinct lineages. We reevaluate this conclusion by examining Danaus phylogenetic relationships using >400 orthologous gene sequences assembled from transcriptome data. Our results indicate that the three Danaus species known to harbor the N122H substitution are more closely related than previously thought, consistent with a single, common origin for N122H. However, we also find evidence of both incomplete lineage sorting and post-speciation genetic exchange among these butterfly species, raising the possibility of collateral evolution of cardenolide-insensitivity in this species group. © 2016 The Author(s). Evolution © 2016 The Society for the Study of Evolution.
Kareiva, Peter; Morse, Douglass H; Eccleston, Jill
1989-03-01
We compared the patch-choice performances of an ambush predator, the crab spider Misumena vatia (Thomisidae) hunting on common milkweed Asclepias syriaca (Asclepiadaceae) umbles, with two stochastic rule-of-thumb simulation models: one that employed a threshold giving-up time and one that assumed a fixed probability of moving. Adult female Misumena were placed on milkweed plants with three umbels, each with markedly different numbers of flower-seeking prey. Using a variety of visitation regimes derived from observed visitation patterns of insect prey, we found that decreases in among-umbel variance in visitation rates or increases in overall mean visitation rates reduced the "clarity of the optimum" (the difference in the yield obtained as foraging behavior changes), both locally and globally. Yield profiles from both models were extremely flat or jagged over a wide range of prey visitation regimes; thus, differences between optimal and "next-best" strategies differed only modestly over large parts of the "foraging landscape". Although optimal yields from fixed probability simulations were one-third to one-half those obtained from threshold simulations, spiders appear to depart umbels in accordance with the fixed probability rule.
Synthesis of Polyformate Esters of Vegetable Oils: Milkweed, Pennycress, and Soy
Harry-O'kuru, Rogers E.; Biresaw, Girma; Tisserat, Brent; Evangelista, Roque
2016-01-01
In a previous study of the characteristics of acyl derivatives of polyhydroxy milkweed oil (PHMWO), it was observed that the densities and viscosities of the respective derivatives decreased with increased chain length of the substituent acyl group. Thus from the polyhydroxy starting material, attenuation in viscosity of the derivatives relative to PHMWO was found in the order: PHMWO ≫ PAcMWE ≫ PBuMWE ≫ PPMWE (2332 : 1733 : 926.2 : 489.4 cSt, resp., at 40°C), where PAcMWE, PBuMWE, and PPMWE were the polyacetyl, polybutyroyl, and polypentanoyl ester derivatives, respectively. In an analogous manner, the densities also decreased as the chain length increased although not as precipitously compared to the viscosity drop. By inference, derivatives of vegetable oils with short chain length substituents on the triglyceride would be attractive in lubricant applications in view of their higher densities and possibly higher viscosity indices. Pursuant to this, we have explored the syntheses of formyl esters of three vegetable oils in order to examine the optimal density, viscosity, and related physical characteristics in relation to their suitability as lubricant candidates. In the absence of ready availability of formic anhydride, we opted to employ the epoxidized vegetable oils as substrates for formyl ester generation using glacial formic acid. The epoxy ring-opening process was smooth but was apparently followed by a simultaneous condensation reaction of the putative α-hydroxy formyl intermediate to yield vicinal diformyl esters from the oxirane. All three polyformyl esters milkweed, soy, and pennycress derivatives exhibited low coefficient of friction and a correspondingly much lower wear scar in the 4-ball antiwear test compared to the longer chain acyl analogues earlier studied. PMID:26955488
Synthesis of Polyformate Esters of Vegetable Oils: Milkweed, Pennycress, and Soy.
Harry-O'kuru, Rogers E; Biresaw, Girma; Tisserat, Brent; Evangelista, Roque
2016-01-01
In a previous study of the characteristics of acyl derivatives of polyhydroxy milkweed oil (PHMWO), it was observed that the densities and viscosities of the respective derivatives decreased with increased chain length of the substituent acyl group. Thus from the polyhydroxy starting material, attenuation in viscosity of the derivatives relative to PHMWO was found in the order: PHMWO ≫ PAcMWE ≫ PBuMWE ≫ PPMWE (2332 : 1733 : 926.2 : 489.4 cSt, resp., at 40°C), where PAcMWE, PBuMWE, and PPMWE were the polyacetyl, polybutyroyl, and polypentanoyl ester derivatives, respectively. In an analogous manner, the densities also decreased as the chain length increased although not as precipitously compared to the viscosity drop. By inference, derivatives of vegetable oils with short chain length substituents on the triglyceride would be attractive in lubricant applications in view of their higher densities and possibly higher viscosity indices. Pursuant to this, we have explored the syntheses of formyl esters of three vegetable oils in order to examine the optimal density, viscosity, and related physical characteristics in relation to their suitability as lubricant candidates. In the absence of ready availability of formic anhydride, we opted to employ the epoxidized vegetable oils as substrates for formyl ester generation using glacial formic acid. The epoxy ring-opening process was smooth but was apparently followed by a simultaneous condensation reaction of the putative α-hydroxy formyl intermediate to yield vicinal diformyl esters from the oxirane. All three polyformyl esters milkweed, soy, and pennycress derivatives exhibited low coefficient of friction and a correspondingly much lower wear scar in the 4-ball antiwear test compared to the longer chain acyl analogues earlier studied.
Typological diversity of tall buildings and complexes in relation to their functional structure
NASA Astrophysics Data System (ADS)
Generalov, Viktor P.; Generalova, Elena M.; Kalinkina, Nadezhda A.; Zhdanova, Irina V.
2018-03-01
The paper focuses on peculiarities of tall buildings and complexes, their typology and its formation in relation to their functional structure. The research is based on the analysis of tall buildings and complexes and identifies the following main functional elements of their formation: residential, administrative (office), hotel elements. The paper also considers the following services as «disseminated» in the space-planning structure: shops, medicine, entertainment, kids and sports facilities, etc., their location in the structure of the total bulk of the building and their impact on typological diversity. Research results include suggestions to add such concepts as «single-function tall buildings» and «mixed-use tall buildings and complexes» into the classification of tall buildings. In addition, if a single-function building or complex performs serving functions, it is proposed to add such concepts as «a residential tall building (complex) with provision of services», «an administrative (public) tall building (complex) with provision of services» into the classification of tall buildings. For mixed-use buildings and complexes the following terms are suggested: «a mixed-use tall building with provision of services», «a mixed-use tall complex with provision of services».
Larger than Life: Reading and Writing Tall Tales
ERIC Educational Resources Information Center
Tunks, Karyn
2008-01-01
The genre of tall tales is characterized by fictional, often intentionally ridiculous, stories that provide a reason for or origin of a natural phenomenon. Tall tales are often based on characters who are unusually adept or powerful; they are particularly appealing to children who are cognitively capable of understanding the tongue-in-cheek humor…
Registration and Release of Syn1RR tall fescue
USDA-ARS?s Scientific Manuscript database
The Agricultural Research Service of the United States DepaRRment of Agriculture announces the release of the new tall fescue [Festuca arundinacea (syn., Lolium arundinaceum Darbyshire; Schedonorus phoenix (Scop.) Holub)] cultivar Syn1RR. Syn1RR is a rust tolerant tall fescue cultivar that exhibits...
Inheritance of ozone resistance in tall fescue
DOE Office of Scientific and Technical Information (OSTI.GOV)
Johnston, W.J.; Haaland, R.L.; Dickens, R.
Ozone is considered the most important air pollutant affecting vegetation. With progressive urbanization, ozone levels have steadily escalated. Reports suggest that ozone tolerance is a highly heritable characteristic and that the selection of resistant plants and breeding for ozone resistance should be possible. This study was undertaken to gain information on the inheritance of ozone resistance in tall fescue (Festuca arundinacea Schreb.).Progenies from a diallel among six tall fescue genotypes of diverse origin were evaluated for ozone resistance in a fumigation-chamber. Sixteen-day-old seedlings were exposed to 0.5 ppm ozone for 3 hours and scored for injury after 3 days. Generalmore » combining ability (GCA) and reciprocal effects were both highly significant; however, GCA constituted a major portion of the genotypic variation. Specific combining ability was not significant. The predominance of additive genetic variance observed indicates that breeding for ozone resistance in this tall fescue population should be possible.« less
Evidence for adaptive radiation from a phylogenetic study of plant defenses
Agrawal, Anurag A.; Fishbein, Mark; Halitschke, Rayko; Hastings, Amy P.; Rabosky, Daniel L.; Rasmann, Sergio
2009-01-01
One signature of adaptive radiation is a high level of trait change early during the diversification process and a plateau toward the end of the radiation. Although the study of the tempo of evolution has historically been the domain of paleontologists, recently developed phylogenetic tools allow for the rigorous examination of trait evolution in a tremendous diversity of organisms. Enemy-driven adaptive radiation was a key prediction of Ehrlich and Raven's coevolutionary hypothesis [Ehrlich PR, Raven PH (1964) Evolution 18:586–608], yet has remained largely untested. Here we examine patterns of trait evolution in 51 North American milkweed species (Asclepias), using maximum likelihood methods. We study 7 traits of the milkweeds, ranging from seed size and foliar physiological traits to defense traits (cardenolides, latex, and trichomes) previously shown to impact herbivores, including the monarch butterfly. We compare the fit of simple random-walk models of trait evolution to models that incorporate stabilizing selection (Ornstein-Ulenbeck process), as well as time-varying rates of trait evolution. Early bursts of trait evolution were implicated for 2 traits, while stabilizing selection was implicated for several others. We further modeled the relationship between trait change and species diversification while allowing rates of trait evolution to vary during the radiation. Species-rich lineages underwent a proportionately greater decline in latex and cardenolides relative to species-poor lineages, and the rate of trait change was most rapid early in the radiation. An interpretation of this result is that reduced investment in defensive traits accelerated diversification, and disproportionately so, early in the adaptive radiation of milkweeds. PMID:19805160
Wood-derived olefins by steam cracking of hydrodeoxygenated tall oils.
Pyl, Steven P; Dijkmans, Thomas; Antonykutty, Jinto M; Reyniers, Marie-Françoise; Harlin, Ali; Van Geem, Kevin M; Marin, Guy B
2012-12-01
Tall oil fractions obtained from Norwegian spruce pulping were hydrodeoxygenated (HDO) at pilot scale using a commercial NiMo hydrotreating catalyst. Comprehensive two dimensional gas chromatography (GC×GC) showed that HDO of both tall oil fatty acids (TOFA) and distilled tall oil (DTO) produced highly paraffinic hydrocarbon liquids. The hydrotreated fractions also contained fatty acid methyl esters and norabietane and norabietatriene isomers. Steam cracking of HDO-TOFA in a pilot plant revealed that high light olefin yields can be obtained, with 35.4 wt.% of ethene and 18.2 wt.% of propene at a coil outlet pressure (COP) of 1.7 bara, a dilution of 0.45 kg(steam)/kg(HDO-TOFA) and a coil outlet temperature (COT) of 820 °C. A pilot plant coking experiment indicated that cracking of HDO-TOFA at a COT of 850 °C results in limited fouling in the reactor. Co-cracking of HDO tall oil fractions with a typical fossil-based naphtha showed improved selectivity to desired light olefins, further demonstrating the potential of large scale olefin production from hydrotreated tall oil fractions in conventional crackers. Copyright © 2012 Elsevier Ltd. All rights reserved.
Severe B cell hyperplasia and autoimmune disease in TALL-1 transgenic mice
Khare, Sanjay D.; Sarosi, Ildiko; Xia, Xing-Zhong; McCabe, Susan; Miner, Kent; Solovyev, Irina; Hawkins, Nessa; Kelley, Michael; Chang, David; Van, Gwyneth; Ross, Larry; Delaney, John; Wang, Ling; Lacey, David; Boyle, William J.; Hsu, Hailing
2000-01-01
TALL-1/Blys/BAFF is a member of the tumor necrosis factor (TNF) ligand superfamily that is functionally involved in B cell proliferation. Here, we describe B cell hyperplasia and autoimmune lupus-like changes in transgenic mice expressing TALL-1 under the control of a β-actin promoter. The TALL-1 transgenic mice showed severe enlargement of spleen, lymph nodes, and Peyer's patches because of an increased number of B220+ cells. The transgenic mice also had hypergammaglobulinemia contributed by elevations of serum IgM, IgG, IgA, and IgE. In addition, a phenotype similar to autoimmune lupus-like disease was also seen in TALL-1 transgenic mice, characterized by the presence of autoantibodies to nuclear antigens and immune complex deposits in the kidney. Prolonged survival and hyperactivity of transgenic B cells may contribute to the autoimmune lupus-like phenotype in these animals. Our studies further confirm TALL-1 as a stimulator of B cells that affect Ig production. Thus, TALL-1 may be a primary mediator in B cell-associated autoimmune diseases. PMID:10716715
21 CFR 172.862 - Oleic acid derived from tall oil fatty acids.
Code of Federal Regulations, 2010 CFR
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Oleic acid derived from tall oil fatty acids. 172... FOOD FOR HUMAN CONSUMPTION Multipurpose Additives § 172.862 Oleic acid derived from tall oil fatty acids. The food additive oleic acid derived from tall oil fatty acids may be safely used in food and as...
21 CFR 172.862 - Oleic acid derived from tall oil fatty acids.
Code of Federal Regulations, 2011 CFR
2011-04-01
... 21 Food and Drugs 3 2011-04-01 2011-04-01 false Oleic acid derived from tall oil fatty acids. 172... FOOD FOR HUMAN CONSUMPTION Multipurpose Additives § 172.862 Oleic acid derived from tall oil fatty acids. The food additive oleic acid derived from tall oil fatty acids may be safely used in food and as...
Nonlinear behaviors of FRP-wrapped tall trees subjected to high wind loads
NASA Astrophysics Data System (ADS)
Kang, J.; Yi, Z. Z.; Choi, S. G.
2017-12-01
This study investigated the mechanical stability of historical tall trees wrapped with fiber-reinforced polymer (FRP) laminates using finite element (FE) analysis. High wind loads are considered as external loading conditions as they are one of the major threats on the structural stability of tall old trees. There have been several traditional practices to enhance the stability of tall trees exposed to high windstorms such as tree supporters and anchorages. They, however, have been sometimes causing negative effects with their misuses as the application guidelines for those methods were not adequately studied or documented. Furthermore, the oldest known trees in the country should be protected from the damage of external surface as well as ruin of the landscape. The objective of this study was to evaluate the structural effects of FRP wraps applied to tall trees subjected to high wind loads. The anisotropic material properties of wood and FRP laminates were considered in the analysis in addition to geometrically nonlinear behaviors. This study revealed that FRP wrapping for tall trees could effectively reduce the deflections and maximum stresses of trees, which results in the enhanced stability of tall trees. The optimum geometry and thicknesses of FRP wraps proposed in this study would provide fundemental guidelines for designing and constructing the application of innovative FRP wraps on tall trees, which are structurally unstable or should be preserved nationally and historically.
Scalar Fluxes Near a Tall Building in an Aligned Array of Rectangular Buildings
NASA Astrophysics Data System (ADS)
Fuka, Vladimír; Xie, Zheng-Tong; Castro, Ian P.; Hayden, Paul; Carpentieri, Matteo; Robins, Alan G.
2018-04-01
Scalar dispersion from ground-level sources in arrays of buildings is investigated using wind-tunnel measurements and large-eddy simulation (LES). An array of uniform-height buildings of equal dimensions and an array with an additional single tall building (wind tunnel) or a periodically repeated tall building (LES) are considered. The buildings in the array are aligned and form long streets. The sensitivity of the dispersion pattern to small changes in wind direction is demonstrated. Vertical scalar fluxes are decomposed into the advective and turbulent parts and the influences of wind direction and of the presence of the tall building on the scalar flux components are evaluated. In the uniform-height array turbulent scalar fluxes are dominant, whereas the tall building produces an increase of the magnitude of advective scalar fluxes that yields the largest component. The presence of the tall building causes either an increase or a decrease to the total vertical scalar flux depending on the position of the source with respect to the tall building. The results of the simulations can be used to develop parametrizations for street-canyon dispersion models and enhance their capabilities in areas with tall buildings.
Decay resistance of wood treated with boric acid and tall oil derivates.
Temiz, Ali; Alfredsen, Gry; Eikenes, Morten; Terziev, Nasko
2008-05-01
In this study, the effect of two boric acid concentrations (1% and 2%) and four derivates of tall oil with varying chemical composition were tested separately and in combination. The tall oil derivates were chosen in a way that they consist of different amounts of free fatty, resin acids and neutral compounds. Decay tests using two brown rot fungi (Postia placenta and Coniophora puteana) were performed on both unleached and leached test samples. Boric acid showed a low weight loss in test samples when exposed to fungal decay before leaching, but no effect after leaching. The tall oil derivates gave better efficacy against decay fungi compared to control, but are not within the range of the efficacy needed for a wood preservative. Double impregnation with boric acid and tall oil derivates gave synergistic effects for several of the double treatments both in unleached and leached samples. In the unleached samples the double treatment gave a better efficacy against decay fungi than tall oil alone. In leached samples a better efficacy against brown rot fungi were achieved than in samples with boron alone and a nearly similar or better efficacy than for tall oil alone. Boric acid at 2% concentration combined with the tall oil derivate consisting of 90% free resin acids (TO-III) showed the best performance against the two decay fungi with a weight loss less than 3% after a modified pure culture test.
Urban Rights-of-Way as Reservoirs for Tall-Grass Prairie Plants and Butterflies
NASA Astrophysics Data System (ADS)
Leston, Lionel; Koper, Nicola
2016-03-01
Urban rights-of-way may be potential reservoirs of tall-grass prairie plants and butterflies. To determine if this is true, in 2007-2008, we conducted vegetation surveys of species richness and cover, and butterfly surveys of species richness and abundance, along 52 transmission lines and four remnant prairies in Winnipeg, Manitoba. We detected many prairie plants and butterflies within transmission lines. Some unmowed and infrequently managed transmission lines had native plant species richness and total percent cover of native plants comparable to that of similar-sized remnant tall-grass prairies in the region. Although we did not find significant differences in overall native butterfly numbers or species richness between rights-of-way and remnant prairies, we found lower numbers of some prairie butterflies along frequently mowed rights-of-way than within remnant tall-grass prairies. We also observed higher butterfly species richness along sites with more native plant species. By reducing mowing and spraying and reintroducing tall-grass prairie plants, urban rights-of-way could serve as extensive reservoirs for tall-grass prairie plants and butterflies in urban landscapes. Eventually, managing urban rights-of-way as reservoirs for tall-grass prairie plants and animals could contribute to the restoration of tall-grass prairie in the North American Midwest.
Urban Rights-of-Way as Reservoirs for Tall-Grass Prairie Plants and Butterflies.
Leston, Lionel; Koper, Nicola
2016-03-01
Urban rights-of-way may be potential reservoirs of tall-grass prairie plants and butterflies. To determine if this is true, in 2007-2008, we conducted vegetation surveys of species richness and cover, and butterfly surveys of species richness and abundance, along 52 transmission lines and four remnant prairies in Winnipeg, Manitoba. We detected many prairie plants and butterflies within transmission lines. Some unmowed and infrequently managed transmission lines had native plant species richness and total percent cover of native plants comparable to that of similar-sized remnant tall-grass prairies in the region. Although we did not find significant differences in overall native butterfly numbers or species richness between rights-of-way and remnant prairies, we found lower numbers of some prairie butterflies along frequently mowed rights-of-way than within remnant tall-grass prairies. We also observed higher butterfly species richness along sites with more native plant species. By reducing mowing and spraying and reintroducing tall-grass prairie plants, urban rights-of-way could serve as extensive reservoirs for tall-grass prairie plants and butterflies in urban landscapes. Eventually, managing urban rights-of-way as reservoirs for tall-grass prairie plants and animals could contribute to the restoration of tall-grass prairie in the North American Midwest.
Therapeutic targeting of NOTCH1 signaling in T-ALL
Palomero, Teresa; Ferrando, Adolfo
2010-01-01
The recent identification of activating mutations in NOTCH1 in the majority of T-cell acute lymphoblastic leukemias (T-ALL) has brought major interest towards targeting the NOTCH signaling pathway in this disease. Small molecule γ-secretase inhibitors (GSIs) which block a critical proteolytic step required for NOTCH1 activation can effectively block the activity of NOTCH1 mutant alleles. However, the clinical development of GSIs has been hampered by their low cytotoxicity against human T-ALL and the development of significant gastrointestinal toxicity derived from inhibition of NOTCH signaling in the gut. Improved understanding of the oncogenic mechanisms of NOTCH1 and the effects of NOTCH inhibition in leukemic cells and the intestinal epithelium are required for the design of effective anti-NOTCH1 therapies in T-ALL. PMID:19778842
Alternative fuel properties of tall oil fatty acid methyl ester-diesel fuel blends.
Altiparmak, Duran; Keskin, Ali; Koca, Atilla; Gürü, Metin
2007-01-01
In this experimental work, tall oil methyl ester-diesel fuel blends as alternative fuels for diesel engines were studied. Tall oil methyl ester was produced by reacting tall oil fatty acids with methyl alcohol under optimum conditions. The blends of tall oil methyl ester-diesel fuel were tested in a direct injection diesel engine at full load condition. The effects of the new fuel blends on the engine performance and exhaust emission were tested. It was observed that the engine torque and power output with tall oil methyl ester-diesel fuel blends increased up to 6.1% and 5.9%, respectively. It was also seen that CO emissions decreased to 38.9% and NO(x) emissions increased up to 30% with the new fuel blends. The smoke opacity did not vary significantly.
Feeding soyhulls on toxic tall fescue is option for stockers
USDA-ARS?s Scientific Manuscript database
Poor weight gain and thriftiness of wean beef calves on toxic endophyte-infected tall fescue has resulted in most the 15 million hectares of tall fescue in the USA to be utilized for cow-calf and not stocker production. An article was written that discusses results of a grazing experiment with toxi...
Element accumulation in tall fescue and alfalfa
DOE Office of Scientific and Technical Information (OSTI.GOV)
Stucky, D.J.; Newman, T.S.
This study was initiated to examine the effect of three application rates of dried anaerobically digested sludge on two different soil media on the establishment, yield, duration, and element accumulation in tall fescue and alfalfa. In a greenhouse study, acid strip-mine spoil and agricultural soil were used to compare plant growth in sewage-amended and untreated media. Sludge was applied at 0, 314, and 627 metric tons/hectare to the agricultural soil control and the strip mine spoil. Plant yields were significantly higher for strip-mine spoil amended with 627 metric tons/ha and for agricultural soil amended with 314 and 627 metric tons/ha.more » Concentrations of Mn, Ni, Cd, Zn, and Cu were measured in plants and soils. Concentrations of Mn, Zn, Ni, and Cd in tall fescue and alfalfa grown in strip-mine spoils were higher at higher sludge application rates. Sludge application rate did not affect Cu uptake. Concentrations of Mn, Zn, Ni, and Cd in tall fescue were highest during the 180 toese is the fluctuation in nutrient salt concentrations:agreement of experimental and calculated data is obtton beam.« less
Modeling Manpower and Equipment Productivity in Tall Building Construction Projects
NASA Astrophysics Data System (ADS)
Mudumbai Krishnaswamy, Parthasarathy; Rajiah, Murugasan; Vasan, Ramya
2017-12-01
Tall building construction projects involve two critical resources of manpower and equipment. Their usage, however, widely varies due to several factors affecting their productivity. Currently, no systematic study for estimating and increasing their productivity is available. What is prevalent is the use of empirical data, experience of similar projects and assumptions. As tall building projects are here to stay and increase, to meet the emerging demands in ever shrinking urban spaces, it is imperative to explore ways and means of scientific productivity models for basic construction activities: concrete, reinforcement, formwork, block work and plastering for the input of specific resources in a mixed environment of manpower and equipment usage. Data pertaining to 72 tall building projects in India were collected and analyzed. Then, suitable productivity estimation models were developed using multiple linear regression analysis and validated using independent field data. It is hoped that the models developed in the study will be useful for quantity surveyors, cost engineers and project managers to estimate productivity of resources in tall building projects.
Synergistic antileukemic therapies in NOTCH1-induced T-ALL
Sanchez-Martin, Marta; Ambesi-Impiombato, Alberto; Qin, Yue; Herranz, Daniel; Bansal, Mukesh; Girardi, Tiziana; Paietta, Elisabeth; Tallman, Martin S.; Rowe, Jacob M.; Califano, Andrea; Ferrando, Adolfo A.
2017-01-01
The Notch1 gene is a major oncogenic driver and therapeutic target in T-cell acute lymphoblastic leukemia (T-ALL). However, inhibition of NOTCH signaling with γ-secretase inhibitors (GSIs) has shown limited antileukemic activity in clinical trials. Here we performed an expression-based virtual screening to identify highly active antileukemic drugs that synergize with NOTCH1 inhibition in T-ALL. Among these, withaferin A demonstrated the strongest cytotoxic and GSI-synergistic antileukemic effects in vitro and in vivo. Mechanistically, network perturbation analyses showed eIF2A-phosphorylation–mediated inhibition of protein translation as a critical mediator of the antileukemic effects of withaferin A and its interaction with NOTCH1 inhibition. Overall, these results support a role for anti-NOTCH1 therapies and protein translation inhibitor combinations in the treatment of T-ALL. PMID:28174276
77 FR 19534 - Special Local Regulations; Savannah Tall Ships Challenge, Savannah River, Savannah, GA
Federal Register 2010, 2011, 2012, 2013, 2014
2012-04-02
...-AA08 Special Local Regulations; Savannah Tall Ships Challenge, Savannah River, Savannah, GA AGENCY... regulations on the Savannah River in Savannah, Georgia during the Savannah Tall Ships Challenge. The Savannah Tall Ships Challenge will take place from Thursday, May 3, 2012 through Monday, May 7, 2012...
Tall fescue management: Pasture and cattle responses to endophyte and fertilization
USDA-ARS?s Scientific Manuscript database
Yearling heifers grazing tall fescue pastures had greatest performance in winter and spring on endophyte-free and novel endophyte associations, because of high forage quality and lack of ergot alkaloids produced by a common “wild” tall fescue-endophyte association. Pasture and cattle responses were...
Endophyte-infected tall fescue seed extract induces constriction of bovine vasculature
USDA-ARS?s Scientific Manuscript database
Ergovaline (ERV) has been extensively used to study vasoactive effects of endophyte (Neotyphodium coenophialum) infected tall fescue (Lolium arundinaceum). However preliminary in vitro tests show that an extract of toxic tall fescue seed (E+EXT) is more potent than ERV alone indicating other compoun...
Wen, Chao; Huang, Wei; Zhu, Xue-Lin; Li, Xiao-San; Zhang, Fan; Jiang, Ren-Wang
2018-02-02
A permissive steroid glycosyltransferase (UGT74AN1) from Asclepias curassavica exhibited robust capabilities for the regiospecific C3 glycosylation of cardiotonic steroids and C 21 steroid precursors, and unprecedented promiscuity toward 53 structurally diverse natural and unnatural compounds to form O-, N-, and S-glycosides, along with the catalytic reversibility for a one-pot transglycosylation reaction. These findings highlight UGT74AN1 as the first regiospecific catalyst for cardiotonic steroid C3 glycosylation and exhibit significant potential for glycosylation of diverse bioactive molecules in drug discovery.
40 CFR 721.9460 - Tall oil fatty acids, reaction products with polyamines, alkyl substituted.
Code of Federal Regulations, 2010 CFR
2010-07-01
... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Tall oil fatty acids, reaction... SUBSTANCES Significant New Uses for Specific Chemical Substances § 721.9460 Tall oil fatty acids, reaction... reporting. (1) The chemical substance identified generically as tall oil fatty acids, reaction products with...
40 CFR 721.9460 - Tall oil fatty acids, reaction products with polyamines, alkyl substituted.
Code of Federal Regulations, 2011 CFR
2011-07-01
... 40 Protection of Environment 31 2011-07-01 2011-07-01 false Tall oil fatty acids, reaction... SUBSTANCES Significant New Uses for Specific Chemical Substances § 721.9460 Tall oil fatty acids, reaction... reporting. (1) The chemical substance identified generically as tall oil fatty acids, reaction products with...
Soil Organic Carbon Fractions Differ in Two Contrasting Tall Fescue Systems
USDA-ARS?s Scientific Manuscript database
The value of tall fescue (Festuca arundinacea Schreb.) for C sequestration in addition to forage production and soil conservation is of current interest. However, studies relating to the impacts of endophyte infected (E+) and endophyte free (E-) tall fescue on soil organic matter fractions are few....
Twisters, Tall Tales, & Science Teaching
ERIC Educational Resources Information Center
Wilcox, Dawn Renee; Sterling, Donna R.
2006-01-01
Legends and tall tales have been part of the American culture for ages. Students are probably already familiar with the tales of how Pecos Bill fearlessly tamed a ferocious tornado, or Paul Bunyan effortlessly restrained a great river. Such tales have been passed down from generation to generation to explain humanity, the natural world, and…
Integrating bermudagrass into tall fescue-based pasture systems for stocker cattle.
Kallenbach, R L; Crawford, R J; Massie, M D; Kerley, M S; Bailey, N J
2012-01-01
The daily BW gain of stocker steers grazing tall fescue [Lolium arundinaceum (Schreb.) S.J. Darbysh. = Schedonorus arundinaceus (Schreb.) Dumort.]-based pastures typically declines during summer. To avoid these declines, in part to mitigate the effects of tall fescue toxicosis, it is commonly advised to move cattle to warm-season forage during this period. A 3-yr (2006, 2007, and 2008) grazing study was conducted to evaluate the effect of replacing 25% of the area of a tall fescue/clover (81% endophyte-infected) pasture system with "Ozark" bermudagrass [Cynodon dactylon (L.) Pers.] overseeded with clover (Trifolium spp.) to provide summer grazing for stocker steers (TF+BERM). The TF+BERM treatment was compared with a grazing system in which tall fescue/clover (TF) pastures were the only type of forage available for grazing. Our objective was to determine if replacement of 25% of the land area in a fescue system with bermudagrass would increase annual beef production compared with a system based solely on tall fescue. The study was conducted at the Southwest Research and Education Center of the University of Missouri near Mt. Vernon. Each treatment was rotationally stocked with 5 steers (248 ± 19.3 kg) on 1.7 ha. Fertilizer applications were applied at rates recommended for each respective forage species. Total forage production, BW gain per hectare, and season-long ADG of steers was greater (P < 0.06) for TF+BERM than for TF in 2006, but none of these measures differed (P > 0.19) in 2007 or 2008. In vitro true digestibility of pastures was greater (P = 0.01) for TF (84.4%, SEM = 0.64%) compared with TF+BERM (80.6%, SEM = 0.79%), even in summer. The decreased in vitro true digestibility of the bermudagrass pastures likely negated any benefit that animals in TF+BERM had in avoiding the ergot-like alkaloids associated with endophyte-infected tall fescue. Renovating 25% of the pasture system to bermudagrass provided some benefit to the system in years when summertime
Viability of Acremonium coenophialum in tall fescue seed after ionizing radiation treatments
DOE Office of Scientific and Technical Information (OSTI.GOV)
Bagegni, A.M.; Sleper, D.A.; Kerr, H.D.
Planting tall fescue (Festuca arundinacea Schreb.) seed free of the endophyte Acremonium coenophialum Morgan-Jones and Gams allows establishment of swards free of the fungus. Eradication of the fungal endophyte from infected tall fescue seeds containing 130 g kg{sup {minus}1} moisture using ionizing radiation was investigated. Three sources of radiation were used: gamma rays ({sup 60}Co source), neutron particles ({sup 252}Cf source), and a thermal neutron beam. The percent germination of tall fescue seeds among gamma doses did not differ significantly (P < 0.05) from the control treatment and did not show a significant negative response (R{sub 2} = 0.41) tomore » increasing levels of gamma radiation. At 250 Gy of gamma radiation, percent germination after 14 d was still > 90%. Percent seed germination of tall fescue and high levels of radiation were negatively correlated for both sources of neutrons. Gamma radiation was shown to reduce (P < 0.01) the percent of the viable endophyte to {approx} 10% of control. The {sup 252}Cf and thermal neutrons reduced the percent of tall fescue infected by the endophyte to {approx} 30% without deleterious effects on seed germination.« less
Birnbaum, Stephanie S L; Rinker, David C; Gerardo, Nicole M; Abbot, Patrick
2017-12-01
Interactions between plants and herbivorous insects have been models for theories of specialization and co-evolution for over a century. Phytochemicals govern many aspects of these interactions and have fostered the evolution of adaptations by insects to tolerate or even specialize on plant defensive chemistry. While genomic approaches are providing new insights into the genes and mechanisms insect specialists employ to tolerate plant secondary metabolites, open questions remain about the evolution and conservation of insect counterdefences, how insects respond to the diversity defences mounted by their host plants, and the costs and benefits of resistance and tolerance to plant defences in natural ecological communities. Using a milkweed-specialist aphid (Aphis nerii) model, we test the effects of host plant species with increased toxicity, likely driven primarily by increased secondary metabolites, on aphid life history traits and whole-body gene expression. We show that more toxic plant species have a negative effect on aphid development and lifetime fecundity. When feeding on more toxic host plants with higher levels of secondary metabolites, aphids regulate a narrow, targeted set of genes, including those involved in canonical detoxification processes (e.g., cytochrome P450s, hydrolases, UDP-glucuronosyltransferases and ABC transporters). These results indicate that A. nerii marshal a variety of metabolic detoxification mechanisms to circumvent milkweed toxicity and facilitate host plant specialization, yet, despite these detoxification mechanisms, aphids experience reduced fitness when feeding on more toxic host plants. Disentangling how specialist insects respond to challenging host plants is a pivotal step in understanding the evolution of specialized diet breadths. © 2017 John Wiley & Sons Ltd.
USDA-ARS?s Scientific Manuscript database
The herbicide Chaparral™ has been shown to suppress seedhead development in tall fescue (Neotyphodium coenophialum) pastures and reduce the symptoms of tall fescue toxicosis in cattle. However, little is known about the logistics of herbicide treatment on tall fescue pastures. The objective of thi...
Gamma-secretase inhibitors reverse glucocorticoid resistance in T-ALL
Real, Pedro J.; Tosello, Valeria; Palomero, Teresa; Castillo, Mireia; Hernando, Eva; de Stanchina, Elisa; Sulis, Maria Luisa; Barnes, Kelly; Sawai, Catherine; Homminga, Irene; Meijerink, Jules; Aifantis, Iannis; Basso, Giuseppe; Cordon-Cardo, Carlos; Ai, Walden; Ferrando, Adolfo
2009-01-01
Summary Gamma-secretase inhibitors (GSIs) block the activation of oncogenic NOTCH1 in T-cell acute lymphoblastic leukemia (T-ALL). However, limited antileukemic cytotoxicity and severe gastrointestinal toxicity have restricted the clinical application of these targeted drugs. Here we show that combination therapy with GSIs plus glucocorticoids can improve the antileukemic effects of GSIs and reduce their gut toxicity in vivo. Inhibition of NOTCH1 signaling in glucocorticoid-resistant T-ALL restored glucocorticoid receptor auto-up-regulation and induced apoptotic cell death through induction of BIM expression. GSI treatment resulted in cell cycle arrest and accumulation of goblet cells in the gut mediated by upregulation of Klf4, a negative regulator of cell cycle required for goblet cell differentiation. In contrast, glucocorticoid treatment induced transcriptional upregulation of Ccnd2 and protected mice from developing intestinal goblet cell metaplasia typically induced by inhibition of NOTCH signaling with GSIs. These results support a role for glucocorticoids plus GSIs in the treatment of glucocorticoid-resistant T-ALL. PMID:19098907
Managing the tall fescue-fungal endophyte symbiosis for optimum forage-animal production
USDA-ARS?s Scientific Manuscript database
Alkaloids produced by the fungal endophyte (Neotyphodium coenophialum) that infects tall fescue [Lolium arundinaceum (Schreb.) Darbysh.] are a paradox to cattle production. While certain alkaloids impart tall fescue with tolerances to environmental stresses, such as moisture, heat, and herbivory, e...
77 FR 39395 - Special Local Regulations; Ocean State Tall Ships Festival 2012, Narragansett Bay, RI
Federal Register 2010, 2011, 2012, 2013, 2014
2012-07-03
...-AA08 Special Local Regulations; Ocean State Tall Ships Festival 2012, Narragansett Bay, RI AGENCY... Tall Ships Festival 2012. DATES: This rule is effective from July 6, 2012 until July 10, 2012... ``Special Local Regulations: Ocean State Tall Ships Festival 2012, Narragansett Bay, RI'' in the Federal...
Molecular discrimination of tall fescue morphotypes in association with Festuca relatives
Chekhovskiy, Konstantin
2018-01-01
Tall fescue (Festuca arundinacea Schreb.) is an important cool-season perennial grass species used as forage and turf, and in conservation plantings. There are three morphotypes in hexaploid tall fescue: Continental, Mediterranean and Rhizomatous. This study was conducted to develop morphotype-specific molecular markers to distinguish Continental and Mediterranean tall fescues, and establish their relationships with other species of the Festuca genus for genomic inference. Chloroplast sequence variation and simple sequence repeat (SSR) polymorphism were explored in 12 genotypes of three tall fescue morphotypes and four Festuca species. Hypervariable chloroplast regions were retrieved by using 33 specifically designed primers followed by sequencing the PCR products. SSR polymorphism was studied using 144 tall fescue SSR primers. Four chloroplast (NFTCHL17, NFTCHL43, NFTCHL45 and NFTCHL48) and three SSR (nffa090, nffa204 and nffa338) markers were identified which can distinctly differentiate Continental and Mediterranean morphotypes. A primer pair, NFTCHL45, amplified a 47 bp deletion between the two morphotypes is being routinely used in the Noble Research Institute’s core facility for morphotype discrimination. Both chloroplast sequence variation and SSR diversity showed a close association between Rhizomatous and Continental morphotypes, while the Mediterranean morphotype was in a distant clade. F. pratensis and F. arundinacea var. glaucescens, the P and G1G2 genome donors, respectively, were grouped with the Continental clade, and F. mairei (M1M2 genome) grouped with the Mediterranean clade in chloroplast sequence variation, while both F. pratensis and F. mairei formed independent clade in SSR analysis. Age estimation based on chloroplast sequence variation indicated that the Continental and Mediterranean clades might have been colonized independently during 0.65 ± 0.06 and 0.96 ± 0.1 million years ago (Mya) respectively. The findings of the study will
Nutrient source and tillage impacts on tall fescue production and soil properties
USDA-ARS?s Scientific Manuscript database
Tall fescue (Festuca arundinacea Schreb.) grass provides a major forage base for many livestock production systems in the southeastern United States. Forage production with manure helps recycle nutrients with less environmental impacts. This two year study examined tall fescue forage production and ...
Short and tall stature: a new paradigm emerges
Baron, Jeffrey; Sävendahl, Lars; De Luca, Francesco; Dauber, Andrew; Phillip, Moshe; Wit, Jan M.; Nilsson, Ola
2016-01-01
In the past, the growth hormone (GH) – insulin-like growth factor-I (IGF-I) axis was thought to be the central system regulating childhood growth and therefore responsible for short stature and tall stature. However, recent findings have revealed that the GH-IGF-I axis is just one of many regulatory systems that control chondrogenesis in the growth plate, the biological process that drives height gain. Consequently, normal growth in children depends not only on GH and IGF-I but on multiple hormones, paracrine factors, extracellular matrix molecules, and intracellular proteins that regulate growth plate chondrocytes. Mutations in genes encoding many of these local proteins cause short stature or tall stature. Similarly genome-wide association studies have revealed that the normal variation in height appears to be due largely to genes outside the GH-IGF-I axis that affect growth at the growth plate through a wide variety of mechanisms. These findings point to a new conceptual framework for understanding short and tall stature, which is centered not on two particular hormones but rather on the growth plate, the structure responsible for height gain. PMID:26437621
77 FR 16974 - Special Local Regulations; Ocean State Tall Ships Festival 2012, Narragansett Bay, RI
Federal Register 2010, 2011, 2012, 2013, 2014
2012-03-23
...-AA08 Special Local Regulations; Ocean State Tall Ships Festival 2012, Narragansett Bay, RI AGENCY... Island, for the Ocean State Tall Ships Festival 2012. This action is necessary to provide for the safety..., during the Ocean State Tall Ships Festival on July 6-9, 2012. These temporary special local regulations...
Tall Poppies: Bullying Behaviors Faced by Australian High-Performance School-Age Athletes
ERIC Educational Resources Information Center
O'Neill, Maureen; Calder, Angela; Allen, Bill
2014-01-01
Little is known about Australian high-performance school-age athletes' experiences as victims of the tall poppy syndrome. Tall poppies are successful individuals bullied by those who are less successful in order to "normalize them." Nineteen current or previous national or international high-performance school-age athletes were…
Code of Federal Regulations, 2010 CFR
2010-07-01
... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Fatty acids, tall-oil, reaction... Substances § 721.10189 Fatty acids, tall-oil, reaction products with (butoxymethyl) oxirane formaldehyde... to reporting. (1) The chemical substance identified generically as fatty acids, tall-oil, reaction...
Code of Federal Regulations, 2011 CFR
2011-07-01
... 40 Protection of Environment 31 2011-07-01 2011-07-01 false Fatty acids, tall-oil, reaction... Substances § 721.10189 Fatty acids, tall-oil, reaction products with (butoxymethyl) oxirane formaldehyde... to reporting. (1) The chemical substance identified generically as fatty acids, tall-oil, reaction...
Collapse of tall granular columns in fluid
NASA Astrophysics Data System (ADS)
Kumar, Krishna; Soga, Kenichi; Delenne, Jean-Yves
2017-06-01
Avalanches, landslides, and debris flows are geophysical hazards, which involve rapid mass movement of granular solids, water, and air as a multi-phase system. In order to describe the mechanism of immersed granular flows, it is important to consider both the dynamics of the solid phase and the role of the ambient fluid. In the present study, the collapse of a granular column in fluid is studied using 2D LBM - DEM. The flow kinematics are compared with the dry and buoyant granular collapse to understand the influence of hydrodynamic forces and lubrication on the run-out. In the case of tall columns, the amount of material destabilised above the failure plane is larger than that of short columns. Therefore, the surface area of the mobilised mass that interacts with the surrounding fluid in tall columns is significantly higher than the short columns. This increase in the area of soil - fluid interaction results in an increase in the formation of turbulent vortices thereby altering the deposit morphology. It is observed that the vortices result in the formation of heaps that significantly affects the distribution of mass in the flow. In order to understand the behaviour of tall columns, the run-out behaviour of a dense granular column with an initial aspect ratio of 6 is studied. The collapse behaviour is analysed for different slope angles: 0°, 2.5°, 5° and 7.5°.
Establishing native warm season grasses on Eastern Kentucky strip mines
DOE Office of Scientific and Technical Information (OSTI.GOV)
Barnes, T.G.; Larkin, J.L.; Arnett, M.B.
1998-12-31
The authors evaluated various methods of establishing native warm season grasses on two reclaimed Eastern Kentucky mines from 1994--1997. Most current reclamation practices incorporate the use of tall fescue (Festuca arundinacea) and other cool-season grasses/legumes that provide little wildlife habitats. The use of native warm season grasses will likely improve wildlife habitat on reclaimed strip mines. Objectives of this study were to compare the feasibility of establishing these grasses during fall, winter, or spring using a native rangeland seeder or hydroseeding; a fertilizer application at planting; or cold-moist stratification prior to hydroseeding. Vegetative cover, bare ground, species richness, and biomassmore » samples were collected at the end of each growing season. Native warm season grass plantings had higher plant species richness compared to cool-season reclamation mixtures. There was no difference in establishment of native warm season grasses as a result of fertilization or seeding technique. Winter native warm season grass plantings were failures and cold-moist stratification did not increase plant establishment during any season. As a result of a drought during 1997, both cool-season and warm season plantings were failures. Cool-season reclamation mixtures had significantly more vegetative cover and biomass compared to native warm season grass mixtures and the native warm season grass plantings did not meet vegetative cover requirements for bond release. Forbs and legumes that established well included pale purple coneflower (Echinacea pallida), lance-leaf coreopsis (Coreopsis lanceolata), round-headed lespedeza (Lespedeza capitata), partridge pea (Cassia fasiculata), black-eyed susan (Rudbeckia hirta), butterfly milkweed (Asclepias tuberosa), and bergamot (Monarda fistulosa). Results from two demonstration plots next to research plots indicate it is possible to establish native warm season grasses on Eastern Kentucky strip mines for wildlife
Host status of endophyte-infected and noninfected tall fescue grass to Meloidogyne spp.
USDA-ARS?s Scientific Manuscript database
Tall fescue grass cultivars with or without endophytes were evaluated for their susceptibility to Meloidogyne incognita in the greenhouse. Tall fescue cultivars evaluated included, i) wild-type Jesup (E+, ergot-producing endophyte present), ii) endophyte-free Jesup (E-, no endophyte present), iii) ...
Lee, Sung Hak; Jung, Chan Kwon; Bae, Ja Seong; Jung, So Lyung; Choi, Yeong Jin; Kang, Chang Suk
2014-01-01
The tall cell variant (TCV) of papillary thyroid carcinoma (PTC) is the most common among the aggressive variants of the disease. We aimed to investigate the clinicopathologic characteristics of TCV, and evaluate the diagnostic efficacy of liquid-based cytology (LBC) in TCV detection compared with conventional smear in thyroid fine needle aspiration (FNA). A total of 266 consecutive patients (220 women and 46 men) with PTC were enrolled. We analyzed tumor characteristics according to histologic growth patterns as classic, classic PTC with tall cell features, and TCV. The cytomorphologic features of these subtypes were investigated according to the preparation methods of conventional smear and LBC. TCV and classic PTC with tall cell features comprised 4.9% and 6.0% of all tumors, respectively, and were significantly associated with older age at presentation, larger tumor size, high frequency of extrathyroid extension, and BRAF mutation in comparison with classic PTC. However, there was no statistically significant difference in clinicopathologic features between TCV and classic PTC with tall cell features. Tall cells were more easily detected by LBC than by conventional smear. The percentage of tall cells identified using LBC was well correlated with three histologic subtypes. Our results demonstrate that TCV is more common than previously recognized in Korea and any PTC containing tall cells may have identical biological behavior regardless of the precise proportions of tall cells. It is possible to make a preoperative diagnosis of TCV using LBC. Copyright © 2013 Wiley Periodicals, Inc.
