Science.gov

Sample records for 35s cauliflower mosaic

  1. Splicing of cauliflower mosaic virus 35S RNA is essential for viral infectivity.

    PubMed Central

    Kiss-László, Z; Blanc, S; Hohn, T

    1995-01-01

    A splicing event essential for the infectivity of a plant pararetrovirus has been characterized. Transient expression experiments using reporter constructs revealed a splice donor site in the leader sequence of the cauliflower mosaic virus (CaMV) 35S RNA and three additional splice donor sites within open reading frame (ORF) I. All four donors use the same splice acceptor within ORF II. Splicing between the leader and ORF II produces an mRNA from which ORF III and, in the presence of the CaMV translational transactivator, ORF IV can be translated efficiently. The other three splicing events produce RNAs encoding ORF I-II in-frame fusions. All four spliced CaMV RNAs were detected in CaMV-infected plants. Virus mutants in which the splice acceptor site in ORF II is inactivated are not infectious, indicating that splicing plays an essential role in the CaMV life cycle. The results presented here suggest a model for viral gene expression in which RNA splicing is required to provide appropriate substrate mRNAs for the specialized translation mechanisms of CaMV. Images PMID:7628455

  2. A novel fluorescent biosensor for detection of target DNA fragment from the transgene cauliflower mosaic virus 35S promoter.

    PubMed

    Qiu, Bin; Zhang, Ya-shan; Lin, Yi-bing; Lu, Yu-Jing; Lin, Zhen-yu; Wong, Kwok-Yin; Chen, Guo-nan

    2013-03-15

    In this paper, we reported a convenient fluorescence method for the detection of genetically modified organisms (GMOs). As it is known that the cauliflower mosaic virus (CaMV) 35S promoter is widely used in most transgenic plants (Schnurr and Guerra, 2000), we thus design a simple method based on the detection of a section target DNA (DNA-T) from the transgene CaMV 35S promoter. In this method, the full-length guanine-rich single-strand sequences were split into fragments (Probe 1 and 2) and each part of the fragment possesses two GGG repeats. In the presence of K(+) ion and berberine, if a complementary target DNA of the CaMV 35S promoter was introduced to hybridize with Probe 1 and 2, a G-quadruplex-berberine complex was thus formed and generated a strong fluorescence signal. The generation of fluorescence signal indicates the presence of CaMV 35S promoter. This method is able to identify and quantify Genetically Modified Organisms (GMOs), and it shows wide linear ranges from 5.0×10(-9) to 9.0×10(-7) mol/L with a detection limit of 2.0×10(-9) mol/L. PMID:22959013

  3. Characteristics of a strong promoter from figwort mosaic virus: comparison with the analogous 35S promoter from cauliflower mosaic virus and the regulated mannopine synthase promoter.

    PubMed

    Sanger, M; Daubert, S; Goodman, R M

    1990-03-01

    A segment of DNA from the genome of figwort mosaic virus (FMV) strain M3 possesses promoter activity when tested in electroporated protoplasts from, and transgenic plants of, Nicotiana tabacum cv. Xanthi nc. The 1.1 kb DNA segment, designated the '34S' promoter, is derived from a position on the FMV genome comparable to the position on the cauliflower mosaic virus (CaMV) genome containing the 35S promoter. The 34S and 35S promoters show approximately 63% nucleotide homology in the TATA, CCACT, and -18 to +1 domains, but in sequences further upstream the homology drops below 50%. Promoter activities were estimated using beta-glucuronidase and neomycin phosphotransferase II reporter gene systems. The activity of the 34S promoter segment approximates that of the 35S promoter in both protoplast transient expression assays and in stably transformed tobacco plants. Truncation of 5' sequences from the 34S promoter indicates that promoter strength depends upon DNA sequences located several hundred nucleotides upstream from the TATA box. In leaf tissue the 34S promoter is 20-fold more active than the mannopine synthase (MAS) promoter from Agrobacterium tumefaciens T-DNA. The 34S promoter lacks the root-specific and wound-stimulated expression of the MAS promoter, showing relatively uniform root, stem, leaf, and floral activities. PMID:2102823

  4. Forced Evolution Reveals the Importance of Short Open Reading Frame A and Secondary Structure in the Cauliflower Mosaic Virus 35S RNA Leader

    PubMed Central

    Pooggin, Mikhail M.; Hohn, Thomas; Fütterer, Johannes

    1998-01-01

    Cauliflower mosaic virus pregenomic 35S RNA begins with a long leader sequence containing an extensive secondary structure and up to nine short open reading frames (sORFs), 2 to 35 codons in length. To test whether any of these sORFs are required for virus viability, their start codons were mutated either individually or in various combinations. The resulting viral mutants were tested for infectivity on mechanically inoculated turnip plants. Viable mutants were passaged several times, and the stability of the introduced mutations was analyzed by PCR amplification and sequencing. Mutations at the 5′-proximal sORF A and in the center of the leader resulted in delayed symptom development and in the appearance of revertants. In the central leader region, the predicted secondary structure, rather than the sORF organization, was restored, while true reversions or second-site substitutions in response to mutations of sORF A restored this sORF. Involvement of sORF A and secondary structure of the leader in the virus replication cycle, and especially in translation of the 35S RNA via ribosome shunting, is discussed. PMID:9557705

  5. Ribosome shunting in the cauliflower mosaic virus 35S RNA leader is a special case of reinitiation of translation functioning in plant and animal systems