Kishton, Rigel J; Barnes, Carson E; Nichols, Amanda G; Cohen, Sivan; Gerriets, Valerie A; Siska, Peter J; Macintyre, Andrew N; Goraksha-Hicks, Pankuri; de Cubas, Aguirre A; Liu, Tingyu; Warmoes, Marc O; Abel, E Dale; Yeoh, Allen Eng Juh; Gershon, Timothy R; Rathmell, W Kimryn; Richards, Kristy L; Locasale, Jason W; Rathmell, Jeffrey C
2016-04-12
T cell acute lymphoblastic leukemia (T-ALL) is an aggressive malignancy associated with Notch pathway mutations. While both normal activated and leukemic T cells can utilize aerobic glycolysis to support proliferation, it is unclear to what extent these cell populations are metabolically similar and if differences reveal T-ALL vulnerabilities. Here we show that aerobic glycolysis is surprisingly less active in T-ALL cells than proliferating normal T cells and that T-ALL cells are metabolically distinct. Oncogenic Notch promoted glycolysis but also induced metabolic stress that activated 5' AMP-activated kinase (AMPK). Unlike stimulated T cells, AMPK actively restrained aerobic glycolysis in T-ALL cells through inhibition of mTORC1 while promoting oxidative metabolism and mitochondrial Complex I activity. Importantly, AMPK deficiency or inhibition of Complex I led to T-ALL cell death and reduced disease burden. Thus, AMPK simultaneously inhibits anabolic growth signaling and is essential to promote mitochondrial pathways that mitigate metabolic stress and apoptosis in T-ALL. Copyright © 2016 Elsevier Inc. All rights reserved.
Tall oil precursors of Douglas fir
Daniel O. Foster; Duane F. Zinkel; Anthony H. Conner
1980-01-01
The sapwood and heartwood extractives of Douglas fir [Pseudotsuga menziesii (Mirb.) Franco] and the tall oil in the kraft black liquor were characterized. On pulping, isomerization and conversion of conjugated resin acids to dehydroabietic acid was observed. Recovery of both fatty and resin acids from pulping was lower than predicted from the extractive composition....
Allocating forage to fall-calving cow-calf pairs strip-grazing stockpiled tall fescue.
Curtis, L E; Kallenbach, R L; Roberts, C A
2008-03-01
In a 2-yr study, we evaluated the effect of different forage allocations on the performance of lactating beef cows and their calves grazing stockpiled tall fescue. Allocations of stockpiled tall fescue at 2.25, 3.00, 3.75, and 4.50% of cow-calf pair BW/d were set as experimental treatments. Conventional hay-feeding was also evaluated as a comparison to grazing stockpiled tall fescue. The experiment had a randomized complete block design with 3 replications and was divided into 3 phases each year. From early December to late February (phase 1) of each year, cows and calves grazed stockpiled tall fescue or were fed hay in the treatments described above. Immediately after phase 1, cows and calves were commingled and managed as a single group until weaning in April (phase 2) so that residual effects could be documented. Residual effects on cows were measured after the calves were weaned in April until mid-July (phase 3). During phase 1 of both years, apparent DMI of cow-calf pairs allocated stockpiled tall fescue at 4.50% of BW/d was 31% greater (P < 0.01) than those allocated 2.25% of BW/d. As allocation of stockpiled tall fescue increased from 2.25 to 4.50% of cow-calf BW/d, pasture utilization fell (P < 0.01) from 84 +/- 7% to 59 +/- 7%. During phase 1 of both years, cow BW losses increased linearly (P < 0.02) as forage allocations decreased, although the losses in yr 1 were almost double (P < 0.01) those in yr 2. During phases 2 and 3, few differences were noted across treatment groups, such that by the end of phase 3, cow BW in all treatments did not differ either year (P > 0.40). Calf ADG in phase 1 increased linearly (P < 0.01) with forage allocation (y = 0.063x + 0.513; R(2) = 0.91). However, calf gain per hectare decreased linearly (P < 0.01) as stockpiled tall fescue allocations increased (y = -26.5x + 212; R(2) = 0.97) such that gain per hectare for cow-calf pairs allocated stockpiled tall fescue at 4.50% BW/d was nearly 40% less (P < 0.01) than for those
Ergovaline recovery from digested tall fescue seedheads
USDA-ARS?s Scientific Manuscript database
Seed heads typically contain high concentrations of ergot alkaloids, which makes them a highly toxic source of ergot alkaloids. Unfortunately, cattle selectively graze tall fescue seedheads. Seedheads were collected from pastures grazed by Angus-cross steers from early-May until mid-June. Pasture...
From the Lab Bench: Should you plant a non-toxic endophyte tall fescue?
USDA-ARS?s Scientific Manuscript database
A column was written to discuss planting novel endophyte tall fescue for alleviating fescue toxicosis. Endophyte-free tall fescue cultivars can be grazed as a non-toxic alternative, but it maust be understood that it is the endophyte, through production of alkaloids other than ergot alkaloids, that...
Revealing the Genomic Landscape of Pediatric T-ALL | Office of Cancer Genomics
T-lineage acute lymphoblastic leukemia (T-ALL) comprises 15-20% of childhood ALL and has historically been associated with inferior outcome to B-cell ALL (B-ALL). Recent studies have used genome-wide sequencing approaches to identify new subtypes and targets of mutation in B-ALL, but comprehensive sequencing studies of large cohorts of T-ALL have not been performed.
Drivers of tall shrub proliferation adjacent to the Dempster Highway, Northwest Territories, Canada
NASA Astrophysics Data System (ADS)
Cameron, Emily A.; Lantz, Trevor C.
2016-04-01
Arctic ecosystems are undergoing rapid changes as a result of climate warming and more frequent disturbances. Disturbances can have particularly large effects on high-latitude ecosystems when ecosystem structure and function is controlled by strong feedbacks between soil conditions, vegetation, and ground thermal regime. In this study we investigated the impact of road construction and maintenance on vegetation structure and biomass along the Dempster Highway where it crosses the Peel Plateau in the Northwest Territories. To explore drivers of tall shrub proliferation and to quantify shrub proliferation in this region of continuous permafrost, greyscale air photos (1975) and Quickbird satellite imagery (2008) were used to map landcover change within two 0.6 km2 belts next to the road and two 0.6 km2 belts 500 m away from the road. Maps showing areas where: 1) tall shrubs expanded, and 2) dwarf shrub tundra resisted invasion were then used to select field sites where a suite of biophysical variables were measured. Rapid tall shrub proliferation and greater biomass adjacent to the road indicate that disturbance can facilitate vegetation change in tundra environments. Our field data also suggests that increased shrub proliferation adjacent to the road was caused by greater soil moisture. Tall shrub proliferation adjacent to the road occurred at lower elevation sites characterized by wetter soils with thicker organic layers. Areas that resisted tall shrub encroachment were located at higher elevations and had drier soils with thin organic layers. Our observations also support previous work illustrating that tall shrub expansion next to the highway promotes strong positive feedbacks to ongoing shrub growth and proliferation.
Prolyl-isomerase Pin1 controls Notch3 protein expression and regulates T-ALL progression.
Franciosa, G; Diluvio, G; Gaudio, F Del; Giuli, M V; Palermo, R; Grazioli, P; Campese, A F; Talora, C; Bellavia, D; D'Amati, G; Besharat, Z M; Nicoletti, C; Siebel, C W; Choy, L; Rustighi, A; Sal, G Del; Screpanti, I; Checquolo, S
2016-09-08
Deregulated Notch signaling is associated with T-cell Acute Lymphoblastic Leukemia (T-ALL) development and progression. Increasing evidence reveals that Notch pathway has an important role in the invasion ability of tumor cells, including leukemia, although the underlying molecular mechanisms remain mostly unclear. Here, we show that Notch3 is a novel target protein of the prolyl-isomerase Pin1, which is able to regulate Notch3 protein processing and to stabilize the cleaved product, leading to the increased expression of the intracellular domain (N3IC), finally enhancing Notch3-dependent invasiveness properties. We demonstrate that the combined inhibition of Notch3 and Pin1 in the Notch3-overexpressing human leukemic TALL-1 cells reduces their high invasive potential, by decreasing the expression of the matrix metalloprotease MMP9. Consistently, Pin1 depletion in a mouse model of Notch3-induced T-ALL, by reducing N3IC expression and signaling, impairs the expansion/invasiveness of CD4(+)CD8(+) DP cells in peripheral lymphoid and non-lymphoid organs. Notably, in in silico gene expression analysis of human T-ALL samples we observed a significant correlation between Pin1 and Notch3 expression levels, which may further suggest a key role of the newly identified Notch3-Pin1 axis in T-ALL aggressiveness and progression. Thus, combined suppression of Pin1 and Notch3 proteins may be exploited as an additional target therapy for T-ALL.
Prolyl-isomerase Pin1 controls Notch3 protein expression and regulates T-ALL progression
Franciosa, G; Diluvio, G; Gaudio, F Del; Giuli, M V; Palermo, R; Grazioli, P; Campese, A F; Talora, C; Bellavia, D; D'Amati, G; Besharat, Z M; Nicoletti, C; Siebel, C W; Choy, L; Rustighi, A; Sal, G Del; Screpanti, I; Checquolo, S
2016-01-01
Deregulated Notch signaling is associated with T-cell Acute Lymphoblastic Leukemia (T-ALL) development and progression. Increasing evidence reveals that Notch pathway has an important role in the invasion ability of tumor cells, including leukemia, although the underlying molecular mechanisms remain mostly unclear. Here, we show that Notch3 is a novel target protein of the prolyl-isomerase Pin1, which is able to regulate Notch3 protein processing and to stabilize the cleaved product, leading to the increased expression of the intracellular domain (N3IC), finally enhancing Notch3-dependent invasiveness properties. We demonstrate that the combined inhibition of Notch3 and Pin1 in the Notch3-overexpressing human leukemic TALL-1 cells reduces their high invasive potential, by decreasing the expression of the matrix metalloprotease MMP9. Consistently, Pin1 depletion in a mouse model of Notch3-induced T-ALL, by reducing N3IC expression and signaling, impairs the expansion/invasiveness of CD4+CD8+ DP cells in peripheral lymphoid and non-lymphoid organs. Notably, in in silico gene expression analysis of human T-ALL samples we observed a significant correlation between Pin1 and Notch3 expression levels, which may further suggest a key role of the newly identified Notch3-Pin1 axis in T-ALL aggressiveness and progression. Thus, combined suppression of Pin1 and Notch3 proteins may be exploited as an additional target therapy for T-ALL. PMID:26876201
Emmerton, Lynne; Rizk, Mariam F S; Bedford, Graham; Lalor, Daniel
2015-02-01
Confusion between similar drug names can cause harmful medication errors. Similar drug names can be visually differentiated using a typographical technique known as Tall Man lettering. While international conventions exist to derive Tall Man representation for drug names, there has been no national standard developed in Australia. This paper describes the derivation of a risk-based, standardized approach for use of Tall Man lettering in Australia, and known as National Tall Man Lettering. A three-stage approach was applied. An Australian list of similar drug names was systematically compiled from the literature and clinical error reports. Secondly, drug name pairs were prioritized using a risk matrix based on the likelihood of name confusion (a four-component score) vs. consensus ratings of the potential severity of the confusion by 31 expert reviewers. The mid-type Tall Man convention was then applied to derive the typography for the highest priority drug pair names. Of 250 pairs of confusable Australian drug names, comprising 341 discrete names, 35 pairs were identified by the matrix as an 'extreme' risk if confused. The mid-type Tall Man convention was successfully applied to the majority of the prioritized drugs; some adaption of the convention was required. This systematic process for identification of confusable drug names and associated risk, followed by application of a convention for Tall Man lettering, has produced a standard now endorsed for use in clinical settings in Australia. Periodic updating is recommended to accommodate new drug names and error reports. © 2014 John Wiley & Sons, Ltd.
Dynamics of growth zone patterning in the milkweed bug Oncopeltus fasciatus
Weiss, Aryeh; Williams, Terri A.; Nagy, Lisa M.
2017-01-01
We describe the dynamic process of abdominal segment generation in the milkweed bug Oncopeltus fasciatus. We present detailed morphological measurements of the growing germband throughout segmentation. Our data are complemented by cell division profiles and expression patterns of key genes, including invected and even-skipped as markers for different stages of segment formation. We describe morphological and mechanistic changes in the growth zone and in nascent segments during the generation of individual segments and throughout segmentation, and examine the relative contribution of newly formed versus existing tissue to segment formation. Although abdominal segment addition is primarily generated through the rearrangement of a pool of undifferentiated cells, there is nonetheless proliferation in the posterior. By correlating proliferation with gene expression in the growth zone, we propose a model for growth zone dynamics during segmentation in which the growth zone is functionally subdivided into two distinct regions: a posterior region devoted to a slow rate of growth among undifferentiated cells, and an anterior region in which segmental differentiation is initiated and proliferation inhibited. PMID:28432218
Code of Federal Regulations, 2010 CFR
2010-07-01
... manufacture of tall oil rosin, pitch and fatty acids subcategory. 454.40 Section 454.40 Protection of... CHEMICALS MANUFACTURING POINT SOURCE CATEGORY Tall Oil Rosin, Pitch and Fatty Acids Subcategory § 454.40 Applicability; description of manufacture of tall oil rosin, pitch and fatty acids subcategory. The provisions...
Code of Federal Regulations, 2011 CFR
2011-07-01
... manufacture of tall oil rosin, pitch and fatty acids subcategory. 454.40 Section 454.40 Protection of... CHEMICALS MANUFACTURING POINT SOURCE CATEGORY Tall Oil Rosin, Pitch and Fatty Acids Subcategory § 454.40 Applicability; description of manufacture of tall oil rosin, pitch and fatty acids subcategory. The provisions...
Performance by Fall-Calving Cows Grazing Tall Fescue Pastures With Different Proportions Stockpiled
USDA-ARS?s Scientific Manuscript database
Tall fescue [Lolium arundinaceum (Schreb.) S.J. Darbyshire.] is often stockpiled to reduce winter feed costs for cattle. Over two consecutive years, a total of 158 Gelbvieh × Angus fall-calving cows (1318 plus/minus 13.2 lb) were allocated randomly to one of eight 24-acre tall fescue pastures on 18 ...
Performance by Fall-Calving Cows Grazing Tall Fescue Pastures with Different Proportions Stockpiled
USDA-ARS?s Scientific Manuscript database
Tall fescue [Lolium arundinaceum (Schreb.) Darbysh.] is often stockpiled to reduce winter feed costs for cattle. Over two consecutive years, a total of 158 Gelbvieh × Angus fall-calving cows (599 ± 6.0 kg) were allocated randomly to one of eight 10-ha tall fescue pastures (subdivided into six 1.6-h...
Steer consumption and ergovaline recovery from in vitro digested residues of tall fescue seedheads
USDA-ARS?s Scientific Manuscript database
Ergot alkaloids produced by the endophyte [Neotyphodium coenophialum (Morgan-Jones and Gams) Glenn, Bacon, and Hanlin] of tall fescue [Lolium arundinaceum (Schreb.) Darbysh.] are a common problem faced by cattle producers. These toxins are concentrated within seedheads of tall fescue tillers, which...
Six new C21 steroidal glycosides from Asclepias curassavica L.
Li, Jun-Zhu; Liu, Hai-Yang; Lin, Yi-Ju; Hao, Xiao-Jiang; Ni, Wei; Chen, Chang-Xiang
2008-07-01
Six new C(21) steroidal glycosides, named curassavosides A-F (3-8), were obtained from the aerial parts of Asclepias curassavica (Asclepiadaceae), along with two known oxypregnanes, 12-O-benzoyldeacylmetaplexigenin (1) and 12-O-benzoylsarcostin (2). By spectroscopic methods, the structures of the six new compounds were determined as 12-O-benzoyldeacylmetaplexigenin 3-O-beta-D-oleandropyranosyl-(1-->4)-beta-D-digitoxopyranoside (3), 12-O-benzoylsarcostin 3-O-beta-D-oleandropyranosyl-(1-->4)-beta-D-digitoxopyranoside (4), sarcostin 3-O-beta-D-oleandropyranosyl-(1-->4)-beta-D-canaropyranosyl-(1-->4)-beta-D-oleandropyranosyl-(1-->4)-beta-D-digitoxopyranoside (5), sarcostin 3-O-beta-D-oleandropyranosyl-(1-->4)-beta-D-canaropyranosyl-(1-->4)-beta-D-canaropyranosyl-(1-->4)-beta-D-digitoxopyranoside (6), 12-O-benzoyldeacylmetaplexigenin 3-O-beta-D-glucopyranosyl-(1-->4)-beta-D-oleandropyranosyl-(1-->4)-beta-D-canaropyranosyl-(1-->4)-beta-d-oleandropyranosyl-(1-->4)-beta-D-digitoxopyranoside (7), and 12-O-benzoylsarcostin 3-O-beta-D-glucopyranosyl-(1-->4)-beta-D-oleandropyranosyl-(1-->4)-beta-d-canaropyranosyl-(1-->4)-beta-D-oleandropyranosyl-(1-->4)-beta-D-digitoxopyranoside (8), respectively. All compounds (1-8) were tested for in vitro cytotoxicity; only compound 3 showed weak inhibitory activity against Raji and AGZY cell lines.
USDA-ARS?s Scientific Manuscript database
Considering the importance of the perennial grass tall fescue (Festuca arundinacea) having as forage potential and its resistance to many pests, including some phytoparasitic nematodes, the host reaction of three tall fescue cultivars (cvs. Bulldogs 51, Georgia 5 and Jesup AR542 ) were evaluated for...
Study of Antibacterial Activity and Bacteriology of Latex from Asclepias syriaca L
McCay, Steven; Mahlberg, Paul
1973-01-01
Whole and fractionated latex of Asclepias syriaca was tested for antimicrobial or growth-promoting activity with 16 genera and species of bacteria. Latex and extracted fractions (distilled water, acetic acid, sodium bicarbonate, sulfuric acid, and ethyl ether) possessed no detectable antimicrobial activity. Comparison of growth curves of selected bacteria incubated with serum and rubber fractions, as well as controls, revealed no detectable inhibition of growth, except for a slight inhibitory response to autoclaved serum. Most bacteria were capable of utilizing latex for a substrate as indicated by the increased growth rate in the exponential phase. The stationary phase was entered simultaneously by both the treated cultures and the controls. Various bacteria cultured in a litmus latex mixture yielded populations which ranged from <104 organisms/ml for Lactobacillus casei, Staphylococcus aureus and Micrococcus lysodeikticus to 1.1 × 1010 organisms/ml for Clostridium acetobutylicum. Whole latex, as well as the serum and rubber fractions, support the growth of various bacteria, but under field conditions there is no evidence for systemic infection of this type of cell by bacteria. PMID:4790590
Properties of Single K+ and Cl− Channels in Asclepias tuberosa Protoplasts 1
Schauf, Charles L.; Wilson, Kathryn J.
1987-01-01
Potassium and chloride channels were characterized in Asclepias tuberosa suspension cell derived protoplasts by patch voltage-clamp. Whole-cell currents and single channels in excised patches had linear instantaneous current-voltage relations, reversing at the Nernst potentials for K+ and Cl−, respectively. Whole cell K+ currents activated exponentially during step depolarizations, while voltage-dependent Cl− channels were activated by hyperpolarizations. Single K+ channel conductance was 40 ± 5 pS with a mean open time of 4.5 milliseconds at 100 millivolts. Potassium channels were blocked by Cs+ and tetraethylammonium, but were insensitive to 4-aminopyridine. Chloride channels had a single-channel conductance of 100 ± 17 picosiemens, mean open time of 8.8 milliseconds, and were blocked by Zn2+ and ethacrynic acid. Whole-cell Cl− currents were inhibited by abscisic acid, and were unaffected by indole-3-acetic acid and 2,4-dichlorophenoxyacetic acid. Since internal and external composition can be controlled, patch-clamped protoplasts are ideal systems for studying the role of ion channels in plant physiology and development. Images Fig. 5 PMID:16665712
NASA Astrophysics Data System (ADS)
Young, Carolyn; Charlton, Nikki; Takach, Johanna; Swoboda, Ginger; Trammell, Michael; Huhman, David; Hopkins, Andrew
2014-11-01
Tall fescue (Lolium arundinaceum) is a valuable and broadly adapted forage grass that occupies approximately 14 million hectares across the United States. A native to Europe, tall fescue was likely introduced into the U.S. around the late 1800’s. Much of the success of tall fescue can be attributed to Epichloë coenophiala (formerly Neotyphodium coenophialum) a seed borne symbiont that aids in host persistence. Epichloë species are capable of producing a range of alkaloids (ergot alkaloids, indole-diterpenes, lolines and peramine) that provide protection to the plant host from herbivory. Unfortunately, most tall fescue within the U.S., commonly referred to as KY31, harbors the endophyte E. coenophiala that causes toxicity to grazing livestock due to the production of ergot alkaloids. Molecular analyses of tall fescue endophytes have identified four independent associations, representing tall fescue with E. coenophiala, Epichloë sp. FaTG-2, Epichloë sp. FaTG-3 or Epichloë sp. FaTG-4. Each of these Epichloë species can be further distinguished based on genetic variation that equates to differences in the alkaloid gene loci. Tall fescue samples were evaluated using markers to SSR and alkaloid biosynthesis genes to determine endophyte strain variation present within continental U.S. Samples represented seed and tillers from the Suiter farm (Menifee County, KY), which is considered the originating site of KY31, as well as plant samples collected from 14 states, breeder’s seed and plant introduction lines (National Plant Germplasm System, NPGS). This study revealed two prominent E. coenophiala genotypes based on presence of alkaloid biosynthesis genes and SSR markers and provides insight into endophyte variation within continental U.S. across historical and current tall fescue samples.
Analysis of Ideal Towers for Tall Wind Applications
DOE Office of Scientific and Technical Information (OSTI.GOV)
Dykes, Katherine L; Damiani, Rick R; Roberts, Joseph O
Innovation in wind turbine tower design is of significant interest for future development of wind power plants. First, wind turbine towers account for a large portion of overall capital expenditures for wind power projects. Second, for low wind-resource regions of the world, the use of low-cost tall-tower technology has the potential to open new markets for development. This study investigates the relative potential of various tower configurations in terms of mass and cost. For different market applications and hub heights, idealized tall towers are designed and compared. The results show that innovation in wind turbine controls makes reaching higher hubmore » heights with current technology economically viable. At the same time, new technologies hold promise for reducing tower costs as these technologies mature and hub heights reach twice the current average.« less
USDA - Kentucky Report (Annual Report to SERA-IEG 8, Tall Fescue Toxicosis/Endophyte Workshop)
USDA-ARS?s Scientific Manuscript database
Of the ergopeptine alkaloids produced by the endophyte (Neotyphodium coenophialum) of tall fescue, ergovaline has been reported as the most abundant in endophyte-infected tall fescue (Lolium arundinacea). As a result much focus has been placed on ergovaline and its impact on grazing animal health (i...
From the Lab Bench: Season Changes in Ergot Alkaloid Concentrations of Toxic Tall Fescue
USDA-ARS?s Scientific Manuscript database
A column was written to discuss seasonal trends in ergot alkaloids produced by the fungal endophyte that infects most plants of tall fescue. Tall fescue is the predominant grass utilized for forage in the U.S. transition zone between the temperature northeast and subtropical southeast; however, erg...
Pringle, Elizabeth G; Novo, Alexandria; Ableson, Ian; Barbehenn, Raymond V; Vannette, Rachel L
2014-01-01
In plant–ant–hemipteran interactions, ants visit plants to consume the honeydew produced by phloem-feeding hemipterans. If genetically based differences in plant phloem chemistry change the chemical composition of hemipteran honeydew, then the plant's genetic constitution could have indirect effects on ants via the hemipterans. If such effects change ant behavior, they could feed back to affect the plant itself. We compared the chemical composition of honeydews produced by Aphis nerii aphid clones on two milkweed congeners, Asclepias curassavica and Asclepias incarnata, and we measured the responses of experimental Linepithema humile ant colonies to these honeydews. The compositions of secondary metabolites, sugars, and amino acids differed significantly in the honeydews from the two plant species. Ant colonies feeding on honeydew derived from A. incarnata recruited in higher numbers to artificial diet, maintained higher queen and worker dry weight, and sustained marginally more workers than ants feeding on honeydew derived from A. curassavica. Ants feeding on honeydew from A. incarnata were also more exploratory in behavioral assays than ants feeding from A. curassavica. Despite performing better when feeding on the A. incarnata honeydew, ant workers marginally preferred honeydew from A. curassavica to honeydew from A. incarnata when given a choice. Our results demonstrate that plant congeners can exert strong indirect effects on ant colonies by means of plant-species-specific differences in aphid honeydew chemistry. Moreover, these effects changed ant behavior and thus could feed back to affect plant performance in the field. PMID:25505534
Cutting, Brian T; Tallamy, Douglas W
2015-10-01
The eastern migratory monarch butterfly (Danaus plexippus L.) population in North America hit record low numbers during the 2013-2014 overwintering season, prompting pleas by scientists and conservation groups to plant the butterfly's milkweed host plants (Asclepias spp.) in residential areas. While planting butterfly gardens with host plants seems like an intuitive action, no previous study has directly compared larval survival in gardens and natural areas to demonstrate that gardens are suitable habitats for Lepidoptera. In this study, milkweed was planted in residential gardens and natural areas. In 2009 and 2010, plants were monitored for oviposition by monarch butterflies and survival of monarch eggs and caterpillars. Monarchs oviposited significantly more frequently in gardens than in natural sites, with 2.0 and 6.2 times more eggs per plant per observation in 2009 and 2010, respectively. There were no significant differences in overall subadult survival between gardens and natural areas. Significant differences in survival were measured for egg and larval cohorts when analyzed separately, but these were not consistent between years. These results suggest that planting gardens with suitable larval host plants can be an effective tool for restoring habitat for monarch butterflies. If planted over a large area, garden plantings may be useful as a partial mitigation for dramatic loss of monarch habitat in agricultural settings. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Code of Federal Regulations, 2010 CFR
2010-07-01
... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Fatty acids, tall-oil, reaction... Fatty acids, tall-oil, reaction products with 4-methyl-2-pentanone and aliphatic polyamine (generic). (a... generically as fatty acids, tall-oil, reaction products with 4-methyl-2-pentanone and aliphatic polyamine (PMN...
Code of Federal Regulations, 2011 CFR
2011-07-01
... 40 Protection of Environment 31 2011-07-01 2011-07-01 false Fatty acids, tall-oil, reaction... Fatty acids, tall-oil, reaction products with 4-methyl-2-pentanone and aliphatic polyamine (generic). (a... generically as fatty acids, tall-oil, reaction products with 4-methyl-2-pentanone and aliphatic polyamine (PMN...
78 FR 38580 - Special Local Regulation; Tall Ships Celebration Bay City, Bay City, MI
Federal Register 2010, 2011, 2012, 2013, 2014
2013-06-27
...-AA08 Special Local Regulation; Tall Ships Celebration Bay City, Bay City, MI AGENCY: Coast Guard, DHS... regulatory act for the celebration specific to Bay City, MI, the Coast Guard recently published a separate... various events throughout the Great Lakes this summer, to include the Tall Ships Celebration Bay City...
Council on Tall Buildings and Urban Habitat
Publications CTBUH Journal Awards Books Technical Guides Research Reports Other Books IJHRB Research Journal TBUH Chinese Journal Virtual Research Journal Conference Publications Posters Awards Global Awards Council on Tall Buildings and Urban Habitat About CTBUH Organization & People Membership
Della Gatta, Giusy; Palomero, Teresa; Perez-Garcia, Arianne; Ambesi-Impiombato, Alberto; Bansal, Mukesh; Carpenter, Zachary W; De Keersmaecker, Kim; Sole, Xavier; Xu, Luyao; Paietta, Elisabeth; Racevskis, Janis; Wiernik, Peter H; Rowe, Jacob M; Meijerink, Jules P; Califano, Andrea; Ferrando, Adolfo A
2012-02-26
The TLX1 and TLX3 transcription factor oncogenes have a key role in the pathogenesis of T cell acute lymphoblastic leukemia (T-ALL). Here we used reverse engineering of global transcriptional networks to decipher the oncogenic regulatory circuit controlled by TLX1 and TLX3. This systems biology analysis defined T cell leukemia homeobox 1 (TLX1) and TLX3 as master regulators of an oncogenic transcriptional circuit governing T-ALL. Notably, a network structure analysis of this hierarchical network identified RUNX1 as a key mediator of the T-ALL induced by TLX1 and TLX3 and predicted a tumor-suppressor role for RUNX1 in T cell transformation. Consistent with these results, we identified recurrent somatic loss-of-function mutations in RUNX1 in human T-ALL. Overall, these results place TLX1 and TLX3 at the top of an oncogenic transcriptional network controlling leukemia development, show the power of network analyses to identify key elements in the regulatory circuits governing human cancer and identify RUNX1 as a tumor-suppressor gene in T-ALL.
Code of Federal Regulations, 2013 CFR
2013-07-01
...-hydroxyethyl)amino]ethyl], reaction products with sulfur dioxide; fatty acids, tall-oil, reaction products with 1-piperazineethanamine and sulfur dioxide; fatty acids, tall-oil reaction products with sulfur...)amino]ethyl], reaction products with sulfur dioxide; fatty acids, tall-oil, reaction products with 1...
Code of Federal Regulations, 2011 CFR
2011-07-01
...-hydroxyethyl)amino]ethyl], reaction products with sulfur dioxide; fatty acids, tall-oil, reaction products with 1-piperazineethanamine and sulfur dioxide; fatty acids, tall-oil reaction products with sulfur...)amino]ethyl], reaction products with sulfur dioxide; fatty acids, tall-oil, reaction products with 1...
Code of Federal Regulations, 2010 CFR
2010-07-01
...-hydroxyethyl)amino]ethyl], reaction products with sulfur dioxide; fatty acids, tall-oil, reaction products with 1-piperazineethanamine and sulfur dioxide; fatty acids, tall-oil reaction products with sulfur...)amino]ethyl], reaction products with sulfur dioxide; fatty acids, tall-oil, reaction products with 1...
Globalisation Reflected onto Architecture: Tall Buildings of Ankara-Turkey
NASA Astrophysics Data System (ADS)
Tanju Gültekin, Ahmet
2017-10-01
Policy switching, radical socioeconomic changes, integration and globalisation were started in 1980s. New urban space developments have been accelerated in 1990s and provided urban space identity policies in 2000s. Luxurious shopping malls, hotels, and ultra-posh residences within the city and gated communities on city peripheries have been formed. Thus, the urban geography, urban silhouette and urban identity are being converted through tall buildings that signify the created prestige, status, and power in competition with the global capital. By the globalisation foresight the cities which have gotten ahead of the nation-state was seen. The buildings that converted into a symbolic (iconic) global product leads to an advantage in the race for attracting global investments and tourism, on behalf of the cities/urban districts. This process, which was initiated haphazardly in Turkey in the 1980s, has been on-going throughout the 1990s and especially in 2000s by means of the re-structuring of the government on a neo-liberal basis. The process is concurrently observable through the tall buildings and/or building blocks which match with urban regeneration projects, urban zoning plan revisions and fragmented zoning plans. In this study, the new global world order is evaluated by their status and architectural properties of selected tall and iconic/ultra-modern buildings in Ankara.
Notice of release of Syn1 Tall Fescue
USDA-ARS?s Scientific Manuscript database
The Agricultural Research Service, U.S. Department of Agriculture announces the release of Syn1 tall fescue [Festuca arundinacea (syn., Lolium arundinaceum Darbyshire; Schedonorus phoenix (Scop.) Holub)] (PI xxxx, PI xxxx) germplasm developed by Dr. Bryan K. Kindiger at the USDA-ARS Grazinglands Res...
Relative effectiveness of sewage sludge as a nitrogen fertilizer for tall fescue
DOE Office of Scientific and Technical Information (OSTI.GOV)
Kiemnec, G.L.; Jackson, T.L.; Hemphill, D.D. Jr.
Sewage sludge application rates on grasses are mainly determined by N availability and concentration of toxic metals in sludge. The exact availability of N in sludge is difficult to predict. A 3-yr study was conducted to determine which sludge rates would give yields of tall fescue (Festuca arundinacea Shreb. Alta) comparable to yields obtained from inorganic N application. Sludge and NH/sub 4/NO/sub 3/ were surface applied at annual rates of 0, 110, 220, 440, and 880 (sludge only) kg N/ha. Dry matter yield of tall fescue from sludge-treated soils was 36, 56, and 50% of that on NH/sub 4/NO/sub 3/-treatedmore » soils for 1976, 1977, and 1978, respectively. Sludge was 27, 41, and 44% as effective as NH/sub 4/NO/sub 3/ as a source of available N in 1976, 1977, and 1978, respectively. Ammonium-N in the sewage sludge apparently provided most of the available N for fescue growth. Concentrations of Zn, Cd, and Cu were higher and Mn lower in tall fescue grown on sludge-treated soil with NH/sub 4/NO/sub 3/ and usually increased toward the end of the growing season. However, plant concentrations of these heavy metals never reached toxic levels at any time. Sewage sludge was an effective and safe nutrient source for tall fescue.« less
Design automation of load-bearing arched structures of roofs of tall buildings
NASA Astrophysics Data System (ADS)
Kulikov, Vladimir
2018-03-01
The article considers aspects of the possible use of arched roofs in the construction of skyscrapers. Tall buildings experience large load from various environmental factors. Skyscrapers are subject to various and complex types of deformation of its structural elements. The paper discusses issues related to the aerodynamics of various structural elements of tall buildings. The technique of solving systems of equations state method of Simpson. The article describes the optimization of geometric parameters of bearing elements of the arched roofs of skyscrapers.
Insights into the Drought and Heat Avoidance Mechanism in Summer-Dormant Mediterranean Tall Fescue
Missaoui, Ali M.; Malinowski, Dariusz P.; Pinchak, William E.; Kigel, Jaime
2017-01-01
Summer dormancy is an evolutionary response that some perennial cool-season grasses adopted as an avoidance strategy to escape summer drought and heat. It is correlated with superior survival after severe summer droughts in many perennial grass species originating from Mediterranean environments. Understanding the genetic mechanism and environmental determinants of summer dormancy is important for interpreting the evolutionary history of seasonal dormancy and for the development of genomic tools to improve the efficiency of genetic selection for this important trait. The objectives of this research are to assess morphological and biochemical attributes that seem to be specific for the characterization of summer dormancy in tall fescue, and to validate the hypothesis that genes underlying stem determinacy might be involved in the mechanism of summer dormancy. Our results suggest that vernalization is an important requirement in the onset of summer dormancy in tall fescue. Non-vernalized tall fescue plants do not exhibit summer dormancy as vernalized plants do and behave more like summer-active types. This is manifested by continuation of shoot growth and high root activity in water uptake during summer months. Therefore, summer dormancy in tall fescue should be tested only in plants that underwent vernalization and are not subjected to water deficit during summer months. Total phenolic concentration in tiller bases (antioxidants) does not seem to be related to vernalization. It is most likely an environmental response to protect meristems from oxidative stress. Sequence analysis of the TFL1 homolog CEN gene from tall fescue genotypes belonging to summer-dormant and summer-active tall fescue types showed a unique deletion of three nucleotides specific to the dormant genotypes. Higher tiller bud numbers in dormant plants that were not allowed to flower and complete the reproductive cycle, confirmed that stem determinacy is a major component in the mechanism of summer
Insights into the Drought and Heat Avoidance Mechanism in Summer-Dormant Mediterranean Tall Fescue.
Missaoui, Ali M; Malinowski, Dariusz P; Pinchak, William E; Kigel, Jaime
2017-01-01
Summer dormancy is an evolutionary response that some perennial cool-season grasses adopted as an avoidance strategy to escape summer drought and heat. It is correlated with superior survival after severe summer droughts in many perennial grass species originating from Mediterranean environments. Understanding the genetic mechanism and environmental determinants of summer dormancy is important for interpreting the evolutionary history of seasonal dormancy and for the development of genomic tools to improve the efficiency of genetic selection for this important trait. The objectives of this research are to assess morphological and biochemical attributes that seem to be specific for the characterization of summer dormancy in tall fescue, and to validate the hypothesis that genes underlying stem determinacy might be involved in the mechanism of summer dormancy. Our results suggest that vernalization is an important requirement in the onset of summer dormancy in tall fescue. Non-vernalized tall fescue plants do not exhibit summer dormancy as vernalized plants do and behave more like summer-active types. This is manifested by continuation of shoot growth and high root activity in water uptake during summer months. Therefore, summer dormancy in tall fescue should be tested only in plants that underwent vernalization and are not subjected to water deficit during summer months. Total phenolic concentration in tiller bases (antioxidants) does not seem to be related to vernalization. It is most likely an environmental response to protect meristems from oxidative stress. Sequence analysis of the TFL1 homolog CEN gene from tall fescue genotypes belonging to summer-dormant and summer-active tall fescue types showed a unique deletion of three nucleotides specific to the dormant genotypes. Higher tiller bud numbers in dormant plants that were not allowed to flower and complete the reproductive cycle, confirmed that stem determinacy is a major component in the mechanism of summer
Effect of ozone on diverse tall fescue germplasm
DOE Office of Scientific and Technical Information (OSTI.GOV)
Johnston, W.J.; Dickens, R.; Haaland, R.L.
Six tall fescue (Festuca arundinacea Schreb.) genotypes of diverse origin (Algeria, Australia, France, Netherlands, Morocco, and a Kentucky 31 type) were evaluated for O/sub 3/ tolerance under controlled environmental conditions. In two tests on clonal parent material, (1) O/sub 3/ constant 0.3 ppm and exposure varied 0-12 hr and (2) O/sub 3/ concentration varied 0-0.5 ppm and exposure varied 1-3 hr, the Australian and Kentucky 31 selections were superior to all others in O/sub 3/ tolerance. Sixteen-day old polycross progeny of the six selections were exposed to 0.5 ppm O/sub 3/ for 0, 3, or 6 hr. Progeny of themore » Australian and Kentucky 31 selections were superior to some, but not all other selections. Increased duration of exposure increased damage only slightly. It would appear that O/sub 3/ tolerance is a heritable characteristic that can be easily detected and selected for in tall fescue.« less
Tall fescue ergot alkaloids are vasoactive in equine vasculature
USDA-ARS?s Scientific Manuscript database
Mares grazing endophyte-infected (Epichloë coenophiala) tall fescue (Lolium arundinaceum) typically exhibit reproductive dysfunction rather than problems associated with peripheral vasoconstriction as a primary sign of the fescue toxicosis syndrome. Research using Doppler ultrasonography demonstrate...
Heggen, E; Granlund, L; Pedersen, J I; Holme, I; Ceglarek, U; Thiery, J; Kirkhus, B; Tonstad, S
2010-05-01
Data comparing the impact of different sources of plant sterols on CVD risk factors and antioxidant levels is scarce. We evaluated the effects of plant sterols from rapeseed and tall oils on serum lipids, lipoproteins, fat-soluble vitamins and plant sterol concentrations. This was a double-blinded, randomized, crossover trial in which 59 hypercholesterolemic subjects consumed 25 g/day of margarine for 4 weeks separated by 1 week washout periods. The two experimental margarines provided 2g/day of plant sterols from rapeseed or tall oil. The control margarine had no added plant sterols. The control margarine reduced LDL cholesterol by 4.5% (95% CI 1.4, 7.6%). The tall and rapeseed sterol margarines additionally reduced LDL cholesterol by 9.0% (95% CI 5.5, 12.4%) and 8.2% (95% CI 5.2, 11.4%) and apolipoprotein B by 5.3% (95% CI 1.0, 9.6%) and 6.9% (95% CI 3.6, 10.2%), respectively. Lipid-adjusted beta-carotene concentrations were reduced by both sterol margarines (P<0.017). alpha-Tocopherol concentrations were reduced by the tall sterol compared to the rapeseed sterol margarine (P=0.001). Campesterol concentrations increased more markedly with the rapeseed sterol versus tall sterol margarine (P<0.001). The rapeseed sterol margarine increased while the tall sterol margarine decreased brassicasterol concentrations (P<0.001). Plant sterols from tall and rapeseed oils reduce atherogenic lipids and lipoproteins similarly. The rapeseed sterol margarine may have more favorable effects on serum alpha-tocopherol concentrations. Copyright 2009 Elsevier B.V. All rights reserved.
Does turgor limit growth in tall trees?
D.R. Woodruff; B.J. Bond; F.C. Meinzer
2004-01-01
The gravitational component of water potential contributes a standing 0.01 MPa m1 to the xylem tension gradient in plants. In tall trees, this contribution can significantly reduce the water potential near the tree tops. The turgor of cells in buds and leaves is expected to decrease in direct proportion with leaf water potential along a height gradient unless osmotic...
Comparison of Nitrogen Fixation Activity in Tall and Short Spartina alterniflora Salt Marsh Soils 1
Hanson, Roger B.
1977-01-01
A comparison of the N2 fixers in the tall Spartina alterniflora and short S. alterniflora marsh soils was investigated. Zero-order kinetics and first-order kinetics of acetylene reduction were used to describe the activity of the N2 fixers in marsh soil slurries. It was found that the Vmax values were approximately 10 times greater for the N2 fixers in the tall Spartina than in the short Spartina marsh when raffinose was used as the energy source. In addition, the (Ks + Sn) values were approximately 4 to 15 times lower for the N2 fixers in the tall Spartina than in short Spartina marsh. First-order kinetics of nitrogen fixation for several substrates indicate that the N2 fixers in the tall Spartina marsh were two to seven times more active than those in the short Spartina marsh. Ammonium chloride (25 μg/ml) did not inhibit nitrogen fixation in the tall Spartina marsh, but there was a 50% inhibition in nitrogen fixation in the short Spartina marsh. On the other hand, sodium nitrate inhibited nitrogen fixation almost 100% at 25 μg/ml in both soil environments. Amino nitrogen (25 to 100 μg/ml) had little or no effect on nitrogen fixation. The results indicate that the N2 fixers in the tall Spartina marsh were physiologically more responsive to nutrient addition than those in the short Spartina marsh. This difference in the two populations may be related to the difference in daily tidal influence in the respective areas and thus provide another explanation for the enhanced S. alterniflora production in the creek bank soil system. PMID:16345213
Analysis of Ideal Towers for Tall Wind Applications: Preprint
DOE Office of Scientific and Technical Information (OSTI.GOV)
Dykes, Katherine L; Damiani, Rick R; Roberts, Joseph O
Innovation in wind turbine tower design is of significant interest for future development of wind power plants. First, wind turbine towers account for a large portion of overall capital expenditures for wind power projects. Second, for low wind-resource regions of the world, the use of low-cost tall-tower technology has the potential to open new markets for development. This study investigates the relative potential of various tower configurations in terms of mass and cost. For different market applications and hub heights, idealized tall towers are designed and compared. The results show that innovation in wind turbine controls makes reaching higher hubmore » heights with current technology economically viable. At the same time, new technologies hold promise for reducing tower costs as these technologies mature and hub heights reach twice the current average.« less
Mucinous breast carcinoma with tall columnar cells.
Tsoukalas, N; Kiakou, M; Tolia, M; Kostakis, I D; Galanopoulos, M; Nakos, G; Tryfonopoulos, D; Kyrgias, G; Koumakis, G
2018-05-01
Mucinous carcinoma of the breast represents 1%-4% of all breast cancers. The World Health Organization classification divides this type of tumour into three different subtypes: mucinous carcinoma, mucinous carcinoma with tall columnar cells (mucinous cystadenocarcinoma and columnar cell mucinous carcinoma) and signet ring cell carcinoma. A 74-year-old woman presented a tumour with inflammatory features in the upper outer quadrant of her left breast, 7 cm in diameter. The core biopsy showed infiltrating ductal carcinoma of no specific type. The tumour-node-metastasis clinical staging was T4cN3M0 (Stage IIIC). She received neoadjuvant chemotherapy, underwent left mastectomy with radical axillary resection and subsequently received radiotherapy and chemotherapy. The histological examination of the surgical specimen revealed two solid tumors in the tail of Spence, which corresponded to adenocarcinoma with high columnar cells. The patient died 16 months after the diagnosis, suffering from pulmonary metastases and anterior chest wall infiltration. A review of the literature revealed only 21 reports of mucinous carcinoma of the breast with tall columnar cells, including our case. This is only the third time that the specific histological type of columnar cell mucinous carcinoma has been reported in the literature.
Chromatin looping defines expression of TAL1, its flanking genes, and regulation in T-ALL.