    PubMed Central

    Ryabova, Lyubov A.; Hohn, Thomas

    2000-01-01

    The shunt model predicts that small ORFs (sORFs) within the cauliflower mosaic virus (CaMV) 35S RNA leader and downstream ORF VII are translated by different mechanisms, that is, scanning–reinitiation and shunting, respectively. Wheat germ extract (WGE) and rabbit reticulocyte lysate (RRL) in vitro translation systems were used to discriminate between these two processes and to study the mechanism of ribosomal shunt. In both systems, expression downstream of the leader occurred via ribosomal shunt under the control of a stable stem and a small ORF preceding it. Shunting ribosomes were also able to initiate quite efficiently at non-AUG start codons just downstream of the shunt landing site in WGE but not in RRL. The short sORF MAGDIS from the mammalian AdoMetDC RNA, which conditionally suppresses reinitiation at a downstream ORF, prevented shunting if placed at the position of sORF A, the 5′-proximal ORF of the CaMV leader. We have demonstrated directly that sORF A is translated and that proper termination of translation at the 5′-proximal ORF is absolutely required for both shunting and linear ribosome migration. These findings strongly indicate that shunting is a special case of reinitiation. PMID:10766738

  6. Real-time polymerase chain reaction detection of cauliflower mosaic virus to complement the 35S screening assay for genetically modified organisms.

    PubMed

    Cankar, Katarina; Ravnikar, Maja; Zel, Jana; Gruden, Kristina; Toplak, Natasa

    2005-01-01

    Labeling of genetically modified organisms (GMOs) is now in place in many countries, including the European Union, in order to guarantee the consumer's choice between GM and non-GM products. Screening of samples is performed by polymerase chain reaction (PCR) amplification of regulatory sequences frequently introduced into genetically modified plants. Primers for the 35S promoter from Cauliflower mosaic virus (CaMV) are those most frequently used. In virus-infected plants or in samples contaminated with plant material carrying the virus, false-positive results can consequently occur. A system for real-time PCR using a TaqMan minor groove binder probe was designed that allows recognition of virus coat protein in the sample, thus allowing differentiation between transgenic and virus-infected samples. We measured the efficiency of PCR amplification, limits of detection and quantification, range of linearity, and repeatability of the assay in order to assess the applicability of the assay for routine analysis. The specificity of the detection system was tested on various virus isolates and plant species. All 8 CaMV isolates were successfully amplified using the designed system. No cross-reactivity was detected with DNA from 3 isolates of the closely related Carnation etched ring virus. Primers do not amplify plant DNA from available genetically modified maize and soybean lines or from different species of Brassicaceae or Solanaceae that are natural hosts for CaMV. We evaluated the assay for different food matrixes by spiking CaMV DNA into DNA from food samples and have successfully amplified CaMV from all samples. The assay was tested on rapeseed samples from routine GMO testing that were positive in the 35S screening assay, and the presence of the virus was confirmed. PMID:16001857

  7. The cauliflower mosaic virus (CaMV) 35S promoter sequence alters the level and patterns of activity of adjacent tissue- and organ-specific gene promoters.

    PubMed

    Zheng, Xuelian; Deng, Wei; Luo, Keming; Duan, Hui; Chen, Yongqin; McAvoy, Richard; Song, Shuiqing; Pei, Yan; Li, Yi

    2007-08-01

    Here we report the effect of the 35S promoter sequence on activities of the tissue- and organ-specific gene promoters in tobacco plants. In the absence of the 35S promoter sequence the AAP2 promoter is active only in vascular tissues as indicated by expression of the AAP2:GUS gene. With the 35S promoter sequence in the same T-plasmid, transgenic plants exhibit twofold to fivefold increase in AAP2 promoter activity and the promoter becomes active in all tissue types. Transgenic plants hosting the ovary-specific AGL5:iaaM gene (iaaM coding an auxin biosynthetic gene) showed a wild-type phenotype except production of seedless fruits, whereas plants hosting the AGL5:iaaM gene along with the 35S promoter sequence showed drastic morphological alterations. RT-PCR analysis confirms that the phenotype was caused by activation of the AGL5:iaaM gene in non-ovary organs including roots, stems and flowers. When the pollen-, ovule- and early embryo-specific PAB5:barnase gene (barnase coding a RNase gene) was transformed, the presence of 35S promoter sequence drastically reduced transformation efficiencies. However, the transformation efficiencies were restored in the absence of 35S promoter, indicating that the 35S promoter might activate the expression of PAB5:barnase in non-reproductive organs such as calli and shoot primordia. Furthermore, if the 35S promoter sequence was replaced with the NOS promoter sequence, no alteration in AAP2, AGL5 or PAB5 promoter activities was observed. Our results demonstrate that the 35S promoter sequence can convert an adjacent tissue- and organ-specific gene promoter into a globally active promoter. PMID:17340093

  8. Cauliflower mosaic virus Transcriptome Reveals a Complex Alternative Splicing Pattern

    PubMed Central

    Bouton, Clément; Geldreich, Angèle; Ramel, Laëtitia; Ryabova, Lyubov A.; Dimitrova, Maria; Keller, Mario

    2015-01-01

    The plant pararetrovirus Cauliflower mosaic virus (CaMV) uses alternative splic-ing to generate several isoforms from its polycistronic pregenomic 35S RNA. This pro-cess has been shown to be essential for infectivity. Previous works have identified four splice donor sites and a single splice acceptor site in the 35S RNA 5’ region and sug-gested that the main role of CaMV splicing is to downregulate expression of open read-ing frames (ORFs) I and II. In this study, we show that alternative splicing is a conserved process among CaMV isolates. In Cabb B-JI and Cabb-S isolates, splicing frequently leads to different fusion between ORFs, particularly between ORF I and II. The corresponding P1P2 fusion proteins expressed in E. coli interact with viral proteins P2 and P3 in vitro. However, they are detected neither during infection nor upon transient expression in planta, which suggests rapid degradation after synthesis and no important biological role in the CaMV infectious cycle. To gain a better understanding of the functional relevance of 35S RNA alternative splicing in CaMV infectivity, we inactivated the previously described splice sites. All the splicing mutants were as pathogenic as the corresponding wild-type isolate. Through RT-PCR-based analysis we demonstrate that CaMV 35S RNA exhibits a complex splicing pattern, as we identify new splice donor and acceptor sites whose selection leads to more than thirteen 35S RNA isoforms in infected turnip plants. Inactivating splice donor or acceptor sites is not lethal for the virus, since disrupted sites are systematically rescued by the activation of cryptic and/or seldom used splice sites. Taken together, our data depict a conserved, complex and flexible process, involving multiple sites, that ensures splicing of 35S RNA. PMID:26162084

  9. A DNA polymerase activity is associated with Cauliflower Mosaic Virus.

    PubMed Central

    Menissier, J; Laquel, P; Lebeurier, G; Hirth, L

    1984-01-01

    A DNA polymerase activity is found within the Cauliflower Mosaic Virus (CaMV) particle. Analysis of the reaction product reveals that the linear form of the virion DNA is preferentially labelled. The molecular weight of the DNA polymerase as determined on an "activity gel" is 76 kDa. Images PMID:6514573

  10. Gene I, a potential cell-to-cell movement locus of cauliflower mosaic virus, encodes an RNA-binding protein

    SciTech Connect

    Citovsky, V.; Knorr, D.; Zambryski, P. )

    1991-03-15

    Cauliflower mosaic virus (CaMV) is a double-stranded DNA (dsDNA) pararetrovirus capable of cell-to-cell movement presumably through intercellular connections, the plasmodesmata, of the infected plant. This movement is likely mediated by a specific viral protein encoded by the gene I locus. Here we report that the purified gene I protein binds RNA and single-stranded DNA (ssDNA) but not dsDNA regardless of nucleotide sequence specificity. The binding is highly cooperative, and the affinity of the gene I protein for RNA is 10-fold higher than for ssDNA. CaMV replicates by reverse transcription of a 35S RNA that is homologous to the entire genome. The authors propose that the 35S RNA may be involved in cell-to-cell movement of CaMV as an intermediate that is transported through plasmodesmata as an RNA-gene I protein complex.

  11. Cauliflower mosaic virus Protein P6 Inhibits Signaling Responses to Salicylic Acid and Regulates Innate Immunity

    PubMed Central

    Love, Andrew J.; Geri, Chiara; Laird, Janet; Carr, Craig; Yun, Byung-Wook; Loake, Gary J.; Tada, Yasuomi; Sadanandom, Ari; Milner, Joel J.

    2012-01-01

    Cauliflower mosaic virus (CaMV) encodes a multifunctional protein P6 that is required for translation of the 35S RNA and also acts as a suppressor of RNA silencing. Here we demonstrate that P6 additionally acts as a pathogenicity effector of an unique and novel type, modifying NPR1 (a key regulator of salicylic acid (SA)- and jasmonic acid (JA)-dependent signaling) and inhibiting SA-dependent defence responses We find that that transgene-mediated expression of P6 in Arabidopsis and transient expression in Nicotiana benthamiana has profound effects on defence signaling, suppressing expression of representative SA-responsive genes and increasing expression of representative JA-responsive genes. Relative to wild-type Arabidopsis P6-expressing transgenics had greatly reduced expression of PR-1 following SA-treatment, infection by CaMV or inoculation with an avirulent bacterial pathogen Pseudomonas syringae pv tomato (Pst). Similarly transient expression in Nicotiana benthamiana of P6 (including a mutant form defective in translational transactivation activity) suppressed PR-1a transcript accumulation in response to Agrobacterium infiltration and following SA-treatment. As well as suppressing the expression of representative SA-regulated genes, P6-transgenic Arabidopsis showed greatly enhanced susceptibility to both virulent and avirulent Pst (titres elevated 10 to 30-fold compared to non-transgenic controls) but reduced susceptibility to the necrotrophic fungus Botrytis cinerea. Necrosis following SA-treatment or inoculation with avirulent Pst was reduced and delayed in P6-transgenics. NPR1 an important regulator of SA/JA crosstalk, was more highly expressed in the presence of P6 and introduction of the P6 transgene into a transgenic line expressing an NPR1:GFP fusion resulted in greatly increased fluorescence in nuclei even in the absence of SA. Thus in the presence of P6 an inactive form of NPR1 is mislocalized in the nucleus even in uninduced plants. These results

  12. RNA silencing of host transcripts by cauliflower mosaic virus requires coordinated action of the four Arabidopsis Dicer-like proteins.