Zhou, Yan; Kurukuti, Sreenivasulu; Saffrey, Peter; Vukovic, Milica; Michie, Alison M; Strogantsev, Ruslan; West, Adam G; Vetrie, David
2013-12-19
TAL1 is an important regulator of hematopoiesis and its expression is tightly controlled despite complexities in its genomic organization. It is frequently misregulated in T-cell acute lymphoblastic leukemia (T-ALL), often due to deletions between TAL1 and the neighboring STIL gene. To better understand the events that lead to TAL1 expression in hematopoiesis and in T-ALL, we studied looping interactions at the TAL1 locus. In TAL1-expressing erythroid cells, the locus adopts a looping "hub" which brings into close physical proximity all known TAL1 cis-regulatory elements including CTCF-bound insulators. Loss of GATA1 results in disassembly of the hub and loss of CTCF/RAD21 from one of its insulators. Genes flanking TAL1 are partly dependent on hub integrity for their transcriptional regulation. We identified looping patterns unique to TAL1-expressing T-ALL cells, and, intriguingly, loops occurring between the TAL1 and STIL genes at the common TAL1/STIL breakpoints found in T-ALL. These findings redefine how TAL1 and neighboring genes communicate within the nucleus, and indicate that looping facilitates both normal and aberrant TAL1 expression and may predispose to structural rearrangements in T-ALL. We also propose that GATA1-dependent looping mechanisms may facilitate the conservation of TAL1 regulation despite cis-regulatory remodeling during vertebrate evolution.
Warashina, Tsutomu; Miyase, Toshio
2018-01-01
Previously, phytochemical investigation of the roots of Asclepias tuberosa (Asclepiadaceae) led to the isolation of some 8,12;8,20-diepoxy-8,14-secopregnane tri-, tetra-, and penta-glycosides. An additional eight new minor 8,12;8,20-diepoxy-8,14-secopregnane glycosides were afforded in the recent investigation of this plant. These glycosides consisted of six or seven 2,6-dideoxy-hexopyranoses together with the aglycone, tuberogenin. The structures of each of these compounds were established using NMR, mass spectroscopic analysis and chemical evidence. As 8,12;8,20-diepoxy-8,14-secopregnane-type glycosides were observed only in A. tuberosa, these compounds were considered to be characteristic phytochemicals of this plant.
NASA Astrophysics Data System (ADS)
Mcculley, Rebecca; Bush, Lowell; Carlisle, Anna; Ji, Huihua; Nelson, Jim
2014-10-01
Tall fescue pastures cover extensive acreage in the eastern half of the United States and contribute to important ecosystem services, including the provisioning of forage for grazing livestock. Yet little is known concerning how these pastures will respond to climate change. Tall fescue’s ability to persist and provide forage under a warmer and wetter environment, as is predicted for much of this region as a result of climate change, will likely depend on a symbiotic relationship the plant can form with the fungal endophyte, Epichloë coenophiala. While this symbiosis can confer environmental stress tolerance to the plant, the endophyte also produces alkaloids toxic to insects (e.g., lolines) and mammals (ergots; which can cause ‘fescue toxicosis’ in grazing animals). The negative animal health and economic consequences of fescue toxicosis make understanding the response of the tall fescue symbiosis to climate change critical for the region. We experimentally increased temperature (+3oC) and growing season precipitation (+30% of the long-term mean) from 2009 - 2013 in a mixed species pasture, that included a tall fescue population that was 40% endophyte-infected. Warming reduced the relative abundance of tall fescue within the plant community, and additional precipitation did not ameliorate this effect. Warming did not alter the incidence of endophyte infection within the tall fescue population; however, warming significantly increased concentrations of ergot alkaloids (by 30-40%) in fall-harvested endophyte-infected individuals. Warming alone did not affect loline alkaloid concentrations, but when combined with additional precipitation, levels increased in fall-harvested material. Although future warming may reduce the dominance of tall fescue in eastern U.S. pastures and have limited effect on the incidence of endophyte infection, persisting endophyte-infected tall fescue will have higher concentrations of toxic alkaloids which may exacerbate fescue
McCulley, Rebecca L.; Bush, Lowell P.; Carlisle, Anna E.; Ji, Huihua; Nelson, Jim A.
2014-01-01
Tall fescue pastures cover extensive acreage in the eastern half of the United States and contribute to important ecosystem services, including the provisioning of forage for grazing livestock. Yet little is known concerning how these pastures will respond to climate change. Tall fescue's ability to persist and provide forage under a warmer and wetter environment, as is predicted for much of this region as a result of climate change, will likely depend on a symbiotic relationship the plant can form with the fungal endophyte, Epichloë coenophiala. While this symbiosis can confer environmental stress tolerance to the plant, the endophyte also produces alkaloids toxic to insects (e.g., lolines) and mammals (ergots; which can cause “fescue toxicosis” in grazing animals). The negative animal health and economic consequences of fescue toxicosis make understanding the response of the tall fescue symbiosis to climate change critical for the region. We experimentally increased temperature (+3°C) and growing season precipitation (+30% of the long-term mean) from 2009–2013 in a mixed species pasture, that included a tall fescue population that was 40% endophyte-infected. Warming reduced the relative abundance of tall fescue within the plant community, and additional precipitation did not ameliorate this effect. Warming did not alter the incidence of endophyte infection within the tall fescue population; however, warming significantly increased concentrations of ergot alkaloids (by 30–40%) in fall-harvested endophyte-infected individuals. Warming alone did not affect loline alkaloid concentrations, but when combined with additional precipitation, levels increased in fall-harvested material. Although future warming may reduce the dominance of tall fescue in eastern U.S. pastures and have limited effect on the incidence of endophyte infection, persisting endophyte-infected tall fescue will have higher concentrations of toxic alkaloids which may exacerbate fescue
DOE Office of Scientific and Technical Information (OSTI.GOV)
Lin Wu; Zhang-Zhi Huang
The discovery of high levels of Se in soil and water samples from the San Joaquin Valley, California, and of its responsibility for deformity and death of wildlife at Kesterson National Wildlife Refuge have renewed interest in the bioaccumulation of this element. Greenhouse nutrient solution culture and field experiments were conducted to examine the effects of Cl and SO{sub 4} salt on growth and Se accumulation in tall fescue (Festuca arundinacea Schreb.) cultivars Alta, Falcon, and Olympic. Sulfate salt substantially reduced growth inhibition and Se accumulation. Tall fescue from the field irrigated with water low in salinity had higher tissuemore » Se concentration than plants from the field irrigated with water high in salinity. No difference in tissue Se concentration was found among the three tall fescue cultivars; however, forage-type Alta produced the most shoot biomass and accumulated the most total Se. The soil irrigated with water high in salinity had 10 times higher Se concentration than soil irrigated with water low in salinity. The highest soil Se concentration was found in the top 15 cm of soil. Growing fescue for one year reduced soil Se by 50%. Selenium concentrations below 15-cm depth were lower and similar between the bare soil and the soil under tall fescue. Both the high and low salinity water irrigations did not cause high levels of Se accumulation by the tall fescue cultivars unless there was continual addition of Se into the system. This study generated important information for Se bioaccumulation management in soils with elevated salinity and Se levels.« less
USDA-ARS?s Scientific Manuscript database
Ergovaline has been extensively used to study vasoactive effects of endophyte- (Neotyphodium coenophialum) infected tall fescue (Lolium arundinaceum). However, preliminary in vitro tests indicated that an extract of toxic tall fescue seed (E+EXT) is more potent than ergovaline alone in a right rumin...
Warashina, Tsutomu; Umehara, Kaoru; Miyase, Toshio; Noro, Tadataka
2011-10-01
A pregnane glycoside fraction from the roots of Asclepias tuberosa L. caused normal human skin fibroblasts to proliferate. This fraction contained 21 pregnane glycosides whose structures were established using NMR spectroscopic analysis and chemical evidence. The aglycones of most of these compounds were identified as 8,12;8,20-diepoxy-8,14-secopregnanes, such as tuberogenin or 5,6-didehydrotuberogenin, the same aglycones as constituents of the aerial parts of this plant. Some of these compounds also caused proliferation of skin fibroblasts. Copyright © 2011 Elsevier Ltd. All rights reserved.
NASA Astrophysics Data System (ADS)
Kar, Rony; Dalui, Sujit Kumar
2016-03-01
The variation of pressure at the faces of the octagonal plan shaped tall building due to interference of three square plan shaped tall building of same height is analysed by computational fluid dynamics module, namely ANSYS CFX for 0° wind incidence angle only. All the buildings are closely spaced (distance between two buildings varies from 0.4 h to 2 h, where h is the height of the building). Different cases depending upon the various positions of the square plan shaped buildings are analysed and compared with the octagonal plan shaped building in isolated condition. The comparison is presented in the form of interference factors (IF) and IF contours. Abnormal pressure distribution is observed in some cases. Shielding and channelling effect on the octagonal plan shaped building due to the presence of the interfering buildings are also noted. In the interfering condition the pressure distribution at the faces of the octagonal plan shaped building is not predictable. As the distance between the principal octagonal plan shaped building and the third square plan shaped interfering building increases the behaviour of faces becomes more systematic. The coefficient of pressure (C p) for each face of the octagonal plan shaped building in each interfering case can be easily found if we multiply the IF with the C p in the isolated case.
Interior of the second floor dance hall showing tall and ...
Interior of the second floor dance hall showing tall and narrow window openings with 10-foot scale near center, looking south. - Bower Building, 409-413 East Weber Avenue, Stockton, San Joaquin County, CA
Tall shrub layer biomass in conifer plantations in northeastern Minnesota.
Lewis F. Ohmann
1982-01-01
Provides estimates of biomass (pounds/acre) for tall shrub species in 53 conifer plantations in northeastern Minnesota. The estimates are analyzed by plantation age and silvicultural practices used to establish and release the plantations.
Satterfield, Dara A; Villablanca, Francis X; Maerz, John C; Altizer, Sonia
2016-08-01
Long-distance migration can lower infection risk for animal populations by removing infected individuals during strenuous journeys, spatially separating susceptible age classes, or allowing migrants to periodically escape from contaminated habitats. Many seasonal migrations are changing due to human activities including climate change and habitat alteration. Moreover, for some migratory populations, sedentary behaviors are becoming more common as migrants abandon or shorten their journeys in response to supplemental feeding or warming temperatures. Exploring the consequences of reduced movement for host-parasite interactions is needed to predict future responses of animal pathogens to anthropogenic change. Monarch butterflies (Danaus plexippus) and their specialist protozoan parasite Ophryocystis elektroscirrha (OE) provide a model system for examining how long-distance migration affects infectious disease processes in a rapidly changing world. Annual monarch migration from eastern North America to Mexico is known to reduce protozoan infection prevalence, and more recent work suggests that monarchs that forego migration to breed year-round on non-native milkweeds in the southeastern and south central Unites States face extremely high risk of infection. Here, we examined the prevalence of OE infection from 2013 to 2016 in western North America, and compared monarchs exhibiting migratory behavior (overwintering annually along the California coast) with those that exhibit year-round breeding. Data from field collections and a joint citizen science program of Monarch Health and Monarch Alert showed that infection frequency was over nine times higher for monarchs sampled in gardens with year-round milkweed as compared to migratory monarchs sampled at overwintering sites. Results here underscore the importance of animal migrations for lowering infection risk and motivate future studies of pathogen transmission in migratory species affected by environmental change. © The
Megacities and tall buildings: symbiosis
NASA Astrophysics Data System (ADS)
Safarik, Daniel; Ursini, Shawn; Wood, Antony
2018-03-01
Anyone concerned with the development of human civilization in the 21st Century will likely have heard the term «megacity». It is - as it should be - increasingly prevalent in both mainstream and academic discussions of the great trends of our time: urbanization, rising technological and physical connectivity, increasingly polarized extremes of wealth and poverty, environmental degradation, and climate change. It is a subject as large and far-reaching as its name implies. This paper sets the scene on how megacities and the built environment are growing together, and examines the implications for those who plan, design, develop and operate tall buildings and urban infrastructure.
[Tall stature: some classical syndromes].
Gusbin, N; Verloes, A; Daly, A; Beckers, A
2006-01-01
We describe the findings of XYY syndrome in the setting of encountering an individual with this particular condition in the endocrinology clinic. XYY syndrome is a relatively frequent if unfamiliar condition, which is characterized by taller than average height. The extra Y chromosome may play a role in determining the height of these individuals. From this case, a differential diagnosis of tall stature is outlined, in addition to a description of the principal syndromes associated with gigantism. These primarily include Klinefelter syndrome, Marfan syndrome, androgen resistance and growth hormone excess. These various entities are described from the point of view of their symptomatology, biology, pathophysiology and therapeutic characteristics.
Evaluation of alfalfa-tall fescue mixtures across multiple environments
USDA-ARS?s Scientific Manuscript database
Binary grass-legume mixtures can benefit forage production systems in different ways helping growers cope both with increasing input costs (e.g., N fertilizer, herbicides) and potentially more variable weather. The main objective of this study was to evaluate alfalfa (Medicago sativa L.) and tall f...
Inhibition of IGF1-R overcomes IGFBP7-induced chemotherapy resistance in T-ALL.
Bartram, Isabelle; Erben, Ulrike; Ortiz-Tanchez, Jutta; Blunert, Katja; Schlee, Cornelia; Neumann, Martin; Heesch, Sandra; Baldus, Claudia D
2015-10-08
T-cell acute lymphoblastic leukemia (T-ALL) is a genetically heterogeneous disease with the need for treatment optimization. Previously, high expression of Insulin-like growth factor binding protein 7 (IGFBP7), a member of the IGF system, was identified as negative prognostic factor in adult T-ALL patients. Since aberrant IGFBP7 expression was observed in a variety of neoplasia and was relevant for prognosis in T-ALL, we investigated the functional role of IGFBP7 in Jurkat and Molt-4 cells as in vitro models for T-ALL. Jurkat and Molt-4 cells were stably transfected with an IGFBP7 over-expression vector or the empty vector as control. Proliferation of the cells was assessed by WST-1 assays and cell cycle status was measured by flow-cytometry after BrDU/7-AAD staining. The effect of IGFBP7 over-expression on sensitivity to cytostatic drugs was determined in AnnexinV/7-AAD assays. IGF1-R protein expression was measured by Western Blot and flow-cytometric analysis. IGF1-R associated gene expression profiles were generated from microarray gene expression data of 86 T-ALL patients from the Microarrays Innovations in Leukemia (MILE) multicenter study. IGFBP7-transfected Jurkat cells proliferated less, leading to a longer survival in a nutrient-limited environment. Both IGFBP7-transfected Jurkat and Molt-4 cells showed an arrest in the G0/G1 cell cycle phase. Furthermore, Jurkat IGFBP7-transfected cells were resistant to vincristine and asparaginase treatment. Surface expression and whole protein measurement of IGF1-R protein expression showed a reduced abundance of the receptor after IGFBP7 transfection in Jurkat cells. Interestingly, combination of the IGF1-R inhibitor NPV-AEW541 restored sensitivity to vincristine in IGFBP7-transfected cells. Additionally, IGF1-R associated GEP revealed an up-regulation of important drivers of T-ALL pathogenesis and regulators of chemo-resistance and apoptosis such as NOTCH1, BCL-2, PRKCI, and TP53. This study revealed a proliferation
Federal Register 2010, 2011, 2012, 2013, 2014
2012-08-09
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. ER12-2374-000] Tall Bear Group, LLC; Supplemental Notice That Initial Market- Based Rate Filing Includes Request for Blanket Section 204 Authorization This is a supplemental notice in the above-referenced proceeding, of Tall Bear...
Spine Shape in Sagittal and Frontal Planes in Short- and Tall-Statured Children Aged 13 Years
ERIC Educational Resources Information Center
Lichota, Malgorzata
2008-01-01
Study aim: To assess spine curvatures, postural categories and scolioses in short and tall children aged 13 years. Material and methods: Short-statured (below Percentile 10) and tall-statured (above Percentile 90) boys (n = 13 and 18, respectively) and girls (n = 10 and 11, respectively) aged 13 years were studied. The following angles of spine…
Aberrant activity of NKL homeobox gene NKX3-2 in a T-ALL subset
Meyer, Corinna; Kaufmann, Maren; Zaborski, Margarete; MacLeod, Roderick A. F.; Drexler, Hans G.
2018-01-01
T-cell acute lymphoblastic leukemia (T-ALL) is a hematopoietic malignancy originating from T-cell progenitors in which differentiation is blocked at early stages. Physiological expression of specific NKL homeobox genes obeys a hematopoietic NKL-code implicated in the process of lymphopoiesis while in differentiated T-cells these genes are silenced. We propose that this developmental expression pattern underlies the observation that NKL homeobox genes are the most ubiquitous group of transcription factors deregulated in T-ALL, including TLX1, TLX3, NKX2-5 and NKX3-1. Here, we describe a novel member of the NKL homeobox gene subclass, NKX3-2 (BAPX1), which is aberrantly activated in 18% of pediatric T-ALL patients analyzed while being normally expressed in developing spleen. Identification of NKX3-2 expression in T-ALL cell line CCRF-CEM qualified these cells to model its deregulation and function in a leukemic context. Genomic and chromosomal analyses demonstrated normal configuration of the NKX3-2 locus at chromosome 4p15, thus excluding cytogenetic dysregulation. Comparative expression profiling analysis of NKX3-2 patient data revealed deregulated activity of BMP- and MAPK-signalling. These candidate pathways were experimentally confirmed to mediate aberrant NKX3-2 expression. We also show that homeobox gene SIX6, plus MIR17HG and GATA3 are downstream targets of NKX3-2 and plausibly contribute to the pathogenesis of this malignancy by suppressing T-cell differentiation. Finally, NKL homeobox gene NKX2-5 was activated by NKX3-2 in CCRF-CEM and by FOXG1 in PEER, representing mutually inhibitory activators of this translocated oncogene. Together, our findings reveal a novel oncogenic NKL homeobox gene subclass member which is aberrantly expressed in a large subset of T-ALL patients and participates in a deregulated gene network likely to arise in developing spleen. PMID:29746601
Aberrant activity of NKL homeobox gene NKX3-2 in a T-ALL subset.
Nagel, Stefan; Meyer, Corinna; Kaufmann, Maren; Zaborski, Margarete; MacLeod, Roderick A F; Drexler, Hans G
2018-01-01
T-cell acute lymphoblastic leukemia (T-ALL) is a hematopoietic malignancy originating from T-cell progenitors in which differentiation is blocked at early stages. Physiological expression of specific NKL homeobox genes obeys a hematopoietic NKL-code implicated in the process of lymphopoiesis while in differentiated T-cells these genes are silenced. We propose that this developmental expression pattern underlies the observation that NKL homeobox genes are the most ubiquitous group of transcription factors deregulated in T-ALL, including TLX1, TLX3, NKX2-5 and NKX3-1. Here, we describe a novel member of the NKL homeobox gene subclass, NKX3-2 (BAPX1), which is aberrantly activated in 18% of pediatric T-ALL patients analyzed while being normally expressed in developing spleen. Identification of NKX3-2 expression in T-ALL cell line CCRF-CEM qualified these cells to model its deregulation and function in a leukemic context. Genomic and chromosomal analyses demonstrated normal configuration of the NKX3-2 locus at chromosome 4p15, thus excluding cytogenetic dysregulation. Comparative expression profiling analysis of NKX3-2 patient data revealed deregulated activity of BMP- and MAPK-signalling. These candidate pathways were experimentally confirmed to mediate aberrant NKX3-2 expression. We also show that homeobox gene SIX6, plus MIR17HG and GATA3 are downstream targets of NKX3-2 and plausibly contribute to the pathogenesis of this malignancy by suppressing T-cell differentiation. Finally, NKL homeobox gene NKX2-5 was activated by NKX3-2 in CCRF-CEM and by FOXG1 in PEER, representing mutually inhibitory activators of this translocated oncogene. Together, our findings reveal a novel oncogenic NKL homeobox gene subclass member which is aberrantly expressed in a large subset of T-ALL patients and participates in a deregulated gene network likely to arise in developing spleen.
Kasprzycka, Agnieszka; Lalak-Kańczugowska, Justyna; Tys, Jerzy
2018-05-09
In this study fungal pretreatment of non-sterile tall wheat grass via the white rot fungi Flammulina velutipes was studied and the effect on biodegradability of lignocellulosic biomass and methane production, was evaluated. Degradation of lignin, cellulose, hemicellulose, and dry matter in non-sterile tall wheat grass during 28 days of fungal pretreatment using different inoculum ratio (0%-50%) and moisture content (MC) (45% MC, 65% MC, and 75% MC) were assessed via comparison to untreated biomass. Pretreatment with F. velutipes was most effective at 65% MC and 40% inoculum ratio, resulting in 22% lignin removal. The corresponding methane yields were 181.3 Ndm 3 ·kg VS -1 , which were 280% higher than for the untreated tall wheat grass. Copyright © 2018 Elsevier Ltd. All rights reserved.
Lu, Yan-Fei; Lu, Mang
2015-03-21
A 120-day experiment was performed to investigate the effect of a multi-component bioremediation system consisting of tall fescue (Festuca arundinacea), arbuscular mycorrhizal fungus (AMF) (Glomus caledoniun L.), and epigeic earthworms (Eisenia foetida) for cleaning up polycyclic aromatic hydrocarbons (PAHs)-contaminated soil. Inoculation with AMF and/or earthworms increased plant yield and PAH accumulation in plants. However, PAH uptake by tall fescue accounted for a negligible portion of soil PAH removal. Mycorrhizal tall fescue significantly enhanced PAH dissipation, PAH degrader density and polyphenol oxidase activity in soil. The highest PAH dissipation (93.4%) was observed in the combination treatment: i.e., AMF+earthworms+tall fescue, in which the soil PAH concentration decreased from an initial value of 620 to 41 mg kg(-1) in 120 days. This concentration is below the threshold level required for Chinese soil PAH quality (45 mg kg(-1) dry weight) for residential use. Copyright © 2014 Elsevier B.V. All rights reserved.
Tall fescue seed extraction and partial purification of ergot alkaloids
USDA-ARS?s Scientific Manuscript database
Many substances in the tall fescue/endophyte association (Schedonorus arundinaceus/Epichloë coenophiala) have biological activity. Of these compounds only the ergot alkaloids are known to have significant mammalian toxicity and the predominant ergot alkaloids are ergovaline and ergovalinine. Because...
USDA-ARS?s Scientific Manuscript database
Tall fescue (Lolium arundinaceum [Schreb.] S. J. Darbyshire) is a cool-season grass grown on over 20 million acres of pasture land and hayfields in the Midwestern and Southeastern United States. A grazing trial was conducted to determine the effects of stockpiled tall fescue on the physiological and...
The use of graphs in the ergonomic evaluation of tall pilots' sitting posture.
de Ree, J J
1989-10-01
A survey has shown that the average height of KLM pilots has increased by 18 mm (0.7 in) per decade in the last 20 years. Around 6% are taller than 1905 mm (75.0 in), the upper limit of pilot height for flight deck design. With the use of graphs of the flight deck, we established that the main problem of tall pilots is insufficient legroom. Of all KLM/NLM aircraft types, the Boeing 747-200/300 and the Douglas DC-9 are most uncomfortable for pilots taller than 1960 mm (77.2 in). In the Airbus A310, pilots of 2000 mm (78.7 in) have insufficient legroom. The other aircraft types do not present difficulties for pilots up to 2030 mm (79.9 in). Ergonomic adaptations on the flight decks of the Boeing 747-200/300 and the Airbus A310 are necessary to alleviate the problems of tall pilots. Future aircraft types should be designed to accommodate tall pilots. If ergonomic adaptation of the flight deck is impossible, anthropometric limits for pilot selection have to be employed.
McCorkle, Ryan; Thomas, Brittany; Suffaletto, Heidi; Jehle, Dietrich
2010-11-01
To establish normative parameters of the spleen by ultrasonography in tall athletes. Prospective cohort observational study. University of Buffalo, Erie County Community College, University of Texas at Tyler, and Austin College. Sixty-six athletes enrolled and finished the study. Height requirements were at least 6 feet 2 inches for men and at least 5 feet 7 inches in women. Measurement of spleen size in tall athletes. Ultrasound measurements of spleen size in tall athletes were compared with "normal-sized" controls from the literature. Mean, SD, and variance determined the sample distribution, and a one sample t test compared measurements in tall athletes with historical measurements in the average height population. Statistical significance was defined as P < 0.05. Mean height was 192.26 cm (SD, ± 6.52) for men and 176.54 cm (SD, ± 5.19) for women. Mean splenic measurements for all subjects were 12.19 cm (SD, ± 1.45) for spleen length, 8.88 cm (SD, ± 0.96) for spleen width, and 5.55 cm (SD, ± 0.76) for spleen thickness. The study mean for spleen length was 12.192 cm (95% confidence interval, 11.835-12.549) and population mean was 8.94 cm (2 tailed t test, P < 0.01). In this population of tall athletes, normal spleen size was significantly larger than the normal spleen size of an average individual. In the clinical arena, it can be difficult to know when the tall athletes with splenomegaly from infectious mononucleosis can safely return to contact sports. Previously, there has not been a sufficient "norm" for this population, but this study helps to establish baseline values.
Ergovaline recovery from digested residues of grazed tall fescue seedheads
USDA-ARS?s Scientific Manuscript database
Ergot alkaloids produced by the endophyte [Neotyphodium coenophialum (Morgan-Jones and Gams) Glenn, Bacon, and Hanlin] of tall fescue [Lolium arundinaceum (Schreb.) Darbysh.] are a common problem faced by livestock producers. While these toxins are often concentrated within the seedheads, there has...
Reconstructing householder vectors from Tall-Skinny QR
Ballard, Grey Malone; Demmel, James; Grigori, Laura; ...
2015-08-05
The Tall-Skinny QR (TSQR) algorithm is more communication efficient than the standard Householder algorithm for QR decomposition of matrices with many more rows than columns. However, TSQR produces a different representation of the orthogonal factor and therefore requires more software development to support the new representation. Further, implicitly applying the orthogonal factor to the trailing matrix in the context of factoring a square matrix is more complicated and costly than with the Householder representation. We show how to perform TSQR and then reconstruct the Householder vector representation with the same asymptotic communication efficiency and little extra computational cost. We demonstratemore » the high performance and numerical stability of this algorithm both theoretically and empirically. The new Householder reconstruction algorithm allows us to design more efficient parallel QR algorithms, with significantly lower latency cost compared to Householder QR and lower bandwidth and latency costs compared with Communication-Avoiding QR (CAQR) algorithm. Experiments on supercomputers demonstrate the benefits of the communication cost improvements: in particular, our experiments show substantial improvements over tuned library implementations for tall-and-skinny matrices. Furthermore, we also provide algorithmic improvements to the Householder QR and CAQR algorithms, and we investigate several alternatives to the Householder reconstruction algorithm that sacrifice guarantees on numerical stability in some cases in order to obtain higher performance.« less
USDA-ARS?s Scientific Manuscript database
Tall fescue [Lolium arundinaceum (Schreb.) Darbysh.] responds to broiler litter fertilization; however, data concerning the summer dormancy trait are not available. This 3-yr study (2006-2008) determined the nutrient value of broiler litter compared with commercial fertilizer (CF) in tall fescue pro...
SO 2 concentrations near tall stacks
NASA Astrophysics Data System (ADS)
Lott, Robert A.
A study was conducted to investigate plume dispersion during convective (stability class A) conditions. The purpose of the study was to determine if high concentrations occur near sources (1.2-1.8 km) with tall stacks and to identify the plume behavior during these episodes. The study was conducted at the Tennessee Valley Authority's Paradise Steam Plant. The highest concentrations were measured near the source during wind shear capping conditions, which normally correspond to stability class B or C conditions. The measured data are compared with results obtained using a convective boundary layer model and a steady-state Gaussian model.
Analysis of Wind Characteristics at United States Tall Tower Measurement Sites
NASA Astrophysics Data System (ADS)
Elliott, D.; Schwartz, M.; Scott, G.; Haymes, S.
2008-12-01
A major initiative of the U.S. Department of Energy (DOE) is to ensure that 20% of the country's electricity is produced by wind energy by the year 2030. An understanding of the boundary layer characteristics, especially at elevated heights greater than 80 meters (m) above the surface is a key factor for wind turbine design, wind plant layout, and identifying potential markets for advanced wind technology. The wind resource group at the DOE National Renewable Energy Laboratory is analyzing wind data collected at tall (80+ m) towers across the United States. The towers established by both public and private initiative, measure wind characteristics at multiple levels above the surface, with the highest measurement levels generally between 80 and 110 m. A few locations have measurements above 200 m. Measurements of wind characteristics over a wide range of heights are useful to: (1) characterize the local and regional wind climate; (2) validate wind resource estimates derived from numerical models; and (3) directly assess and analyze specific wind resource characteristics such as wind speed shear over the turbine blade swept area. The majority of the available public tall tower measurement sites are located between the Appalachian and Rocky Mountains. The towers are not evenly distributed among the states. The states with the largest number of towers include Indiana, Iowa, Missouri, and Kansas. These states have five or six towers collecting data. Other states with multiple tower locations include Texas, Oklahoma, Minnesota, and Ohio. The primary consideration when analyzing the data from the tall towers is identifying tower flow effects that not only can produce slightly misleading average wind speeds, but also significantly misleading wind speed shear values. In addition, the periods-of-record of most tall tower data are only one to two years in length. The short data collection time frame does not significantly affect the diurnal wind speed pattern though it does
Wang, ShuTing; Dong, Qin; Wang, ZhaoLong
2017-11-01
Organic acids play an important role in cadmium availability, uptake, translocation, and detoxification. A sand culture experiment was designed to investigate the effects of citric acid on Cd uptake, translocation, and accumulation in tall fescue and Kentucky bluegrass. The results showed that two grass species presented different Cd chemical forms, organic acid components and amount in roots. The dormant Cd accumulated in roots of tall fescue was the pectate- and protein- integrated form, which contributed by 84.85%. However, in Kentucky bluegrass, the pectate- and protein- integrated Cd was only contributed by 35.78%, and the higher proportion of Cd form was the water soluble Cd-organic acid complexes. In tall fescue, citric acid dramatically enhanced 2.8 fold of Cd uptake, 3 fold of root Cd accumulation, and 2.3 fold of shoot Cd accumulation. In Kentucky bluegrass, citric acid promoted Cd accumulation in roots, but significantly decreased Cd accumulation in shoots. These results suggested that the enhancements of citric acid on Cd uptake, translocation, and accumulation in tall fescue was associated with its promotion of organic acids and the water soluble Cd-organic acid complexes in roots. Copyright © 2017 Elsevier Inc. All rights reserved.
Observations of flow and dispersion in urban areas with tall buildings have revealed a phenomenon whereby contaminants can be transported vertically up the lee sides of tall buildings due to the vertical flow in the wake of the building. This phenomenon, which contributes to w...
1. EAST END OF MACHINE SHOP No. 2. THE TALL ...
1. EAST END OF MACHINE SHOP No. 2. THE TALL STRUCTURE IS THE VERTICAL FURNACE BUILDING, AND THE TWO-STORY BRICK BUILDING WAS THE HEAT TREATING AND FORGING OFFICE. - U.S. Steel Homestead Works, Machine Shop No. 2, Along Monongahela River, Homestead, Allegheny County, PA
Antiproliferative and apoptotic activities of extracts of Asclepias subulata.
Rascón Valenzuela, Luisa Alondra; Jiménez Estrada, Manuel; Velázquez Contreras, Carlos Arturo; Garibay Escobar, Adriana; Medina Juárez, Luis Angel; Gámez Meza, Nohemi; Robles Zepeda, Ramón Enrique
2015-01-01
Asclepias subulata Decne. (Apocynaceae) is a shrub used in the Mexican traditional medicine for the treatment of cancer. The objective of this study was to evaluate the antiproliferative activity of methanol extract of aerial parts of A. subulata and its fractions against different cancer cell lines. Additionally, we analyzed the mechanism of action of the active fractions. Methanol extract fractions were prepared by serial extraction with n-hexane, ethyl acetate, and ethanol. The antiproliferative activity of methanol extract and its fractions was evaluated, against several murine (M12.C3.F6, RAW 264.7, and L929) and human (HeLa, A549, PC-3, LS 180, and ARPE-19) cell lines by the MTT assay, using concentrations of 0.4-400 µg/mL for 48 h. Ethanol and residual fractions were separated using silica gel column. Apoptosis induction of cancer cells was evaluated by Annexin and JC-1 staining using flow cytometry. Methanol extract and its fractions showed antiproliferative activity against all human cancer cell lines tested. Methanol extract had the highest antiproliferative activity on A549 and HeLa cells (IC50 values < 0.4 and 8.7 µg/mL, respectively). Ethanol and residual fractions exerted significant antiproliferative effect on A549 (IC50 < 0.4 µg/mL) and PC3 cells (IC50 1.4 and 5.1 µg/mL). Apoptotic assays showed that CEF7, CEF9, CRF6, and CRF5 fractions induced mitochondrial depolarization in A549 cells, 70, 73, 77, and 80%, respectively. Those fractions triggered the apoptosis mitochondrial pathway. Our data show that A. subulata extracts have potent antiproliferative properties on human cancer cell lines. This plant should be considered an important source of potent anticancer compounds.
2010-01-01
Background The agriculturally important pasture grass tall fescue (Festuca arundinacea Schreb. syn. Lolium arundinaceum (Schreb.) Darbysh.) is an outbreeding allohexaploid, that may be more accurately described as a species complex consisting of three major (Continental, Mediterranean and rhizomatous) morphotypes. Observation of hybrid infertility in some crossing combinations between morphotypes suggests the possibility of independent origins from different diploid progenitors. This study aims to clarify the evolutionary relationships between each tall fescue morphotype through phylogenetic analysis using two low-copy nuclear genes (encoding plastid acetyl-CoA carboxylase [Acc1] and centroradialis [CEN]), the nuclear ribosomal DNA internal transcribed spacer (rDNA ITS) and the chloroplast DNA (cpDNA) genome-located matK gene. Other taxa within the closely related Lolium-Festuca species complex were also included in the study, to increase understanding of evolutionary processes in a taxonomic group characterised by multiple inter-specific hybridisation events. Results Putative homoeologous sequences from both nuclear genes were obtained from each polyploid species and compared to counterparts from 15 diploid taxa. Phylogenetic reconstruction confirmed F. pratensis and F. arundinacea var. glaucescens as probable progenitors to Continental tall fescue, and these species are also likely to be ancestral to the rhizomatous morphotype. However, these two morphotypes are sufficiently distinct to be located in separate clades based on the ITS-derived data set. All four of the generated data sets suggest independent evolution of the Mediterranean and Continental morphotypes, with minimal affinity between cognate sequence haplotypes. No obvious candidate progenitor species for Mediterranean tall fescues were identified, and only two putative sub-genome-specific haplotypes were identified for this morphotype. Conclusions This study describes the first phylogenetic analysis of
Apoptotic activities of cardenolide glycosides from Asclepias subulata.
Rascón-Valenzuela, L A; Velázquez, C; Garibay-Escobar, A; Vilegas, W; Medina-Juárez, L A; Gámez-Meza, N; Robles-Zepeda, R E
2016-12-04
Asclepias subulata Decne. (Apocynaceae) is a shrub occurring in Sonora-Arizona desert. The ethnic groups of Sonora, Mexico, Seris and Pimas, use this plant for the treatment of sore eyes, gastrointestinal disorders and cancer. To determine the cell death pathways that the cardenolide glycosides with antiproliferative activity found in the methanol extract of A. subulata are able to activate. The effect of cardenolide glycosides isolated of A. subulata on induction of apoptosis in cancer cells was evaluated through the measuring of several key events of apoptosis. A549 cells were treated for 12h with doses of 3.0, 0.2, 3.0 and 1.0µM of 12, 16-dihydroxicalotropin, calotropin, corotoxigenin 3-O-glucopyranoside and desglucouzarin, respectively. Apoptotic and necrotic cell levels were measured by double staining with annexin V-FITC/PI. Mitochondrial membrane depolarization was examined through JC-1 staining. Apoptosis cell death and the apoptosis pathways activated by cardenolide glycosides isolated of A. subulata were further characterized by the measurement of caspase-3, caspase-8 and caspase-9 activity. Apoptotic assays showed that the four cardenolide glycosides isolated of A. subulata induced apoptosis in A549 cells, which was evidencing by phosphatidylserine externalization in 18.2%, 17.0%, 23.9% and 22.0% for 12, 16-dihydroxicalotropin, calotropin, corotoxigenin 3-O-glucopyranoside and desglucouzarin, respectively, compared with 4.6% of control cells. Cell death was also associated with a decrease in mitochondrial membrane potential, which was more than 75% in the treated cultures respect to control. The activation of caspase-3 was observed in all cardenolide glycosides-treated cancer cells indicating the caspase-dependent apoptosis of A549 cells. Extrinsic and intrinsic apoptosis pathways were activated by cardenolide glycosides treatment at the doses tested. In this study was found that cardenolide glycosides, 12, 16-dihydroxicalotropin, calotropin
Tidal influence on particulate organic carbon export fluxes around a tall seamount
NASA Astrophysics Data System (ADS)
Turnewitsch, Robert; Dumont, Matthew; Kiriakoulakis, Kostas; Legg, Sonya; Mohn, Christian; Peine, Florian; Wolff, George
2016-12-01
As tall seamounts may be 'stepping stones' for dispersion and migration of deep open ocean fauna, an improved understanding of the productivity at and food supply to such systems needs to be formed. Here, the 234Th/238U approach for tracing settling particulate matter was applied to Senghor Seamount - a tall sub-marine mountain near the tropical Cape Verde archipelago - in order to elucidate the effects of topographically-influenced physical flow regimes on the export flux of particulate organic carbon (POC) from the near-surface (topmost ⩽ 100 m) into deeper waters. The comparison of a suitable reference site and the seamount sites revealed that POC export at the seamount sites was ∼2-4 times higher than at the reference site. For three out of five seamount sites, the calculated POC export fluxes are likely to be underestimates. If this is taken into account, it can be concluded that POC export fluxes increase while the passing waters are advected around and over the seamount, with the highest export fluxes occurring on the downstream side of the seamount. This supports the view that biogeochemical and biological effects of tall seamounts in surface-ocean waters might be strongest at some downstream distance from, rather than centred around, the seamount summit. Based on measured (vessel-mounted ADCP) and modelled (regional flow field: AVISO; internal tides at Senghor: MITgcm) flow dynamics, it is proposed that tidally generated internal waves result in a 'screen' of increased rates of energy dissipation that runs across the seamount and leads to a combination of two factors that caused the increased POC export above the seamount: (1) sudden increased upward transport of nutrients into the euphotic zone, driving brief pulses of primary production of new particulate matter, followed by the particles' export into deeper waters; and (2) pulses of increased shear-driven aggregation of smaller, slower-settling into larger, faster-settling particles. This study
USDA-ARS?s Scientific Manuscript database
As part of a large 2-year study documenting the physiologic impact of grazing endophyte-infected tall fescue on growing cattle, 2 experiments were conducted to characterize and evaluate the effects of grazing 2 levels of toxic endophyte-infected tall fescue pastures on vascular contractility and ser...
Probabilistic safety assessment of the design of a tall buildings under the extreme load
DOE Office of Scientific and Technical Information (OSTI.GOV)
Králik, Juraj, E-mail: juraj.kralik@stuba.sk
2016-06-08
The paper describes some experiences from the deterministic and probabilistic analysis of the safety of the tall building structure. There are presented the methods and requirements of Eurocode EN 1990, standard ISO 2394 and JCSS. The uncertainties of the model and resistance of the structures are considered using the simulation methods. The MONTE CARLO, LHS and RSM probabilistic methods are compared with the deterministic results. On the example of the probability analysis of the safety of the tall buildings is demonstrated the effectiveness of the probability design of structures using Finite Element Methods.
Probabilistic safety assessment of the design of a tall buildings under the extreme load
NASA Astrophysics Data System (ADS)
Králik, Juraj
2016-06-01
The paper describes some experiences from the deterministic and probabilistic analysis of the safety of the tall building structure. There are presented the methods and requirements of Eurocode EN 1990, standard ISO 2394 and JCSS. The uncertainties of the model and resistance of the structures are considered using the simulation methods. The MONTE CARLO, LHS and RSM probabilistic methods are compared with the deterministic results. On the example of the probability analysis of the safety of the tall buildings is demonstrated the effectiveness of the probability design of structures using Finite Element Methods.
Suspended chains damp wind-induced oscillations of tall flexible structures
NASA Technical Reports Server (NTRS)
Reed, W. H., III
1968-01-01
Hanging-chain system, which is a form of impact damper, suppresses wind-induced bending oscillations of tall cylindrical antenna masts. A cluster of chains enclosed in a neoprene shroud is suspended inside the tip of the antenna mast, forming a simple method of damping structural vibrations.
Ergovaline recovery from digested residues of grazed tall fescue seedheads
USDA-ARS?s Scientific Manuscript database
Ergot alkaloids produced by the endophyte [Neotyphodium coenophialum] of tall fescue [Lolium arundinaceum] induce a toxicosis in cattle that is a common problem in the southeastern USA. While these toxins are heavily concentrated within the seedheads, there is a lack of information on the degree th...
Browse evaluation of tall shrubs based on direct measurement of a management objective
Keigley, R.B.; Frisina, M.R.; Kitchen, Stanley G.; Pendleton, Rosemary L.; Monaco, Thomas A.; Vernon, Jason
2008-01-01
The monitoring of Geyer willow was based on the following management objective: Browsing will prevent fewer than 50 percent of Geyer willow shrubs from growing taller than 3 m . Three questions were addressed: (1) Is browsing a potential factor? (2) If so, can young plants grow taller than 3 meters? (3) If not, is browsing the dominant factor? All shrubs were intensely browsed. With a post-browsing growth rate of 5.0 cm per yr, no shrub could grow 3 m tall. Analyses of stem growth rate excluded dominant roles for climate and plant vigor. Browsing and stem age were the dominant factors that limited growth to 3 m tall.
Tall shrub dynamics in northern Minnesota aspen and conifer forests.
James C. Galogh; David F. Grigal
1988-01-01
Tall shrub dynamics were examined in upland stands in northern Minnesota. Mortality rates of shrub stems did not differ among the stands. Shrub stem regeneration did differ among the stands and was related to overstory characteristics, soil moisture, and soil nutrients. Stem density was regulated by annual regeneration.
Endophyte status of tall fescue (festuca arundinacea) affects seed predation
USDA-ARS?s Scientific Manuscript database
In a preliminary study seed of a tall fescue (Festuca arundinacea Schreb.) variety ‘Jesup’ without endophyte were consumed at a slightly higher rate by common cricket (Acheta domesticus L.) in a standard feeding trial than the same fescue variety with the endophyte. Although, the preference for the...
A Simple Tall Fescue Seed Extraction and Partial Purification of Ergovaline
USDA-ARS?s Scientific Manuscript database
There are several substances present in the tall fescue/endophyte association (Lolium arundinaceum /Neotyphodium coenophialum) that have biological activity. These include the pyrrolizidine and ergot alkaloids plus peramine. Of these compounds only the ergot alkaloids have significant mammalian to...
Process for tertiary oil recovery using tall oil pitch
Radke, C.J.
1983-07-25
A process and compositions for enhancing the recovery of acid crudes are disclosed. The process involves injecting caustic solutions into the reservoir to maintain a pH of 11 to 13. The fluid contains an effective amount of multivalent cation for inhibiting alkaline silica dissolution with the reservoir. A tall oil pitch soap is added as a polymeric mobility control agent. (DMC)
View of worlds tallest totem pole, 136.5 feet tall. First ...
View of worlds tallest totem pole, 136.5 feet tall. First potlatch pole since 1904. Dedicated to all things and all peoples of southeast Alaska, 1971. Oct potlatch, looking northwest - Kake Salmon Cannery, Totem Pole, Kake, Wrangell-Petersburg Census Area, AK
Welch, Kevin D; Green, Benedict T; Gardner, Dale R; Cook, Daniel; Pfister, James A; Stegelmeier, Bryan L; Panter, Kip E; Davis, T Zane
2010-04-01
To determine the contribution of 7,8-methylenedioxylycoctonine (MDL)-type alkaloids to the toxic effects of tall larkspur (Delphinium spp) consumption in cattle. Sixteen 2-year-old Angus steers. Plant material from 3 populations of tall larkspur that contained different concentration ratios of MDL-type-to-N-(methylsuccinimido) anthranoyllycoctonine (MSAL)-type alkaloids was collected, dried, and finely ground. For each plant population, a dose of ground plant material that would elicit similar clinical signs of toxicosis in cattle after oral administration was determined on the basis of the plants' MSAL-type alkaloid concentration. Cattle were treated via oral gavage with single doses of ground plant material from each of the 3 populations of tall larkspur; each animal underwent 1 to 3 single-dose treatments (> or = 21-day interval between treatments). Heart rate was recorded immediately before (baseline) and 24 hours after each larkspur treatment. Tall larkspur populations with a lower MDL-type-to-MSAL-type alkaloid concentration ratio required a greater amount of MSAL-type alkaloids to cause the expected clinical signs of toxicosis (including increased heart rate) in cattle. Results indicated that the typically less toxic MDL-type alkaloids contributed in a significant manner to the toxic effects of tall larkspur in steers. Consequently, both the concentration of MSAL-type alkaloids and the total concentration of MSAL- and MDL-type alkaloids should be determined when assessing the relative toxicity of tall larkspur populations. These results provide valuable information to determine the risk of toxicosis in cattle grazing on tall larkspur-infested rangelands.
Tall oil precursors in three western pines: ponderosa, lodgepole, and limber pine
DOE Office of Scientific and Technical Information (OSTI.GOV)
Conner, A.H.; Diehl, M.A.; Rowe, J.W.