    PubMed

    Moissiard, Guillaume; Voinnet, Olivier

    2006-12-19

    RNA silencing is an ancient mechanism of gene regulation with important antiviral roles in plants and insects. Although induction of RNA silencing by RNA viruses has been well documented in plants, the interactions between DNA viruses and the host silencing machinery remain poorly understood. We investigate this question with cauliflower mosaic virus (CaMV), a dsDNA virus that expresses its genome through the polycistronic 35S RNA, which carries an unusually extensive secondary structure known as translational leader. We show that CaMV-derived siRNAs accumulate in turnip- and Arabidopsis-infected plants and that the leader is a major, albeit not exclusive, source for those molecules. Biogenesis of leader-derived siRNA requires the coordinated and hierarchical action of the four Arabidopsis Dicer-like (DCL) proteins. Our study also uncovers a "facilitating" role exerted by the microRNA biosynthetic enzyme DCL1 on accumulation of DCL2-, DCL3-, and DCL4-dependent siRNAs derived from the 35S leader. This feature of DCL1 defines a small RNA biosynthetic pathway that might have relevance for endogenous gene regulation. Several leader-derived siRNAs were found to bear near-perfect sequence complementarity to Arabidopsis transcripts, and, using a sensor transgene, we provide direct evidence that at least one of those molecules acts as a bona fide siRNA in infected turnip. Extensive bioinformatics searches identified >100 transcripts potentially targeted by CaMV-derived siRNAs, several of which are effectively down-regulated during infection. The implications of virus-directed silencing of host gene expression are discussed. PMID:17164336

  13. Evaluation of the minimal replication time of Cauliflower mosaic virus in different hosts

    SciTech Connect

    Khelifa, Mounia; Masse, Delphine; Blanc, Stephane; Drucker, Martin

    2010-01-20

    Though the duration of a single round of replication is an important biological parameter, it has been determined for only few viruses. Here, this parameter was determined for Cauliflower mosaic virus (CaMV) in transfected protoplasts from different hosts: the highly susceptible Arabidopsis and turnip, and Nicotiana benthamiana, where CaMV accumulates only slowly. Four methods of differing sensitivity were employed: labelling of (1) progeny DNA and (2) capsid protein, (3) immunocapture PCR,, and (4) progeny-specific PCR. The first progeny virus was detected about 21 h after transfection. This value was confirmed by all methods, indicating that our estimate was not biased by the sensitivity of the detection method, and approximated the actual time required for one round of CaMV replication. Unexpectedly, the replication kinetics were similar in the three hosts; suggesting that slow accumulation of CaMV in Nicotiana plants is determined by non-optimal interactions in other steps of the infection cycle.

  14. Mapping regions of the cauliflower mosaic virus ORF III product required for infectivity.

    PubMed

    Jacquot, E; Geldreich, A; Keller, M; Yot, P

    1998-03-15

    The open reading frame (ORF) III product (PIII) of the pararetrovirus cauliflower mosaic virus (CaMV) has nucleic acid-binding properties in vitro, but its biological role is not yet determined. ORF III is closely linked to ORF II and overlaps ORF IV out of frame in the CaMV genome. A new CaMV-derived vector (Ca delta) devoid of ORF III and containing unique restriction sites between ORFs II and IV was designed. Introduction of the wild-type CaMV ORF III into Ca delta results in a clone (Ca3) infectious in turnip plants. Truncated or point-mutated versions of ORF III were then inserted into Ca delta and tested in vivo. Inoculation of the different mutants into turnip revealed that the four C-terminal amino acid residues of PIII are dispensable for infectivity as well as an internal domain (amino acids 61 to 80). Taken together the results show that PIII possesses a functional two-domain organization. Moreover, the CaMV PIII function(s) cannot be replaced either by the PIII protein of another caulimovirus, the figwort mosaic virus, or by the P2 protein of the cacao swollen shoot badnavirus, a member of the second plant pararetrovirus group. PMID:9514961

  15. A model for intracellular movement of Cauliflower mosaic virus: the concept of the mobile virion factory.

    PubMed

    Schoelz, James E; Angel, Carlos A; Nelson, Richard S; Leisner, Scott M

    2016-03-01

    The genomes of many plant viruses have a coding capacity limited to <10 proteins, yet it is becoming increasingly clear that individual plant virus proteins may interact with several targets in the host for establishment of infection. As new functions are uncovered for individual viral proteins, virologists have realized that the apparent simplicity of the virus genome is an illusion that belies the true impact that plant viruses have on host physiology. In this review, we discuss our evolving understanding of the function of the P6 protein of Cauliflower mosaic virus (CaMV), a process that was initiated nearly 35 years ago when the CaMV P6 protein was first described as the 'major inclusion body protein' (IB) present in infected plants. P6 is now referred to in most articles as the transactivator (TAV)/viroplasmin protein, because the first viral function to be characterized for the Caulimovirus P6 protein beyond its role as an inclusion body protein (the viroplasmin) was its role in translational transactivation (the TAV function). This review will discuss the currently accepted functions for P6 and then present the evidence for an entirely new function for P6 in intracellular movement. PMID:26687180

  16. Virus factories of cauliflower mosaic virus are virion reservoirs that engage actively in vector transmission.

    PubMed

    Bak, Aurélie; Gargani, Daniel; Macia, Jean-Luc; Malouvet, Enrick; Vernerey, Marie-Stéphanie; Blanc, Stéphane; Drucker, Martin