1980-01-01
The nonvolatile diethyl ether extracts (NVEE) from ponderosa, lodgepole, and limber pines were analyzed to determine the amounts and chemical composition of the tall oil precursors (resin acids, fatty acids, and nonsaponifiables) and turpentine precursors available from these species. The results showed that crude tall oil compositions would be approximately as follows (% resin acids, % fatty acids, % nonsaponifiables); ponderosa pine - sapwood (15, 75, 10), heartwood (78, 7, 15); lodgepole pine - sapwood (24, 57, 19), heartwood (51, 26, 23); limber pine - sapwood (10, 82, 8), heartwood (23, 60, 17). The larger nonsaponifiables content, as compared tomore » southern pines, is the major factor in explaining the greater difficulty in the distillative refining of tall oil from these western species. Eight resin acids were found in ponderosa and lodgepole pine: palustric, isopimaric, abietic, dehydroabietic, and neoabietic acids predominated. Seven resin acids were identified from limber pine: anticopalic, isopimaric, abietic, and dehydroabietic acids predominated. The free and esterfied fatty acids from these species contained predominantly oleic and linoleic acids. In addition limber pine contained major amounts of 5, 9, 12-octadecatrienoic acid. The nonsaponifiables contained mostly diterpenes and the sterols, sitosterol and campesterol. The major turpentine components were: ponderosa pine - ..beta..-pinene and 3-carene; lodgepole pine - ..beta..-phellandrene; and limber pine - 3-carene, ..beta..-phellandrene, ..cap alpha..-piene, and ..beta..-pinene.« less
Brown, M A; Brown, A H; Jackson, W G; Miesner, J R
1997-04-01
Reproductive and preweaning data on 233 Angus (A), Brahman (B), and reciprocal-cross cows (AB, BA) and 455 two- and three-breed cross calves managed on common bermudagrass or endophyte-infected tall fescue were used to evaluate the interaction of forage type with individual and maternal heterosis and maternal and grandmaternal breed effects. Cows were born from 1988 to 1991 and calves from 15 Polled Hereford sires were born from 1991 to 1994. Heterosis for calving rate was similar and important on both forages (P < .01), but maternal effects were small on each forage. Maternal heterosis for birth weight differed between common bermudagrass and tall fescue (P < .10) and grandmaternal effects were evident on bermudagrass (P < .05) but not tall fescue. Forage effects were generally substantial for 205-d weight, weaning hip height, and weaning weight:height ratio (P < .01), and maternal heterosis for these traits was larger on tall fescue than on common bermudagrass (P < .01). Grandmaternal effects were in favor of Angus for 205-d weight, hip height, and weight:height ratio on common bermudagrass (P < .05) but not on tall fescue. Heterosis for 205-d weight per cow exposed was substantial on both forages (P < .01) and was numerically larger on tall fescue than on bermudagrass, but maternal effects were not significant. These results suggest more advantage for Brahman-cross cows over purebreds on endophyte-infected tall fescue than a similar comparison on common bermudagrass. They also suggest an advantage for Angus in grandmaternal effects on bermudagrass but not tall fescue.
USDA-ARS?s Scientific Manuscript database
Stockpiled tall fescue can provide economical winter feed for grazing livestock in the mid-Atlantic of the United States. The objective of this study was to evaluate the effect of N rate and application timing on the yield of stockpiled tall fescue. Four N rates ranging from 0 to 120 lb N/acre wer...
DOE Office of Scientific and Technical Information (OSTI.GOV)
Dehgan, B.; Wang, S.C.
1983-01-01
Most of the hydrocarbon plants reported in the literature are not suitable for cultivation under Florida conditions. Preliminary results of field and greenhouse trials have indicated two species; Euphorbia tirucalli, which is suitable only for south Florida and Asclepias curassavica which has shown promise for the entire state. The hydrocarbon content of E. tirucalli increases with age of the plants (8.19-11.90%), whereas, that of A. curassavica is influenced positively by fertilization (3.62%) and negatively by supplemental irrigation (2.75%). A comparison between the results of field trials with A. curassavica in Florida and E. lathyris in California shows similar biomass yieldsmore » under unirrigated conditions, despite 3.6 to 7.8 times greater nitrogen application for E. lathyris. Because of environmental conditions in Florida, E. lathyris is not capable of good growth. It is suggested that future research on hydrocarbon plants should concentrate on selection of individuals or species with vigorous, upright growth habits, low fertilizer-irrigation requirements and high hydrocarbon contents. 18 references.« less
Caruso, Christina M; Remington, Davin L D; Ostergren, Kate E
2005-11-01
The availability of both pollen and resources can influence natural selection on floral traits, but their relative importance in shaping floral evolution is unclear. We experimentally manipulated pollinator and resource (fertilizer and water) availability in the perennial wildflower Asclepias syriaca L. Nine floral traits, one male fitness component (number of pollinia removed), and two female fitness components (number of pollinia inserted and number of fruits initiated) were measured for plants in each of three treatments (unmanipulated control, decreased pollinator access, and resource supplementation). Although decreasing pollinators' access to flowers did result in fewer pollinia inserted and removed, fruit set and phenotypic selection on floral traits via female and male fitness did not differ from the control. In contrast, resource supplementation increased fruit set, and phenotypic selection on seven out of nine floral traits was stronger via female than male fitness, consistent with the prediction that selection via female fitness would be greater when reproduction was less resource-limited. Our results support the hypothesis that abiotic resource availability can influence floral evolution by altering gender-specific selection.
Ruminal tryptophan-utilizing bacteria degrade ergovaline from tall fescue seed extract
USDA-ARS?s Scientific Manuscript database
The objectives of this study were to evaluate degradation of ergovaline in a tall fescue [Lolium arundinaceum (Schreb.) Darbysh.] seed extract by rumen microflora ex vivo and to identify specific bacteria capable of ergovaline degradation in vitro. Rumen cell suspensions were prepared by harvesting ...
Hand, Melanie L; Cogan, Noel O I; Forster, John W
2012-04-01
Allohexaploid tall fescue (Festuca arundinacea Schreb. syn. Lolium arundinaceum [Schreb.] Darbysh.) is an agriculturally important grass cultivated for pasture and turf world-wide. Genetic improvement of tall fescue could benefit from the use of non-domesticated germplasm to diversify breeding populations through the incorporation of novel and superior allele content. However, such potential germplasm must first be characterised, as three major morphotypes (Continental, Mediterranean and rhizomatous) with varying degrees of hybrid interfertility are commonly described within this species. As hexaploid tall fescue is also a member of a polyploid species complex that contains tetraploid, octoploid and decaploid taxa, it is also possible that germplasm collections may have inadvertently sampled some of these sub-species. In this study, 1,040 accessions from the publicly available United States Department of Agriculture tall fescue and meadow fescue germplasm collections were investigated. Sequence of the chloroplast genome-located matK gene and the nuclear ribosomal DNA internal transcribed spacer (rDNA ITS) permitted attribution of accessions to the three previously known morphotypes and also revealed the presence of tall fescue sub-species of varying ploidy levels, as well as other closely related species. The majority of accessions were, however, identified as Continental hexaploid tall fescue. Analysis using 34 simple sequence repeat markers was able to further investigate the level of genetic diversity within each hexaploid tall fescue morphotype group. At least two genetically distinct sub-groups of Continental hexaploid tall fescue were identified which are probably associated with palaeogeographic range expansion of this morphotype. This work has comprehensively characterised a large and complex germplasm collection and has identified genetically diverse accessions which may potentially contribute valuable alleles at agronomic loci for tall fescue cultivar
High-Throughput Flow Cytometry Identifies Small-Molecule Inhibitors for Drug Repurposing in T-ALL.
Perez, Dominique R; Nickl, Christian K; Waller, Anna; Delgado-Martin, Cristina; Woods, Travis; Sharma, Nitesh D; Hermiston, Michelle L; Loh, Mignon L; Hunger, Stephen P; Winter, Stuart S; Chigaev, Alexandre; Edwards, Bruce; Sklar, Larry A; Matlawska-Wasowska, Ksenia
2018-05-01
Kinase inhibitors have dramatically increased patient survival in a multitude of cancers, including hematological malignancies. However, kinase inhibitors have not yet been integrated into current clinical trials for patients with T-cell-lineage acute lymphoblastic leukemia (T-ALL). In this study, we used a high-throughput flow cytometry (HTFC) approach to test a collection of small-molecule inhibitors, including 26 FDA-approved tyrosine kinase inhibitors in a panel of T-ALL cell lines and patient-derived xenografts. Because hypoxia is known to cause resistance to chemotherapy, we developed a synthetic niche that mimics the low oxygen levels found in leukemic bone marrow to evaluate the effects of hypoxia on the tested inhibitors. Drug sensitivity screening was performed using the Agilent BioCel automated liquid handling system integrated with the HyperCyt HT flow cytometry platform, and the uptake of propidium iodide was used as an indication of cell viability. The HTFC dose-response testing identified several compounds that were efficacious in both normal and hypoxic conditions. This study shows that some clinically approved kinase inhibitors target T-ALL in the hypoxic niche of the bone marrow.
Liggieri, Constanza; Arribére, M Cecilia; Trejo, Sebastián A; Canals, Francesc; Avilés, Francesc X; Priolo, Nora S
2004-08-01
In this work we report the isolation, purification and characterization of a new protease from latex of Asclepias curassavica L. Crude extract (CE) was obtained by gathering latex on 0.1 M citric-phosphate buffer with EDTA and cysteine with subsequent ultracentrifugation. Proteolytic assays were made on casein or azocasein as substrates. Caseinolytic activity was completely inhibited by E-64. Stability at different temperatures, optimum pH and ionic strength were evaluated by measuring the residual caseinolytic activity at different times after the incubation. CE showed the highest caseinolytic activity at pH 8.5 in the presence of 12 mM cysteine. CE was purified by cation exchange chromatography (FPLC). Two active fractions, homogeneous by SDS-PAGE, were isolated. The major purified protease (asclepain cI) showed a molecular mass of 23.2 kDa by mass spectrometry and a pI higher than 9.3. The N-terminal sequence showed a high similarity with those of other plant cysteine proteinases. When assayed on N-alpha-CBZ-aminoacid-p-nitrophenyl esters, the enzyme showed higher preference for the glutamine derivative. Determinations of kinetic parameter (km and Kcat) were performed with PFLNA.
Çelebi, Mehmet; Hasan Ulusoy,; Nori Nakata,
2016-01-01
Increasing inventory of tall buildings in the United States and elsewhere may be subjected to motions generated by near and far seismic sources that cause long-period effects. Multiple sets of records that exhibited such effects were retrieved from tall buildings in Tokyo and Osaka ~ 350 km and 770 km from the epicenter of the 2011 Tohoku earthquake. In California, very few tall buildings have been instrumented. An instrumented 52-story building in downtown Los Angeles recorded seven local and distant earthquakes. Spectral and system identification methods exhibit significant low frequencies of interest (~0.17 Hz, 0.56 Hz and 1.05 Hz). These frequencies compare well with those computed by transfer functions; however, small variations are observed between the significant low frequencies for each of the seven earthquakes. The torsional and translational frequencies are very close and are coupled. Beating effect is observed in at least two of the seven earthquake data.
NASA Astrophysics Data System (ADS)
Menicovich, David
By 2050 an estimated 9 billion people will inhabit planet earth and almost all the growth in the next 40 years will be in urban areas putting tremendous pressure on creating sustainable cities. The rapid increase in population, rise in land value and decrease in plot sizes in cities around the world positions tall or more importantly slender buildings as the best suited building typology to address the increasingly critical demand for space in this pressing urbanization trend. However, the majority of new tall building urban developments have not followed principles of environmental and/or sustainable design and incentives to innovate, both technological and economic, are urgently required. The biggest climatic challenge to the design, construction and performance of tall buildings is wind sensitivity. This challenge is further emphasized seeing two market driven trends: on one hand as urban population grows, land value rises while plot sizes decrease; on the other, more cost effective modular construction techniques are introducing much lighter tall building structures. The combination of the two suggests a potential increase in the slenderness ratio of tall buildings (typically less than 6:1 but stretching to 20:1 in the near future) where not-so-tall but much lighter buildings will be the bulk of new construction in densely populated cities, providing affordable housing in the face of fast urbanization but also introducing wind sensitivity which was previously the problem of a very limited number of super tall buildings to a much larger number of buildings and communities. The proposed research aims to investigate a novel approach to the interaction between tall buildings and their environment. Through this approach the research proposes a new relationship between buildings and the flows around, through and inside them, where buildings could adapt to better control and manage the air flow around them, and consequently produce significant opportunities to reduce
Antiproliferative activity of cardenolide glycosides from Asclepias subulata.
Rascón-Valenzuela, L; Velázquez, C; Garibay-Escobar, A; Medina-Juárez, L A; Vilegas, W; Robles-Zepeda, R E
2015-08-02
Asclepias subulata Decne. is a shrub occurring in Sonora-Arizona desert (Mexico-USA). The ethnic groups, Seris and Pimas, use this plant for the treatment of sore eyes, gastrointestinal disorders and cancer. To isolate the compounds responsible for antiproliferative activity of the methanol extract of A. subulata. A bioguided fractionation of methanol extract of A. subulata was performed using MTT assay to measure the antiproliferative activity of different compounds on three human cancer cell lines (A549, LS 180 and PC-3), one murine cancer cell line (RAW 264.7) and one human normal cell line (ARPE-19). The methanol extract was partitioned with hexane, ethyl acetate and ethanol. The active fractions, ethanol and residual, were fractioned by silica-column chromatography and active sub-fractions were separated using HPLC. The chemical structures of isolated compounds were elucidated with different chemical and spectroscopic methods. A new cardenolide glycoside, 12, 16-dihydroxycalotropin, and three known, calotropin, corotoxigenin 3-O-glucopyranoside and desglucouzarin, were isolated of active sub-fractions. All isolated compounds showed a strong antiproliferative activity in human cancer cells. Calotropin was the more active with IC50 values of 0.0013, 0.06 and 0.41 µM on A549, LS 180 and PC-3 cell lines, respectively; while 12, 16-dihydroxycalotropin reached values of 2.48, 5.62 and 11.70 µM, on the same cells; corotoxigenin 3-O-glucopyranoside had IC50 of 2.64, 3.15 and 6.62 µM and desglucouzarin showed values of 0.90, 6.57 and 6.62, µM. Doxorubicin, positive control, showed IC50 values of 1.78, 6.99 and 3.18 µM, respectively. The isolated compounds had a weak effect on murine cancer cells and human normal cells, exhibiting selectivity to human cancer cells. In this study, we found that 12, 16-dihydroxicalotropin, calotropin, corotoxigenin 3-O-glucopyranoside and desglucouzarin are responsible of antiproliferative properties of A. subulata, and that these
Tall oil precursors and turpentine in Jack and Eastern White Pine
DOE Office of Scientific and Technical Information (OSTI.GOV)
Conner, A.H.; Diehl, M.A.; Rowe, J.W.
1980-04-01
The tall oil precursors and turpentine from jack pine (Pinus banksiana Lamb.) and eastern white pine (Pinus strobus L.) were investigated. The tall oil precursors (resin acids, fatty acids, and unsaponifiables were determined by chemical fractionation of the nonvolatile diethyl ether extractives (NVEE) of these speices: (approximate % resin acids, % fatty acids, % unsaponifiables, and % acids other that fatty and resin acids) - jack pine sapwood (10, 60, 10, 20%), heartwood (38, 12, 6, 44%); eastern white pine sapwood (11, 57, 9, 22%), and heartwood (11, 18, 10, 62%). The resin acids were a mixture of the pimaricmore » and abietic acids common to pines. In addition, eastern white pine contained major amounts of the resin acid, anticopalic acid. The fatty acids were predominately oleic, linoleic, and 5, 9, 12-octadecatrienoic acids. The unsaponsiables were a complex mixture of diterpenes and sterols (mainly campesterol and sitosterol). On treating these species with paraquat, lightwood occurred in the sapwood but not in the heartwood areas as we have oberved with other pines. The NVEE of the lightwood areas contained increased amounts of resin acids, unsaponifiables, and acids other than fatty and resin acids. The total fatty acid content was essentially unchanged. Since fatty acid components are preferentially lost by esterification with neutral alcoholic constituents in the unsaponifiables during the distillation refining of crude tall oil, the increased unsaponifiables relative to the constant fatty acid content might result in a net reduction in fatty acid recovery from lightered trees. The turpentine content of both jack and eastern white pine increased on lightering and was primarily a mixture of ..cap alpha..- and ..beta..-pinene.« less
Xia, Xing-Zhong; Treanor, James; Senaldi, Giorgio; Khare, Sanjay D.; Boone, Tom; Kelley, Michael; Theill, Lars E.; Colombero, Anne; Solovyev, Irina; Lee, Frances; McCabe, Susan; Elliott, Robin; Miner, Kent; Hawkins, Nessa; Guo, Jane; Stolina, Marina; Yu, Gang; Wang, Judy; Delaney, John; Meng, Shi-Yuan; Boyle, William J.; Hsu, Hailing
2000-01-01
We and others recently reported tumor necrosis factor (TNF) and apoptosis ligand–related leukocyte-expressed ligand 1 (TALL-1) as a novel member of the TNF ligand family that is functionally involved in B cell proliferation. Transgenic mice overexpressing TALL-1 have severe B cell hyperplasia and lupus-like autoimmune disease. Here, we describe expression cloning of a cell surface receptor for TALL-1 from a human Burkitt's lymphoma RAJI cell library. The cloned receptor is identical to the previously reported TNF receptor (TNFR) homologue transmembrane activator and calcium modulator and cyclophilin ligand (CAML) interactor (TACI). Murine TACI was subsequently isolated from the mouse B lymphoma A20 cells. Human and murine TACI share 54% identity overall. Human TACI exhibits high binding affinities to both human and murine TALL-1. Soluble TACI extracellular domain protein specifically blocks TALL-1–mediated B cell proliferation without affecting CD40- or lipopolysaccharide-mediated B cell proliferation in vitro. In addition, when injected into mice, soluble TACI inhibits antibody production to both T cell–dependent and –independent antigens. By yeast two-hybrid screening of a B cell library with TACI intracellular domain, we identified that, like many other TNFR family members, TACI intracellular domain interacts with TNFR-associated factor (TRAF)2, 5, and 6. Correspondingly, TACI activation in a B cell line results in nuclear factor κB and c-Jun NH2-terminal kinase activation. The identification and characterization of the receptor for TALL-1 provides useful information for the development of a treatment for B cell–mediated autoimmune diseases such as systemic lupus erythematosus. PMID:10880535
4. EXTERIOR OF SOUTH END OF BUILDING 105 SHOWING TALL ...
4. EXTERIOR OF SOUTH END OF BUILDING 105 SHOWING TALL RUSTIC STYLE CHIMNEY WITH GABLE FRAME, METAL ROOF, AND CONCRETE WALKWAY AND STEP TO OPEN SIDE-ENTRY DOOR AT PHOTO ENTER. ORIGINAL DECORATIVE WOOD SHIPLAP SIDING ON UPPER END GABLE HAS BEEN COVERED WITH ASPHALT SHINGLES. VIEW TO NORTH. - Rush Creek Hydroelectric System, Worker Cottage, Rush Creek, June Lake, Mono County, CA
Occupational asthma induced by tall oil in the rubber tyre industry.
Tarlo, S M
1992-01-01
A worker in the rubber tyre industry is described with occupational asthma from exposure to a solution of tall oil, a pine resin, confirmed by specific inhalation challenge. This supports studies of contact dermatitis which have suggested abietic and dehydroabietic acid oxidants to be the cause of colophony induced allergic reactions.
Tall shrub and tree expansion in Siberian tundra ecotones since the 1960s.
Frost, Gerald V; Epstein, Howard E
2014-04-01
Circumpolar expansion of tall shrubs and trees into Arctic tundra is widely thought to be occurring as a result of recent climate warming, but little quantitative evidence exists for northern Siberia, which encompasses the world's largest forest-tundra ecotonal belt. We quantified changes in tall shrub and tree canopy cover in 11, widely distributed Siberian ecotonal landscapes by comparing very high-resolution photography from the Cold War-era 'Gambit' and 'Corona' satellite surveillance systems (1965-1969) with modern imagery. We also analyzed within-landscape patterns of vegetation change to evaluate the susceptibility of different landscape components to tall shrub and tree increase. The total cover of tall shrubs and trees increased in nine of 11 ecotones. In northwest Siberia, alder (Alnus) shrubland cover increased 5.3-25.9% in five ecotones. In Taymyr and Yakutia, larch (Larix) cover increased 3.0-6.7% within three ecotones, but declined 16.8% at a fourth ecotone due to thaw of ice-rich permafrost. In Chukotka, the total cover of alder and dwarf pine (Pinus) increased 6.1% within one ecotone and was little changed at a second ecotone. Within most landscapes, shrub and tree increase was linked to specific geomorphic settings, especially those with active disturbance regimes such as permafrost patterned-ground, floodplains, and colluvial hillslopes. Mean summer temperatures increased at most ecotones since the mid-1960s, but rates of shrub and tree canopy cover expansion were not strongly correlated with temperature trends and were better correlated with mean annual precipitation. We conclude that shrub and tree cover is increasing in tundra ecotones across most of northern Siberia, but rates of increase vary widely regionally and at the landscape scale. Our results indicate that extensive changes can occur within decades in moist, shrub-dominated ecotones, as in northwest Siberia, while changes are likely to occur much more slowly in the highly continental
Electrocardiographical case. A tale of tall T's. Hyperkalaemia.
Chew, H C; Lim, S H
2005-08-01
A 63-year-old woman presented at the emergency department (ED) with a history of increasing lethargy and drowsiness. The electrocardiogram (ECG) showed tall peaked T waves with broadening of the QRS interval, suggestive of hyperkalaemia. This patient had an elevated serum potassium level due to diabetic ketoacidosis. She was treated with intravenous calcium chloride and insulin with 50% dextrose. The ECG changes associated with hyperkalaemia are discussed, with illustrations from a second 48-year-old male patient with renal failure who presented with malaise, lethargy and generalised weakness.
Tall fescue management in the Piedmont: Sequestration of soil organic and total nitrogen
USDA-ARS?s Scientific Manuscript database
High quality soil-surface characteristics are important for developing environmentally sustainable agroecosystems. We evaluated the factorial combination of fertilization regime (inorganic and broiler litter) and tall fescue [Lolium arundinaceum (Schreb.) Darbysh.]-endophyte association (free, nove...
Ergovaline stability in tall fescue based on sample handling and storage methods
USDA-ARS?s Scientific Manuscript database
Ergovaline is an ergot alkaloid produced by the endophyte Neotyphodium coenophialum (Morgan-Jones and Gams) found in tall fescue [Schedonorus arundinacea (Schreb.) Dumort.] and blamed for a multitude of livestock disorders. Ergovaline is known to be unstable and affected by many variables. The objec...
Loiola, Carina Mendes; Azevedo, Alinne Oliveira Nunes; Diniz, Leandro E C; Aragão, Wilson Menezes; Azevedo, Carlos Diego de O; Santos, Pedro Henrique A D; Ramos, Helaine Christine C; Pereira, Messias Gonzaga; Ramos, Semíramis R Ramalho
2016-01-01
The diversity and genetic relationships among two accessions of tall coconut palms collected in Brazil and seven accessions introduced from different geographic regions of the world were analyzed using 25 microsatellite primers, 19 of which were polymorphic and detected between 4 and 10 alleles per locus, with an average of 6.57. The observed and expected heterozygosity ranged from 0.25 and 0.40 in the Rennell Islands Tall (RIT) accession to 0.54 and 0.62 in the Polynesian Tall (PYT) accession. The analysis of genetic structure resulted in the formation of five distinct groups. The first group was formed by the accessions Brazilian Tall-Praia do Forte (BRTPF), Brazilian Tall-Merepe (BRTMe) and West African Tall (WAT); the second group consisted of Malaysian Tall (MLT); the third group of RIT; the fourth group of Vanuatu Tall (VTT); and the fifth group of Rotuman Tall (RTMT), Tonga Tall (TONT) and PYT. The dendrogram based on the nearest-neighbor method detected the formation of two main groups and five subgroups, indicating that the genetic relationships of the accessions are based on their geographic regions of origin. The analyses revealed genetic relationships between the accessions collected in Brazil and the accession from Africa, and among palms from South East Asia and the South Pacific, confirming the common origin of these accessions. The information obtained in this study can guide decisions on germplasm conservation activities and the efficient selection of genetically divergent parents for use in coconut breeding programs in Brazil, which are attempting to select for disease resistance, mainly to lethal yellowing, among other characteristics.
Process for tertiary oil recovery using tall oil pitch
Radke, Clayton J.
1985-01-01
Compositions and process employing same for enhancing the recovery of residual acid crudes, particularly heavy crudes, by injecting a composition comprising caustic in an amount sufficient to maintain a pH of at least about 11, preferably at least about 13, and a small but effective amount of a multivalent cation for inhibiting alkaline silica dissolution with the reservoir. Preferably a tall oil pitch soap is included and particularly for the heavy crudes a polymeric mobility control agent.
Antibody binding of circulating ergot alkaloids in cattle grazing tall fescue.
Hill, N S; Thompson, F N; Dawe, D L; Stuedemann, J A
1994-03-01
Direct evidence linking alkaloids found in endophyte-infected tall fescue forage with the livestock disorder known as fescue toxicosis is lacking. Physiologic effects of fescue toxicosis include reduced serum prolactin concentration in cattle. A monoclonal antibody specific to the lysergic moiety of ergot alkaloids was developed in mice after creating an immunogen by linking lysergol to human serum albumin. The antibody was specific to the lysergic moiety and, therefore, it cross-reacted with ergot alkaloids, lysergic acid, and lysergol. The antibody did not cross-react with alkaloid derivatives that had bromated or hydrogenated lysergic ring moieties. Fescue toxicosis conditions were elicited in yearling Angus steers by permitting them to graze endophyte-infected tall fescue containing > 650 micrograms/kg of ergovaline for 60 days. Passive immunization of steers by infusion of the monoclonal antibody increased serum prolactin concentration by 7 ng/ml, beginning immediately after infusion. Control steers did not respond to treatment with bovine serum albumin. Active immunization of yearling Angus heifers with immunogens containing lysergol or ergonovine linked to human serum albumin resulted in an antibody response.
USDA-ARS?s Scientific Manuscript database
There is a lack of information about the effect of different sources, levels, and the mixtures of energy supplements commonly fed to cattle grazing tall fescue. Therefore, the objective of this study was to evaluate different common energy sources for beef cattle grazing tall fescue using an in vitr...
The goal of this project is to identify key druggable regulators of glucocorticoid resistance in T-ALL. To this end, a reverse-engineered T-ALL context-specific regulatory interaction network was created from a phenotypically diverse T-ALL gene expression dataset, and then this network was interrogated using master regulator analysis to find drivers of glucocorticoid resistance.
Effects of spoil texture on growth of K-31 tall fescue
David H. Van Lear
1971-01-01
Growth of K-31 tall fescue (Festuca arundinacea) was significantly affected by the particle-size distribution, or texture, of four spoils from eastern Kentucky. Growth on spoils having no toxic chemical properties generally was greatest where texture consisted of about equal quantities of soil-size material and a coarser fraction (2 mm. to 6.4 mm.),...
Finch, S C; Munday, J S; Sutherland, B L; Vlaming, J B; Fletcher, L R
2017-11-01
AIMS To determine if equine fescue oedema (EFO) induced by grazing Mediterranean-type tall fescue (Lolium arundinaceum) infected with selected endophytes (Epichloë coenophiala) could be prevented by treatment with the corticosteroid, methylprednisolone, and anti-histamine, cetirizine, and to determine concentrations of lolines, specifically N-acetyl norloline (NANL), in grasses grazed by horses that did and did not develop EFO. METHODS Four horses were grazed on AR542-infected Mediterranean tall fescue pasture (from Day 0) for 7 days prior to being subjected to euthanasia. Two of these horses were treated with 250 mg methylprednisolone and 300 mg cetirizine hydrochloride every 12 hours orally from Days 0-7. Two more horses grazed meadow fescue (Festuca pratensis) infected with the naturally-occurring, common endophyte (Epichloë uncinata) for 21 days before euthanasia. All horses were observed closely for signs of EFO, and blood samples were taken daily for measurement of concentrations of total protein (TP) in serum. Following euthanasia post-mortem examinations were conducted on all horses. Pasture samples of meadow fescue and Mediterranean tall fescue from the current study, and endophyte-infected Mediterranean tall fescue from a previous study that were associated with EFO, were analysed for concentrations of lolines using gas chromatography. RESULTS By Day 7, the treated and untreated horses grazing AR542-infected Mediterranean tall fescue all developed signs of EFO, and concentrations of TP in serum of all horses were <45 g/L. No signs of EFO were observed in horses grazing meadow fescue and concentrations of TP remained above 60 g/L. Necropsy showed marked oedema and eosinophilic inflammation in the intestines of all horses grazing Mediterranean tall fescue. In the sample of meadow fescue, concentrations of total lolines and N-acetyl norloline (NANL) were 2,402 and 543 mg/kg, respectively. In the three samples of Mediterranean tall fescue
3D Concrete Printing Concept Could Solve Tall-Wind Dilemma
DOE Office of Scientific and Technical Information (OSTI.GOV)
Cotrell, Jason; Jenne, Scott; Butterfield, Sandy
When building a wind turbine, you want to make it as tall as possible to capture stronger, faster winds aloft. But taller tower bases become too large to be transported over the road—a constraint that has kept average U.S. wind turbine heights at 80 meters for the last 10 years. A Lab-Corps project undertaken by the National Renewable Energy Laboratory has found a potential solution: automated concrete manufacturing.
De Ford, C; Heidersdorf, B; Haun, F; Murillo, R; Friedrich, T; Borner, C; Merfort, I
2016-01-01
T-cell acute lymphoblastic leukemia (T-ALL) is an aggressive hematologic malignancy that preferentially affects children and adolescents. Over 50% of human T-ALLs possess activating mutations of Notch1. The clerodane diterpene casearin J (CJ) is a natural product that inhibits the sarcoendoplasmatic reticulum calcium ATPase (SERCA) pump and induces cell death in leukemia cells, but the molecular mechanism of cytotoxicity remains poorly understood. Here we show that owing to SERCA pump inhibition, CJ induces depletion of the endoplasmic reticulum calcium pools, oxidative stress, and apoptosis via the intrinsic signaling pathway. Moreover, Notch1 signaling is reduced in T-ALL cells with auto-activating mutations in the HD-domain of Notch1, but not in cells that do not depend on Notch1 signaling. CJ also provoked a slight activation of NF-κB, and consistent with this notion a combined treatment of CJ and the NF-κB inhibitor parthenolide (Pt) led to a remarkable synergistic cell death in T-ALL cells. Altogether, our data support the concept that inhibition of the SERCA pump may be a novel strategy for the treatment of T-ALL with HD-domain-mutant Notch1 receptors and that additional treatment with the NF-κB inhibitor parthenolide may have further therapeutic benefits. PMID:26821066
Tennessee Report (Annual Report to SERA-IEG8 Tall Fescue Toxicosis/Endophyte Workshop)
USDA-ARS?s Scientific Manuscript database
A number of updates on research projects conducted within Tennessee concerning tall fescue (Lolium arundinacium) and its symbiotic endophyte (Neotyphodium coenophialum) were presented at the annual SERA-IEG 8 workshop including one with Forage-Animal Production Research Unit scientist collaborations...
Zhang, Liang; Hu, Tao; Amombo, Erick; Wang, Guangyang; Xie, Yan; Fu, Jinmin
2017-01-01
Tall fescue ( Festuca arundinacea Schreb) is a typical cool-season grass that is widely used in turf and pasture. However, high temperature as an abiotic stress seriously affects its utilization. The objective of this study was to explore the effect of spermidine (Spd) on heat stress response of tall fescue. The samples were exposed to 22°C (normal condition) or 44°C (heat stress) for 4 h. The results showed that exogenous Spd partially improved the quality of tall fescue leaves under normal temperature conditions. Nevertheless, after heat stress treatment, exogenous Spd significantly decreased the electrolyte leakage of tall fescue leaves. Spd also profoundly reduced the H 2 O 2 and O 2 ⋅- content and increased antioxidant enzymes activities. In addition, PAs can also regulate antioxidant enzymes activities including SOD, POD, and APX which could help to scavenge ROS. Moreover, application of Spd could also remarkably increase the chlorophyll content and had a positive effect on the chlorophyll α fluorescence transients under high temperature. The Spd reagent enhanced the performance of photosystem II (PSII) as observed by the JIP-test. Under heat stress, the Spd profoundly improved the partial potentials at the steps of energy bifurcations (PI ABS and PI total ) and the quantum yields and efficiencies (φP 0 , δR 0 , φR 0 , and γRC). Exogenous Spd could also reduce the specific energy fluxes per Q A - reducing PSII reaction center (RC) (TP 0 /RC and ET 0 /RC). Additionally, exogenous Spd improved the expression level of psbA and psbB , which encoded the proteins of PSII core reaction center complex. We infer that PAs can stabilize the structure of nucleic acids and protect RNA from the degradation of ribonuclease. In brief, our study indicates that exogenous Spd enhances the heat tolerance of tall fescue by maintaining cell membrane stability, increasing antioxidant enzymes activities, improving PSII, and relevant gene expression.
Impact of a Large San Andreas Fault Earthquake on Tall Buildings in Southern California
NASA Astrophysics Data System (ADS)
Krishnan, S.; Ji, C.; Komatitsch, D.; Tromp, J.
2004-12-01
In 1857, an earthquake of magnitude 7.9 occurred on the San Andreas fault, starting at Parkfield and rupturing in a southeasterly direction for more than 300~km. Such a unilateral rupture produces significant directivity toward the San Fernando and Los Angeles basins. The strong shaking in the basins due to this earthquake would have had a significant long-period content (2--8~s). If such motions were to happen today, they could have a serious impact on tall buildings in Southern California. In order to study the effects of large San Andreas fault earthquakes on tall buildings in Southern California, we use the finite source of the magnitude 7.9 2001 Denali fault earthquake in Alaska and map it onto the San Andreas fault with the rupture originating at Parkfield and proceeding southward over a distance of 290~km. Using the SPECFEM3D spectral element seismic wave propagation code, we simulate a Denali-like earthquake on the San Andreas fault and compute ground motions at sites located on a grid with a 2.5--5.0~km spacing in the greater Southern California region. We subsequently analyze 3D structural models of an existing tall steel building designed in 1984 as well as one designed according to the current building code (Uniform Building Code, 1997) subjected to the computed ground motion. We use a sophisticated nonlinear building analysis program, FRAME3D, that has the ability to simulate damage in buildings due to three-component ground motion. We summarize the performance of these structural models on contour maps of carefully selected structural performance indices. This study could benefit the city in laying out emergency response strategies in the event of an earthquake on the San Andreas fault, in undertaking appropriate retrofit measures for tall buildings, and in formulating zoning regulations for new construction. In addition, the study would provide risk data associated with existing and new construction to insurance companies, real estate developers, and
Welch, K D; Green, B T; Gardner, D R; Cook, D; Pfister, J A; Panter, K E
2012-07-01
Delphinium spp. contain numerous norditerpenoid alkaloids which are structurally delineated as 7, 8-methylenedioxylycoctonine (MDL) and N-(methylsuccinimido) anthranoyllycoctonine (MSAL)-type alkaloids. The toxicity of many tall larkspur species has been primarily attributed to their increased concentration of MSAL-type alkaloids, such as methyllycaconitine (MLA), which are typically 20 times more toxic than MDL-type alkaloids. However, the less toxic MDL-type alkaloids are often more abundant than MSAL-type alkaloids in most Delphinium barbeyi and Delphinium occidentale populations. Previous research demonstrated that MDL-type alkaloids increase the acute toxicity of MSAL-type alkaloids. In this study, we examined the role of MDL-type alkaloids on the overall toxicity of tall larkspur plants to cattle while controlling for the exact dose of MSAL-type alkaloids. Cattle were dosed with plant material from 2 different populations of tall larkspur containing either almost exclusively MDL- or MSAL-type alkaloids. These 2 plant populations were combined to create mixtures with ratios of 0.3:1, 1:1, 5:1, and 10:1 MDL- to MSAL-type alkaloids. The dose that elicited similar clinical signs of poisoning in mice and cattle was determined for each mixture on the basis of the MSAL-type alkaloid content. As the ratio of MDL- to MSAL-type alkaloids increased, the amount of MSAL-type alkaloids required to elicit clinical signs decreased. These results indicate that the less toxic MDL-type alkaloids in tall larkspur exacerbate the toxicity of the MSAL-type alkaloids. Consequently, both the amount of MSAL-type alkaloids and the amount of total alkaloids should be fully characterized to determine more accurately the relative toxicity of tall larkspur plant material.
Investigation of a long time series of CO2 from a tall tower using WRF-SPA
NASA Astrophysics Data System (ADS)
Smallman, Luke; Williams, Mathew; Moncrieff, John B.
2013-04-01
Atmospheric observations from tall towers are an important source of information about CO2 exchange at the regional scale. Here, we have used a forward running model, WRF-SPA, to generate a time series of CO2 at a tall tower for comparison with observations from Scotland over multiple years (2006-2008). We use this comparison to infer strength and distribution of sources and sinks of carbon and ecosystem process information at the seasonal scale. The specific aim of this research is to combine a high resolution (6 km) forward running meteorological model (WRF) with a modified version of a mechanistic ecosystem model (SPA). SPA provides surface fluxes calculated from coupled energy, hydrological and carbon cycles. This closely coupled representation of the biosphere provides realistic surface exchanges to drive mixing within the planetary boundary layer. The combined model is used to investigate the sources and sinks of CO2 and to explore which land surfaces contribute to a time series of hourly observations of atmospheric CO2 at a tall tower, Angus, Scotland. In addition to comparing the modelled CO2 time series to observations, modelled ecosystem specific (i.e. forest, cropland, grassland) CO2 tracers (e.g., assimilation and respiration) have been compared to the modelled land surface assimilation to investigate how representative tall tower observations are of land surface processes. WRF-SPA modelled CO2 time series compares well to observations (R2 = 0.67, rmse = 3.4 ppm, bias = 0.58 ppm). Through comparison of model-observation residuals, we have found evidence that non-cropped components of agricultural land (e.g., hedgerows and forest patches) likely contribute a significant and observable impact on regional carbon balance.
Wang, Xiuyun; Zhuang, Lili; Huang, Bingru
2017-01-01
Abscisic acid (ABA) is known to play roles in regulating plant tolerance to various abiotic stresses, but whether ABA’s effects on heat tolerance are associated with its regulation of heat stress transcription factors (HSFs) and heat shock proteins (HSPs) is not well documented. The objective of this study was to determine whether improved heat tolerance of tall fescue (Festuca arundinacea Schreb.) by ABA was through the regulation of HSFs and HSPs. ABA-responsive transcriptional factors, ABA-responsive element binding protein 3 (FaAREB3) and dehydration-responsive element binding protein 2A (FaDREB2A) of tall fescue, were able to bind to the cis-elements in the promoter of tall fescue heat stress transcription factor A2c (FaHSFA2c). Exogenous ABA (5 μM) application enhanced heat tolerance of tall fescue, as manifested by increased leaf photochemical efficiency and membrane stability under heat stress (37/32 °C, day/night). The expression levels of FaHSFA2c, several tall fescue HSPs (FaHSPs), and ABA-responsive transcriptional factors were up-regulated in plants treated with ABA. Deficiency of Arabidopsis heat stress transcription factor A2 (AtHSFA2) suppressed ABA-induction of AtHSPs expression and ABA-improved heat tolerance in Arabidopsis. These results suggested that HSFA2 plays an important role in ABA-mediated plant heat tolerance, and FaAREB3 and FaDREB2A may function as upstream trans-acting factors and regulate transcriptional activity of FaHSFA2c and the downstream FaHSPs, leading to improved heat tolerance. PMID:28914758
3D Concrete Printing Concept Could Solve Tall-Wind Dilemma
Cotrell, Jason; Jenne, Scott; Butterfield, Sandy
2018-06-12
When building a wind turbine, you want to make it as tall as possible to capture stronger, faster winds aloft. But taller tower bases become too large to be transported over the roadâa constraint that has kept average U.S. wind turbine heights at 80 meters for the last 10 years. A Lab-Corps project undertaken by the National Renewable Energy Laboratory has found a potential solution: automated concrete manufacturing.
Gazi, Mohiuddin; Moharram, Sausan A; Marhäll, Alissa; Kazi, Julhash U
2017-04-28
Although significant improvements have been made in the treatment of acute lymphoblastic leukemia (ALL), there is a substantial subset of high-risk T-cell ALL (T-ALL) patients with relatively poor prognosis. Like in other leukemia types, alterations of the PI3K/mTOR pathway are predominant in ALL which is also responsible for treatment failure and relapse. In this study, we show that relapsed T-ALL patients display an enrichment of the PI3K/mTOR pathway. Using a panel of inhibitors targeting multiple components of the PI3K/mTOR pathway, we observed that the dual-specific PI3K/mTOR inhibitor PKI-587 was the most selective inhibitor for T-ALL cells dependent on the PI3K/mTOR pathway. Furthermore, we observed that PKI-587 blocked proliferation and colony formation of T-ALL cell lines. Additionally, PKI-587 selectively abrogated PI3K/mTOR signaling without affecting MAPK signaling both in in vitro and in vivo. Inhibition of the PI3K/mTOR pathway using PKI-587 delayed tumor progression, reduced tumor load and enhanced the survival rate in immune-deficient mouse xenograft models without inducing weight loss in the inhibitor treated mice. This preclinical study shows beneficial effects of PKI-587 on T-ALL that warrants further investigation in the clinical setting. Copyright © 2017 Elsevier B.V. All rights reserved.
21 CFR 172.862 - Oleic acid derived from tall oil fatty acids.
Code of Federal Regulations, 2013 CFR
2013-04-01
... a component in the manufacture of food-grade additives in accordance with the following prescribed... component in the manufacture of other food-grade additives. (d) To assure safe use of the additive, the... 21 Food and Drugs 3 2013-04-01 2013-04-01 false Oleic acid derived from tall oil fatty acids. 172...
Fike, J H; Allen, V G; Schmidt, R E; Zhang, X; Fontenot, J P; Bagley, C P; Ivy, R L; Evans, R R; Coelho, R W; Wester, D B
2001-04-01
Seaweed (Ascophyllum nodosum) is a known source of plant growth regulators, and application to turfgrasses has increased activity of the antioxidant superoxide dismutase (SOD) and specific vitamin precursors. Increased antioxidant activity in both plants and animals diminishes oxidative stress. Two pasture experiments investigated effects of Tasco-Forage (a proprietary seaweed-based product) applied to tall fescue (Festuca arundinacea) on antioxidant activity in plants and in ruminants that grazed the forage. In Exp. 1, fescue was 70 to 100% infected with the endophyte fungus Neotyphodium coenophialum ([Morgan-Jones and Gams] Glenn, Bacon, and Hanlin). Twenty-four wether lambs (initial BW 41 kg; SD = 5) grazed fescue treated with 0, 1.7, or 3.4 kg Tasco/ha applied in April and July, 1994, with four replications per treatment. Grazing occurred for 26 d beginning April 21 and for 22 d beginning July 19. In July, there was a linear increase in daily gains (P < 0.05), and serum vitamin A (P < 0.13) and whole-blood Se (P < 0.10) tended to increase in lambs grazing Tasco-treated fescue. In Exp. 2,48 Angus and Angus x Hereford steers (initial BW 245 kg; SD = 20) grazed infected or uninfected tall fescue in Virginia that was treated (3.4 kg/ ha) or untreated with Tasco in April and July, 1995. Steers that grazed infected tall fescue had lower (P < 0.02) serum vitamin A and E and tended (P < 0.07) to have lower whole-blood Se in September compared with steers that grazed uninfected tall fescue. Tasco decreased (P < 0.06) serum vitamin E but tended to increase whole-blood Se (P < 0.10) in September and serum vitamin A in July (P < 0.12). During 1996 and 1997, the experiment was repeated in Virginia with Angus steers and was replicated at Prairie, MS, where 1/4 Brahman x 3/4 Angus steers were used. Forty-eight steers were included at each location in each year (n = 192 total steers for 1996 and 1997). Steers that grazed infected tall fescue in Mississippi had lower (P < 0
Portable tripod-mounted boom sprayer for applying herbicides on tall shrubs
Charles A. Graham; Jay R. Bentley
1975-01-01
A tripod-supported boom sprayer was developed and used to spray herbicides on shrubs up to 15 feet tall on experimental plots where use of other spray equipment was not feasible. A pneumatic pressurized sprayer with 10 diaphragm nozzles, geometrically spaced along the outer 20 feet (6.1 m) of a 25-foot (7.6-m) boom, distributed the spray uniformly. Brush leaves were...
Health monitoring system for a tall building with Fiber Bragg grating sensors
NASA Astrophysics Data System (ADS)
Li, D. S.; Li, H. N.; Ren, L.; Guo, D. S.; Song, G. B.
2009-03-01
Fiber Bragg grating (FBG) sensors demonstrate great potentials for structural health monitoring of civil structures to ensure their structural integrity, durability and reliability. The advantages of applying fiber optic sensors to a tall building include their immunity of electromagnetic interference and multiplexing ability to transfer optical signals over a long distance. In the work, FBG sensors, including strain and temperature sensors, are applied to the construction monitoring of an 18-floor tall building starting from its construction date. The main purposes of the project are: 1) monitoring the temperature evolution history within the concrete during the pouring process; 2) measuring the variations of the main column strains on the underground floor while upper 18 floors were subsequently added on; and 3) monitoring the relative displacements between two foundation blocks. The FBG sensors have been installed and interrogated continuously for more than five months. Monitoring results of temperature and strains during the period are presented in the paper. Furthermore, the lag behavior between the concrete temperature and its surrounding air temperature is investigated.
Mebs, Dietrich; Wunder, Cora; Pogoda, Werner; Toennes, Stefan W
2017-06-01
Caterpillars of the monarch butterfly, Danaus plexippus, feed on milkweed plants, Asclepias spp. (Apocynaceae), and sequester their toxic cardenolides aimed at deterring predators. Nevertheless, Chinese praying mantids, Tenodera sinensis, consume these caterpillars after removing the midgut ("gutting") including its plant content. In the present study, monarch caterpillars raised on A. curassavica, and those of the death's-head hawkmoth, Acherontia atropos, raised on Atropa belladonna containing atropine, were fed to mantids, Hierodula membranacea, which removed the gut of both species discarding about 59% of cardenolides and more than 90% of atropine, respectively. The ingestion of these compounds produced no apparent ill effects in the mantids and both were excreted with faeces. On the other hand, when mantids were fed with larvae of two moth species, Amata mogadorensis and Brahmaea certia, raised on non-poisonous host plants, the mantids showed the same gutting behaviour, thereby discarding indigestible plant material. As polar compounds, e.g. cardenolides and atropine, are not absorbed from the mantids midgut and do not pass the gut membrane, this enables the mantids to feed on toxic prey. Copyright © 2017 Elsevier Ltd. All rights reserved.
USDA-ARS?s Scientific Manuscript database
An experiment was conducted to determine if ergot alkaloids affect blood flow to the absorptive surface of the rumen. Steers (n = 8) were pair-fed alfalfa cubes and received ground endophyte-infected tall fescue seed (E+; 0.015 mg ergovaline•kg BW-1•d-1) or endophyte-free tall fescue seed (E-) via r...
USDA-ARS?s Scientific Manuscript database
1. Fungal endophyte - grass symbioses can have dramatic ecological effects, altering individual plant physiology, plant and animal community structure and function, and ecosystem processes such as litter decomposition and nutrient cycling. 2. Within the tall fescue (Schedonorus arundinaceus) - funga...
Coretta Scott King Award Winner Javaka Steptoe Stands Tall "In Daddy's Arms."
ERIC Educational Resources Information Center
Peck, Jackie; Hendershot, Judy
1999-01-01
Offers an interview with artist and author Javaka Steptoe, winner of the Coretta Scott King award for his book "In Daddy's Arms I Am Tall: African Americans Celebrating Fathers." Discusses his background in the arts, the variety of media he uses, how he begins thinking about his illustrations, his work with children's art, and aspects of his work.…
Rojas, Xavier; Guo, Jingqi; Leff, Jonathan W; McNear, David H; Fierer, Noah; McCulley, Rebecca L
2016-07-01
Tall fescue (Schedonorus arundinaceus) is a widespread grass that can form a symbiotic relationship with a shoot-specific fungal endophyte (Epichloë coenophiala). While the effects of fungal endophyte infection on fescue physiology and ecology have been relatively well studied, less attention has been given to how this relationship may impact the soil microbial community. We used high-throughput DNA sequencing and phospholipid fatty acid analysis to determine the structure and biomass of microbial communities in both bulk and rhizosphere soils from tall fescue stands that were either uninfected with E. coenophiala or were infected with the common toxic strain or one of several novel strains of the endophyte. We found that rhizosphere and bulk soils harbored distinct microbial communities. Endophyte presence, regardless of strain, significantly influenced soil fungal communities, but endophyte effects were less pronounced in prokaryotic communities. E. coenophiala presence did not change total fungal biomass but caused a shift in soil and rhizosphere fungal community composition, increasing the relative abundance of taxa within the Glomeromycota phylum and decreasing the relative abundance of genera in the Ascomycota phylum, including Lecanicillium, Volutella, Lipomyces, Pochonia, and Rhizoctonia. Our data suggests that tripartite interactions exist between the shoot endophyte E. coenophiala, tall fescue, and soil fungi that may have important implications for the functioning of soils, such as carbon storage, in fescue-dominated grasslands.
USDA-ARS?s Scientific Manuscript database
Broad phenotypic variations were induced in derivatives of an asymmetric somatic hybridization of bread wheat (Triticum aestivum) and tall wheatgrass (Thinopyrum ponticum Podp); however, how did these variations happened was unknown. We explored the nature of these variations by cytogenetic assays ...
Invasive and native tall forms of Spartina alterniflora respond differently to nitrogen availability
NASA Astrophysics Data System (ADS)
Qing, Hua; Yao, Yihan; Xiao, Yan; Hu, Fengqin; Sun, Yixiang; Zhou, Changfang; An, Shuqing
2011-01-01
The objective of this study was to compare various plant traits of native and invasive conspecifics of the tall form of Spartina alterniflora to test the genetic shift hypothesis, which predicts that due to genetic differences invasive plants may have different performance. We conducted a controlled experiment with six populations of the tall form of S. alterniflora: three transported from its introduced range in Jiangsu Province, China, and three from its native range in Georgia, USA. Plants were grown in a greenhouse and subjected to one of two levels of nitrogen availability for several months. Growth, biomass accumulation, biomass allocation, and photosynthetic and morphological traits, as well as the corresponding trait plasticities, were measured and compared between the populations. Nitrogen addition significantly affected individual traits of both invasive Jiangsu and native Georgia S. alterniflora populations, with invasive populations having stronger responses to nitrogen addition in RGR, total biomass, total leaf number (TLN), total leaf area (TLA) and maximum culm height (MxCH) than native populations according to the results of both reaction norms and the relative distance plasticity index (RDPI). Invasive S. alterniflora was more vigorous than its native conspecific as shown by greater total biomass and higher light-saturated photosynthetic rate (Pmax). Several morphological traits (MxCH, TLN and LAR) and most of the biomass allocation traits of invasive populations were found to differ from native populations. Our results indicated probable genetic shifts in plant traits in the introduced populations relative to the native populations of the tall form of S. alterniflora. Such genetic shifts may play a vital role in their success as invasive plants.
Chen, Lei; Auh, Chung-Kyoon; Dowling, Paul; Bell, Jeremey; Chen, Fang; Hopkins, Andrew; Dixon, Richard A; Wang, Zeng-Yu
2003-11-01
Lignification of cell walls during plant development has been identified as the major factor limiting forage digestibility and concomitantly animal productivity. cDNA sequences encoding a key lignin biosynthetic enzyme, cinnamyl alcohol dehydrogenase (CAD), were cloned from the widely grown monocotyledonous forage species tall fescue (Festuca arundinacea Schreb.). Recombinant tall fescue CAD expressed in E. coli exhibited the highest V(max)/K(m) values when coniferaldehyde and sinapaldehyde were used as substrates. Transgenic tall fescue plants carrying either sense or antisense CAD gene constructs were obtained by microprojectile bombardment of single genotype-derived embryogenic suspension cells. Severely reduced levels of mRNA transcripts and significantly reduced CAD enzymatic activities were found in two transgenic plants carrying sense and antisense CAD transgenes, respectively. These CAD down-regulated transgenic lines had significantly decreased lignin content and altered ratios of syringyl (S) to guaiacyl (G), G to p-hydroxyphenyl (H) and S to H units. No significant changes in cellulose, hemicellulose, neutral sugar composition, p-coumaric acid and ferulic acid levels were observed in the transgenic plants. Increases of in vitro dry matter digestibility of 7.2-9.5% were achieved in the CAD down-regulated lines, thus providing a novel germplasm to be used for the development of grass cultivars with improved forage quality.
Loiola, Carina Mendes; Azevedo, Alinne Oliveira Nunes; Diniz, Leandro E. C.; Aragão, Wilson Menezes; Azevedo, Carlos Diego de O.; Santos, Pedro Henrique A. D.; Ramos, Helaine Christine C.; Pereira, Messias Gonzaga; Ramos, Semíramis R. Ramalho
2016-01-01
The diversity and genetic relationships among two accessions of tall coconut palms collected in Brazil and seven accessions introduced from different geographic regions of the world were analyzed using 25 microsatellite primers, 19 of which were polymorphic and detected between 4 and 10 alleles per locus, with an average of 6.57. The observed and expected heterozygosity ranged from 0.25 and 0.40 in the Rennell Islands Tall (RIT) accession to 0.54 and 0.62 in the Polynesian Tall (PYT) accession. The analysis of genetic structure resulted in the formation of five distinct groups. The first group was formed by the accessions Brazilian Tall—Praia do Forte (BRTPF), Brazilian Tall—Merepe (BRTMe) and West African Tall (WAT); the second group consisted of Malaysian Tall (MLT); the third group of RIT; the fourth group of Vanuatu Tall (VTT); and the fifth group of Rotuman Tall (RTMT), Tonga Tall (TONT) and PYT. The dendrogram based on the nearest-neighbor method detected the formation of two main groups and five subgroups, indicating that the genetic relationships of the accessions are based on their geographic regions of origin. The analyses revealed genetic relationships between the accessions collected in Brazil and the accession from Africa, and among palms from South East Asia and the South Pacific, confirming the common origin of these accessions. The information obtained in this study can guide decisions on germplasm conservation activities and the efficient selection of genetically divergent parents for use in coconut breeding programs in Brazil, which are attempting to select for disease resistance, mainly to lethal yellowing, among other characteristics. PMID:26974540
Gao, Yanzheng; Li, Hui; Gong, Shuaishuai
2012-01-01
Plant contamination by polycyclic aromatic hydrocarbons (PAHs) is crucial to food safety and human health. Enzyme inhibitors are commonly utilized in agriculture to control plant metabolism of organic components. This study revealed that the enzyme inhibitor ascorbic acid (AA) significantly reduced the activities of peroxidase (POD) and polyphenol oxidase (PPO), thus enhancing the potential risks of PAH contamination in tall fescue (Festuca arundinacea Schreb.). POD and PPO enzymes in vitro effectively decomposed naphthalene (NAP), phenanthrene (PHE) and anthracene (ANT). The presence of AA reduced POD and PPO activities in plants, and thus was likely responsible for enhanced PAH accumulation in tall fescue. This conclusion is supported by the significantly enhanced uptake of PHE in plants in the presence of AA, and the positive correlation between enzyme inhibition efficiencies and the rates of metabolism of PHE in tall fescue roots. This study provides a new perspective, that the common application of enzyme inhibitors in agricultural production could increase the accumulation of organic contaminants in plants, hence enhancing risks to food safety and quality. PMID:23185628
DOE Office of Scientific and Technical Information (OSTI.GOV)
Martin, Madhavi Z; Stewart, Arthur J; Gwinn, Dr. Kimberley
Laser-induced breakdown spectroscopy was used to determine the impact of endophyte (Neotyphodium sp.) infection on elemental composition of tall fescue (Festuca arundinacea). Leaf material from endophyte-infected (E+) and endophyte-free (E-) tall fescue populations in established plots was examined. Leaf-tissue digestates were also tested for metals, by ICP-MS. Seven of eleven metals (Ca, Mg, Fe, Mn, Cu, Ni and Zn) were measured by both techniques at concentrations great enough to reliably compare. Mg, Zn, and Cd, a toxic metal that can be present in forage, were readily detected by LIBS, even though Cd concentrations in the plants were below levels typicallymore » achieved using ICP-MS detection. Implications of these results for research on forage analysis and phytoremediation are discussed.« less
DOE Office of Scientific and Technical Information (OSTI.GOV)
Martin, Madhavi Z.; Stewart, Arthur J.; Gwinn, Kimberley D.
Laser-induced breakdown spectroscopy (LIBS) was used to determine the impact of endophyte (Neotyphodium sp.) infection on elemental composition of tall fescue (Festuca arundinacea). Leaf material from endophyte-infected (E+) and endophyte-free (E-) tall fescue populations in established plots was examined. Leaf-tissue digestates were also tested for metals, by inductively coupled plasma (ICP) mass spectrometry (MS). Seven of eleven metals (Ca, Mg, Fe, Mn, Cu, Ni, and Zn) were measured by both techniques at concentrations great enough for a reliable comparison. Mg, Zn, and Cd, a toxic metal that can be present in forage, were readily detected by LIBS, even though Cdmore » concentrations in the plants were below levels typically achieved using ICP MS detection. Implications of these results for research on forage analysis and phytoremediation are discussed.« less
75 FR 34936 - Safety Zone; Chicago Tall Ships Fireworks, Lake Michigan, Chicago, IL
Federal Register 2010, 2011, 2012, 2013, 2014
2010-06-21
...-AA00 Safety Zone; Chicago Tall Ships Fireworks, Lake Michigan, Chicago, IL AGENCY: Coast Guard, DHS... waters of Lake Michigan within Chicago Harbor, Chicago, Illinois. This zone is intended to restrict... CWO2 Jon Grob, U.S. Coast Guard, Sector Lake Michigan, telephone (414)747-7188, e-mail [email protected
Hijacking T cell differentiation: new insights in TLX function in T-ALL.
King, Bryan; Ntziachristos, Panagiotis; Aifantis, Iannis
2012-04-17
TLX1 and TLX3 are two closely-related homeobox transcriptional repressors frequently misexpressed and translocated in T cell acute lymphoblastic leukemia (T-ALL). In this issue of Cancer Cell, Dadi et al. provide new insights into how these factors are recruited by ETS-1 to the TCRα enhancer and actively repress differentiation. Copyright © 2012 Elsevier Inc. All rights reserved.
Macronutrient and boron ratios in tall fescue: relationship to yields on pyritic coal wastes
DOE Office of Scientific and Technical Information (OSTI.GOV)
Lewis, B.G.
A previous greenhouse study had demonstrated that yield of tall fescue (Festuca arundinacea Schreb.) grown directly on a pyritic waste was not significantly different from yield on a soil despite low tissue concentrations of P and K in the waste-grown plants. In an attempt to explain this result, and to determine if this phenomenon was typical of such waste, a greenhouse study was carried out with pyritic waste from five disposal sites for coal-cleaning refuse in southern Illinois. The wastes and an agricultural soil (Eilliott silt loam: fine, illitic, mesic Aquic Arguidolls) were treated with limestone (to pH 6.5) andmore » fertilizers. Yields of 8-week-old shoots of tall fescue grown on the wastes were significantly lower than yield of plants grown on the soil when the Ca/B ratio in the shoots was outside a range of 1.7 to 2.8 (where Ca/B is the ratio of log/sub 10/ concentrations of Ca and B expressed as microgram-atoms per gram dry matter). Within this range, yields were not significantly different from yield on the soil despite significantly lower concentrations of P and K in the shoots of the waste-grown plants. It is suggested that elemental interactions should not be ignored in reclamation of waste sites, particularly where ''trace'' element concentrations are either higher or lower than concentrations in typical soils. Results also suggest a P- and K-sparing effect of elevated B concentrations in tall fescue. 23 references.« less
Mitigating shear lag in tall buildings
NASA Astrophysics Data System (ADS)
Gaur, Himanshu; Goliya, Ravindra K.
2015-09-01
As the height of building increases, effect of shear lag also becomes considerable in the design of high-rise buildings. In this paper, shear lag effect in tall buildings of heights, i.e., 120, 96, 72, 48 and 36 stories of which aspect ratio ranges from 3 to 10 is studied. Tube-in-tube structural system with façade bracing is used for designing the building of height 120 story. It is found that bracing system considerably reduces the shear lag effect and hence increases the building stiffness to withstand lateral loads. Different geometric patterns of bracing system are considered. The best effective geometric configuration of bracing system is concluded in this study. Lateral force, as wind load is applied on the buildings as it is the most dominating lateral force for such heights. Wind load is set as per Indian standard code of practice IS 875 Part-3. For analysis purpose SAP 2000 software program is used.
The watering of tall trees--embolization and recovery.
Gouin, Henri
2015-03-21
We can propound a thermo-mechanical understanding of the ascent of sap to the top of tall trees thanks to a comparison between experiments associated with the cohesion-tension theory and the disjoining pressure concept for liquid thin-films. When a segment of xylem is tight-filled with crude sap, the liquid pressure can be negative although the pressure in embolized vessels remains positive. Examples are given that illustrate how embolized vessels can be refilled and why the ascent of sap is possible even in the tallest trees avoiding the problem due to cavitation. However, the maximum height of trees is limited by the stability domain of liquid thin-films. Copyright © 2015 Elsevier Ltd. All rights reserved.
Seasonal nitrogen effects on nutritive value in binary mixtures of tall fescue and bermudagrass
USDA-ARS?s Scientific Manuscript database
Year-round forage production is feasible in much of the southeastern USA through utilization of cool- and warm-season forages. This study determined changes in herbage nutritive value in binary mixtures of cool-season, tall fescue [Schedonorus arundinaceus (Schreb.) Dumort], and warm-season, bermuda...
Matsuura, Kazuki; Hatta, Shiro; Terasaka, Yuki; Inoue, Yoshitsugu
2017-01-18
Surgeons may be unaware of the ability of plant toxins to cause corneal damage. Therefore, corneal damage following intraocular surgery due to plant toxins may be misdiagnosed as postoperative infection. A 74-year-old man presented with hyperemia and reduced visual acuity in both eyes 6 weeks after uneventful cataract surgery. We observed extensive hyperemia and corneal stromal edema with Descemet's folds in both eyes. After obtaining a detailed patient history, we diagnosed plant toxin-induced corneal edema due to Asclepias physocarpa, which can induce corneal edema by inhibiting the Na + /K + ATPase activity of the corneal endothelium. Antimicrobial and steroid eye drops and an oral steroid were prescribed accordingly. Symptons began to improve on day 3 and had almost completely resolved by day 6. At 1 month, the patient had fully recovered without any sequelae. The correct diagnosis was possible in the present case as symptoms were bilateral and the patient was able to report his potential exposure to plant toxins. However, if the symptoms had been unilateral and the patient had been unaware of these toxins, he may have undergone unnecessary surgical interventions to treat non-existent postoperative endophthalmitis.
Nutrition and In Vitro Digestibility of Tall Fescue for White-Tailed Deer, May Through November
G.E. Probasco; A.J. Bjugstad
1978-01-01
Describes a study of the nutritive quality and digestibility of ferilized and unfertilized tall fescue in spring, summer, and fall. The grass may be most valuable as food in early spring and late fall, and on unfertilized sites.
Effect of grazing seedhead-suppressed tall fescue pasture on the vasoactivity of serotonin receptors
USDA-ARS?s Scientific Manuscript database
Previous research has demonstrated that exposure to ergot alkaloids reduces vasoactivity of serotonin (5HT) receptors. Chemical suppression of tall fescue seedhead production is a tool to reduce the level of exposure to ergot alkaloids by a grazing animal. Therefore, the objective was to evaluate co...
From the Lab Bench: Why the heat and cold stresses on tall fescue pasture
USDA-ARS?s Scientific Manuscript database
A column is written to provide information on why cattle that graze toxic endophyte infected tall fescue are vulnerable to both heat and cold stress. Peer reviewed research conducted by scientists at the USDA-ARS Forage-Animal Production Research Unit demonstrated that ergot alkaloids produced by t...
An 11-year history of crop rotation into new perennial ryegrass and tall fescue
USDA-ARS?s Scientific Manuscript database
Converting multi-year remote sensing classification data into crop rotations is beneficial by defining the length of crop rotation cycles and the specific sequences of intervening crops grown between the final year of a grass seed stand and establishment of new perennial ryegrass and tall fescue see...
Evaluation of modal pushover-based scaling of one component of ground motion: Tall buildings
Kalkan, Erol; Chopra, Anil K.
2012-01-01
Nonlinear response history analysis (RHA) is now increasingly used for performance-based seismic design of tall buildings. Required for nonlinear RHAs is a set of ground motions selected and scaled appropriately so that analysis results would be accurate (unbiased) and efficient (having relatively small dispersion). This paper evaluates accuracy and efficiency of recently developed modal pushover–based scaling (MPS) method to scale ground motions for tall buildings. The procedure presented explicitly considers structural strength and is based on the standard intensity measure (IM) of spectral acceleration in a form convenient for evaluating existing structures or proposed designs for new structures. Based on results presented for two actual buildings (19 and 52 stories, respectively), it is demonstrated that the MPS procedure provided a highly accurate estimate of the engineering demand parameters (EDPs), accompanied by significantly reduced record-to-record variability of the responses. In addition, the MPS procedure is shown to be superior to the scaling procedure specified in the ASCE/SEI 7-05 document.
Ergovaline Stability in Tall Fescue Based on Sample Handling and Storage Methods
NASA Astrophysics Data System (ADS)
Lea, Krista; Smith, Lori; Gaskill, Cynthia; Coleman, Robert; Smith, S.
2014-09-01
Ergovaline is an ergot alkaloid produced by the endophyte Neotyphodium coenophialum (Morgan-Jones and Gams) found in tall fescue (Schedonorus arundinacea (Schreb.) Dumort.) and blamed for a multitude of livestock disorders. Ergovaline is known to be unstable and affected by many variables. The objective of this study was to determine the effect of sample handling and storage on the stability of ergovaline in tall fescue samples. Fresh tall fescue was collected from a horse farm in central Kentucky at three harvest dates and transported on ice to the University of Kentucky Veterinary Diagnostic Laboratory. Plant material was frozen in liquid nitrogen, milled and mixed before being allocated into different sub-samples. Three sub-samples were assigned to each of 14 sample handling or storage treatments. Sample handling included increased heat and UV light to simulate transportation in a vehicle and on ice in a cooler per standard transportation recommendations. Storage conditions included storage at 22oC, 5oC and -20oC for up to 28 days. Each sub-sample was then analyzed for ergovaline concentration using HPLC with fluorescence detection and this experiment was repeated for each harvest date. Sub-samples exposed to UV light and heat lost a significant fraction of ergovaline in 2 hours, while sub-samples stored on ice in a cooler showed no change in ergovaline in 2 hours. All sub-samples stored at 22oC, 5oC and -20oC lost a significant fraction of ergovaline in the first 24 hours of storage. There was little change in ergovaline in the freezer (-20oC) after the first 24 hours up to 28 days of storage but intermittent losses were observed at 22oC and 5oC. To obtain results that most closely represent levels in the field, all samples should be transported on ice to the laboratory immediately after harvest for same day analysis. If immediate testing is not possible, samples should be stored at -20oC until analysis.
USDA-ARS?s Scientific Manuscript database
Human alteration of symbiont genetics among aboveground endophytic Epichloë coenophiala strains within tall fescue (Schedonorus arundinaceus) has led to widespread deployment of novel grass-endophyte combinations, yet little is known about their ecological consequences. In this study, clone pairs (e...
USDA-ARS?s Scientific Manuscript database
Treatment of toxic endophyte-infected tall fescue [Lolium arundinaceum (Schreb.) Darbysh] with metsulfuran-methyl can mitigate fescue toxicosis and enhance forage nutritive value by suppressing seedhead emergence. A grazing experiment was conducted with steers (2013) and heifers (2014) to evaluate a...
USDA-ARS?s Scientific Manuscript database
Tall fescue (Schedonorus arundinaceus) can form a symbiosis with the fungal endophyte, Epichloë coenophiala, whose presence can benefit the plant, depending on plant and fungal genetics and prevailing environmental conditions. Despite this symbiosis having agricultural, economic and ecological impor...
Arouiee, H; Nazdar, T; Mousavi, A
2010-11-01
In order to investigation of allelopathic effects of some ornamental trees on seed germination of rye-grass (Lolium prenne) and tall fescue (Festuca arundinaceae), this experiment was conducted in a randomized complete block design with 3 replicates at the laboratory of Horticultural Sciences Department of Ferdowsi University of Mashhad, during 2008. In this research, we studied the effect of aqueous and hydro-alcoholic extracts of Afghanistan pine (Pinus eldarica), arizona cypress (Cupressus arizonica), black locust (Robinia psedue acacia) and box elder (Acer negundo) leaves that prepared in 1:5 ratio on seed germination percent and rate for two grasses. The results showed that all extracts decreased statistically seed germination in compared to control treatment. The highest germination percentage and germination rate of tested grass detected in control treatment. Hydro-alcoholic extracts of all woody plants (15, 30%) were completely inhibited seed germination of rye-grass and tall fescue. Also aqueous extract of arizona cypress was completely inhibited seed germination of tall fescue and had more inhibitory activity than other aqueous extracts on rye-grass. Between aqueous extracts, the highest and lowest seed germination of rye-grass was found in Afghanistan pine and arizona cypress, respectively.
Electromagnetic field radiation model for lightning strokes to tall structures
DOE Office of Scientific and Technical Information (OSTI.GOV)
Motoyama, H.; Janischewskyj, W.; Hussein, A.M.
1996-07-01
This paper describes observation and analysis of electromagnetic field radiation from lightning strokes to tall structures. Electromagnetic field waveforms and current waveforms of lightning strokes to the CN Tower have been simultaneously measured since 1991. A new calculation model of electromagnetic field radiation is proposed. The proposed model consists of the lightning current propagation and distribution model and the electromagnetic field radiation model. Electromagnetic fields calculated by the proposed model, based on the observed lightning current at the CN Tower, agree well with the observed fields at 2km north of the tower.
KCMP Minnesota Tall Tower Nitrous Oxide Inverse Modeling Dataset 2010-2015
Griffis, Timothy J. [University of Minnesota; Baker, John; Millet, Dylan; Chen, Zichong; Wood, Jeff; Erickson, Matt; Lee, Xuhui
2017-01-01
This dataset contains nitrous oxide mixing ratios and supporting information measured at a tall tower (KCMP, 244 m) site near St. Paul, Minnesot, USA. The data include nitrous oxide and carbon dioxide mixing ratios measured at the 100 m level. Turbulence and wind data were measured using a sonic anemometer at the 185 m level. Also included in this dataset are estimates of the "background" nitrous oxide mixing ratios and monthly concentration source footprints derived from WRF-STILT modeling.
USDA-ARS?s Scientific Manuscript database
The first year of a 2 yr grazing study was conducted to evaluate use of Chaparral™ to suppress reproductive growth in tall fescue grazed with low and moderate grazing intensities. Chaparral applications (0 and 2.0 oz/acre) and grazing intensities were arranged as RCBD with three replications. Variab...
Mo, En-Pan; Zhang, Rong-Rong; Xu, Jun; Zhang, Huan; Wang, Xiao-Xiong; Tan, Qiu-Tong; Liu, Fang-Lan; Jiang, Ren-Wang; Cai, Shao-Hui
2016-09-16
Calotropin (M11), an active compound isolated from Asclepias curasavica L., was found to exert strong inhibitory and pro-apoptotic activity specifically against cisplatin-induced resistant non-small cell lung cancer (NSCLC) cells (A549/CDDP). Molecular mechanism study revealed that M11 induced cell cycle arrest at the G2/M phase through down-regulating cyclins, CDK1, CDK2 and up-regulating p53 and p21. Furthermore, M11 accelerated apoptosis through the mitochondrial apoptotic pathway which was accompanied by increase Bax/Bcl-2 ratio, decrease in mitochondrial membrane potential, increase in reactive oxygen species production, activations of caspases 3 and 9 as well as cleavage of poly ADP-ribose polymerase (PARP). The activation and phosphorylation of JNK was also found to be involved in M11-induced apoptosis, and SP610025 (specific JNK inhibitor) partially prevented apoptosis induced by M11. In contrast, all of the effects that M11 induce cell cycle arrest and apoptosis in A549/CDDP cells were not significant in A549 cells. Drugs with higher sensitivity against resistant tumor cells than the parent cells are rather rare. Results of this study supported the potential application of M11 on the non-small lung cancer (NSCLC) with cisplatin resistance. Copyright © 2016 Elsevier Inc. All rights reserved.
Lou, Yanhong; Zhao, Peng; Wang, Deling; Amombo, Erick; Sun, Xin; Wang, Hui; Zhuge, Yuping
2017-01-01
Cadmium (Cd) and lead (Pb) are recognized as the most toxic metal ions due to their detrimental effects not only to plants, but also to humans. The objective of this study was to investigate the effects of Cd and Pb treatments on seed germination, plant growth, and physiological response in tall fescue (Festuca arundinacea Schreb.). We employed six treatments: CK (nutrient solution as control), T1 (1000 mg L-1 Pb), T2 (50 mg L-1 Cd), T3 (150 mg L-1 Cd), T4 (1000 mg L-1 Pb+50 mg L-1 Cd), T5 (1000 mg L-1 Pb+150 mg L-1 Cd). Antagonistic and synergistic actions were observed in tall fescue under Pb and Cd combined treatments. Under low Cd, plants exhibited higher relative germination rate, germ length, VSGR, catalase (CAT) and peroxidase (POD) activities. Additionally, in the shoots, the gene expression level of Cu/Zn SOD, FeSOD, POD, GPX, translocation factors, MDA, EL, and soluble protein contents were reduced under Pb stress. Conversely, under high Cd level, there was a decline in NRT, Pb content in shoots, Pb translocation factors, CAT activity; and an increase in VSGR, Pb content in roots, gene expression level of Cu/ZnSOD and POD in tall fescue exposed to Pb2+ regimes. On the other hand, tall fescue plants treated with low Cd exhibited lower relative germination rate, germination index, germ length, NRT, Cd content in roots. On the other hand there was higher Cd content, Cd translocation factor, CAT and POD activities, and gene expression level of Cu/Zn SOD, FeSOD, POD, GPX under Pb treatment compared with single Cd2+ treatment in the shoots. However, after high Cd exposure, plants displayed lower NRT, Cd content, CAT activity, and exhibited higher Cd contents, Cd translocation factor, MDA content, gene expression level of Cu/ZnSOD and GPX with the presence of Pb2+ relative to single Cd2+ treatment. These findings lead to a conclusion that the presence of low Cd level impacted positively towards tall fescue growth under Pb stress, while high level of Cd impacted
Flores, R; Coblentz, W K; Ogden, R K; Coffey, K P; Looper, M L; West, C P; Rosenkrans, C F
2007-06-01
Two tall fescue (Festuca arundinacea Schreb.) forages, one an experimental host plant/endophyte association containing a novel endophyte (HM4) that produces low or nil concentrations of ergot alkaloids, and the other a typical association of Kentucky 31 tall fescue and the wild-type endophyte (Neotyphodium coenophialum; E+), were autumn-stockpiled following late-summer clipping and fertilization with 56 kg/ha of N to assess the nutritive value and ruminal disappearance kinetics of autumn-stockpiled tall fescue forages. Beginning on December 4, 2003, sixteen 361 +/- 56.4-kg replacement dairy heifers were stratified by weight and breeding and assigned to one of four 1.6-ha pastures (2 each of E+ and HM4) that were strip-grazed throughout the winter. Pastures were sampled before grazing was initiated (December 4), each time heifers were allowed access to a fresh strip (December 26, January 15, and February 4), and when the study was terminated (February 26). For fiber components, there were no interactions between fescue type and sampling date for either pregrazed or postgrazed forages. Over sampling dates, neutral detergent fiber (NDF; 56.5 to 67.8%), acid detergent fiber (27.7 to 34.9%), hemicellulose (28.8 to 34.0%), cellulose (25.0 to 28.1%), and lignin (3.61 to 10.05%) varied with sampling date, but patterns were almost exclusively curvilinear with time. Ruminal disappearance rate of dry matter (DM) was not affected by any treatment factor (overall mean for both pregrazed and postgrazed forages = 0.050 h(- 1)); similar responses were observed for NDF disappearance (overall mean = 0.048 h(- 1)). Interactions of fescue type and sampling date were observed for both pregrazed and postgrazed forages with respect to effective ruminal disappearance of DM; however, estimates were relatively high for all forages (overall mean = 64.0%). Effective disappearance of NDF was relatively extensive for all forages (overall mean = 55.4% of NDF). Based on the results of this trial
Lou, Yanhong; Zhao, Peng; Wang, Deling; Amombo, Erick; Sun, Xin; Wang, Hui; Zhuge, Yuping
2017-01-01
Cadmium (Cd) and lead (Pb) are recognized as the most toxic metal ions due to their detrimental effects not only to plants, but also to humans. The objective of this study was to investigate the effects of Cd and Pb treatments on seed germination, plant growth, and physiological response in tall fescue (Festuca arundinacea Schreb.). We employed six treatments: CK (nutrient solution as control), T1 (1000 mg L-1 Pb), T2 (50 mg L-1 Cd), T3 (150 mg L-1 Cd), T4 (1000 mg L-1 Pb+50 mg L-1 Cd), T5 (1000 mg L-1 Pb+150 mg L-1 Cd). Antagonistic and synergistic actions were observed in tall fescue under Pb and Cd combined treatments. Under low Cd, plants exhibited higher relative germination rate, germ length, VSGR, catalase (CAT) and peroxidase (POD) activities. Additionally, in the shoots, the gene expression level of Cu/Zn SOD, FeSOD, POD, GPX, translocation factors, MDA, EL, and soluble protein contents were reduced under Pb stress. Conversely, under high Cd level, there was a decline in NRT, Pb content in shoots, Pb translocation factors, CAT activity; and an increase in VSGR, Pb content in roots, gene expression level of Cu/ZnSOD and POD in tall fescue exposed to Pb2+ regimes. On the other hand, tall fescue plants treated with low Cd exhibited lower relative germination rate, germination index, germ length, NRT, Cd content in roots. On the other hand there was higher Cd content, Cd translocation factor, CAT and POD activities, and gene expression level of Cu/Zn SOD, FeSOD, POD, GPX under Pb treatment compared with single Cd2+ treatment in the shoots. However, after high Cd exposure, plants displayed lower NRT, Cd content, CAT activity, and exhibited higher Cd contents, Cd translocation factor, MDA content, gene expression level of Cu/ZnSOD and GPX with the presence of Pb2+ relative to single Cd2+ treatment. These findings lead to a conclusion that the presence of low Cd level impacted positively towards tall fescue growth under Pb stress, while high level of Cd impacted
Palomero, Teresa; Ferrando, Adolfo
2008-01-01
The identification of activating mutations in NOTCH1 in the majority of T-cell acute lymphoblastic leukemias and lymphomas (T-ALL) has brought much interest in inhibiting NOTCH1 signaling as therapeutic target in this disease. Small molecule inhibitors of the γ-secretase complex, which mediates a critical proteolytic cleavage required for NOTCH1 activation, hold the promise of becoming an effective molecular therapy against relapsed and refractory T-ALL. Recent progress in the elucidation of the transcriptional regulatory networks downstream of oncogenic NOTCH1 has uncovered a central role of NOTCH1 signaling in promoting leukemic cell growth and revealed an intricate circuitry that connects NOTCH1 signaling with MYC and the PI3K-AKT signaling pathway. The identification of the downstream effector pathways controlled by NOTCH1 should pave the way for the rational design of anti-NOTCH1 therapies for the treatment of T-ALL. PMID:18765521
Challenges of managing disease in tall orchard trees – pecan scab, a case study
USDA-ARS?s Scientific Manuscript database
Managing disease in tall orchard trees presents unique issues not found in relatively shorter horticultural and agronomic crops, simply due to height. Pecan scab (caused by Fusicladium effusum [G. Winter] Seyran et al.) is used as an example of a major disease of one of the tallest orchard crops in ...
Trejo, Sebastián A; López, Laura M I; Caffini, Néstor O; Natalucci, Claudia L; Canals, Francesc; Avilés, Francesc X
2009-07-01
Asclepain f is a papain-like protease previously isolated and characterized from latex of Asclepias fruticosa. This enzyme is a member of the C1 family of cysteine proteases that are synthesized as preproenzymes. The enzyme belongs to the alpha + beta class of proteins, with two disulfide bridges (Cys22-Cys63 and Cys56-Cys95) in the alpha domain, and another one (Cys150-Cys201) in the beta domain, as was determined by molecular modeling. A full-length 1,152 bp cDNA was cloned by RT-RACE-PCR from latex mRNA. The sequence was predicted as an open reading frame of 340 amino acid residues, of which 16 residues belong to the signal peptide, 113 to the propeptide and 211 to the mature enzyme. The full-length cDNA was ligated to pPICZalpha vector and expressed in Pichia pastoris. Recombinant asclepain f showed endopeptidase activity on pGlu-Phe-Leu-p-nitroanilide and was identified by PMF-MALDI-TOF MS. Asclepain f is the first peptidase cloned and expressed from mRNA isolated from plant latex, confirming the presence of the preprocysteine peptidase in the latex.
USDA-ARS?s Scientific Manuscript database
The hypotheses that endophyte (Neotyphodium coenophialum)-infected tall fescue (TF) seed causes vasoconstriction in horses in vivo and that ground seed would cause more pronounced vasoconstriction than whole seed were tested. Ten horses each received 1 of 3 treatments: endophyte-free ground (E–G; n ...
USDA-ARS?s Scientific Manuscript database
Previous research has indicated that serotonergic and a-adrenergic receptors in peripheral vasculature are affected by exposure of cattle grazing toxic endophyte-infected (E+; Epichlöe coenophialia) tall fescue (Lolium arundinaceum). The objective of this experiment was to determine the period of ti...
Nusslé, Sébastien; Miltner, Daniela; Kohle, Oliver; Glaizot, Olivier; Braunisch, Veronika; Obrist, Martin K.; Arlettaz, Raphaël
2018-01-01
Wind turbines represent a source of hazard for bats, especially through collision with rotor blades. With increasing technical development, tall turbines (rotor-swept zone 50–150 m above ground level) are becoming widespread, yet we lack quantitative information about species active at these heights, which impedes proposing targeted mitigation recommendations for bat-friendly turbine operation. We investigated vertical activity profiles of a bat assemblage, and their relationships to wind speed, within a major valley of the European Alps where tall wind turbines are being deployed. To monitor bat activity we installed automatic recorders at sequentially increasing heights from ground level up to 65 m, with the goal to determine species-specific vertical activity profiles and to link them to wind speed. Bat call sequences were analysed with an automatic algorithm, paying particular attention to mouse-eared bats (Myotis myotis and Myotis blythii) and the European free-tailed bat (Tadarida teniotis), three locally rare species. The most often recorded bats were the Common pipistrelle (Pipistrellus pipistrellus) and Savi’s pipistrelle (Hypsugo savii). Mouse-eared bats were rarely recorded, and mostly just above ground, appearing out of risk of collision. T. teniotis had a more evenly distributed vertical activity profile, often being active at rotor level, but its activity at that height ceased above 5 ms-1 wind speed. Overall bat activity in the rotor-swept zone declined with increasing wind speed, dropping below 5% above 5.4 ms-1. Collision risk could be drastically reduced if nocturnal operation of tall wind turbines would be restricted to wind speeds above 5 ms-1. Such measure should be implemented year-round because T. teniotis remains active in winter. This operational restriction is likely to cause only small energy production losses at these tall wind turbines, although further analyses are needed to assess these losses precisely. PMID:29561851
Wellig, Sascha D; Nusslé, Sébastien; Miltner, Daniela; Kohle, Oliver; Glaizot, Olivier; Braunisch, Veronika; Obrist, Martin K; Arlettaz, Raphaël
2018-01-01
Wind turbines represent a source of hazard for bats, especially through collision with rotor blades. With increasing technical development, tall turbines (rotor-swept zone 50-150 m above ground level) are becoming widespread, yet we lack quantitative information about species active at these heights, which impedes proposing targeted mitigation recommendations for bat-friendly turbine operation. We investigated vertical activity profiles of a bat assemblage, and their relationships to wind speed, within a major valley of the European Alps where tall wind turbines are being deployed. To monitor bat activity we installed automatic recorders at sequentially increasing heights from ground level up to 65 m, with the goal to determine species-specific vertical activity profiles and to link them to wind speed. Bat call sequences were analysed with an automatic algorithm, paying particular attention to mouse-eared bats (Myotis myotis and Myotis blythii) and the European free-tailed bat (Tadarida teniotis), three locally rare species. The most often recorded bats were the Common pipistrelle (Pipistrellus pipistrellus) and Savi's pipistrelle (Hypsugo savii). Mouse-eared bats were rarely recorded, and mostly just above ground, appearing out of risk of collision. T. teniotis had a more evenly distributed vertical activity profile, often being active at rotor level, but its activity at that height ceased above 5 ms-1 wind speed. Overall bat activity in the rotor-swept zone declined with increasing wind speed, dropping below 5% above 5.4 ms-1. Collision risk could be drastically reduced if nocturnal operation of tall wind turbines would be restricted to wind speeds above 5 ms-1. Such measure should be implemented year-round because T. teniotis remains active in winter. This operational restriction is likely to cause only small energy production losses at these tall wind turbines, although further analyses are needed to assess these losses precisely.
Li, Huiying; Hu, Tao; Amombo, Erick; Fu, Jinmin
2017-06-01
MicroRNAs (miRNAs) play vital roles in the adaptive response of plants to various abiotic and biotic stresses. Tall fescue (Festuca arundinacea Schreb.) is a major cool-season forage and turf grass species which is severely influenced by heat stress. To unravel possible heat stress-responsive miRNAs, high-throughput sequencing was employed for heat-tolerant PI578718 and heat-sensitive PI234881 genotypes growing in presence and absence of heat stress (40°C for 36h). By searching against the miRBase database, among 1421 reference monocotyledon miRNAs, more than 850 were identified in all samples. Among these miRNAs, 1.46% and 2.29% were differentially expressed in PI234881 and PI578718 under heat stress, respectively, and most of them were down-regulated. In addition, a total of 170 novel miRNAs belonging to 145 miRNA families were identified. Furthermore, putative targets of differentially expressed miRNAs were predicted. The regulation of selected miRNAs by heat stress was revalidated through quantitative reverse transcription PCR (qRT-PCR) analysis. Most of these miRNAs shared similar expression patterns; however, some showed distinct expression patterns under heat stress, with their putative targets displaying different transcription levels. This is the first genome-wide miRNA identification in tall fescue. miRNAs specific to PI578718, or those that exhibited differential expression profiles between the two genotypes under high temperature, were probably associated with the variation in thermotolerance of tall fescue. The differentially expressed miRNAs between these two tall fescue genotypes and their putative targeted genes will provide essential information for further study on miRNAs mediating heat response and facilitate to improve turf grass breeding. Copyright © 2017. Published by Elsevier GmbH.
Population structures of Brazilian tall coconut (Cocos nucifera L.) by microsatellite markers
2010-01-01
Coconut palms of the Tall group were introduced to Brazil from the Cape Verde Islands in 1553. The present study sought to evaluate the genetic diversity among and within Brazilian Tall coconut populations. Samples were collected of 195 trees from 10 populations. Genetic diversity was accessed by investigating 13 simple sequence repeats (SSR) loci. This provided a total of 68 alleles, ranging from 2 to 13 alleles per locus, with an average of 5.23. The mean values of gene diversity (He ) and observed heterozygosity (Ho ) were 0.459 and 0.443, respectively. The genetic differentiation among populations was estimated at θ^P=0.1600and the estimated apparent outcrossing rate was ta = 0.92. Estimates of genetic distances between the populations varied from 0.034 to 0.390. Genetic distance and the corresponding clustering analysis indicate the formation of two groups. The first consists of the Baía Formosa, Georgino Avelino, and São José do Mipibu populations and the second consists of the Japoatã, Pacatuba, and Praia do Forte populations. The correlation matrix between genetic and geographic distances was positive and significant at a 1% probability. Taken together, our results suggest a spatial structuring of the genetic variability among the populations. Geographically closer populations exhibited greater similarities. PMID:21637579
Reducing stem bending increases the height growth of tall pines.
Meng, Shawn X; Lieffers, Victor J; Reid, Douglas E B; Rudnicki, Mark; Silins, Uldis; Jin, Ming
2006-01-01
The hypothesis was tested that upper limits to height growth in trees are the result of the increasing bending moment of trees as they grow in height. The increasing bending moment of tall trees demands increased radial growth at the expense of height growth to maintain mechanical stability. In this study, the bending moment of large lodgepole pine (Pinus contorta Dougl. Ex Loud. var. latifolia Engelm.) was reduced by tethering trees at 10 m height to counter the wind load. Average bending moment of tethered trees was reduced to 38% of control trees. Six years of tethering resulted in a 40% increase in height growth relative to the period before tethering. By contrast, control trees showed decreased height growth in the period after tethering treatment. Average radial growth along the bole, relative to height growth, was reduced in tethered trees. This strongly suggests that mechanical constraints play a crucial role in limiting the height growth of tall trees. Analysis of bending moment and basal area increment at both 10 m and 1.3 m showed that the amount of wood added to the stem was closely related to the bending moment produced at these heights, in both control and tethered trees. The tethering treatment also resulted in an increase in the proportion of latewood at the tethering height, relative to 1.3 m height. For untethered control trees, the ratio of bending stresses at 10 m versus 1.3 m height was close to 1 in both 1998 and 2003, suggesting a uniform stress distribution along the outer surface of the bole.
NASA Astrophysics Data System (ADS)
Chen, Z.; Griffis, T. J.; Lee, X.; Fu, C.; Dlugokencky, E. J.; Andrews, A. E.
2017-12-01
Mitigation of nitrous oxide (N2O) emissions requires a sound understanding of N2O production processes and a robust estimate of N2O budgets. It is critical to understand how emissions vary spatially and temporally, and how they are likely to change given future climate and land management decisions. To address these challenges we have coupled two models including WRF-Chem version 3.8.1 and CLM-GBC-CROP version 4.5 to simulate retrospective and future N2O emissions for the US Corn Belt. Using 7 years (2010-2016) of N2O mixing ratio data from 6 tall tower sites within the US Midwest, we ran the coupled model at a spatial resolution of 0.125o× 0.125o and tested and optimized the simulation of N2O emissions at hourly, seasonal, and inter-annual timescales. Our preliminary results indicate:1) The simulated tall tower mixing ratios for 6 tall towers were all significantly higher than the observations in the growing seasons, indicating a high bias of N2O emissions when using the default N2O production mechanisms in CLM. 2) Following the optimization of N2O production in CLM, the simulated tall tower mixing ratios were strongly correlated with the KCMP and WBI towers, and had moderate correlation with the BAO tower. Overall, the absolute biases in mixing ratios were relatively small. Our next step is to examine 7 years of simulations to assess the spatiotemporal variations of direct and indirect emissions within the US Corn Belt to help identify potential N2O hotspots and hot moments.