    2013-11-01

    Cauliflower mosaic virus (CaMV) forms two types of inclusion bodies within infected plant cells: numerous virus factories, which are the sites for viral replication and virion assembly, and a single transmission body (TB), which is specialized for virus transmission by aphid vectors. The TB reacts within seconds to aphid feeding on the host plant by total disruption and redistribution of its principal component, the viral transmission helper protein P2, onto microtubules throughout the cell. At the same time, virions also associate with microtubules. This redistribution of P2 and virions facilitates transmission and is reversible; the TB reforms within minutes after vector departure. Although some virions are present in the TB before disruption, their subsequent massive accumulation on the microtubule network suggests that they also are released from virus factories. Using drug treatments, mutant viruses, and exogenous supply of viral components to infected protoplasts, we show that virions can rapidly exit virus factories and, once in the cytoplasm, accumulate together with the helper protein P2 on the microtubule network. Moreover, we show that during reversion of this phenomenon, virions from the microtubule network can either be incorporated into the reverted TB or return to the virus factories. Our results suggest that CaMV factories are dynamic structures that participate in vector transmission by controlled release and uptake of virions during TB reaction. PMID:24006440

  17. Antiviral activity of tenofovir against Cauliflower mosaic virus and its metabolism in Brassica pekinensis plants.

    PubMed

    Spak, Josef; Votruba, Ivan; Pavingerová, Daniela; Holý, Antonín; Spaková, Vlastimila; Petrzik, Karel

    2011-11-01

    The antiviral effect of the acyclic nucleoside phosphonate tenofovir (R)-PMPA on double-stranded DNA Cauliflower mosaic virus (CaMV) in Brassica pekinensis plants grown in vitro on liquid medium was evaluated. Double antibody sandwich ELISA and PCR were used for relative quantification of viral protein and detecting nucleic acid in plants. (R)-PMPA at concentrations of 25 and 50 mg/l significantly reduced CaMV titers in plants within 6-9 weeks to levels detectable neither by ELISA nor by PCR. Virus-free plants were obtained after 3-month cultivation of meristem tips on semisolid medium containing 50 mg/l (R)-PMPA and their regeneration to whole plants in the greenhouse. Studying the metabolism of (R)-PMPA in B. pekinensis revealed that mono- and diphosphate, structural analogs of NDP and/or NTP, are the only metabolites formed. The data indicate very low substrate activity of the enzymes toward (R)-PMPA as substrate. The extent of phosphorylation in the plant's leaves represents only 4.5% of applied labeled (R)-PMPA. In roots, we detected no radioactive peaks of phosphorylated metabolites of (R)-PMPAp or (R)-PMPApp. PMID:21889541

  18. Hitching a ride on vesicles: cauliflower mosaic virus movement protein trafficking in the endomembrane system.

    PubMed

    Carluccio, Anna Vittoria; Zicca, Stefania; Stavolone, Livia

    2014-03-01

    The transport of a viral genome from cell to cell is enabled by movement proteins (MPs) targeting the cell periphery to mediate the gating of plasmodesmata. Given their essential role in the development of viral infection, understanding the regulation of MPs is of great importance. Here, we show that cauliflower mosaic virus (CaMV) MP contains three tyrosine-based sorting signals that interact with an Arabidopsis (Arabidopsis thaliana) μA-adaptin subunit. Fluorophore-tagged MP is incorporated into vesicles labeled with the endocytic tracer N-(3-triethylammoniumpropyl)-4-(6-(4-(diethylamino)phenyl)hexatrienyl)pyridinium dibromide. The presence of at least one of the three endocytosis motifs is essential for internalization of the protein from the plasma membrane to early endosomes, for tubule formation, and for CaMV infection. In addition, we show that MP colocalizes in vesicles with the Rab GTPase AtRAB-F2b, which is resident in prevacuolar late endosomal compartments that deliver proteins to the vacuole for degradation. Altogether, these results demonstrate that CaMV MP traffics in the endocytic pathway and that virus viability depends on functional host endomembranes. PMID:24477592

  19. Cauliflower mosaic virus produces an aspartic proteinase to cleave its polyproteins.

    PubMed

    Torruella, M; Gordon, K; Hohn, T

    1989-10-01

    Cauliflower mosaic virus (CaMV), a plant pararetrovirus, produces polyproteins from its adjacent genes for the coat protein (ORF IV) and for enzymatic functions (ORF V). The N-terminal domain of the latter gene includes a sequence showing homology to the active site of other retroviral and acid proteases. We have now shown that this domain does indeed produce a functional aspartic protease that can process both the polyproteins. Mutations in the putative active site abolished virus infectivity. In transient expression studies in protoplasts, the N-terminal domain of ORF V was able to free active CAT enzyme from a precursor containing an N-terminal fusion of a portion of ORF IV. The junction between the two domains of this artificial polyprotein comprised sequences from the ORF IV product that had previously been shown to include a proteolytic processing site. The protease mutants were not able to free active CAT enzyme from this precursor. Direct analysis of cleavage at the same site in the ORF IV product using proteins expressed in Escherichia coli revealed the expected products. In vitro translation of a synthetic transcript covering ORF V was used to study the autocatalytic cleavage of the ORF product. Pulse-chase experiments showed that the 80 kd initial translation product was processed to yield a N-terminal doublet of polypeptides of 22 and 20 kd apparent mol. wt, which cover the protease domain. The mutants in the active site were not processed. PMID:2684630

  20. A coiled-coil interaction mediates cauliflower mosaic virus cell-to-cell movement

    PubMed Central

    Stavolone, Livia; Villani, Maria Elena; Leclerc, Denis; Hohn, Thomas

    2005-01-01

    The function of the virion-associated protein (VAP) of cauliflower mosaic virus (CaMV) has long been only poorly understood. VAP is associated with the virion but is dispensable for virus morphogenesis and replication. It mediates virus transmission by aphids through simultaneous interaction with both the aphid transmission factor and the virion. However, although insect transmission is not fundamental to CaMV survival, VAP is indispensable for spreading the virus infection within the host plant. We used a GST pull-down technique to demonstrate that VAP interacts with the viral movement protein through coiled-coil domains and surface plasmon resonance to measure the interaction kinetics. We mapped the movement protein coiled-coil to the C terminus of the protein and proved that it self-assembles as a trimer. Immunogold labeling/electron microscopy revealed that the VAP and viral movement protein colocalize on CaMV particles within plasmodesmata. These results highlight the multifunctional potential of the VAP protein conferred by its efficient coiled-coil interaction system and show a plant virus possessing a surface-exposed protein (VAP) mediating viral entry into host cells. PMID:15837934

  1. A coiled-coil interaction mediates cauliflower mosaic virus cell-to-cell movement

    NASA Astrophysics Data System (ADS)

    Stavolone, Livia; Villani, Maria Elena; Leclerc, Denis; Hohn, Thomas

    2005-04-01

    The function of the virion-associated protein (VAP) of cauliflower mosaic virus (CaMV) has long been only poorly understood. VAP is associated with the virion but is dispensable for virus morphogenesis and replication. It mediates virus transmission by aphids through simultaneous interaction with both the aphid transmission factor and the virion. However, although insect transmission is not fundamental to CaMV survival, VAP is indispensable for spreading the virus infection within the host plant. We used a GST pull-down technique to demonstrate that VAP interacts with the viral movement protein through coiled-coil domains and surface plasmon resonance to measure the interaction kinetics. We mapped the movement protein coiled-coil to the C terminus of the protein and proved that it self-assembles as a trimer. Immunogold labeling/electron microscopy revealed that the VAP and viral movement protein colocalize on CaMV particles within plasmodesmata. These results highlight the multifunctional potential of the VAP protein conferred by its efficient coiled-coil interaction system and show a plant virus possessing a surface-exposed protein (VAP) mediating viral entry into host cells. movement protein | virion-associated protein | Biacore

  2. Biological and molecular variation of Iranian Cauliflower mosaic virus (CaMV) isolates.

    PubMed

    Farzadfar, Shirin; Pourrahim, Reza

    2013-10-01

    Seventeen provinces of Iran were surveyed during 2003-2012 to find Brassicaceae hosts of Cauliflower mosaic virus (CaMV). A total 397 samples were collected from plants with virus-like symptoms. Among those tested by ELISA, 255 samples (67.2 %) were found to be infected with CaMV. Mechanical transmission tests showed that the Iranian isolates have similar biological properties on a number of Brassica and Raphanus plant species and cultivars tested. However, the isolates varied in the severity of symptoms they induced and in the capacity to infect B. oleracea var. capitata, on the basis of which they were grouped into two distinct biotypes L/MMo (latent/mild mottle) and severe (S) infection. The molecular diversity of natural population of CaMV were investigated based on the complete sequences of OFR 6 of 36 Iranian isolates collected from different geographically distant regions in Iran alongside the sequences of 14 previously reported isolates. Phylogenetic analyses indicated that the Iranian CaMV isolates belong to two groups (GI and GII). Most of the Iranian isolates fell into GI with other exotic isolates; however, the isolates from North-East Iran with Xinjiang from China fell into GII. The phylogenetic group GII (the North-East Iranian isolates) closely corresponded to the S biological group however other Iranian isolates corresponded to the L/MMo biological group. The within-population diversity was lower than the between population diversity suggesting the contribution of a founder effect on diversification of CaMV isolates. The Iranian isolates were differentiated from other exotic CaMV isolates and clustered into two RFLP groups using Hpy99I which closely corresponded to the biological and phylogenetic groups. This study showed the evolutionary process in CaMV isolates is shaped by a combination of host range differentiation and nucleotide substitution using the approach of population genetics. PMID:23828619

  3. The Temporal Evolution and Global Spread of Cauliflower mosaic virus, a Plant Pararetrovirus

    PubMed Central

    Ho, Simon Y. W.; Duchêne, Sebastián; Korkmaz, Savas; Katis, Nikolaos; Takahashi, Hideki; Gibbs, Adrian J.; Ohshima, Kazusato