From the Lab Bench: Can cattle meet their nutrient needs on toxic tall fescue pasture?
USDA-ARS?s Scientific Manuscript database
A column is written to provide information on nutrient utilization by cattle grazing toxic endophyte-infected tall fescue. We have considerable knowledge and understanding of ergot alkaloid-induced constriction of blood flow to peripheral tissues, but what about blood flow to other parts of the bod...
USDA-ARS?s Scientific Manuscript database
Plants interact with myriad microorganisms, which influence ecosystem processes and can regulate ecosystem response to global change. One important symbiosis occurs between the grass, tall fescue (Schedonorus arundinaceus), and the asexual fungal endophyte Epichloë coenophiala. Because the common to...
USDA-ARS?s Scientific Manuscript database
Serum prolactin (PRL) and testosterone concentrations, body weight, body composition, semen quality, and semen freezing potential for bulls grazing the toxic tall fescue (Lolium arundinaceum [Schreb.] Darbysh. ¼ Schedonorous arundinaceum [Schreb.] Dumort.) cultivar Kentucky 31 (E+) compared with a n...
USDA-ARS?s Scientific Manuscript database
Studies were conducted to address conditioned flavour aversion (CFA) and place avoidance learning in hamsters given injections of alkaloid extracts from tall larkspur (Delphinium barbeyi), to determine if larkspur had reinforcing or negative properties sufficient to cause place avoidance or preferen...
Exogenous Calcium Enhances the Photosystem II Photochemistry Response in Salt Stressed Tall Fescue.
Wang, Guangyang; Bi, Aoyue; Amombo, Erick; Li, Huiying; Zhang, Liang; Cheng, Cheng; Hu, Tao; Fu, Jinmin
2017-01-01
Calcium enhances turfgrass response to salt stress. However, little is known about PSII photochemical changes when exogenous calcium was applied in salinity-stressed turfgrass. Here, we probe into the rearrangements of PSII electron transport and endogenous ion accumulation in tall fescue ( Festuca arundinacea Schreber) treated with exogenous calcium under salt stress. Three-month-old seedlings of genotype "TF133" were subjected to the control (CK), salinity (S), salinity + calcium nitrate (SC), and salinity + ethylene glycol tetraacetic acid (SE). Calcium nitrate and ethylene glycol tetraacetic acid was used as exogenous calcium donor and calcium chelating agent respectively. At the end of a 5-day duration treatment, samples in SC regime had better photochemistry performance on several parameters than salinity only. Such as the Area (equal to the plastoquinone pool size), N (number of [Formula: see text] redox turnovers until F m is reached), ψE 0 , or δRo (Efficiencdy/probability with which a PSII trapped electron is transferred from Q A to Q B or PSI acceptors), ABS/RC (Absorbed photon flux per RC). All the above suggested that calcium enhanced the electron transfer of PSII (especially beyond [Formula: see text]) and prevented reaction centers from inactivation in salt-stressed tall fescue. Furthermore, both grass shoot and root tissues generally accumulated more C, N, Ca 2+ , and K + in the SC regime than S regime. Interrelated analysis indicated that ψE 0 , δRo, ABS/RC, C, and N content in shoots was highly correlated to each other and significantly positively related to Ca 2+ and K + content in roots. Besides, high salt increased ATP6E and CAMK2 transcription level in shoot at 1 and 5 day, respectively while exogenous calcium relieved it. In root, CAMK2 level was reduced by Salinity at 5 day and exogenous calcium recovered it. These observations involved in electron transport capacity and ion accumulation assist in understanding better the protective role
Exogenous Calcium Enhances the Photosystem II Photochemistry Response in Salt Stressed Tall Fescue
Wang, Guangyang; Bi, Aoyue; Amombo, Erick; Li, Huiying; Zhang, Liang; Cheng, Cheng; Hu, Tao; Fu, Jinmin
2017-01-01
Calcium enhances turfgrass response to salt stress. However, little is known about PSII photochemical changes when exogenous calcium was applied in salinity-stressed turfgrass. Here, we probe into the rearrangements of PSII electron transport and endogenous ion accumulation in tall fescue (Festuca arundinacea Schreber) treated with exogenous calcium under salt stress. Three-month-old seedlings of genotype “TF133” were subjected to the control (CK), salinity (S), salinity + calcium nitrate (SC), and salinity + ethylene glycol tetraacetic acid (SE). Calcium nitrate and ethylene glycol tetraacetic acid was used as exogenous calcium donor and calcium chelating agent respectively. At the end of a 5-day duration treatment, samples in SC regime had better photochemistry performance on several parameters than salinity only. Such as the Area (equal to the plastoquinone pool size), N (number of QA- redox turnovers until Fm is reached), ψE0, or δRo (Efficiencdy/probability with which a PSII trapped electron is transferred from QA to QB or PSI acceptors), ABS/RC (Absorbed photon flux per RC). All the above suggested that calcium enhanced the electron transfer of PSII (especially beyond QA-) and prevented reaction centers from inactivation in salt-stressed tall fescue. Furthermore, both grass shoot and root tissues generally accumulated more C, N, Ca2+, and K+ in the SC regime than S regime. Interrelated analysis indicated that ψE0, δRo, ABS/RC, C, and N content in shoots was highly correlated to each other and significantly positively related to Ca2+ and K+ content in roots. Besides, high salt increased ATP6E and CAMK2 transcription level in shoot at 1 and 5 day, respectively while exogenous calcium relieved it. In root, CAMK2 level was reduced by Salinity at 5 day and exogenous calcium recovered it. These observations involved in electron transport capacity and ion accumulation assist in understanding better the protective role of exogenous calcium in tall fescue
USDA-ARS?s Scientific Manuscript database
Yearling steers were grazed on endophyte-infected ‘Kentucky-31’ tall fescue (Lolium arundinaceum) pastures for 77 days in 2007 and for 86 days in 2008 to evaluate effects of feeding pelleted soybean hulls (PSBH) and steroid hormone implants (SHI) on steer performance and physiology. Steers were str...
Progress on the development of seismic resilient Tall CLT Buildings in the Pacific Northwest
Shiling Pei; Jeffrey Berman; Daniel Dolan; John van de Lindt; James Ricles; Richard Sause; Hans-Erik Blomgren; Marjan Popovski; Douglas Rammer
2014-01-01
As urban densification occurs in U.S. regions of high seismicity, there is a natural demand for seismically resilient tall buildings that are reliable, economically viable, and can be rapidly constructed. In urban regions on the west coast of the U.S., specifically the Pacific Northwest, there is significant interest in utilizing CLT in 8-20 story residential and...
An annual pattern of native embolism in upper branches of four tall conifer species
Katherine A. McCulloh; Daniel M. Johnson; Frederick C. Meinzer; Barbara Lachenbruch
2011-01-01
The Pacific Northwest of North America experiences relatively mild winters and dry summers. For the tall coniferous trees that grow in this region, we predicted that loss in the hydraulic conductivity of uppermost branches would be avoided because of difficulty reversing accumulated emboli in xylem that is always under negative pressure. To test this hypothesis, we...
Biochemical analysis of a papain-like protease isolated from the latex of Asclepias curassavica L.
Liggieri, Constanza; Obregon, Walter; Trejo, Sebastian; Priolo, Nora
2009-02-01
Most of the species belonging to Asclepiadaceae family usually secrete an endogenous milk-like fluid in a network of laticifer cells in which sub-cellular organelles intensively synthesize proteins and secondary metabolites. A new papain-like endopeptidase (asclepain c-II) has been isolated and characterized from the latex extracted from petioles of Asclepias curassavica L. (Asclepiadaceae). Asclepain c-II was the minor proteolytic component in the latex, but showed higher specific activity than asclepain c-I, the main active fraction previously studied. Both enzymes displayed quite distinct biochemical characteristics, confirming that they are different enzymes. Crude extract was purified by cation exchange chromatography (FPLC). Two active fractions, homogeneous by sodium dodecyl sulphate-polyacrylamide gel electrophoresis and mass spectrometry, were isolated. Asclepain c-II displayed a molecular mass of 23,590 Da, a pI higher than 9.3, maximum proteolytic activity at pH 9.4-10.2, and showed poor thermostability. The activity of asclepain c-II is inhibited by cysteine proteases inhibitors like E-64, but not by any other protease inhibitors such as 1,10-phenantroline, phenylmethanesulfonyl fluoride, and pepstatine. The Nterminal sequence (LPSFVDWRQKGVVFPIRNQGQCGSCWTFSA) showed a high similarity with those of other plant cysteine proteinases. When assayed on N-alpha-CBZ-amino acid-p-nitrophenyl esters, the enzyme exhibited higher preference for the glutamine derivative. Determinations of kinetic parameters were performed with N-alpha-CBZ-L-Gln-p-nitrophenyl ester as substrate: K(m)=0.1634 mM, k(cat)=121.48 s(-1), and k(cat)/K(m)=7.4 x 10(5) s(-1)/mM.
Alexander, Helen M; Reed, Aaron W; Kettle, W Dean; Slade, Norman A; Bodbyl Roels, Sarah A; Collins, Cathy D; Salisbury, Vaughn
2012-01-01
Monitoring programs, where numbers of individuals are followed through time, are central to conservation. Although incomplete detection is expected with wildlife surveys, this topic is rarely considered with plants. However, if plants are missed in surveys, raw count data can lead to biased estimates of population abundance and vital rates. To illustrate, we had five independent observers survey patches of the rare plant Asclepias meadii at two prairie sites. We analyzed data with two mark-recapture approaches. Using the program CAPTURE, the estimated number of patches equaled the detected number for a burned site, but exceeded detected numbers by 28% for an unburned site. Analyses of detected patches using Huggins models revealed important effects of observer, patch state (flowering/nonflowering), and patch size (number of stems) on probabilities of detection. Although some results were expected (i.e. greater detection of flowering than nonflowering patches), the importance of our approach is the ability to quantify the magnitude of detection problems. We also evaluated the degree to which increased observer numbers improved detection: smaller groups (3-4 observers) generally found 90 - 99% of the patches found by all five people, but pairs of observers or single observers had high error and detection depended on which individuals were involved. We conclude that an intensive study at the start of a long-term monitoring study provides essential information about probabilities of detection and what factors cause plants to be missed. This information can guide development of monitoring programs.
NASA Astrophysics Data System (ADS)
Partono, Windu; Pardoyo, Bambang; Atmanto, Indrastono Dwi; Azizah, Lisa; Chintami, Rouli Dian
2017-11-01
Fault is one of the dangerous earthquake sources that can cause building failure. A lot of buildings were collapsed caused by Yogyakarta (2006) and Pidie (2016) fault source earthquakes with maximum magnitude 6.4 Mw. Following the research conducted by Team for Revision of Seismic Hazard Maps of Indonesia 2010 and 2016, Lasem, Demak and Semarang faults are three closest earthquake sources surrounding Semarang. The ground motion from those three earthquake sources should be taken into account for structural design and evaluation. Most of tall buildings, with minimum 40 meter high, in Semarang were designed and constructed following the 2002 and 2012 Indonesian Seismic Code. This paper presents the result of sensitivity analysis research with emphasis on the prediction of deformation and inter-story drift of existing tall building within the city against fault earthquakes. The analysis was performed by conducting dynamic structural analysis of 8 (eight) tall buildings using modified acceleration time histories. The modified acceleration time histories were calculated for three fault earthquakes with magnitude from 6 Mw to 7 Mw. The modified acceleration time histories were implemented due to inadequate time histories data caused by those three fault earthquakes. Sensitivity analysis of building against earthquake can be predicted by evaluating surface response spectra calculated using seismic code and surface response spectra calculated from acceleration time histories from a specific earthquake event. If surface response spectra calculated using seismic code is greater than surface response spectra calculated from acceleration time histories the structure will stable enough to resist the earthquake force.
NASA Astrophysics Data System (ADS)
Xu, K.; Sühring, M.; Metzger, S.; Desai, A. R.
2017-12-01
Most eddy covariance (EC) flux towers suffer from footprint bias. This footprint not only varies rapidly in time, but is smaller than the resolution of most earth system models, leading to a systemic scale mismatch in model-data comparison. Previous studies have suggested this problem can be mitigated (1) with multiple towers, (2) by building a taller tower with a large flux footprint, and (3) by applying advanced scaling methods. Here we ask: (1) How many flux towers are needed to sufficiently sample the flux mean and variation across an Earth system model domain? (2) How tall is tall enough for a single tower to represent the Earth system model domain? (3) Can we reduce the requirements derived from the first two questions with advanced scaling methods? We test these questions with output from large eddy simulations (LES) and application of the environmental response function (ERF) upscaling method. PALM LES (Maronga et al. 2015) was set up over a domain of 12 km x 16 km x 1.8 km at 7 m spatial resolution and produced 5 hours of output at a time step of 0.3 s. The surface Bowen ratio alternated between 0.2 and 1 among a series of 3 km wide stripe-like surface patches, with horizontal wind perpendicular to the surface heterogeneity. A total of 384 virtual towers were arranged on a regular grid across the LES domain, recording EC observations at 18 vertical levels. We use increasing height of a virtual flux tower and increasing numbers of virtual flux towers in the domain to compute energy fluxes. Initial results show a large (>25) number of towers is needed sufficiently sample the mean domain energy flux. When the ERF upscaling method was applied to the virtual towers in the LES environment, we were able to map fluxes over the domain to within 20% precision with a significantly smaller number of towers. This was achieved by relating sub-hourly turbulent fluxes to meteorological forcings and surface properties. These results demonstrate how advanced scaling
Evolution of plant growth and defense in a continental introduction.
Agrawal, Anurag A; Hastings, Amy P; Bradburd, Gideon S; Woods, Ellen C; Züst, Tobias; Harvey, Jeffrey A; Bukovinszky, Tibor
2015-07-01
Substantial research has addressed adaptation of nonnative biota to novel environments, yet surprisingly little work has integrated population genetic structure and the mechanisms underlying phenotypic differentiation in ecologically important traits. We report on studies of the common milkweed Asclepias syriaca, which was introduced from North America to Europe over the past 400 years and which lacks most of its specialized herbivores in the introduced range. Using 10 populations from each continent grown in a common environment, we identified several growth and defense traits that have diverged, despite low neutral genetic differentiation between continents. We next developed a Bayesian modeling approach to account for relationships between molecular and phenotypic differences, confirming that continental trait differentiation was greater than expected from neutral genetic differentiation. We found evidence that growth-related traits adaptively diverged within and between continents. Inducible defenses triggered by monarch butterfly herbivory were substantially reduced in European populations, and this reduction in inducibility was concordant with altered phytohormonal dynamics, reduced plant growth, and a trade-off with constitutive investment. Freedom from the community of native and specialized herbivores may have favored constitutive over induced defense. Our replicated analysis of plant growth and defense, including phenotypically plastic traits, suggests adaptive evolution following a continental introduction.
46 CFR 34.20-90 - Installations contracted for prior to January 1, 1970-T/ALL.
Code of Federal Regulations, 2011 CFR
2011-10-01
... 46 Shipping 1 2011-10-01 2011-10-01 false Installations contracted for prior to January 1, 1970-T/ALL. 34.20-90 Section 34.20-90 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY TANK VESSELS FIREFIGHTING EQUIPMENT Deck Foam System, Details § 34.20-90 Installations contracted for prior to January 1...
46 CFR 34.20-90 - Installations contracted for prior to January 1, 1970-T/ALL.
Code of Federal Regulations, 2010 CFR
2010-10-01
... 46 Shipping 1 2010-10-01 2010-10-01 false Installations contracted for prior to January 1, 1970-T/ALL. 34.20-90 Section 34.20-90 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY TANK VESSELS FIREFIGHTING EQUIPMENT Deck Foam System, Details § 34.20-90 Installations contracted for prior to January 1...
DOE Office of Scientific and Technical Information (OSTI.GOV)
Brosi, Glade; McCulley, Rebecca L; Bush, L P
Climate change (altered CO{sub 2}, warming, and precipitation) may affect plant-microbial interactions, such as the Lolium arundinaceum-Neotyphodium coenophialum symbiosis, to alter future ecosystem structure and function. To assess this possibility, tall fescue tillers were collected from an existing climate manipulation experiment in a constructed old-field community in Tennessee (USA). Endophyte infection frequency (EIF) was determined, and infected (E+) and uninfected (E-) tillers were analysed for tissue chemistry. The EIF of tall fescue was higher under elevated CO{sub 2} (91% infected) than with ambient CO{sub 2} (81%) but was not affected by warming or precipitation treatments. Within E+ tillers, elevated CO{submore » 2} decreased alkaloid concentrations of both ergovaline and loline, by c. 30%; whereas warming increased loline concentrations 28% but had no effect on ergovaline. Independent of endophyte infection, elevated CO{sub 2} reduced concentrations of nitrogen, cellulose, hemicellulose, and lignin. These results suggest that elevated CO{sub 2}, more than changes in temperature or precipitation, may promote this grass-fungal symbiosis, leading to higher EIF in tall fescue in old-field communities. However, as all three climate factors are likely to change in the future, predicting the symbiotic response and resulting ecological consequences may be difficult and dependent on the specific atmospheric and climatic conditions encountered.« less
Narayanan, Vidya Kanamkote; Kharbanda, Mira; Donaldson, Malcolm
2016-12-01
Gonadal dysgenesis with an apparently normal 46,XX karyotype is a rare cause of hypergonadotrophic hypogonadism. Tall stature is not a widely recognized association. A 15-year-old girl presented with primary amenorrhoea. Examination showed a non-dysmorphic girl of normal intellect with no breast development (Tanner stage B1P4A1) who was tall compared with her parents: height standard deviation score (SDS) +1.56 vs. midparental height of +0.23 SDS, and slim build (weight -0.13 SDS). Investigations showed a 46,XX karyotype, elevated gonadotropins (FSH 119 and LH 33.7 IU/L), serum estradiol <5 pmol/L, uterine length 3.75 cm with cylindrical shape, and absent ovaries on ultrasound. Initially, a 364055-bp deletion on Xp21.2 was reported on array CGH. However, repeat analysis using BlueGnome CytoChip ISCA 4x180k v2.0 array was normal. With oral ethinyl estradiol induction puberty progressed to B4P4A2 but aged 18.4 years, the patient was remarkably tall with height SDS +2.88, weight SDS +0.97. Caution is needed in interpreting small changes with array CGH, particularly with the older assays. We postulate that the genetic change causing 46,XX gonadal dysgenesis in our patient may have also resulted in unsuppressed somatic growth. More critical height assessment, including parental height measurement, of future patients with 46,XX gonadal dysgenesis is recommended in order to determine whether or not a true association with tall stature may be present in certain cases.
Browning, R
2004-02-01
Poor growth often occurs in cattle consuming ergot alkaloids associated with endophyte-infected (EI) tall fescue. Hyperthermia may contribute significantly to poor growth resulting from fescue toxicosis. This study examined indicators of thermal status and growth in Hereford (n = 30; heat-sensitive Bos taurus; H) and Senepol (n = 28; heat-tolerant Bos taurus; S) steers fed EI tall fescue (TF) or orchardgrass (OG) in 2 x 2 factorial experiments. Respiration rates, daytime shade use, tail skin temperatures, and body weights were measured during the summer and fall of 2000 (Exp. 1) and 2001 (Exp. 2). Experimental diets consisted of hay and seed for 12 wk in 2000, hay for 6 wk during the summer of 2001, and hay plus seed for 6 wk during the fall of 2001. In Exp. 1, EI tall fescue increased (P < 0.01) respiration rates, shade use, and skin temperatures in both breeds. Breed x diet affected (P < 0.01) 12-wk ADG in Exp. 1. Growth rate was lower for H-TF (262 g/d) than for S-TF, S-OG, and H-OG (475, 497, and 524 g/d, respectively). In Exp. 2, Senepol had lower (P < 0.01) respiration rates, shade use, and skin temperatures compared with Hereford, but diet did not alter (P > 0.14) these indicator traits in either breed. Breed x diet affected (P < 0.01) summer growth rates. Growth rate was lower for H-TF (88 g/d) than for H-OG, S-TF, and S-OG (508, 555, and 566 g/d, respectively). Adding seed to the diets in Exp. 2 decreased (P < 0.01) ADG for both breeds on TF during the fall. Thermal status indicator traits in Senepol and Hereford steers were similarly altered by TF; however, only Hereford showed consistently poor growth. Senepol showed resilience in their capacity for growth under conditions of fescue toxicosis. Senepol influence may enhance cattle performance in production systems that use EI tall fescue as the base forage.
Heymsfield, Steven B; Pietrobelli, Angelo
2010-01-01
Mammalian resting energy expenditure (REE) increases as approximately weight(0.75) while mass-specific REE scales as approximately weight(-0.25). Energy needs for replacing resting losses are thus less relative to weight (W) in large compared with small mammals, a classic observation with biological implications. Human weight scales as approximately height(2) and tall adults thus have a greater weight than their short counterparts. However, it remains unknown if mass-specific energy requirements are less in tall adults; allometric models linking total energy expenditure (TEE) and weight with height (H) are lacking. We tested the hypothesis that mass-specific energy requirements scale inversely to height in adults by evaluating TEE (doubly labeled water) data collected by the National Academy of Sciences. Activity energy expenditure (AEE) was calculated from TEE, REE (indirect calorimetry), and estimated diet-induced energy expenditure. Main analyses focused on nonmorbidly obese subjects < or =50 yrs of age with non-negative AEE values (n = 404), although results were directionally similar for all samples. Allometric models, including age as a covariate, revealed significantly (P < 0.05) greater REE, AEE, and TEE as a function of height (range H(1.5-1.7)) in both men and women. TEE/W scaled negatively to height ( approximately H(-0.7), P < 0.01) with predicted mass-specific TEE (kcal/kg/d) at +/-2 SD for US height lower in tall compared with short men (40.3 vs. 46.5) and women (37.7 vs. 42.7). REE/W also scaled negatively to height in men (P < 0.001) and women (P < 0.01). Results were generally robust across several different analytic strategies. These observations reveal previously unforeseen associations between human stature and energy requirements that have implications for modeling efforts and provide new links to mammalian biology as a whole.
Exploring U.S. Westward Expansion in the Elementary and Middle School Curriculum through Tall Tales
ERIC Educational Resources Information Center
Almerico, Gina M.; Martin, Nicole; Masuck, William; Strickland, Cynthia; Thomas, Jessica
2012-01-01
Teaching social studies in the elementary and middle school curriculum is enhanced by incorporating quality children's and adolescent literature and strategies that bring the human element into play. American tall tales are a genre unique to the history of our nation and provide a glimpse into the way early settlers of the west envisioned heroism…
Tall stature without growth hormone: four male patients with aromatase deficiency.
Rochira, Vincenzo; Zirilli, Lucia; Maffei, Laura; Premrou, Valeria; Aranda, Claudio; Baldi, Matteo; Ghigo, Ezio; Aimaretti, Gianluca; Carani, Cesare; Lanfranco, Fabio
2010-04-01
From preliminary observations, GH-IGF-I seems to be compromised in men with aromatase deficiency. The GH deficiency (GHD) coexists paradoxically with tall stature, raising the question whether or not a true GHD is part of this rare syndrome. To evaluate the GH secretion in aromatase-deficient men, their GH response to the GHRH plus arginine (GHRH-ARG) test was compared with that of normal subjects. The effect of estrogen replacement treatment on the GH-IGF-I axis in aromatase-deficient men was evaluated before and during therapy. A case-control study was conducted. Four adult men with aromatase deficiency were compared with 12 normal subjects. We measured the GH response to GHRH-ARG in aromatase-deficient men (at baseline and during estrogen treatment) and in normal subjects. Basal serum IGF-I was measured in both patients and controls. The response of GH to GHRH-ARG was severely impaired in men with aromatase deficiency and resulted in significantly lower (P < 0.001) levels than in normal subjects. Although normal, serum IGF-I levels were also significantly lower (P < 0.001) than in normal subjects. Both GH peak and IGF-I concentrations were not modified by estrogen therapy in men with aromatase deficiency. In aromatase-deficient men, GH response to potent provocative stimuli is impaired and is not restored by exogenous estrogens. Furthermore, a tall stature may be reached, notwithstanding the coexistence of GHD, if a prolonged time for growth is available due to a delay in bone maturation, and other growth factors different from GH (mainly insulin) promote growth.
Federal Register 2010, 2011, 2012, 2013, 2014
2013-05-01
... DEPARTMENT OF HOMELAND SECURITY Coast Guard 33 CFR Part 165 [Docket No. USCG-2013-0192] RIN 1625-AA00 Safety Zone; Tall Ship Safety Zones; War of 1812 Bicentennial Commemoration, Great Lakes AGENCY... 2013 and the War of 1812 Bicentennial Commemoration. These safety zones will ensure the safety of...
Vowles, Tage; Gunnarsson, Bengt; Molau, Ulf; Hickler, Thomas; Klemedtsson, Leif; Björk, Robert G
2017-11-01
One of the most palpable effects of warming in Arctic ecosystems is shrub expansion above the tree line. However, previous studies have found that reindeer can influence plant community responses to warming and inhibit shrubification of the tundra.We revisited grazed (ambient) and ungrazed study plots (exclosures), at the southern as well as the northern limits of the Swedish alpine region, to study long-term grazing effects and vegetation changes in response to increasing temperatures between 1995 and 2011, in two vegetation types (shrub heath and mountain birch forest).In the field layer at the shrub heath sites, evergreen dwarf shrubs had increased in cover from 26% to 49% but were unaffected by grazing. Deciduous dwarf and tall shrubs also showed significant, though smaller, increases over time. At the birch forest sites, the increase was similar for evergreen dwarf shrubs (20-48%) but deciduous tall shrubs did not show the same consistent increase over time as in the shrub heath.The cover and height of the shrub layer were significantly greater in exclosures at the shrub heath sites, but no significant treatment effects were found on species richness or diversity.July soil temperatures and growing season thawing degree days (TDD) were higher in exclosures at all but one site, and there was a significant negative correlation between mean shrub layer height and soil TDD at the shrub heath sites. Synthesis . This study shows that shrub expansion is occurring rapidly in the Scandes mountain range, both above and below the tree line. Tall, deciduous shrubs had benefitted significantly from grazing exclosure, both in terms of cover and height, which in turn lowered summer soil temperatures. However, the overriding vegetation shift across our sites was the striking increase in evergreen dwarf shrubs, which were not influenced by grazing. As the effects of an increase in evergreen dwarf shrubs and more recalcitrant plant litter may to some degree counteract some of
USDA-ARS?s Scientific Manuscript database
A common problem when poultry litter is applied to pastures in the southeastern USA is the buildup of soil P because of the difference in N-P-K ratio of the litter and plant requirements. This 2-yr study tested the theory that if the N requirement of a tall fescue-bermudagrass binary mixture is only...
Lead Accumulation by Tall Fescue (Festuca arundinacea Schreb.) Grown on a Lead-Contaminated Soil
Begonia, M. T.; Begonia, G. B.; Ighoavodha, M.; Gilliard, D.
2005-01-01
Phytoextraction is gaining acceptance as a cost-effective and environmentally friendly phytoremediation strategy for reducing toxic metal levels from contaminated soils. Cognizant of the potential of this phytoremediation technique as an alternative to expensive engineering-based remediation technologies, experiments were conducted to evaluate the suitability of some plants as phytoextraction species. From one of our preliminary studies, we found that tall fescue (Festuca arundinacea Schreb. cv. Spirit) can tolerate and accumulate significant amounts of lead (Pb) in its shoots when grown in Pb-amended sand. To further evaluate the suitability of tall fescue as one of the potential crop rotation species for phytoextraction, a study was conducted to determine whether the addition of ethylenediaminetetraacetic acid (EDTA) alone or in combination with acetic acid can further enhance the shoot uptake of Pb. Seeds were planted in 3.8 L plastic pots containing top soil, peat, and sand (4:2:1, v:v:v) spiked with various levels (0,1000, 2000 mg Pb/kg dry soil) of lead. At six weeks after planting, aqueous solutions (0, 5 mmol/kg dry soil) of EDTA and acetic acid (5 mmol/kg dry soil) were applied to the root zone, and all plants were harvested a week later. Results revealed that tall fescue was relatively tolerant to moderate levels of Pb as shown by non-significant differences in root and shoot biomass among treatments. An exception to this trend however, was the slight reduction in root and shoot biomass of plants exposed to the highest Pb level in combination with the two chelates. Root Pb concentration increased with increasing level of soil-applied Pb. Further increases in root Pb concentrations were attributed to chelate amendments. Translocation index, which is a measure of the partitioning of the metal to the shoots, was significantly enhanced with chelate addition especially when both EDTA and acetic acid were used. Chelate-induced increases in translocation indices
Evaluation of low wind modeling approaches for two tall-stack databases.
Paine, Robert; Samani, Olga; Kaplan, Mary; Knipping, Eladio; Kumar, Naresh
2015-11-01
The performance of the AERMOD air dispersion model under low wind speed conditions, especially for applications with only one level of meteorological data and no direct turbulence measurements or vertical temperature gradient observations, is the focus of this study. The analysis documented in this paper addresses evaluations for low wind conditions involving tall stack releases for which multiple years of concurrent emissions, meteorological data, and monitoring data are available. AERMOD was tested on two field-study databases involving several SO2 monitors and hourly emissions data that had sub-hourly meteorological data (e.g., 10-min averages) available using several technical options: default mode, with various low wind speed beta options, and using the available sub-hourly meteorological data. These field study databases included (1) Mercer County, a North Dakota database featuring five SO2 monitors within 10 km of the Dakota Gasification Company's plant and the Antelope Valley Station power plant in an area of both flat and elevated terrain, and (2) a flat-terrain setting database with four SO2 monitors within 6 km of the Gibson Generating Station in southwest Indiana. Both sites featured regionally representative 10-m meteorological databases, with no significant terrain obstacles between the meteorological site and the emission sources. The low wind beta options show improvement in model performance helping to reduce some of the over-prediction biases currently present in AERMOD when run with regulatory default options. The overall findings with the low wind speed testing on these tall stack field-study databases indicate that AERMOD low wind speed options have a minor effect for flat terrain locations, but can have a significant effect for elevated terrain locations. The performance of AERMOD using low wind speed options leads to improved consistency of meteorological conditions associated with the highest observed and predicted concentration events. The
Tall fescue seed extraction and partial purification of ergot alkaloids
Ji, Huihua; Fannin, F.; Klotz, J.; Bush, Lowell
2014-01-01
Many substances in the tall fescue/endophyte association (Schedonorus arundinaceus/Epichloë coenophiala) have biological activity. Of these compounds only the ergot alkaloids are known to have significant mammalian toxicity and the predominant ergot alkaloids are ergovaline and ergovalinine. Because synthetically produced ergovaline is difficult to obtain, we developed a seed extraction and partial purification protocol for ergovaline/ergovalinine that provided a biologically active product. Tall fescue seed was ground and packed into several different sized columns for liquid extraction. Smaller particle size and increased extraction time increased efficiency of extraction. Our largest column was a 114 × 52 × 61 cm (W × L × D) stainless steel tub. Approximately 150 kg of seed could be extracted in this tub. The extraction was done with 80% ethanol. When the solvent front migrated to bottom of the column, flow was stopped and seed was allowed to steep for at least 48 h. Light was excluded from the solvent from the beginning of this step to the end of the purification process. Following elution, ethanol was removed from the eluate by evaporation at room temperature and the resulting syrup was freeze-dried. About 80% recovery of alkaloids was achieved with 18-fold increase in concentration of ergovaline. Initial purification of the dried product was accomplished by extracting with hexane/water (6:1, v/v). The aqueous fraction was extracted with chloroform, the aqueous layer discarded, after which the chloroform was removed with a resulting 20-fold increase of ergovaline. About 65% of the ergovaline was recovered from the chloroform residue for an overall recovery of 50%. The resultant partially purified ergovaline had biological activities in in vivo and in vitro bovine bioassays that approximate that of synthetic ergovaline. PMID:25566528
Recent Results From the NOAA/ESRL GMD Tall Tower Network
NASA Astrophysics Data System (ADS)
Andrews, A. E.; Tans, P. P.; Peters, W.; Hirsch, A.; Sweeney, C.; Petron, G.; Kofler, J.; Zhao, C.; Masarie, K.; Wofsy, S. C.; Matross, D. M.; Mahadevan, P.; Longo, M.; Gerbig, C.; Lin, J. C.
2006-12-01
We will present a summary of new results from NOAA Earth System Research Laboratory`s Tall Tower greenhouse gas monitoring network. The tower network is operated by the Global Monitoring Division, which also maintains the global Cooperative Air Sampling network and a network of aircraft profiling sites over North America. Tall tower CO2 mixing ratio measurements are sensitive to upwind fluxes over scales of hundreds of kilometers, and the primary objective of the tower network is to obtain regionally representative carbon flux estimates for the North American continent. Mixing ratios of CO2 and CO are measured semi-continuously at the towers, and the KWKT-TV tower site near Moody, TX has recently also been equipped with sensors to measure radon and O3. Daily flask samples are collected at the KWKT tower and analyzed for CO2, CO, CH4, SF6, N2O, H2, stable isotopes of CO2 and CH4, COS, and a variety of halocarbon and hydrocarbon species. Daily flask sampling will be implemented at all tower sites within the next few years. We have used the Stochastic Time Inverted Lagrangian Transport (STILT) model to investigate upwind influences on the tower observations. CO measurements provide an indicator of polluted air masses, and we will present a summary of the frequency and origin of pollution events observed at the towers. We will present an analysis of the primary factors contributing to observed CO2 variability along with average seasonal and diurnal cycles of CO2 at the tower sites. Tower measurements are being used to evaluate atmospheric transport models in the context of the Transcom Continuous experiment and are an important constraint for CO2 data assimilation systems that produce regional to global carbon flux estimates with up to weekly resolution.
Tall fescue seed extraction and partial purification of ergot alkaloids
NASA Astrophysics Data System (ADS)
Bush, Lowell
2014-12-01
Many substances in the tall fescue/endophyte association (Schedonorus arundinaceus/Epichloë coenophiala) have biological activity. Of these compounds only the ergot alkaloids are known to have significant mammalian toxicity and the predominant ergot alkaloids are ergovaline and ergovalinine. Because synthetically produced ergovaline is difficult to obtain, we developed a seed extraction and partial purification protocol for ergovaline/ergovalinine that provided a biologically active product. Tall fescue seed was ground and packed into several different sized columns for liquid extraction. Smaller particle size and increased extraction time increased efficiency of extraction. Our largest column was a 114 × 52 × 61 cm (W×L×D) stainless steel tub. Approximately 150 kg of seed could be extracted in this tub. The extraction was done with 80% ethanol. When the solvent front migrated to bottom of the column, flow was stopped and seed was allowed to steep for at least 48 h. Light was excluded from the solvent from the beginning of this step to the end of the purification process. Following elution, ethanol was removed from the eluate by evaporation at room temperature. Resulting syrup was freeze-dried. About 80% recovery of alkaloids was achieved with 18-fold increase in concentration of ergovaline. Initial purification of the dried product was accomplished by extracting with hexane/water (6:1, v/v) and the hexane fraction was discarded. The aqueous fraction was extracted with chloroform, the aqueous layer discarded, after which the chloroform was removed with a resulting 20-fold increase of ergovaline. About 65% of the ergovaline was recovered from the chloroform residue for an overall recovery of 50%. The resultant partially purified ergovaline had biological activities in in vivo and in vitro bovine bioassays that approximate that of synthetic ergovaline.
Water retained in tall Cryptomeria japonica leaves as studied by infrared micro-spectroscopy.
Azuma, Wakana; Nakashima, Satoru; Yamakita, Eri; Ishii, H Roaki; Kuroda, Keiko
2017-10-01
Recent studies in the tallest tree species suggest that physiological and anatomical traits of tree-top leaves are adapted to water-limited conditions. In order to examine water retention mechanism of leaves in a tall tree, infrared (IR) micro-spectroscopy was conducted on mature leaf cross-sections of tall Cryptomeria japonica D. Don from four different heights (51, 43, 31 and 19 m). We measured IR transmission spectra and mainly analyzed OH (3700-3000 cm-1) and C-O (1190-845 cm-1) absorption bands, indicating water molecules and sugar groups, respectively. The changes in IR spectra of leaf sections from different heights were compared with bulk-leaf hydraulics. Both average OH band area of the leaf sections and leaf water content were larger in the upper-crown, while osmotic potential at saturation did not vary with height, suggesting higher dissolved sugar contents of upper-crown leaves. As cell-wall is the main cellular structure of leaves, we inferred that larger average C-O band area of upper-crown leaves reflected higher content of structural polysaccharides such as cellulose, hemicellulose and pectin. Infrared micro-spectroscopic imaging showed that the OH and C-O band areas are large in the vascular bundle, transfusion tissue and epidermis. Infrared spectra of individual tissue showed that much more water is retained in vascular bundle and transfusion tissue than mesophyll. These results demonstrate that IR micro-spectroscopy is a powerful tool for visualizing detailed, quantitative information on the spatial distribution of chemical substances within plant tissues, which cannot be done using conventional methods like histochemical staining. The OH band could be well reproduced by four Gaussian OH components around 3530 (free water: long H bond), 3410 (pectin-like OH species), 3310 (cellulose-like OH species) and 3210 (bound water: short H bond) cm-1, and all of these OH components were higher in the upper crown while their relative proportions did not
NASA Astrophysics Data System (ADS)
Momtaz, Ali Ajilian; Abdollahian, Mohamadreza Akhavan; Farshidianfar, Anooshiravan
2017-12-01
In recent years, construction of tall buildings has been of great interest. Use of lightweight materials in such structures reduces stiffness and damping, making the building more influenced by wind loads. Moreover, tall buildings of more than 30 to 40 stories, depending on the geographical location, the wind effects are more influential than earthquakes. In addition, the complexity of the effects of wind flow on the structure due to the interaction of the fluid flow and solid body results in serious damages to the structure by eliminating them. Considering the importance of the issue, the present study investigates the phenomenon of wind-induced vibration on high-rise buildings, taking into account the effects of vortices created by the fluid flow and the control of this phenomenon. To this end, the governing equations of the structure, the fluid flow and the tuned mass damper (TMD) are first introduced, and their coefficient values are extracted according to the characteristics of ACT skyscraper in Japan. Then, these three coupled equations are solved using a program coded in MATLAB. After validation of the results, the effects of wind loads are analyzed and considered with regard to the effects of vortices and the use of TMD, and are compared with the results of the state where no vortices are considered. Generally, the results of this study point out the significance of vibrations caused by vortices in construction of engineering structures as well as the appropriate performance of a TMD in reducing oscillations in tall buildings.
Hu, Longxing; Zhang, Zhifei; Xiang, Zuoxiang; Yang, Zhijian
2016-01-01
Citric acid may be involved in plant response to high temperature. The objective of this study was to investigate whether exogenous citric acid could improve heat tolerance in a cool-season turfgrass species, tall fescue (Lolium arundinaceum), and to determine the physiological mechanisms of citric acid effects on heat stress tolerance. The grasses were subjected to four citric acid levels (0, 0.2, 2, and 20 mM) and two temperature levels (25/20 and 35/30 ± 0.5°C, day/night) treatments in growth chambers. Heat stress increased an electrolyte leakage (EL) and malonaldehyde (MDA) content, while reduced plant growth, chlorophyll (Chl) content, photochemical efficiency (Fv/Fm), root activity and antioxidant enzyme activities (superoxide dismutase, SOD; catalase, CAT; peroxidase, POD). External citric acid alleviated the detrimental effects of heat stress on tall fescue, which was evidenced by decreased EL and MDA content, and improved plant growth under stress conditions. Additionally, the reduction in Chl content, Fv/Fm, SOD, POD, CAT and root activity were ameliorated in citric acid treated plants under heat stressed conditions. High temperature induced the expression of heat shock protein (HSP) genes, which exhibited greater expression levels after citric acid treatment under heat stress. These results suggest that exogenous citric acid application may alleviate growth and physiological damage caused by high temperature. In addition, the exogenously applied citric acid might be responsible for maintaining membrane stability, root activity, and activation of antioxidant response and HSP genes which could contribute to the protective roles of citric acid in tall fescue responses to heat stress. PMID:26925085
Propagation of seismic waves in tall buildings
Safak, E.
1998-01-01
A discrete-time wave propagation formulation of the seismic response of tall buildings is introduced. The building is modeled as a layered medium, similar to a layered soil medium, and is subjected to vertically propagating seismic shear waves. Soil layers and the bedrock under the foundation are incorporated in the formulation as additional layers. Seismic response is expressed in terms of the wave travel times between the layers, and the wave reflection and transmission coefficients at the layer interfaces. The equations account for the frequency-dependent filtering effects of the foundation and floor masses. The calculation of seismic response is reduced to a pair of simple finite-difference equations for each layer, which can be solved recursively starting from the bedrock. Compared to the commonly used vibration formulation, the wave propagation formulation provides several advantages, including simplified calculations, better representation of damping, ability to account for the effects of the soil layers under the foundation, and better tools for identification and damage detection from seismic records. Examples presented show the versatility of the method. ?? 1998 John Wiley & Sons, Ltd.
Jin, Zhong Min; Sha, Wei; Zhang, Yan Fu; Zhao, Jing; Ji, Hongyang
2013-07-01
Phytoremediation combined with suitable microorganisms and biodegradable chelating agents can be a means of reclaiming lands contaminated by toxic heavy metals. We investigated the ability of a lead- and cadmium-resistant bacterial strain (JB12) and the biodegradable chelator ethylenediamine-N,N'-disuccinic acid (EDDS) to improve absorption of these metals from soil by tall fescue and red clover. Strain JB12 was isolated from contaminated soil samples, analysed for lead and cadmium resistance, and identified as Burkholderia cepacia. Tall fescue and red clover were grown in pots to which we added JB12, (S,S)-EDDS, combined JB12 and EDDS, or water only. Compared with untreated plants, the biomass of plants treated with JB12 was significantly increased. Concentrations of lead and cadmium in JB12-treated plants increased significantly, with few exceptions. Plants treated with EDDS responded variably, but in those treated with combined EDDS and JB12, heavy metal concentrations increased significantly in tall fescue and in the aboveground parts of red clover. We conclude that JB12 is resistant to lead and cadmium. Its application to the soil improved the net uptake of these heavy metals by experimental plants. The potential for viable phytoremediation of lead- and cadmium-polluted soils with tall fescue and red clover combined with JB12 was further enhanced by the addition of EDDS.
Baseline report - tall upland shrubland at the Rocky Flats Environmental Technology Site
DOE Office of Scientific and Technical Information (OSTI.GOV)
NONE
Rocky Flats Environmental Technology Site (Site) is located on the Colorado Piedmont east of the Front Range between Boulder and Golden. At an elevation of approximately 6,000 feet, the Site contains a unique ecotonal mixture of mountain and prairie plant species, resulting from the topography and close proximity to the mountain front. The Buffer Zone surrounding the Industrial Area is one of the largest remaining undeveloped areas of its kind along the Colorado Piedmont. A number of plant communities at the Site have been identified as increasingly rare and unique by Site ecologists and the Colorado Natural Heritage Program (CNHP).more » These include the xeric tallgrass prairie, tall upland shrubland, wetlands, and Great Plains riparian woodland communities. Many of these communities support populations of increasingly rare animals as well, including the Preble`s meadow jumping mouse, grasshopper sparrow, loggerhead shrike, Merriam`s shrew, black crowned night heron, and Hops blue and Argos skipper butterflies. One of the more interesting and important plant communities at the Site is the tall upland shrubland community. It has been generally overlooked by previous Site ecological studies, probably due to its relatively small size; only 34 acres total. Although mentioned in a plant community ordination study conducted by Clark et al. and also in the Site baseline ecological study, few data were available on this plant community before the present study.« less
Alexander, Helen M.; Reed, Aaron W.; Kettle, W. Dean; Slade, Norman A.; Bodbyl Roels, Sarah A.; Collins, Cathy D.; Salisbury, Vaughn
2012-01-01
Monitoring programs, where numbers of individuals are followed through time, are central to conservation. Although incomplete detection is expected with wildlife surveys, this topic is rarely considered with plants. However, if plants are missed in surveys, raw count data can lead to biased estimates of population abundance and vital rates. To illustrate, we had five independent observers survey patches of the rare plant Asclepias meadii at two prairie sites. We analyzed data with two mark-recapture approaches. Using the program CAPTURE, the estimated number of patches equaled the detected number for a burned site, but exceeded detected numbers by 28% for an unburned site. Analyses of detected patches using Huggins models revealed important effects of observer, patch state (flowering/nonflowering), and patch size (number of stems) on probabilities of detection. Although some results were expected (i.e. greater detection of flowering than nonflowering patches), the importance of our approach is the ability to quantify the magnitude of detection problems. We also evaluated the degree to which increased observer numbers improved detection: smaller groups (3–4 observers) generally found 90 – 99% of the patches found by all five people, but pairs of observers or single observers had high error and detection depended on which individuals were involved. We conclude that an intensive study at the start of a long-term monitoring study provides essential information about probabilities of detection and what factors cause plants to be missed. This information can guide development of monitoring programs. PMID:23285179
Code of Federal Regulations, 2012 CFR
2012-07-01
... 40 Protection of Environment 31 2012-07-01 2012-07-01 false Applicability; description of manufacture of tall oil rosin, pitch and fatty acids subcategory. 454.40 Section 454.40 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS (CONTINUED) GUM AND...
Code of Federal Regulations, 2014 CFR
2014-07-01
... 40 Protection of Environment 30 2014-07-01 2014-07-01 false Applicability; description of manufacture of tall oil rosin, pitch and fatty acids subcategory. 454.40 Section 454.40 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS (CONTINUED) GUM AND...