    2014-01-01

    Cauliflower mosaic virus (CaMV) is a plant pararetrovirus with a double-stranded DNA genome. It is the type member of the genus Caulimovirus in the family Caulimoviridae. CaMV is transmitted by sap inoculation and in nature by aphids in a semi-persistent manner. To investigate the patterns and timescale of CaMV migration and evolution, we sequenced and analyzed the genomes of 67 isolates of CaMV collected mostly in Greece, Iran, Turkey, and Japan together with nine published sequences. We identified the open-reading frames (ORFs) in the genomes and inferred their phylogeny. After removing recombinant sequences, we estimated the substitution rates, divergence times, and phylogeographic patterns of the virus populations. We found that recombination has been a common feature of CaMV evolution, and that ORFs I–V have a different evolutionary history from ORF VI. The ORFs have evolved at rates between 1.71 and 5.81×10−4 substitutions/site/year, similar to those of viruses with RNA or ssDNA genomes. We found four geographically confined lineages. CaMV probably spread from a single population to other parts of the world around 400–500 years ago, and is now widely distributed among Eurasian countries. Our results revealed evidence of frequent gene flow between populations in Turkey and those of its neighboring countries, with similar patterns observed for Japan and the USA. Our study represents the first report on the spatial and temporal spread of a plant pararetrovirus. PMID:24465629

  4. The temporal evolution and global spread of Cauliflower mosaic virus, a plant pararetrovirus.

    PubMed

    Yasaka, Ryosuke; Nguyen, Huy D; Ho, Simon Y W; Duchêne, Sebastián; Korkmaz, Savas; Katis, Nikolaos; Takahashi, Hideki; Gibbs, Adrian J; Ohshima, Kazusato

    2014-01-01

    Cauliflower mosaic virus (CaMV) is a plant pararetrovirus with a double-stranded DNA genome. It is the type member of the genus Caulimovirus in the family Caulimoviridae. CaMV is transmitted by sap inoculation and in nature by aphids in a semi-persistent manner. To investigate the patterns and timescale of CaMV migration and evolution, we sequenced and analyzed the genomes of 67 isolates of CaMV collected mostly in Greece, Iran, Turkey, and Japan together with nine published sequences. We identified the open-reading frames (ORFs) in the genomes and inferred their phylogeny. After removing recombinant sequences, we estimated the substitution rates, divergence times, and phylogeographic patterns of the virus populations. We found that recombination has been a common feature of CaMV evolution, and that ORFs I-V have a different evolutionary history from ORF VI. The ORFs have evolved at rates between 1.71 and 5.81×10(-4) substitutions/site/year, similar to those of viruses with RNA or ssDNA genomes. We found four geographically confined lineages. CaMV probably spread from a single population to other parts of the world around 400-500 years ago, and is now widely distributed among Eurasian countries. Our results revealed evidence of frequent gene flow between populations in Turkey and those of its neighboring countries, with similar patterns observed for Japan and the USA. Our study represents the first report on the spatial and temporal spread of a plant pararetrovirus. PMID:24465629

  5. Both the constitutive Cauliflower Mosaic Virus 35S and tissue-specific AGAMOUS enhancers activate transcription autonomously in Arabidopsis thaliana

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The presence of multiple enhancers and promoters within a single vector often provokes complicated mutual interaction and crosstalk, thereby, altering promoter specificity, which causes serious problems for precisely engineering gene function and agronomic traits in transgenic plants. Enhancer elem...

  6. Association of the P6 protein of Cauliflower mosaic virus with plasmodesmata and plasmodesmal proteins.

    PubMed

    Rodriguez, Andres; Angel, Carlos A; Lutz, Lindy; Leisner, Scott M; Nelson, Richard S; Schoelz, James E

    2014-11-01

    The P6 protein of Cauliflower mosaic virus (CaMV) is responsible for the formation of inclusion bodies (IBs), which are the sites for viral gene expression, replication, and virion assembly. Moreover, recent evidence indicates that ectopically expressed P6 inclusion-like bodies (I-LBs) move in association with actin microfilaments. Because CaMV virions accumulate preferentially in P6 IBs, we hypothesized that P6 IBs have a role in delivering CaMV virions to the plasmodesmata. We have determined that the P6 protein interacts with a C2 calcium-dependent membrane-targeting protein (designated Arabidopsis [Arabidopsis thaliana] Soybean Response to Cold [AtSRC2.2]) in a yeast (Saccharomyces cerevisiae) two-hybrid screen and have confirmed this interaction through coimmunoprecipitation and colocalization assays in the CaMV host Nicotiana benthamiana. An AtSRC2.2 protein fused to red fluorescent protein (RFP) was localized to the plasma membrane and specifically associated with plasmodesmata. The AtSRC2.2-RFP fusion also colocalized with two proteins previously shown to associate with plasmodesmata: the host protein Plasmodesmata-Localized Protein1 (PDLP1) and the CaMV movement protein (MP). Because P6 I-LBs colocalized with AtSRC2.2 and the P6 protein had previously been shown to interact with CaMV MP, we investigated whether P6 I-LBs might also be associated with plasmodesmata. We examined the colocalization of P6-RFP I-LBs with PDLP1-green fluorescent protein (GFP) and aniline blue (a stain for callose normally observed at plasmodesmata) and found that P6-RFP I-LBs were associated with each of these markers. Furthermore, P6-RFP coimmunoprecipitated with PDLP1-GFP. Our evidence that a portion of P6-GFP I-LBs associate with AtSRC2.2 and PDLP1 at plasmodesmata supports a model in which P6 IBs function to transfer CaMV virions directly to MP at the plasmodesmata. PMID:25239023

  7. Unconventional P-35S sequence identified in genetically modified maize.

    PubMed

    Al-Hmoud, Nisreen; Al-Husseini, Nawar; Ibrahim-Alobaide, Mohammed A; Kübler, Eric; Farfoura, Mahmoud; Alobydi, Hytham; Al-Rousan, Hiyam