Code of Federal Regulations, 2013 CFR
2013-07-01
... 40 Protection of Environment 31 2013-07-01 2013-07-01 false Applicability; description of manufacture of tall oil rosin, pitch and fatty acids subcategory. 454.40 Section 454.40 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS (CONTINUED) GUM AND...
USDA-ARS?s Scientific Manuscript database
Larkspurs (Delphinium spp.) are a serious toxic plant problem for cattle in western North America. There are two chemotypes in the tall larkspur Delphinium occidentale, a more toxic chemotype and a less toxic chemotype. These chemotypes differ in the composition and concentrations of key alkaloids. ...
Evaluation of a ruminally dosed tall fescue seed extract as a model for fescue toxicosis in steers
USDA-ARS?s Scientific Manuscript database
Tall fescue (Lolium arundinaceum) toxicosis research is often complicated by a reduction in intake of infected forage or seed making treatment comparisons difficult. This study was conducted to develop a fescue toxicosis model that would allow for variations in DM intake without altering the quanti...
USDA-ARS?s Scientific Manuscript database
A mixture of ergot alkaloids does not increase the contractile response of peripheral bovine vasculature, but may increase the contractile response of foregut vasculature. Preliminary data indicated that an extract of tall fescue seed induced a greater contractile response in ruminal artery and vein...
Li, Qing; Hegge, Raquel; Bridges, Phillip J; Matthews, James C
2017-01-01
Consumption of ergot alkaloid-containing tall fescue grass impairs several metabolic, vascular, growth, and reproductive processes in cattle, collectively producing a clinical condition known as "fescue toxicosis." Despite the apparent association between pituitary function and these physiological parameters, including depressed serum prolactin; no reports describe the effect of fescue toxicosis on pituitary genomic expression profiles. To identify candidate regulatory mechanisms, we compared the global and selected targeted mRNA expression patterns of pituitaries collected from beef steers that had been randomly assigned to undergo summer-long grazing (89 to 105 d) of a high-toxic endophyte-infected tall fescue pasture (HE; 0.746 μg/g ergot alkaloids; 5.7 ha; n = 10; BW = 267 ± 14.5 kg) or a low-toxic endophyte tall fescue-mixed pasture (LE; 0.023 μg/g ergot alkaloids; 5.7 ha; n = 9; BW = 266 ± 10.9 kg). As previously reported, in the HE steers, serum prolactin and body weights decreased and a potential for hepatic gluconeogenesis from amino acid-derived carbons increased. In this manuscript, we report that the pituitaries of HE steers had 542 differentially expressed genes (P < 0.001, false discovery rate ≤ 4.8%), and the pattern of altered gene expression was dependent (P < 0.001) on treatment. Integrated Pathway Analysis revealed that canonical pathways central to prolactin production, secretion, or signaling were affected, in addition to those related to corticotropin-releasing hormone signaling, melanocyte development, and pigmentation signaling. Targeted RT-PCR analysis corroborated these findings, including decreased (P < 0.05) expression of DRD2, PRL, POU1F1, GAL, and VIP and that of POMC and PCSK1, respectively. Canonical pathway analysis identified HE-dependent alteration in signaling of additional pituitary-derived hormones, including growth hormone and GnRH. We conclude that consumption of endophyte-infected tall fescue alters the pituitary
Tallness is associated with risk of testicular cancer: evidence for the nutrition hypothesis.
Dieckmann, K-P; Hartmann, J T; Classen, J; Lüdde, R; Diederichs, M; Pichlmeier, U
2008-11-04
The pathogenesis of testicular germ cell tumours (GCTs) is potentially influenced by high-energy nutrition during infancy. As adult height is a proxy for childhood nutrition, we investigated the role of nutrition in GCT pathogenesis by comparing stature of patients with healthy men. In a matched case-control study, 6415 patients with GCT were compared with healthy army conscripts (1:6 matching modus) with regard to height (cm) and body mass index (BMI; kg/m(2)). Statistical analysis involved tabulation of descriptive height measures and BMI. Conditional logistic regression models were used to quantify the association of GCT with height, with odds ratios (OR) adjusted for BMI. The literature was searched for studies on stature in GCT patients. Body size is significantly associated with risk of GCT, very tall men (>195 cm) having a GCT risk of OR=3.35 (95% confidence intervals (CI): 2.88-3.90; adjusted). Short stature is protective (OR=0.798; 95% CI: 0.68-0.93). Both histologic subgroups are associated with tallness. Of 16 previous reports, 7 were confirmative, 5 had null and 4 equivocal results. The association of stature with GCT risk accords with the nutrition hypothesis of GCT. This study expands the current view of GCT tumorigenesis by suggesting that high-calorie intake in childhood promotes GCT precursors originating in utero.
Munday, J S; Finch, S C; Vlaming, J B; Sutherland, B L; Fletcher, L R
2017-05-01
To investigate whether Mediterranean tall fescue (Lolium arundinaceum (Schreb.) Darbysh. (syn Festuca arundinacea)) infected with selected fungal endophytes (Epichloë coenophiala (formerly Neotyphodium coenophialum)) caused equine fescue oedema when grown in New Zealand, and to examine the pathological changes associated with this intoxication. Horses were grazed on Mediterranean tall fescue that was infected with the endophytes AR542 (n=2), or AR584 (n=3), or Mediterranean tall fescue that was endophyte-free (n=2). Blood samples were taken up to 7 days after the start of feeding to detect changes in concentrations of total protein in serum and packed cell volume. Any horse showing clinical evidence of disease was subject to euthanasia and necropsy. Within 6 days, both horses grazing fescue infected with AR542 became depressed and lethargic. One horse grazing fescue infected with endophyte AR584 became depressed within a 5-day feeding period while another horse in this group died shortly after being removed from the AR584 pasture. The third horse in this group did not develop clinical signs within the 5-day feeding period. However, haemoconcentration and hypoproteinaemia was detected in all horses grazing Mediterranean tall fescue that was infected by AR542 or AR584 endophyte. No abnormalities were observed in horses grazing fescue that was endophyte-free. Necropsy examination was performed on two horses grazing fescue infected with AR542 and one horse grazing fescue infected with AR584. All three horses had marked oedema of the gastrointestinal tract. Histologically, the oedema was accompanied by large numbers of eosinophils, but no necrosis. Horses grazing Mediterranean tall fescue that was infected by AR542 or AR584 developed hypoproteinaemia and haemoconcentration, most likely due to leakage of plasma proteins into the gastrointestinal tract. This suggests that these selected endophytes produce a compound that is toxic to horses, although the toxic principle
USDA-ARS?s Scientific Manuscript database
Year-round forage production is feasible in much of the southeastern USA through utilization of cool- and warm-season forages. This study determined if productivity and nutritive value in binary mixtures of tall fescue [Schedonorus arundinaceus (Schreb.) Dumort] and bermudagrass [Cynodon dactylon (L...
Belowground carbon trade among tall trees in a temperate forest.
Klein, Tamir; Siegwolf, Rolf T W; Körner, Christian
2016-04-15
Forest trees compete for light and soil resources, but photoassimilates, once produced in the foliage, are not considered to be exchanged between individuals. Applying stable carbon isotope labeling at the canopy scale, we show that carbon assimilated by 40-meter-tall spruce is traded over to neighboring beech, larch, and pine via overlapping root spheres. Isotope mixing signals indicate that the interspecific, bidirectional transfer, assisted by common ectomycorrhiza networks, accounted for 40% of the fine root carbon (about 280 kilograms per hectare per year tree-to-tree transfer). Although competition for resources is commonly considered as the dominant tree-to-tree interaction in forests, trees may interact in more complex ways, including substantial carbon exchange. Copyright © 2016, American Association for the Advancement of Science.
USDA-ARS?s Scientific Manuscript database
The objective of this experiment was to determine the effect of endophyte toxicity in clover additions to tall fescue pastures used as a limit-grazed complement to warm-season grass pastures. Over 3 years, beef cows (n = 108, Year 1; n = 72, Year 2 and 3; initial fall body weight = 480 ± 8.6 kg, bo...
de Zegher, Francis; Pérez-Cruz, Miriam; Sebastiani, Giorgia; Díaz, Marta; López-Bermejo, Abel; Ibáñez, Lourdes
2016-11-01
A longitudinal study with dual x-ray absorptiometry disclosed that infants born large for gestational age from mothers without diabetes mellitus and without excessive gestational weight gain tend to be long with increased adipose tissue as newborns and tall and lean as toddlers. Copyright © 2016 Elsevier Inc. All rights reserved.
USDA-ARS?s Scientific Manuscript database
Year-round grazing in animal production systems has potential in the mid-Atlantic USA. Tall fescue [Lolium arundinaceum (Schreb.) S. J. Darbysh.] is generally the cool-season perennial and bermudagrass [Cynodon dactylon (L.) Pers.] the warm-season perennial in these systems. This study evaluated yel...
USDA-ARS?s Scientific Manuscript database
Previous research has indicated that serotonergic and a-adrenergic receptors in peripheral vasculature are affected by exposure of cattle grazing toxic endophyte-infected (E+) tall fescue (TF; Lolium arundinaceum). This study was conducted to investigate changes in vascular contractile response over...
S.L. Clement; D.G. Lester; A. Dan Wilson; R.C. Johnson; J.H. Bouton
1996-01-01
Experiments were conducted to compare the expression of Russian wheat aphid, Diurnphis noxia (Mordvilko), resistance in 2 genotypes of tall fescue grass, Festucn arundinacea Schreb., harboring different isolates of the endophytic fungus Acremonium coenophialum Morgan-Jones & cams. Aphids did not select...
Waller, Lauren P; Hahn, Philip G; Maron, John L; Lekberg, Ylva
2018-02-01
Arbuscular mycorrhizal (AM) fungi can promote plant growth and reproduction, but other plant physiological traits or traits that provide defense against herbivores can also be affected by AM fungi. However, whether responses of different traits to AM fungi are correlated and whether these relationships vary among plants from different populations are unresolved. In a common garden experiment, we grew Asclepias speciosa plants from seed collected from populations found along an environmental gradient with and without AM fungi to assess whether the responses of six growth and defense traits to AM fungi are correlated. Although there was strong genetic differentiation in mean trait values among populations, AM fungi consistently increased expression of most growth and defense traits across all populations. Responses of biomass and root to shoot ratio to AM fungi were positively correlated, suggesting that plants that are more responsive to AM fungi allocated more biomass belowground. Responses of biomass and trichome density to AM fungi were negatively correlated, indicating a trade-off in responsiveness between a growth and defensive trait. Our results suggest that while there is substantial population differentiation in many traits of A. speciosa, populations respond similarly to AM fungi, and both positive and negative correlations among trait responses occur. © 2018 Botanical Society of America.
USDA-ARS?s Scientific Manuscript database
To evaluate the efficacy of a modified glucomannan to mitigate fescue toxicosis, 45 Angus cross (BW = 281 ± 7.0 kg) steer calves were randomly assigned to nine 2-ha pastures of endemically-infected tall fescue in March of 2 yr and allowed to graze for 133 d. The 3 treatments were: non supplemented (...
USDA-ARS?s Scientific Manuscript database
It was hypothesized that a tannin-rich legume like sainfoin reduces the negative postingestive effects of ergot alkaloids in tall fescue. Thirty-two 3-month-old lambs were individually penned and randomly assigned to a 2X2 factorial experimental design with two legume species (1-sainfoin [SF; tannin...
Horn fly larval survival in cattle dung is reduced by endophyte infection of tall fescue pasture.
Parra, Leonardo; Mutis, Ana; Chacón, Manuel; Lizama, Marcelo; Rojas, Claudio; Catrileo, Adrián; Rubilar, Olga; Tortella, Gonzalo; Birkett, Michael A; Quiroz, Andrés
2016-07-01
The potential for using endophytic microorganisms in pest control has increased during the last 40 years. In this study, we investigated the impact of endophyte (Neotyphodium coenophialum) infection of cattle pasture upon the survival of the horn fly, Haematobia irritans, a major agricultural pest affecting livestock in many parts of the world. In laboratory assays, where cattle dung collected from endophyte-infected (E+) tall fescue cultivar K-31 was used as the oviposition substrate, larval development was significantly reduced compared with development on cattle dung from steers that grazed uninfected (E-) tall fescue. Furthermore, studies with cattle dung supplemented with the alkaloid fraction extracted from the endophytic fungi revealed significant larval mortality, and HPLC analysis identified two alkaloids, peramine and lolitrem B. The development of larvae was shown to be significantly reduced in field-collected cattle dung. These results suggest that part of the toxicity of alkaloids contained in endophytes is transferred to faecal matter, causing an increase in mortality of H. irritans. These data suggest that endophyte infection of cattle pasture, i.e. modified pasture management, can significantly affect horn fly development. © 2015 Society of Chemical Industry. © 2015 Society of Chemical Industry.
Watson, R H; McCann, M A; Parish, J A; Hoveland, C S; Thompson, F N; Bouton, J H
2004-11-01
The nonergot alkaloid-producing endo-phyte, AR542, has been shown to improve the persistence and yield of tall fescue pastures without causing the animal disorders commonly associated with tall fescue toxicosis. A 3-yr grazing study was conducted to compare effects of AR542-infected tall fescue pastures with wild type endophyte-infected (E+) tall fescue pastures on cow-calf performance. Replicated 7.3-ha pastures of each treatment were grazed by cow-calf pairs (16 pairs per pasture replication) each year from March to weaning in September. The cows were exposed to breeding on their respective pasture treatments from April 1 through June 15. The treatment groups were compared for reproductive performance, ADG, BCS, calf growth rate, and weaning weight. Blood samples were also collected for serum prolactin (PRL) analysis. There were no significant differences in calving rate (P = 0.98) or calving interval (P = 0.62) between pasture treatments. Cows that grazed the AR542 pastures subsequently gave birth to calves that were heavier (P < 0.05) than calves from cows that had grazed the E+ pastures. Cows grazing the AR542 pastures had higher (P < 0.05) BCS at the end of the grazing period, and had higher ADG during the grazing period. Calves raised on the AR542 pasture had higher (P < 0.05) ADG and weaning weights than calves of the same sex raised on the E+ pastures. Serum PRL concentrations were decreased (P < 0.05) in both cows and calves on the E+ pastures compared with serum PRL concentrations in cows and calves grazing the AR542 pastures. The results indicate that grazing tall fescue pastures infected with the AR542 endophyte may give significant advantages in cow-calf growth rates and BCS over grazing E+ pastures. However, there did not seem to be any benefit in reproductive performance in this trial. There was a small, but significant increase in birth weight in cows grazing AR542 pasture.
Chen, Ke; Zhang, Minna; Zhu, Huihui; Huang, Meiyu; Zhu, Qing; Tang, Diyong; Han, Xiaole; Li, Jinlin; Sun, Jie; Fu, Jinmin
2017-01-01
L-Ascorbate (Asc) plays important roles in plant development, hormone signaling, the cell cycle and cellular redox system, etc. The higher content of Asc in plant chloroplasts indicates its important role in the photosystem. The objective of this study was to study the roles of Asc in tall fescue leaves against heat stress. After a heat stress treatment, we observed a lower value of the maximum quantum yield for primary photochemistry (φPo), which reflects the inhibited activity of the photochemical phase of photosystem II (PSII). Moreover, we observed a higher value of efficiency of electron transfer from QB to photosystem I acceptors (δR0), which reflects elevated activity of the thermal phase of the photosystem of the tall fescue. The addition of Asc facilitate the behavior of the photochemical phase of the PSII by lowering the ROS content as well as that of the alternative electron donor to provide electron to the tyrosine residue of the D1 protein. Additionally, exogenous Asc reduces the activity of the thermal phase of the photosystem, which could contribute to the limitation of energy input into the photosystem in tall fescue against heat stress. Synthesis of the Asc increased under heat stress treatment. However, under heat stress this regulation does not occur at the transcription level and requires further study. PMID:28848577
Effect of Minesoil Compaction on Growth and Yield of KY-31 Tall Fescue and Sericea Lespedeza
Jerry T. Crews; Jerry T. Crews
1984-01-01
Kentucky 31 tall fescue and sericea lespedeza were sown on clay and loam minesoils that had been screened throu h a No. 10 sieve and compacted to densities of 1.6, 1.8, and 2.0 gfjcm3. Stands of sericea lespedeza were more difficult to establish than fescue on both minesoils and were more susceptible than fescue to increased levels of compaction. Dry matter yields...
USDA-ARS?s Scientific Manuscript database
It was hypothesized that a tannin-rich legume like sainfoin reduces the negative post-ingestive effects of ergot alkaloids in tall fescue. Thirty-two 4-month-old lambs were individually penned and randomly assigned to a 2X2 factorial arrangement with two legume species (1-sainfoin [SAN; ' 3% condens...
S.L. Clement; K.S. Pike; W.J. Kaiser; A. Dan Wilson
1991-01-01
Fewer aphids of the Russian wheat aphid, (Mordvilko), were found on tall fescue and perennial ryegrass plants harboring systemic fungal endophytes than on endophyte-free plants in laboratory tests. These results indicate that enhanced resistance in some perennial grasses to D. noxia is associated with the presence of endophytic fungi.
Photosynthate partitioning in basal zones of tall fescue leaf blades. [Festuca arundinacea Schreb
DOE Office of Scientific and Technical Information (OSTI.GOV)
Allard, G.; Nelson, C.J.
Elongating grass leaves have successive zones of cell division, cell elongation, and cell maturation in the basal portion of the blade and are a strong sink for photosynthate. Our objective was to determine dry matter (DM) deposition and partitioning in basal zones of elongating tall fescue (Festuca arundinacea Schreb.) leaf blades. Vegetative tall fescue plants were grown in continuous light (350 micromoles per square meter per second photosynthetic photon flux density) to obtain a constant spatial distribution of elongation growth with time. Content and net deposition rates of water-soluble carbohydrates (WSC) and DM along elongating leaf blades were determined. Thesemore » data were compared with accumulation of {sup 14}C in the basal zones following leaf-labeling with {sup 14}CO{sub 2}. Net deposition of DM was highest in the active cell elongation zone, due mainly to deposition of WSC. The maturation zone, just distal to the elongation zone, accounted for 22% of total net deposition of DM in elongating leaves. However, the spatial profile of {sup 14}C accumulation suggested that the elongation zone and the maturation zone were sinks of equal strength. WSC-free DM accounted for 55% of the total net DM deposition in elongating leaf blades, but only 10% of incoming {sup 14}C-photosynthate accumulated in the water-insoluble fraction (WIF {approximately} WSC-free DM) after 2 hours. In the maturation zone, more WSC was used for synthesis of WSC-free DM than was imported as recent photosynthate.« less
Ozone and sulfur dioxide effects on tall fescue. I. Growth and yield responses
DOE Office of Scientific and Technical Information (OSTI.GOV)
Flagler, R.B.; Youngner, V.B.
The effects of ozone (O/sub 3/) and sulfur dioxide (SO/sub 2/) on growth and yield components of tall fescue (Festuca arundinacea Schreb. 'Alta') were studied in a greenhouse experiment. Four O/sub 3/ treatments ranging from 0 to 0.30 ppm in equally spaced intervals and two SO/sub 2/ treatments, 0 and 0.10 ppm, were arranged factorially in a randomized complete block design utilizing three blocks. Each block was exposed to the pollutants 6 h/d, once a week, for 12 weeks. Statistical analysis was by analysis of variance and regression techniques. Ozone significantly affected root/shoot ratio and all dry weight fractions. Tillermore » weight was also affected adversely by O/sub 3/ with a linear decrease of >44% at the highest O/sub 3/ level. SO/sub 2/ also affected tall fescue, but not nearly as severely as O/sub 3/. Total dry weight was reduced by 7.3% due to SO/sub 2/. Root weight was decreased by 11%, but shoot weight was unaffected. Root/shoot ratio was lowered about 7% due to the pollutant. Weight per tiller was unaffected by SO/sub 2/. Number of tillers was significantly reduced by an interaction of the two pollutants. Neither O/sub 3/ or SO/sub 2/ had an effect singly, but at the high O/sub 3/ level, the addition of SO/sub 3/ caused an 18.6% reduction in number of tillers. This was the only significant pollutant interaction noted. (JMT)« less
USDA-ARS?s Scientific Manuscript database
A previous report demonstrated that steers exposed to an endophyte-infected tall fescue seed extract had altered rumen epithelial blood flow and decreased ruminal flux of VFA. Thus, this study was conducted to determine whether there are differences in gene expression related to VFA absorption betwe...
Li, Xa; Zhou, Bo; Zhao, Zilong; Hu, Zixi; Zhou, Sufang; Yang, Nuo; Huang, Yong; Zhang, Zhenghua; Su, Jing; Lan, Dan; Qin, Xue; Meng, Jinyu; Zheng, Duo; He, Jian; Huang, Xianing; Zhao, Jing; Zhang, Zhiyong; Tan, Weihong; Lu, Xiaoling; Zhao, Yongxiang
2016-12-01
It is a major clinical challenge for clinicians how to early find out minimal residual diseases (MRD) of leukemia. Here, we developed a smart detection system for MRD involving magnetic aptamer sgc8 probe (M-sgc8 probe) to capture CEM cells and rolling cycle amplification probe (RCA-sgc8 probe) to initiate RCA, producing a single-stranded tandem repeated copy of the circular template. The DNA products were hybridized with molecular beacon to generate the amplified fluorescence signal. An in vitro model to mimic MRD was established to evaluate the sensitivity of the smart detection system. The smart detection system was used to detect MRD in patients with T-ALL peri-chemotherapy, which could not only specifically captured T-ALL cells, but also significantly amplified fluorescence signals on them. The sensitivity was 1/20,000. These results indicate that the smart detection system with high specificity and sensitivity could more efficiently monitor the progress of T-ALL peri-chemotherapy.
Çelebi, Mehmet; Kashima, Toshihide; Ghahari, S. Farid; Abazarsa, Fariba; Taciroglu, Ertugrul
2016-01-01
The 11 March 2011 M 9.0 Tohoku earthquake generated long-duration shaking that propagated hundreds of kilometers from the epicenter and affected tall buildings in urban areas several hundred kilometers from the epicenter of the main shock. Recorded responses show that tall buildings were affected by long-period motions. This study presents the behavior and performance of a 37-story building in the Tsukuda area of Tokyo, Japan, as inferred from modal analyses of records retrieved for a time interval covering a few days before, during, and for several months after the main shock. The U.S. “code-type” array comprises three triaxial accelerometers deployed at three levels in the superstructure. Such a sparse array in a tall structure limits a reliable assessment, because its performance must be based on only the average drift ratios. Based on the inferred values of this parameter, the subject building was not structurally damaged.
USDA-ARS?s Scientific Manuscript database
The tall fescue – Epichloe coenophiala symbiotic system is the most extensively studied of any grass-microbe symbiosis, mainly because of its economic importance worldwide. This is also an extraordinarily stable and mutualistic symbiosis where the endophyte colonizes both vegetative and reproductive...
Couvreur, Valentin; Ledder, Glenn; Manzoni, Stefano; Way, Danielle A; Muller, Erik B; Russo, Sabrina E
2018-05-08
Trees grow by vertically extending their stems, so accurate stem hydraulic models are fundamental to understanding the hydraulic challenges faced by tall trees. Using a literature survey, we showed that many tree species exhibit continuous vertical variation in hydraulic traits. To examine the effects of this variation on hydraulic function, we developed a spatially-explicit, analytical water transport model for stems. Our model allows Huber ratio, stem-saturated conductivity, pressure at 50% loss of conductivity, leaf area, and transpiration rate to vary continuously along the hydraulic path. Predictions from our model differ from a matric flux potential model parameterized with uniform traits. Analyses show that cavitation is a whole-stem emergent property resulting from nonlinear pressure-conductivity feedbacks that, with gravity, cause impaired water transport to accumulate along the path. Because of the compounding effects of vertical trait variation on hydraulic function, growing proportionally more sapwood and building tapered xylem with height, as well as reducing xylem vulnerability only at branch tips while maintaining transport capacity at the stem base, can compensate for these effects. We therefore conclude that the adaptive significance of vertical variation in stem hydraulic traits is to allow trees to grow tall and tolerate operating near their hydraulic limits. This article is protected by copyright. All rights reserved.
Environmental Limits of Tall Shrubs in Alaska's Arctic National Parks.
Swanson, David K
2015-01-01
We sampled shrub canopy volume (height times area) and environmental factors (soil wetness, soil depth of thaw, soil pH, mean July air temperature, and typical date of spring snow loss) on 471 plots across five National Park Service units in northern Alaska. Our goal was to determine the environments where tall shrubs thrive and use this information to predict the location of future shrub expansion. The study area covers over 80,000 km2 and has mostly tundra vegetation. Large canopy volumes were uncommon, with volumes over 0.5 m3/m2 present on just 8% of plots. Shrub canopy volumes were highest where mean July temperatures were above 10.5°C and on weakly acid to neutral soils (pH of 6 to 7) with deep summer thaw (>80 cm) and good drainage. On many sites, flooding helped maintain favorable soil conditions for shrub growth. Canopy volumes were highest where the typical snow loss date was near 20 May; these represent sites that are neither strongly wind-scoured in the winter nor late to melt from deep snowdrifts. Individual species varied widely in the canopy volumes they attained and their response to the environmental factors. Betula sp. shrubs were the most common and quite tolerant of soil acidity, cold July temperatures, and shallow thaw depths, but they did not form high-volume canopies under these conditions. Alnus viridis formed the largest canopies and was tolerant of soil acidity down to about pH 5, but required more summer warmth (over 12°C) than the other species. The Salix species varied widely from S. pulchra, tolerant of wet and moderately acid soils, to S. alaxensis, requiring well-drained soils with near neutral pH. Nearly half of the land area in ARCN has mean July temperatures of 10.5 to 12.5°C, where 2°C of warming would bring temperatures into the range needed for all of the potential tall shrub species to form large canopies. However, limitations in the other environmental factors would probably prevent the formation of large shrub canopies
For Black men, being tall increases threat stereotyping and police stops.
Hester, Neil; Gray, Kurt
2018-03-13
Height seems beneficial for men in terms of salaries and success; however, past research on height examines only White men. For Black men, height may be more costly than beneficial, primarily signaling threat rather than competence. Three studies reveal the downsides of height in Black men. Study 1 analyzes over 1 million New York Police Department stop-and-frisk encounters and finds that tall Black men are especially likely to receive unjustified attention from police. Then, studies 2 and 3 experimentally demonstrate a causal link between perceptions of height and perceptions of threat for Black men, particularly for perceivers who endorse stereotypes that Black people are more threatening than White people. Together, these data reveal that height is sometimes a liability for Black men, particularly in contexts in which threat is salient.
Villalba, J J; Spackman, C; Goff, B M; Klotz, J L; Griggs, T; MacAdam, J W
2016-02-01
It was hypothesized that a tannin-rich legume such as sainfoin attenuates the negative postingestive effects of ergot alkaloids in tall fescue. Thirty-two 4-mo-old lambs were individually penned and randomly assigned to a 2 × 2 factorial arrangement with 2 legume species, sainfoin (SAN; 2.9% condensed tannins) or cicer milkvetch (CIC; without tannins) and a mixed ration containing tall fescue seed (50:30:20 seed:beet pulp:alfalfa) with 2 levels of endophyte infection (endophyte-infected tall fescue seed [E+; 3,150 ug/L ergovaline] or endophyte-free tall fescue seed [E-]). For a 10-d baseline period, half of the lambs were fed SAN and half were fed CIC and all lambs had ad libitum amounts of E-. In an ensuing 10-d experimental period, the protocol was the same except half of the lambs fed SAN or CIC received E+ instead of E-. Subsequently, all lambs could choose between their respective legume and seed-containing ration and between E+ and E-. Finally, an in vitro radial diffusion assay was conducted to determine whether tannins isolated from SAN would bind to alkaloids isolated from E+. All groups consumed similar amounts of E- during baseline period ( > 0.10), but lambs ate more E- than E+ during the experimental period ( < 0.05) and lambs offered SAN ate more E+ than lambs offered CIC ( < 0.05). Groups fed E- during the baseline and experimental periods had similar rectal temperatures ( > 0.10), but lambs fed E+ had lower rectal temperatures per gram of feed ingested when supplemented with SAN than with CIC ( < 0.05). Lambs fed E+ had greater concentrations of hemoglobin and more red blood cells than lambs fed E- ( < 0.05), but plasmatic concentrations of cortisol and prolactin did not differ among treatments ( > 0.10). All lambs preferred their treatment ration over their treatment legume, but lambs in the SAN and E+ treatment ate more legume + ration than lambs in the CIC and E+ (CIC-E+; < 0.05) treatment. All lambs preferred E- over E+, but lambs in the CIC
USDA-ARS?s Scientific Manuscript database
Pharmacologic profiling of 5-hydroxytryptamine (5HT) receptors of bovine lateral saphenous vein has shown that cattle grazing endophyte-infected (Neotyphodium coenophialum) tall fescue (Lolium arundinaceum) have altered responses to ergovaline (ERV), 5HT, 5HT2A and 5HT7 agonists. To determine if 5HT...
Ma, Xiqing; Xu, Qian; Meyer, William A.; Huang, Bingru
2016-01-01
Background and Aims Rhizomes are underground stems with meristematic tissues capable of generating shoots and roots. However, mechanisms controlling rhizome formation and growth are yet to be completely understood. The objectives of this study were to investigate whether rhizome development could be regulated by cytokinins (CKs) and gibberellic acids (GAs), and determine underlying mechanisms of regulation of rhizome formation and growth of tall fescue (Festuca arundinacea) by a CK or GA through proteomic and transcript analysis. Methods A rhizomatous genotype of tall fescue (‘BR’) plants were treated with 6-benzylaminopurine (BAP, a synthetic cytokinin) or GA3 in hydroponic culture in growth chambers. Furthermore, comparative proteomic analysis of two-dimensional electrophoresis and mass spectrometry were performed to investigate proteins and associated metabolic pathways imparting increased rhizome number by BAP and rhizome elongation by GA3. Key Results BAP stimulated rhizome formation while GA3 promoted rhizome elongation. Proteomic analysis identified 76 differentially expressed proteins (DEPs) due to BAP treatment and 37 DEPs due to GA3 treatment. Cytokinin-related genes and cell division-related genes were upregulated in the rhizome node by BAP and gibberellin-related and cell growth-related genes in the rhizome by GA3. Conclusions Most of the BAP- or GA-responsive DEPs were involved in respiratory metabolism and amino acid metabolism. Transcription analysis demonstrated that genes involved in hormone metabolism, signalling pathways, cell division and cell-wall loosening were upregulated by BAP or GA3. The CK and GA promoted rhizome formation and growth, respectively, by activating metabolic pathways that supply energy and amino acids to support cell division and expansion during rhizome initiation and elongation in tall fescue. PMID:27443301
Physiological and digestive effects of Neotyphodium coenophialum-infected tall fescue fed to lambs.
De Lorme, M J M; Lodge-Ivey, S L; Craig, A M
2007-05-01
The digestive responses and degradation of ergovaline and production of lysergic acid in the rumen of sheep offered Neotyphodium coenophialum-infected tall fescue straw at 2 ergovaline levels were investigated. Six crossbred wethers (56 +/- 3.0 kg of BW) were used in a randomized crossover design involving 2 treatments, for a total of 6 observations per treatment. The experiment consisted of two 28-d feeding periods with a 14-d washout period between them. The treatments were 1) tall fescue straw containing <0.010 mg of ergovaline/kg (E-), and 2) tall fescue straw containing 0.610 mg of ergovaline/kg (E+). Feed, orts, and feces were measured and analyzed for DM, ADF, and CP, and used to determine digestibilities. Feed and water intake were monitored throughout the feeding periods. Body weight and serum prolactin levels were measured at the beginning and end of each feeding period. Ruminal fluid was sampled 3 times (d 0, 3, and 28) during each 28-d feeding period for determination of ergovaline, lysergic acid, ammonia, and pH. Samples were collected before feeding (0 h) and at 6 and 12 h after feeding. Total fecal and urine collection commenced on d 21 and continued until d 25 of each feeding period. Ruminal ammonia, ruminal pH, and rectal temperature were not influenced by ergovaline concentration (P > 0.10). Digestion of DM, ADF, and CP was not different between treatments (P > 0.10). Daily water intake was less for the E+ diet (2.95 vs. 2.77 L/d; P < 0.05) as was serum prolactin (22.9 vs. 6.4 ng/mL; P < 0.05). Ergovaline concentration in ruminal fluid increased over sampling days at each sampling time (P < 0.05). Lysergic acid concentration in ruminal fluid increased over time from d 0 to 3 (P < 0.05) but was not different between d 3 and 28 (P > 0.10). In the E+ treatment, ergovaline was not detectable in the urine, whereas the concentration in the feces was 0.480 mg/kg. Lysergic acid was detected in the diet of the E+ treatment at 0.041 g/kg, lysergic acid in
Gunalp, Bengul; Okuyucu, Kursat; Ince, Semra; Ayan, Aslı; Alagoz, Engin
2017-01-01
There has been much discussion recently about the risk category of tall cell variant (TVC) histology and its effects on the management of papillary thyroid carcinoma (PTC). We, therefore, undertook a retrospective study to compare stage-matched risk factors and recurrence rates between classical PTC (cPTC) patients and patients with TCV histology. A total of 3128 well-differentiated thyroid carcinoma patients who were treated and followed-up for more than 5 years in our clinic from 1995 to 2016 were included in this study. There were 2783 PTC (89%) patients, 1113 (40%) of them were cPTC and 56 (2%) of them were TCV patients. In all stages, the stage-matched incidence of extrathyroidal extension (ETE), lymphovascular invasion and initial lymph node metastases were significantly higher in TCV patients than in cPTC patients (P<0.001). Recurrence was in 10 of 27 patients (37%) with TCV and in 91 of 890 (10%) patients with cPTC diagnosed in stage I (odds ratio (OR)=5.16); in 4 of 6 patients with TCV and 18 of 84 (21%) patients with cPTC in stage II (OR=7.33); in 5 of 6 patients with TCV and 11 of 46 (23%) patients with cPTC in stage III (OR=15.90); and in 13 of 17 patients with TCV and 31 of 93 (33%) patients with cPTC in stage IV (OR=6.50). Stage-matched recurrence rates were found significantly higher in all stages of TCV patients than in cPTC patients (OR=8.49, P<0.001). Recurrence with distant metastases was seen more frequently in TCV patients than in cPTC patients (P<0.001) and treatment of metastatic disease was more difficult in TCV patients. Tall cell variant was an independent poor prognostic factor in papillary thyroid carcinoma patients even if they were diagnosed at early stages of the disease. Patients with tall cell variant histology required more aggressive therapeutic approach and closer follow-up than classical patients.
Klotz, J L; Brown, K R; Xue, Y; Matthews, J C; Boling, J A; Burris, W R; Bush, L P; Strickland, J R
2012-02-01
As part of a 2-yr study documenting the physiologic impact of grazing endophyte-infected tall fescue on growing cattle, 2 experiments were conducted to characterize and evaluate effects of grazing 2 levels of toxic endophyte-infected tall fescue pastures on vascular contractility and serotonin receptors. Experiment 1 examined vasoconstrictive activities of 5-hydroxytryptamine (5HT), α-methylserotonin (ME5HT; a 5HT(2) receptor agonist), d-lysergic acid (LSA), and ergovaline (ERV) on lateral saphenous veins collected from steers immediately removed from a high-endophyte-infected tall fescue pasture (HE) or a low-endophyte-infected mixed-grass (LE) pasture. Using the same pastures, Exp. 2 evaluated effects of grazing 2 levels of toxic endophyte-infected tall fescue on vasoconstrictive activities of (±)-1-(2,5-dimethoxy-4-iodophenyl)-2-aminopropane hydrochloride (DOI), BW 723C86 (BW7), CGS-12066A (CGS), and 5-carboxamidotryptamine hemiethanolate maleate (5CT), agonists for 5HT(2A),( 2B), 5HT(1B), and 5HT(7) receptors, respectively. One-half of the steers in Exp. 2 were slaughtered immediately after removal from pasture, and the other one-half were fed finishing diets for >91 d before slaughter. For Exp. 1, maximal contractile intensities were greater (P < 0.05) for steers grazing LE pastures than HE pastures for 5HT (73.3 vs. 48.9 ± 2.1%), ME5HT (52.7 vs. 24.9 ± 1.5%), and ERV (65.7 vs. 49.1 ± 2.6%). Onset of contractile response did not differ for 5HT (P = 0.26) and ERV (P = 0.93), but onset of ME5HT contraction was not initiated (P < 0.05) in HE steers until 10(-4) compared with 10(-5) M in LE-grazing steers. For Exp. 2, maximal contractile intensities achieved with DOI were 35% less (P < 0.05), whereas those achieved with 5CT were 37% greater (P < 0.05), in steers grazing HE pastures. Contractile response to CGS did not differ between pasture groups, and there was an absence of contractile response to BW7 in both groups. There were no differences between
1998-07-01
Festuca arundinacea 3.3 4.0 S Fragaria virginiana 3.0 3.0 S Grindelia squarrosa 4.0 S Helianthus annuus 4.0 S Hieracium longipilum 4.0 G Hordeum...B Ceanothus serrulatus G L Asclepias verticillata S B Celastrus scandens S B Asclepias viridiflora S B Celtis occidentalis S B Asclepias viridis G...F Lythrum alatum S F Fragaria virginiana S B Lythrum califomicum S L Madura pomifera S B Polygonum aviculare S B Madia yosemitana G L Polygonum
Wang, Xiuyun; Huang, Wanlu; Liu, Jun; Yang, Zhimin; Huang, Bingru
2017-02-01
Heat stress transcription factors (HSFs) compose a large gene family, and different members play differential roles in regulating plant responses to abiotic stress. The objectives of this study were to identify and characterize an A2-type HSF, FaHsfA2c, in a cool-season perennial grass tall fescue (Festuca arundinacea Schreb.) for its association with heat tolerance and to determine the underlying physiological functions and regulatory mechanisms of FaHsfA2c imparting plant tolerance to heat stress. FaHsfA2c was localized in nucleus and exhibited a rapid transcriptional increase in leaves and roots during early phase of heat stress. Ectopic expression of FaHsfA2c improved basal and acquired thermotolerance in wild-type Arabidopsis and also restored heat-sensitive deficiency of hsfa2 mutant. Overexpression of FaHsfA2c in tall fescue enhanced plant tolerance to heat by triggering transcriptional regulation of heat-protective gene expression, improving photosynthetic capacity and maintaining plant growth under heat stress. Our results indicated that FaHsfA2c acted as a positive regulator conferring thermotolerance improvement in Arabidopsis and tall fescue, and it could be potentially used as a candidate gene for genetic modification and molecular breeding to develop heat-tolerant cool-season grass species. © 2016 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.
USDA-ARS?s Scientific Manuscript database
Pharmacologic profiling of 5-hydroxytryptamine (5HT) receptors of bovine lateral saphenous vein has shown that cattle grazing endophyte-infected (Neotyphodium coenophialum) tall fescue (Lolium arundinaceum) have altered responses to ergovaline (ERV), 5HT, 5HT2A and 5HT7 agonists. To determine if 5HT...
NASA Astrophysics Data System (ADS)
Gryning, S. E.; Batchvarova, E.; Pena, A.; Mikkelsen, T.; Brümmer, B.; Emeis, S.; Gulstad, L.; Lee, N.
2010-09-01
Predicting the wind at typical heights of present and future wind turbines is a considerable scientific challenge. Presently applied models are accurate within the surface layer. New measurements and instrument synergies are necessary as basis for developing new wind models and understanding the physical processes that form the wind profile in order to describe the wind profile above it. Analysis of the wind and turbulence profiles from a meteorological mast at heights up to 160 meters and wind lidars up to 300 meters at the National test station at Høvsøre, Denmark, shows deviations of the wind profile above 80 meters the from the profile used so far near the surface. It also reveals the importance of the boundary-layer height as a physical parameter for the description of the wind profile. In the Tall Wind project, mast and lidar measurements of wind and fluxes will be combined with monitoring of the boundary-layer height by use of an aerosol lidar. At the main project monitoring sites (Høvsøre in Denmark and Hamburg in Germany) long term monitoring programmes on tall masts (160 and 300 meters) already exists and will be intensified. As part of the project the wind profile will be measured up to 1000 meters by a wind lidar (windcube) and the boundary-layer height by an aerosol lidar. The new data sets can be used for theoretical developments and evaluation of meso-scale meteorological models. The project is an international collaboration between academia (Risoe-DTU, HU and KIT) and industry (Vestas and DONG), funded by the Danish Research Agency, the Strategic Research Council (Sagsnr. 2104-08-0025). In the paper the set-up of the Tall Wind project will be described and some first results and experience will be presented.
Ma, Xiqing; Xu, Qian; Meyer, William A; Huang, Bingru
2016-09-01
Rhizomes are underground stems with meristematic tissues capable of generating shoots and roots. However, mechanisms controlling rhizome formation and growth are yet to be completely understood. The objectives of this study were to investigate whether rhizome development could be regulated by cytokinins (CKs) and gibberellic acids (GAs), and determine underlying mechanisms of regulation of rhizome formation and growth of tall fescue (Festuca arundinacea) by a CK or GA through proteomic and transcript analysis. A rhizomatous genotype of tall fescue ('BR') plants were treated with 6-benzylaminopurine (BAP, a synthetic cytokinin) or GA3 in hydroponic culture in growth chambers. Furthermore, comparative proteomic analysis of two-dimensional electrophoresis and mass spectrometry were performed to investigate proteins and associated metabolic pathways imparting increased rhizome number by BAP and rhizome elongation by GA3 KEY RESULTS: BAP stimulated rhizome formation while GA3 promoted rhizome elongation. Proteomic analysis identified 76 differentially expressed proteins (DEPs) due to BAP treatment and 37 DEPs due to GA3 treatment. Cytokinin-related genes and cell division-related genes were upregulated in the rhizome node by BAP and gibberellin-related and cell growth-related genes in the rhizome by GA3 CONCLUSIONS: Most of the BAP- or GA-responsive DEPs were involved in respiratory metabolism and amino acid metabolism. Transcription analysis demonstrated that genes involved in hormone metabolism, signalling pathways, cell division and cell-wall loosening were upregulated by BAP or GA3 The CK and GA promoted rhizome formation and growth, respectively, by activating metabolic pathways that supply energy and amino acids to support cell division and expansion during rhizome initiation and elongation in tall fescue. © The Author 2016. Published by Oxford University Press on behalf of the Annals of Botany Company. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Environmental Limits of Tall Shrubs in Alaska’s Arctic National Parks
Swanson, David K.
2015-01-01
We sampled shrub canopy volume (height times area) and environmental factors (soil wetness, soil depth of thaw, soil pH, mean July air temperature, and typical date of spring snow loss) on 471 plots across five National Park Service units in northern Alaska. Our goal was to determine the environments where tall shrubs thrive and use this information to predict the location of future shrub expansion. The study area covers over 80,000 km2 and has mostly tundra vegetation. Large canopy volumes were uncommon, with volumes over 0.5 m3/m2 present on just 8% of plots. Shrub canopy volumes were highest where mean July temperatures were above 10.5°C and on weakly acid to neutral soils (pH of 6 to 7) with deep summer thaw (>80 cm) and good drainage. On many sites, flooding helped maintain favorable soil conditions for shrub growth. Canopy volumes were highest where the typical snow loss date was near 20 May; these represent sites that are neither strongly wind-scoured in the winter nor late to melt from deep snowdrifts. Individual species varied widely in the canopy volumes they attained and their response to the environmental factors. Betula sp. shrubs were the most common and quite tolerant of soil acidity, cold July temperatures, and shallow thaw depths, but they did not form high-volume canopies under these conditions. Alnus viridis formed the largest canopies and was tolerant of soil acidity down to about pH 5, but required more summer warmth (over 12°C) than the other species. The Salix species varied widely from S. pulchra, tolerant of wet and moderately acid soils, to S. alaxensis, requiring well-drained soils with near neutral pH. Nearly half of the land area in ARCN has mean July temperatures of 10.5 to 12.5°C, where 2°C of warming would bring temperatures into the range needed for all of the potential tall shrub species to form large canopies. However, limitations in the other environmental factors would probably prevent the formation of large shrub canopies
Sternberg, Eleanore D; Lefèvre, Thierry; Li, James; de Castillejo, Carlos Lopez Fernandez; Li, Hui; Hunter, Mark D; de Roode, Jacobus C
2012-11-01
Organisms can protect themselves against parasite-induced fitness costs through resistance or tolerance. Resistance includes mechanisms that prevent infection or limit parasite growth while tolerance alleviates the fitness costs from parasitism without limiting infection. Although tolerance and resistance affect host-parasite coevolution in fundamentally different ways, tolerance has often been ignored in animal-parasite systems. Where it has been studied, tolerance has been assumed to be a genetic mechanism, unaffected by the host environment. Here we studied the effects of host ecology on tolerance and resistance to infection by rearing monarch butterflies on 12 different species of milkweed food plants and infecting them with a naturally occurring protozoan parasite. Our results show that monarch butterflies experience different levels of tolerance to parasitism depending on the species of milkweed that they feed on, with some species providing over twofold greater tolerance than other milkweed species. Resistance was also affected by milkweed species, but there was no relationship between milkweed-conferred resistance and tolerance. Chemical analysis suggests that infected monarchs obtain highest fitness when reared on milkweeds with an intermediate concentration, diversity, and polarity of toxic secondary plant chemicals known as cardenolides. Our results demonstrate that environmental factors-such as interacting species in ecological food webs-are important drivers of disease tolerance. © 2012 The Author(s). Evolution© 2012 The Society for the Study of Evolution.
KOMARNYTSKY, SLAVKO; ESPOSITO, DEBORA; POULEV, ALEXANDER; RASKIN, ILYA
2013-01-01
A group of bioactive steroidal glycosides (pregnanes) with anorectic activity in animals was isolated from several genera of milkweeds including Hoodia and Asclepias. In this study, we investigated the effects, structure-activity relationships, and mechanism of action of pregnane glycosides on steroidogenesis in human adrenocortical H295R cells. Administration of pregnane glycosides for 24 h suppressed the basal and forskolin-stimulated release of androstenedione, corticosterone, and cortisone from H295R cells. The conversion of progesterone to 11-deoxycorticosterone and 17-hydroxyprogesterone to either androstenedione or 11-deoxycortisol was most strongly affected, with 12-cinnamoyl-, benzoyl-, and tigloyl-containing pregnanes showing the highest activity. Incubation of pregnane glycosides for 24 h had no effect on mRNA transcripts of CYP11A1, CYP21A1, CYP11B1 cytochrome enzymes and steroidogenic acute regulatory protein (StaR) protein, yet resulted in twofold decrease in HSD3B1 mRNA levels. At the same time, pregnane glycosides had no effect on the CYP1, 2, or 3 drug and steroid metabolism enzymes and showed weak Na+/K+ ATPase and glucocorticoid receptor binding. Taken together, these data suggest that pregnane glycosides specifically suppress steroidogenesis through strong inhibition of 11β-hydroxylase and steroid 17-alpha-monooxygenase, and weak inhibition of cytochrome P450 side chain cleavage enzyme and 21β-hydroxylase, but not 3β-hydroxysteroid dehydrogenase/isomerase. PMID:23065845
Hallett, Allysa C.; Mitchell, Randall J.; Chamberlain, Evan R.
2017-01-01
Abstract Pollinator abundance is declining worldwide and may lower the quantity and quality of pollination services to flowering plant populations. Loss of an important pollinator is often assumed to reduce the amount of pollen received by stigmas of a focal species (pollination success), yet this assumption has rarely been tested experimentally. The magnitude of the effect, if any, may depend on the relative efficiency of the remaining pollinators, and on whether the loss of one pollinator leads to changes in visitation patterns by other pollinators. To explore how a change in pollinator composition influences pollination of Asclepias verticillata, we excluded bumble bees from plots in large and small populations of this milkweed species. We then quantified pollinator visitation rates, pollen export and pollen receipt for control plots and for plots where bumble bees were experimentally excluded. We found that exclusion of bumble bees did not reduce pollen receipt by A. verticillata flowers. Visitation by Polistes wasps increased markedly following bumble bee exclusion, both in small populations (186 % increase) and in large populations (400 % increase). Because Polistes wasps were as efficient as bumble bees at pollen transfer, increased wasp visitation offset lost bumble bee pollination services. Thus, loss of a frequent pollinator will not necessarily lead to a decline in pollination success. When pollinator loss is followed by a shift in the composition and abundance of remaining pollinators, pollination success will depend on the net change in the quantity and quality of pollination services. PMID:28798863
DOE Office of Scientific and Technical Information (OSTI.GOV)
Lyons, P.C.; Evans, J.J.; Bacon, C.W.
Infection by the fungal endophyte Acremonium coenophialum affected the accumulation of inorganic and organic N in leaf blades and leaf sheaths of KY31 tall fescue (Festuca arundinacea Schreb.) grown under greenhouse conditions. Total soluble amino acid concentrations were increased in either the blade or sheath of the leaf from infected plants. A number of amino acids were significantly increased in the sheath, but only asparagine increased in the blade. Infection resulted in higher sheath NH{sub 4}{sup +} concentrations, whereas NO{sub 3}{sup {minus}} concentrations decreased in both leaf parts. The effects on amino acid, NO{sub 3}{sup {minus}}, and NH{sub 4}{sup +}more » concentrations were dependent upon the level of N fertilization and were usually apparent only at the high rate (10 millimolar) of application. Administration of {sup 14}CO{sub 2} to the leaf blades increased the accumulation of {sup 14}C in their amino acid fraction but not in the sheaths of infected plants. This may indicate that infection increased amino acid synthesis in the blade but that translocation to the sheath, which is the site of fungal colonization, was not affected. Glutamine synthetase activity was greater in leaf blades of infected plants at high and low N rates of fertilization, but nitrate reductase activity was not affected in either part of the leaf. Increased activities of glutamine synthetase together with the other observed changes in N accumulation and metabolism in endophyte-infected tall fescue suggest that NH{sub 4}{sup +} reassimilation could also be affected in the leaf blade.« less
Ekanayake, Piyumi N; Kaur, Jatinder; Tian, Pei; Rochfort, Simone J; Guthridge, Kathryn M; Sawbridge, Timothy I; Spangenberg, German C; Forster, John W
2017-06-01
Symbiotic associations between tall fescue grasses and asexual Epichloë fungal endophytes exhibit biosynthesis of alkaloid compounds causing both beneficial and detrimental effects. Candidate novel endophytes with favourable chemotypic profiles have been identified in germplasm collections by screening for genetic diversity, followed by metabolite profile analysis in endogenous genetic backgrounds. A subset of candidates was subjected to genome survey sequencing to detect the presence or absence and structural status of known genes for biosynthesis of the major alkaloid classes. The capacity to produce specific metabolites was directly predictable from metabolic data. In addition, study of duplicated gene structure in heteroploid genomic constitutions provided further evidence for the origin of such endophytes. Selected strains were inoculated into meristem-derived callus cultures from specific tall fescue genotypes to perform isogenic comparisons of alkaloid profile in different host backgrounds, revealing evidence for host-specific quantitative control of metabolite production, consistent with previous studies. Certain strains were capable of both inoculation and formation of longer-term associations with a nonhost species, perennial ryegrass (Lolium perenne L.). Discovery and primary characterisation of novel endophytes by DNA analysis, followed by confirmatory metabolic studies, offers improvements of speed and efficiency and hence accelerated deployment in pasture grass improvement programs.
USDA-ARS?s Scientific Manuscript database
Ergot alkaloids in endophyte-infected (Neotyphodium coenophialum) tall fescue (Lolium arundinaceum) have been shown to cause a reduction in blood flow to the rumen epithelium as well as a decrease in VFA absorption from the washed rumen of steers. Previous data also indicates that incubating an extr...
Foote, A P; Penner, G B; Walpole, M E; Klotz, J L; Brown, K R; Bush, L P; Harmon, D L
2014-07-01
Ergot alkaloids in endophyte-infected (Neotyphodium coenophialum) tall fescue (Lolium arundinaceum) have been shown to cause a reduction in blood flow to the rumen epithelium as well as a decrease in volatile fatty acids (VFA) absorption from the washed rumen of steers. Previous data also indicates that incubating an extract of endophyte-infected tall fescue seed causes an increase in the amount of VFA absorbed per unit of blood flow, which could result from an alteration in the absorptive or barrier function of the rumen epithelium. An experiment was conducted to determine the acute effects of an endophyte-infected tall fescue seed extract (EXT) on total, passive or facilitated acetate and butyrate flux across the isolated bovine rumen as well as the barrier function measured by inulin flux and tissue conductance (G t ). Flux of ergovaline across the rumen epithelium was also evaluated. Rumen tissue from the caudal dorsal sac of Holstein steers (n=6), fed a common diet, was collected and isolated shortly after slaughter and mounted between two halves of Ussing chambers. In vitro treatments included vehicle control (80% methanol, 0.5% of total volume), Low EXT (50 ng ergovaline/ml) and High EXT (250 ng ergovaline/ml). Results indicate that there is no effect of acute exposure to ergot alkaloids on total, passive or facilitated flux of acetate or butyrate across the isolate bovine rumen epithelium (P>0.51). Inulin flux (P=0.16) and G t (P>0.17) were not affected by EXT treatment, indicating no alteration in barrier function due to acute ergot alkaloid exposure. Ergovaline was detected in the serosal buffer of the High EXT treatment indicating that the flux rate is ~0.25 to 0.44 ng/cm2 per hour. Data indicate that specific pathways for VFA absorption and barrier function of the rumen epithelium are not affected by acute exposure to ergot alkaloids from tall fescue at the concentrations tested. Ergovaline has the potential to be absorbed from the rumen of cattle that
Code of Federal Regulations, 2010 CFR
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Safety and Security Zones; Tall Ships Challenge 2010; Great Lakes; Cleveland, OH; Bay City, MI; Duluth, MN; Green Bay, WI; Sturgeon Bay...; Cleveland, OH; Bay City, MI; Duluth, MN; Green Bay, WI; Sturgeon Bay, WI; Chicago, IL; Erie, PA. (a...
Salehi, Mohammadreza; Salehi, Hassan; xNiazi, Hassan; Ghobadi, Cyrus
2014-03-01
The aim of this study is to find Iranian tall fescue accessions that tolerate drought stress and investigation on phylogenetical, morphological, and physiological characterization of them. For this propose, inter-simple sequence repeats (ISSR) markers were used to examine the genetic variability of accessions from different provinces of Iran. Of 21 primers, 20 primers generated highly reproducible fragments. Using these primers, 390 discernible DNA fragments were produced with 367 (93.95 %) being polymorphic. The polymorphic information content (PIC) values ranged from 0.948 to 0.976, with a mean PIC value of 0.969. Probability identity (PI) and discriminating power (D = 1-PI) among the primers ranged from 0.001 to 0.004 and 0.998 to 0.995, respectively. A binary qualitative data matrix was constructed. Data analyses were performed using the NTSYS software and the similarity values were used to generate a dendrogram via UPGMA. To study the drought stress, plants were irrigated at 25 % FC condition for three times. Fresh leaves were collected to measure physiological characters including: superoxide dismutase, catalase, and peroxidase activities and proline and total chlorophyll content at two times, before and after stress application. Relative water content, fresh and dry weight ratio, survival percentage, and visual quality were evaluated after stress. Morphological and physiological characters were assessed in order to classify accessions as either tolerant or sensitive using Ward's method of Hierarchical cluster analysis in SPSS software. The results of present study demonstrated that the ISSR markers are useful for studying tall fescue genetic diversity. Convergence of morphological and physiological characterizations during drought stress and phylogenetic relationship results showed that accessions can be grouped into four clusters; drought-tolerant accessions that collected from west of Iran, drought-tolerant accessions collected from northwest of Iran
On cat's eyes and multiple disjoint cells natural convection flow in tall tilted cavities
NASA Astrophysics Data System (ADS)
Báez, Elsa; Nicolás, Alfredo
2014-10-01
Natural convection fluid flow in air-filled tall tilted cavities is studied numerically with a direct projection method applied on the unsteady Boussinesq approximation in primitive variables. The study is focused on the so called cat's eyes and multiple disjoint cells as the aspect ratio A and the angle of inclination ϕ of the cavity vary. Results have already been reported with primitive and stream function-vorticity variables. The former are validated with the latter ones, which in turn were validated through mesh size and time-step independence studies. The new results complemented with the previous ones lead to find out the fluid motion and heat transfer invariant properties of this thermal phenomenon, which is the novelty here.
Hussaan, Muhammad; Iqbal, Naeem; Adeel, Shahid; Azeem, Muhammad; Tariq Javed, M; Raza, Ali
2017-02-01
Application of natural colorants to textile fabrics has gained worldwide public acceptance due to the hazardous nature of synthetic dyes. Present study investigated the microwave's mediated extraction of natural colorants from leaves of milkweed (Calotropis procera L.) as well as their application to cotton fabrics assisted with biochemical mordants. Dye extraction from C. procera leaves was carried out in various mediums (alkali and aqueous), and the extracted dye as well as cotton fabrics was irradiated with microwaves for 2, 4, 6, 8, or 10 min. Effect of various temperature regimes and sodium chloride (NaCl) concentrations was also evaluated on the color strength of dyed cotton fabrics. The results revealed that extraction of natural colorants was enhanced when microwave radiations were applied for 4 min by using alkali as an extraction medium as compared to aqueous one. Optimum dyeing of cotton fabrics was achieved by using NaCl at a temperature of 55 °C. Among the chemical mordants, iron was effective for better color strength when used as pre- and post-mordant. Among the studied bio-mordants, extract of Acacia nilotica bark significantly improved the color strength and fastness properties as pre-mordant and Curcuma longa tuber as post-mordant. It was concluded that extract of C. procera leaves was a potential source of natural colorants and a high level of dye was obtained upon irradiation of alkali-solubilized extract for 4 min. Application of NaCl at concentration of 3 g/100 mL and temperature treatment of 55 °C significantly improved the color strength of dyed cotton fabrics.
NASA Astrophysics Data System (ADS)
Králik, Juraj; Králik, Juraj
2017-07-01
The paper presents the results from the deterministic and probabilistic analysis of the accidental torsional effect of reinforced concrete tall buildings due to earthquake even. The core-column structural system was considered with various configurations in plane. The methodology of the seismic analysis of the building structures in Eurocode 8 and JCSS 2000 is discussed. The possibilities of the utilization the LHS method to analyze the extensive and robust tasks in FEM is presented. The influence of the various input parameters (material, geometry, soil, masses and others) is considered. The deterministic and probability analysis of the seismic resistance of the structure was calculated in the ANSYS program.
USDA-ARS?s Scientific Manuscript database
Chemical seedhead suppression of toxic endophyte-infected (E+) tall fescue can enhance steer performance and mitigate the adverse effects of ergot alkaloids on cattle physiology; however, it is not known if seedhead suppression can mitigate alkaloid-induced vasoconstriction and improve post-graze pe...
ERIC Educational Resources Information Center
Barner, David; Snedeker, Jesse
2008-01-01
Four experiments investigated 4-year-olds' understanding of adjective-noun compositionality and their sensitivity to statistics when interpreting scalar adjectives. In Experiments 1 and 2, children selected "tall" and "short" items from 9 novel objects called "pimwits" (1-9 in. in height) or from this array plus 4 taller or shorter distractor…
Tall Amazonian forests are less sensitive to precipitation variability
NASA Astrophysics Data System (ADS)
Giardina, Francesco; Konings, Alexandra G.; Kennedy, Daniel; Alemohammad, Seyed Hamed; Oliveira, Rafael S.; Uriarte, Maria; Gentine, Pierre
2018-06-01
Climate change is altering the dynamics, structure and function of the Amazon, a biome deeply connected to the Earth's carbon cycle. Climate factors that control the spatial and temporal variations in forest photosynthesis have been well studied, but the influence of forest height and age on this controlling effect has rarely been considered. Here, we present remote sensing observations of solar-induced fluorescence (a proxy for photosynthesis), precipitation, vapour-pressure deficit and canopy height, together with estimates of forest age and aboveground biomass. We show that photosynthesis in tall Amazonian forests, that is, forests above 30 m, is three times less sensitive to precipitation variability than in shorter (less than 20 m) forests. Taller Amazonian forests are also found to be older, have more biomass and deeper rooting systems1, which enable them to access deeper soil moisture and make them more resilient to drought. We suggest that forest height and age are an important control of photosynthesis in response to interannual precipitation fluctuations. Although older and taller trees show less sensitivity to precipitation variations, they are more susceptible to fluctuations in vapour-pressure deficit. Our findings illuminate the response of Amazonian forests to water stress, droughts and climate change.
Urea metabolism in beef steers fed tall fescue, orchardgrass, or gamagrass hays.
Huntington, G B; Magee, K; Matthews, A; Poore, M; Burns, J
2009-04-01
Two experiments were conducted to assess effects of endophyte treatments (Exp. 1), forage species (Exp. 2), and supplementation (Exp. 2) on urea production, excretion, and recycling in beef steers. Infusion of (15,15)N-urea and enrichment of urea in urine samples were used to calculate urea-N entry and recycling to the gut. Acceptably stable enrichment of (15)N-urea in urine was obtained after 50 h of intrajugular infusion of (15,15)N-urea, indicating that valid data on urea metabolism can be obtained from steers fed forages twice daily. After adjustment by covariance for differences in N intake among treatments in Exp. 1, steers fed endophyte-infected tall fescue had less (P<0.10) urea-N entry, recycling to the gut, and return of recycled urea-N to the ornithine cycle than those fed endophyte-free or novel endophyte-infected tall fescue. However, urea-N urinary excretion or return to the gut was similar among endophyte treatments when expressed as a proportion of urea-N entry. Urea-N entry and return to the gut in Exp. 2 was similar in steers fed gamagrass or orchardgrass hay after adjustment by covariance for differences in N intake. Less (P<0.01) urinary excretion, expressed as grams per day or as a proportion of urea-N entry, with gamagrass than with orchardgrass was associated with faster in vitro NDF-N digestion with gamagrass. Supplementation of gamagrass or orchardgrass with 1.76 kg/d of readily fermentable fiber and starch decreased urea entry (P<0.06) and urinary excretion of urea (P<0.01). Interactions between hay source and supplement reflected a greater response to supplementation for steers fed orchardgrass than for those fed gamagrass. After adjustment for differences among treatments in N supply, results of both experiments support the concept of improved N use in response to increased carbohydrate fermentability in the rumen, due either to inherent differences in forage fiber or to supplementation with readily fermentable carbohydrate (starch or
Hu, Tao; Liu, Shu-Qian; Amombo, Erick; Fu, Jin-Min
2015-01-01
When plants are pre-exposed to stress, they can produce some stable signals and physiological reactions that may be carried forward as “stress memory”. However, there is insufficient information about plants' stress memory responses mechanisms. Here, two tall fescue genotypes, heat-tolerant PI 574522 and heat-sensitive PI 512315, were subjected to recurring high-temperature pre-acclimation treatment. Two heat shock protein (HSP) genes, LMW-HSP and HMW-HSP, exhibited transcriptional memory for their higher transcript abundance during one or more subsequent stresses (S2, S3, S4) relative to the first stress (S1), and basal transcript levels during the recovery states (R1, R2, and R3). Activated transcriptional memory from two trainable genes could persist up to 4 days, and induce higher thermotolerance in tall fescue. This was confirmed by greater turf quality and lower electrolyte leakage. Pre-acclimation treatment inhibited the decline at steps of O-J-I-P and energy transport fluxes in active Photosystem II reaction center (PSII RC) for both tall fescue genotypes. The heat stress memory was associated with major shifts in leaf metabolite profiles. Furthermore, there was an exclusive increase in leaf organic acids (citric acid, malic acid, tris phosphoric acid, threonic acid), sugars (sucrose, glucose, idose, allose, talose, glucoheptose, tagatose, psicose), amino acids (serine, proline, pyroglutamic acid, glycine, alanine), and one fatty acid (butanoic acid) in pre-acclimated plants. These observations involved in transcriptional memory, PSII RC energy transport and metabolite profiles could provide new insights into the plant high–temperature response process. PMID:26136755
Perimortem fractures in Lucy suggest mortality from fall out of tall tree.
Kappelman, John; Ketcham, Richard A; Pearce, Stephen; Todd, Lawrence; Akins, Wiley; Colbert, Matthew W; Feseha, Mulugeta; Maisano, Jessica A; Witzel, Adrienne
2016-09-22
The Pliocene fossil 'Lucy' (Australopithecus afarensis) was discovered in the Afar region of Ethiopia in 1974 and is among the oldest and most complete fossil hominin skeletons discovered. Here we propose, on the basis of close study of her skeleton, that her cause of death was a vertical deceleration event or impact following a fall from considerable height that produced compressive and hinge (greenstick) fractures in multiple skeletal elements. Impacts that are so severe as to cause concomitant fractures usually also damage internal organs; together, these injuries are hypothesized to have caused her death. Lucy has been at the centre of a vigorous debate about the role, if any, of arboreal locomotion in early human evolution. It is therefore ironic that her death can be attributed to injuries resulting from a fall, probably out of a tall tree, thus offering unusual evidence for the presence of arborealism in this species.
NASA Astrophysics Data System (ADS)
Schuldt, B.; Leuschner, C.; Horna, V.; Moser, G.; Köhler, M.; Barus, H.
2010-11-01
In a throughfall displacement experiment on Sulawesi, Indonesia, three 0.16 ha stands of a premontane perhumid rainforest were exposed to a two-year soil desiccation period that reduced the soil moisture in the upper soil layers beyond the conventional wilting point. About 25 variables, including leaf morphological and chemical traits, stem diameter growth and hydraulic properties of the xylem in the trunk and terminal twigs, were investigated in trees of the tall-growing tree species Castanopsis acuminatissima (Fagaceae) by comparing desiccated roof plots with nearby control plots. We tested the hypotheses that this tall and productive species is particularly sensitive to drought, and the exposed upper sun canopy is more affected than the shade canopy. Hydraulic conductivity in the xylem of terminal twigs normalised to vessel lumen area was reduced by 25%, leaf area-specific conductivity by 10-33% during the desiccation treatment. Surprisingly, the leaves present at the end of the drought treatment were significantly larger, but not smaller in the roof plots, though reduced in number (about 30% less leaves per unit of twig sapwood area), which points to a drought effect on the leaf bud formation while the remaining leaves may have profited from a surplus of water. Mean vessel diameter and axial conductivity in the outermost xylem of the trunk were significantly reduced and wood density increased, while annual stem diameter increment decreased by 26%. In contradiction to our hypotheses, (i) we found no signs of major damage to the C. acuminatissima trees nor to any other drought sensitivity of tall trees, and (ii) the exposed upper canopy was not more drought susceptible than the shade canopy.
Maintenance of carbohydrate transport in tall trees.
Savage, Jessica A; Beecher, Sierra D; Clerx, Laura; Gersony, Jessica T; Knoblauch, Jan; Losada, Juan M; Jensen, Kaare H; Knoblauch, Michael; Holbrook, N Michele
2017-12-01
Trees present a critical challenge to long-distance transport because as a tree grows in height and the transport pathway increases in length, the hydraulic resistance of the vascular tissue should increase. This has led many to question whether trees can rely on a passive transport mechanism to move carbohydrates from their leaves to their roots. Although species that actively load sugars into their phloem, such as vines and herbs, can increase the driving force for transport as they elongate, it is possible that many trees cannot generate high turgor pressures because they do not use transporters to load sugar into the phloem. Here, we examine how trees can maintain efficient carbohydrate transport as they grow taller by analysing sieve tube anatomy, including sieve plate geometry, using recently developed preparation and imaging techniques, and by measuring the turgor pressures in the leaves of a tall tree in situ. Across nine deciduous species, we find that hydraulic resistance in the phloem scales inversely with plant height because of a shift in sieve element structure along the length of individual trees. This scaling relationship seems robust across multiple species despite large differences in plate anatomy. The importance of this scaling becomes clear when phloem transport is modelled using turgor pressures measured in the leaves of a mature red oak tree. These pressures are of sufficient magnitude to drive phloem transport only in concert with structural changes in the phloem that reduce transport resistance. As a result, the key to the long-standing mystery of how trees maintain phloem transport as they increase in size lies in the structure of the phloem and its ability to change hydraulic properties with plant height.
NASA Astrophysics Data System (ADS)
Stanley, Kieran M.; Grant, Aoife; O'Doherty, Simon; Young, Dickon; Manning, Alistair J.; Stavert, Ann R.; Spain, T. Gerard; Salameh, Peter K.; Harth, Christina M.; Simmonds, Peter G.; Sturges, William T.; Oram, David E.; Derwent, Richard G.
2018-03-01
A network of three tall tower measurement stations was set up in 2012 across the United Kingdom to expand measurements made at the long-term background northern hemispheric site, Mace Head, Ireland. Reliable and precise in situ greenhouse gas (GHG) analysis systems were developed and deployed at three sites in the UK with automated instrumentation measuring a suite of GHGs. The UK Deriving Emissions linked to Climate Change (UK DECC) network uses tall (165-230 m) open-lattice telecommunications towers, which provide a convenient platform for boundary layer trace gas sampling. In this paper we describe the automated measurement system and first results from the UK DECC network for CO2, CH4, N2O, SF6, CO and H2. CO2 and CH4 are measured at all of the UK DECC sites by cavity ring-down spectroscopy (CRDS) with multiple inlet heights at two of the three tall tower sites to assess for boundary layer stratification. The short-term precisions (1σ on 1 min means) of CRDS measurements at background mole fractions for January 2012 to September 2015 is < 0.05 µmol mol-1 for CO2 and < 0.3 nmol mol-1 for CH4. Repeatability of standard injections (1σ) is < 0.03 µmol mol-1 for CO2 and < 0.3 nmol mol-1 for CH4 for the same time period. N2O and SF6 are measured at three of the sites, and CO and H2 measurements are made at two of the sites, from a single inlet height using gas chromatography (GC) with an electron capture detector (ECD), flame ionisation detector (FID) or reduction gas analyser (RGA). Repeatability of individual injections (1σ) on GC and RGA instruments between January 2012 and September 2015 for CH4, N2O, SF6, CO and H2 measurements were < 2.8 nmol mol-1, < 0.4 nmol mol-1, < 0.07 pmol mol-1, < 2 nmol mol-1 and < 3 nmol mol-1, respectively. Instrumentation in the network is fully automated and includes sensors for measuring a variety of instrumental parameters such as flow, pressures, and sampling temperatures. Automated alerts are generated and emailed to site
Çelebi, Mehmet; Hisada, Yoshiuaki; Omrani, Roshanak; Ghahari, S. Farid; Taciroglu, Ertugrul
2016-01-01
The 11 March 2011 M 9.0 Tohoku earthquake generated significant long duration shaking that propagated hundreds of kilometers from the epicenter and affected urban areas throughout much of Honshu. Recorded responses of tall buildings at several hundred km from the epicenter of the main shock and other events show tall buildings were affected by long-period motions of events at distant sources. This study presents behavioral aspects of 29-story and 30-story neighboring buildings in the Shinjuku area of Tokyo, Japan, as inferred from records retrieved from a sparse array of accelerometers deployed in the superstructures, at ground and 100 m below the ground level over a time interval covering before, during, and after the main shock. Such long-period effects are common in several regions of Japan as well as in the United States and in other seismically active countries. Permanent shifts in fundamental frequencies are observed. Drift ratios indicate possible structural nonlinear behavior occurred during the main shock. The need to consider risks to built environments from distant sources, including those in neighboring countries, is emphasized.
Wood, Sam W.; Prior, Lynda D.; Stephens, Helen C.; Bowman, David M. J. S.
2015-01-01
Tracking the response of forest ecosystems to climate change demands large (≥1 ha) monitoring plots that are repeatedly measured over long time frames and arranged across macro-ecological gradients. Continental scale networks of permanent forest plots have identified links between climate and carbon fluxes by monitoring trends in tree growth, mortality and recruitment. The relationship between tree growth and climate in Australia has been recently articulated through analysis of data from smaller forest plots, but conclusions were limited by (a) absence of data on recruitment and mortality, (b) exclusion of non-eucalypt species, and (c) lack of knowledge of stand age or disturbance histories. To remedy these gaps we established the Ausplots Forest Monitoring Network: a continental scale network of 48 1 ha permanent plots in highly productive tall eucalypt forests in the mature growth stage. These plots are distributed across cool temperate, Mediterranean, subtropical and tropical climates (mean annual precipitation 850 to 1900 mm per year; mean annual temperature 6 to 21°C). Aboveground carbon stocks (AGC) in these forests are dominated by eucalypts (90% of AGC) whilst non-eucalypts in the understorey dominated species diversity and tree abundance (84% of species; 60% of stems). Aboveground carbon stocks were negatively related to mean annual temperature, with forests at the warm end of the temperature range storing approximately half the amount of carbon as forests at the cool end of the temperature range. This may reflect thermal constraints on tree growth detected through other plot networks and physiological studies. Through common protocols and careful sampling design, the Ausplots Forest Monitoring Network will facilitate the integration of tall eucalypt forests into established global forest monitoring initiatives. In the context of projections of rapidly warming and drying climates in Australia, this plot network will enable detection of links between
USDA-ARS?s Scientific Manuscript database
Theories suggest that incorporating alfalfa (Medicago sativa L.; Alf) or birdsfoot trefoil (Lotus corniculatus L.; BFT) into endophyte-infected tall fescue (Festuca arundinaceas Schreb.; E+TF) pasturelands may improve livestock production. We investigated how planting configuration might influence p...
Spatially organized «vertical city» as a synthesis of tall buildings and airships
NASA Astrophysics Data System (ADS)
Gagulina, Olga; Matovnikov, Sergei
2018-03-01
The paper explores the compact city concept based on the «spatial» urban development principles and describes the prerequisites and possible methods to move from «horizontal» planning to «vertical» urban environments. It highlights the close connection between urban space, high-rise city landscape and conveyance options and sets out the ideas for upgrading the existing architectural and urban planning principles. It also conceptualizes the use of airships to create additional spatial connections between urban structure elements and high-rise buildings. Functional changes are considered in creating both urban environment and internal space of tall buildings, and the environmental aspects of the new spatial model are brought to light. The paper delineates the prospects for making a truly «spatial» multidimensional city space.
1986-07-01
years. Powdery mildew may infest plants seasonally when prolonged damp weather occurs (Wasser 1982). Th . 13 LITERATURE CITED Association of Official...truncate (square) tips. The seeds are similar to small grains of wheat (Cronquist 3 ~’ auricle .4. * ligule glume-t / I a Figure 1. Distribution and...distinguishing characteristics of tall wheat - grass (Agropyron elongatwn): (a) culms, (b) ligule and auricle, (c) seedhead, (d) spikelet, and (e) floret
From cat's eyes to disjoint multicellular natural convection flow in tall tilted cavities
NASA Astrophysics Data System (ADS)
Nicolás, Alfredo; Báez, Elsa; Bermúdez, Blanca
2011-07-01
Numerical results of two-dimensional natural convection problems, in air-filled tall cavities, are reported to study the change of the cat's eyes flow as some parameters vary, the aspect ratio A and the angle of inclination ϕ of the cavity, with the Rayleigh number Ra mostly fixed; explicitly, the range of the variation is given by 12⩽A⩽20 and 0°⩽ϕ⩽270°; about Ra=1.1×10. A novelty contribution of this work is the transition from the cat's eyes changes, as A varies, to a disjoint multicellular flow, as ϕ varies. These flows may be modeled by the unsteady Boussinesq approximation in stream function and vorticity variables which is solved with a fixed point iterative process applied to the nonlinear elliptic system that results after time discretization. The validation of the results relies on mesh size and time-step independence studies.
Richards, C J; Pugh, R B; Waller, J C
2006-03-01
Six steers (288.6 +/- 2.1 kg of BW) fitted with rumen and duodenal cannulas were used in a crossover design to evaluate intake, rumen fermentation, and site of nutrient digestion of freshly clipped, endophyte-infected (E+) Kentucky 31 tall fescue with or without soybean hull (SH) supplementation at 0.60% of BW (OM basis). Steers were placed in metabolism units within an environmentally controlled room and provided with free-choice access to fresh forage, water, and a vitamin/mineral supplement. The spring growth of E+ tall fescue was harvested daily during the experiment. Supplement was fed at 0700 with approximately 65% of the estimated daily forage. To maintain a fresh forage supply, additional forage was stored in a cooler and fed at 1900. Periods were 21 d with 14 d of adaptation and 7 d of digesta sample collection. Chromic oxide was used as a marker of duodenal digesta flow. Duodenal samples were taken 4 times daily with times shifting by 1 h each day to represent all 24 h of a day. Treatments were considered significant at P < 0.05. Supplementation of SH decreased forage OM intake from 1.64 to 1.41% of BW but increased total OM intake from 1.64 to 2.01% of BW. Apparent percentages (53.1%) and quantities (2,786 g/d) of rumen OM disappearance were not affected by supplementation. Percentages of total tract OM disappearance were not different (70.8%). Percentages of apparent rumen NDF disappearance also were not different (65.6%). Percentages of N disappearance were not different. Supplementation of SH resulted in increased total N (34.1 g/d) and microbial N (17.1 g/d) flowing to the duodenum. Rumen pH (6.5) was not affected, and rumen ammonia concentrations exhibited a time x treatment interaction in which SH decreased ammonia for 12 h after supplementation. Total VFA concentrations (103.9 mM) were unaffected. Liquid dilution rate (12.7%/h) and rumen OM fill (4.3 kg) were not different between treatments. Supplementation of SH at a rate of 0.60% of BW (OM
Pleasants, John M.; Zalucki, Myron P.; Oberhauser, Karen S.; Brower, Lincoln P.; Taylor, Orley R.; Thogmartin, Wayne E.
2017-01-01
To assess the change in the size of the eastern North American monarch butterfly summer population, studies have used long-term data sets of counts of adult butterflies or eggs per milkweed stem. Despite the observed decline in the monarch population as measured at overwintering sites in Mexico, these studies found no decline in summer counts in the Midwest, the core of the summer breeding range, leading to a suggestion that the cause of the monarch population decline is not the loss of Midwest agricultural milkweeds but increased mortality during the fall migration. Using these counts to estimate population size, however, does not account for the shift of monarch activity from agricultural fields to non-agricultural sites over the past 20 years, as a result of the loss of agricultural milkweeds due to the near-ubiquitous use of glyphosate herbicides. We present the counter-hypotheses that the proportion of the monarch population present in non-agricultural habitats, where counts are made, has increased and that counts reflect both population size and the proportion of the population observed. We use data on the historical change in the proportion of milkweeds, and thus monarch activity, in agricultural fields and non-agricultural habitats to show why using counts can produce misleading conclusions about population size. We then separate out the shifting proportion effect from the counts to estimate the population size and show that these corrected summer monarch counts show a decline over time and are correlated with the size of the overwintering population. In addition, we present evidence against the hypothesis of increased mortality during migration. The milkweed limitation hypothesis for monarch decline remains supported and conservation efforts focusing on adding milkweeds to the landscape in the summer breeding region have a sound scientific basis.
Pleasants, John M; Zalucki, Myron P; Oberhauser, Karen S; Brower, Lincoln P; Taylor, Orley R; Thogmartin, Wayne E
2017-01-01
To assess the change in the size of the eastern North American monarch butterfly summer population, studies have used long-term data sets of counts of adult butterflies or eggs per milkweed stem. Despite the observed decline in the monarch population as measured at overwintering sites in Mexico, these studies found no decline in summer counts in the Midwest, the core of the summer breeding range, leading to a suggestion that the cause of the monarch population decline is not the loss of Midwest agricultural milkweeds but increased mortality during the fall migration. Using these counts to estimate population size, however, does not account for the shift of monarch activity from agricultural fields to non-agricultural sites over the past 20 years, as a result of the loss of agricultural milkweeds due to the near-ubiquitous use of glyphosate herbicides. We present the counter-hypotheses that the proportion of the monarch population present in non-agricultural habitats, where counts are made, has increased and that counts reflect both population size and the proportion of the population observed. We use data on the historical change in the proportion of milkweeds, and thus monarch activity, in agricultural fields and non-agricultural habitats to show why using counts can produce misleading conclusions about population size. We then separate out the shifting proportion effect from the counts to estimate the population size and show that these corrected summer monarch counts show a decline over time and are correlated with the size of the overwintering population. In addition, we present evidence against the hypothesis of increased mortality during migration. The milkweed limitation hypothesis for monarch decline remains supported and conservation efforts focusing on adding milkweeds to the landscape in the summer breeding region have a sound scientific basis.
Analysis of Foundation of Tall R/C Chimney Incorporating Flexibility of Soil
NASA Astrophysics Data System (ADS)
Jayalekshmi, B. R.; Jisha, S. V.; Shivashankar, R.
2017-09-01
Three dimensional Finite Element (FE) analysis was carried out for 100 and 400 m high R/C chimneys having piled annular raft and annular raft foundations considering the flexibility of soil subjected to across-wind load. Stiffness of supporting soil and foundation were varied to evaluate the significance of Soil-Structure Interaction (SSI). The integrated chimney-foundation-soil system was analysed by finite element software ANSYS based on direct method of SSI assuming linear elastic material behaviour. FE analyses were carried out for two cases of SSI namely, (1) chimney with annular raft foundation and (2) chimney with piled annular raft foundation. The responses in raft such as bending moments and settlements were evaluated for both the cases and compared to those obtained from the conventional method of analysis of annular raft foundation. It is found that the responses in raft vary considerably depending on the stiffness of the underlying soil and the stiffness of foundation. Piled raft foundations are better suited for tall chimneys to be constructed in loose or medium sand.
NASA Astrophysics Data System (ADS)
Calugaru, Vladimir
This dissertation pursues three main objectives: (1) to investigate the seismic response of tall reinforced concrete core wall buildings, designed following current building codes, subjected to pulse type near-fault ground motion, with special focus on the relation between the characteristics of the ground motion and the higher-modes of response; (2) to determine the characteristics of a base isolation system that results in nominally elastic response of the superstructure of a tall reinforced concrete core wall building at the maximum considered earthquake level of shaking; and (3) to demonstrate that the seismic performance, cost, and constructability of a base-isolated tall reinforced concrete core wall building can be significantly improved by incorporating a rocking core-wall in the design. First, this dissertation investigates the seismic response of tall cantilever wall buildings subjected to pulse type ground motion, with special focus on the relation between the characteristics of ground motion and the higher-modes of response. Buildings 10, 20, and 40 stories high were designed such that inelastic deformation was concentrated at a single flexural plastic hinge at their base. Using nonlinear response history analysis, the buildings were subjected to near-fault seismic ground motions as well as simple close-form pulses, which represented distinct pulses within the ground motions. Euler-Bernoulli beam models with lumped mass and lumped plasticity were used to model the buildings. Next, this dissertation investigates numerically the seismic response of six seismically base-isolated (BI) 20-story reinforced concrete buildings and compares their response to that of a fixed-base (FB) building with a similar structural system above ground. Located in Berkeley, California, 2 km from the Hayward fault, the buildings are designed with a core wall that provides most of the lateral force resistance above ground. For the BI buildings, the following are investigated
NASA Astrophysics Data System (ADS)
Kim, Edward; Baloch, Zubair; Kim, Caroline
2015-03-01
The number of new cases of thyroid cancer are dramatically increasing as incidences of this cancer have more than doubled since the early 1970s. Tall cell variant (TCV-PTC) papillary thyroid carcinoma is one type of thyroid cancer that is more aggressive and usually associated with higher local recurrence and distant metastasis. This variant can be identified through visual characteristics of cells in histological images. Thus, we created a fully automatic algorithm that is able to segment cells using a multi-stage approach. Our method learns the statistical characteristics of nuclei and cells during the segmentation process and utilizes this information for a more accurate result. Furthermore, we are able to analyze the detected regions and extract characteristic cell data that can be used to assist in clinical diagnosis.
NASA Astrophysics Data System (ADS)
Schuldt, B.; Leuschner, C.; Horna, V.; Moser, G.; Köhler, M.; van Straaten, O.; Barus, H.
2011-08-01
A large-scale replicated throughfall exclusion experiment was conducted in a pre-montane perhumid rainforest in Sulawesi (Indonesia) exposing the trees for two years to pronounced soil desiccation. The lack of regularly occurring dry periods and shallow rooting patterns distinguish this experiment from similar experiments conducted in the Amazonian rainforest. We tested the hypotheses that a tree's sun canopy is more affected by soil drought than its shade crown, making tall trees particularly vulnerable even under a perhumid climate, and that extended drought periods stimulate an acclimation in the hydraulic system of the sun canopy. In the abundant and tall tree species Castanopsis acuminatissima (Fagaceae), we compared 31 morphological, anatomical, hydraulic and chemical variables of leaves, branches and the stem together with stem diameter growth between drought and control plots. There was no evidence of canopy dieback. However, the drought treatment led to a 30 % reduction in sapwood-specific hydraulic conductivity of sun canopy branches, possibly caused by the formation of smaller vessels and/or vessel filling by tyloses. Drought caused an increase in leaf size, but a decrease in leaf number, and a reduction in foliar calcium content. The δ13C and δ18O signatures of sun canopy leaves gave no indication of a permanent down-regulation of stomatal conductance during the drought, indicating that pre-senescent leaf shedding may have improved the water status of the remaining leaves. Annual stem diameter growth decreased during the drought, while the density of wood in the recently produced xylem increased in both the stem and sun canopy branches (marginally significant). The sun canopy showed a more pronounced drought response than the shade crown indicating that tall trees with a large sun canopy are more vulnerable to drought stress. We conclude that the extended drought prompted a number of medium- to long-term responses in the leaves, branches and the trunk
NASA Astrophysics Data System (ADS)
Báez, Elsa; Nicolás, Alfredo
2013-11-01
Natural convection fluid flow in air-filled tall tilted cavities is studied numerically with a new direct projection method on the Boussinesq approximation in primitive variables. The study deals with “cat's eyes” instabilities and multiple disjoint cells as the aspect ratio A and the angle of inclination ϕ of the cavity vary. The flows are validated with those reported before using the stream function-vorticity variables. New cases, A=12 and 20 varying ϕ, lead to get more insight on the physical phenomenon.
USDA-ARS?s Scientific Manuscript database
Previous research has demonstrated differences in contractile responses to ergot alkaloids, serotonin (5HT), and adrenergic agonists by lateral saphenous veins collected from cattle that grazed either endophyte (Neotyphodium coenophialum)-infected or endophyte-free tall fescue (Lolium arundinaceum),...
ERIC Educational Resources Information Center
Gathercole, Virginia C. Mueller
A decline exists in children's ability at ages 4 and 5 to accurately respond to the difference between polar adjectives such as "big" and "tall.""Taller" and "bigger" are both taken to mean "having a higher top point," rather than "bigger" meaning "greater overall mass." Two hypotheses are put forth to explain this. The "strong cognitive…
Thomas, Philippe J; Carpenter, David; Boutin, Céline; Allison, Jane E
2014-02-01
The phytotoxicity of rare earth elements (REEs) is still poorly understood. The exposure-response relationships of three native Canadian plant species (common milkweed, Asclepias syriaca L., showy ticktrefoil, Desmodium canadense (L.) DC. and switchgrass, Panicum virgatum L.) and two commonly used crop species (radish, Raphanus sativus L., and tomato, Solanum lycopersicum L.) to the REEs lanthanum (La), yttrium (Y) and cerium (Ce) were tested. In separate experiments, seven to eight doses of each element were added to the soil prior to sowing seeds. Effects of REE dose on germination were established through measures of total percent germination and speed of germination; effects on growth were established through determination of above ground biomass. Ce was also tested at two pH levels and plant tissue analysis was conducted on pooled samples. Effects on germination were mostly observed with Ce at low pH. However, effects on growth were more pronounced, with detectable inhibition concentrations causing 10% and 25% reductions in biomass for the two native forb species (A. syriaca and D. canadense) with all REEs and on all species tested with Ce in both soil pH treatments. Concentration of Ce in aboveground biomass was lower than root Ce content, and followed the dose-response trend. From values measured in natural soils around the world, our results continue to support the notion that REEs are of limited toxicity and not considered extremely hazardous to the environment. However, in areas where REE contamination is likely, the slow accumulation of these elements in the environment could become problematic. Copyright © 2013 The Authors. Published by Elsevier Ltd.. All rights reserved.
An adaptive decision framework for the conservation of a threatened plant
Moore, Clinton T.; Fonnesbeck, Christopher J.; Shea, Katriona; Lah, Kristopher J.; McKenzie, Paul M.; Ball, Lianne C.; Runge, Michael C.; Alexander, Helen M.
2011-01-01
Mead's milkweed Asclepias meadii, a long-lived perennial herb of tallgrass prairie and glade communities of the central United States, is a species designated as threatened under the U.S. Endangered Species Act. Challenges to its successful management include the facts that much about its life history is unknown, its age at reproductive maturity is very advanced, certain life stages are practically unobservable, its productivity is responsive to unpredictable environmental events, and most of the known populations occur on private lands unprotected by any legal conservation instrument. One critical source of biological uncertainty is the degree to which fire promotes growth and reproductive response in the plant. To aid in its management, we developed a prototype population-level state-dependent decision-making framework that explicitly accounts for this uncertainty and for uncertainties related to stochastic environmental effects and vital rates. To parameterize the decision model, we used estimates found in the literature, and we analyzed data from a long-term monitoring program where fates of individual plants were observed through time. We demonstrate that different optimal courses of action are followed according to how one believes that fire influences reproductive response, and we show that the action taken for certain population states is informative for resolving uncertainty about competing beliefs regarding the effect of fire. We advocate the use of a model-predictive approach for the management of rare populations, particularly when management uncertainty is profound. Over time, an adaptive management approach should reduce uncertainty and improve management performance as predictions of management outcome generated under competing models are continually informed and updated by monitoring data.
Wason, Elizabeth L; Agrawal, Anurag A; Hunter, Mark D
2013-08-01
The existence of predictable latitudinal variation in plant defense against herbivores remains controversial. A prevailing view holds that higher levels of plant defense evolve at low latitudes compared to high latitudes as an adaptive plant response to higher herbivore pressure on low-latitude plants. To date, this prediction has not been examined with respect to volatile organic compounds (VOCs) that many plants emit, often thus attracting the natural enemies of herbivores. Here, we compared genetically-based constitutive and herbivore-induced aboveground vegetative VOC emissions from plants originating across a gradient of more than 10° of latitude (>1,500 km). We collected headspace VOCs from Asclepias syriaca (common milkweed) originating from 20 populations across its natural range and grown in a common garden near the range center. Feeding by specialist Danaus plexippus (monarch) larvae induced VOCs, and field environmental conditions (temperature, light, and humidity) also influenced emissions. Monarch damage increased plant VOC concentrations and altered VOC blends. We found that genetically-based induced VOC emissions varied with the latitude of plant population origin, although the pattern followed the reverse of that predicted-induced VOC concentration increased with increasing latitude. This pattern appeared to be driven by a greater induction of sesquiterpenoids at higher latitudes. In contrast, constitutive VOC emission did not vary systematically with latitude, and the induction of green leafy volatiles declined with latitude. Our results do not support the prevailing view that plant defense is greater at lower than at higher latitudes. That the pattern holds only for herbivore-induced VOC emission, and not constitutive emission, suggests that latitudinal variation in VOCs is not a simple adaptive response to climatic factors.