    2014-01-01

    The Cauliflower Mosaic Virus 35S promoter sequence, CaMV P-35S, is one of several commonly used genetic targets to detect genetically modified maize and is found in most GMOs. In this research we report the finding of an alternative P-35S sequence and its incidence in GM maize marketed in Jordan. The primer pair normally used to amplify a 123 bp DNA fragment of the CaMV P-35S promoter in GMOs also amplified a previously undetected alternative sequence of CaMV P-35S in GM maize samples which we term V3. The amplified V3 sequence comprises 386 base pairs and was not found in the standard wild-type maize, MON810 and MON 863 GM maize. The identified GM maize samples carrying the V3 sequence were found free of CaMV when compared with CaMV infected brown mustard sample. The data of sequence alignment analysis of the V3 genetic element showed 90% similarity with the matching P-35S sequence of the cauliflower mosaic virus isolate CabbB-JI and 99% similarity with matching P-35S sequences found in several binary plant vectors, of which the binary vector locus JQ693018 is one example. The current study showed an increase of 44% in the incidence of the identified 386 bp sequence in GM maize sold in Jordan's markets during the period 2009 and 2012. PMID:24495911

  8. Analysis of cis-sequence of subgenomic transcript promoter from the Figwort mosaic virus and comparison of promoter activity with the cauliflower mosaic virus promoters in monocot and dicot cells.

    PubMed

    Bhattacharyya, Somnath; Dey, Nrisingha; Maiti, Indu B

    2002-12-01

    A sub-genomic transcript (Sgt) promoter was isolated from the Figwort mosaic virus (FMV) genomic clone. The FMV Sgt promoter was linked to heterologous coding sequences to form a chimeric gene construct. The 5'-3'-boundaries required for maximal activity and involvement of cis-sequences for optimal expression in plants were defined by 5'-, 3'-end deletion and internal deletion analysis of FMV Sgt promoter fragments coupled with a beta-glucuronidase reporter gene in both transient protoplast expression experiments and in transgenic plants. A 301 bp FMV Sgt promoter fragment (sequence -270 to +31 from the transcription start site; TSS) provided maximum promoter activity. The TSS of the FMV Sgt promoter was determined by primer extension analysis using total RNA from transgenic plants developed for FMV Sgt promoter: uidA fusion gene. An activator domain located upstream of the TATA box at -70 to -100 from TSS is absolutely required for promoter activity and its function is critically position-dependent with respect to TATA box. Two sequence motifs AGATTTTAAT (coordinates -100 to -91) and GTAAGCGC (coordinates -80 to -73) were found to be essential for promoter activity. The FMV Sgt promoter is less active in monocot cells; FMV Sgt promoter expression level was about 27.5-fold higher in tobacco cells compared to that in maize cells. Comparative expression analysis of FMV Sgt promoter with cauliflower mosaic virus (CaMV) 35S promoter showed that the FMV Sgt promoter is about 2-fold stronger than the CaMV 35S promoter. The FMV Sgt promoter is a constitutive promoter; expression level in seedlings was in the order: root>leaf>stem. PMID:12457962

  9. The Cauliflower Mosaic Virus Protein P6 Forms Motile Inclusions That Traffic along Actin Microfilaments and Stabilize Microtubules1[W][OA

    PubMed Central

    Harries, Phillip A.; Palanichelvam, Karuppaiah; Yu, Weichang; Schoelz, James E.; Nelson, Richard S.

    2009-01-01

    The gene VI product (P6) of Cauliflower mosaic virus (CaMV) is a multifunctional protein known to be a major component of cytoplasmic inclusion bodies formed during CaMV infection. Although these inclusions are known to contain virions and are thought to be sites of translation from the CaMV 35S polycistronic RNA intermediate, the precise role of these bodies in the CaMV infection cycle remains unclear. Here, we examine the functionality and intracellular location of a fusion between P6 and GFP (P6-GFP). We initially show that the ability of P6-GFP to transactivate translation is comparable to unmodified P6. Consequently, our work has direct application for the large body of literature in which P6 has been expressed ectopically and its functions characterized. We subsequently found that P6-GFP forms highly motile cytoplasmic inclusion bodies and revealed through fluorescence colocalization studies that these P6-GFP bodies associate with the actin/endoplasmic reticulum network as well as microtubules. We demonstrate that while P6-GFP inclusions traffic along microfilaments, those associated with microtubules appear stationary. Additionally, inhibitor studies reveal that the intracellular movement of P6-GFP inclusions is sensitive to the actin inhibitor, latrunculin B, which also inhibits the formation of local lesions by CaMV in Nicotiana edwardsonii leaves. The motility of P6 along microfilaments represents an entirely new property for this protein, and these results imply a role for P6 in intracellular and cell-to-cell movement of CaMV. PMID:19028879

  10. Site-specific deletion in cauliflower mosaic virus DNA: possible involvement of RNA splicing and reverse transcription

    PubMed Central

    Hirochika, Hirohiko; Takatsuji, Hiroshi; Ubasawa, Aiko; Ikeda, Joh-E

    1985-01-01

    A frequent site-specific deletion was observed in the life cycle of cauliflower mosaic virus (S strain). Analysis of the sequence around the deletion site and the parental sequence implied that the deletion was promoted at sequences similar to the donor and acceptor consensus sequences of RNA splicing, designated as the deletion donor and acceptor sequences, respectively. To elucidate the mechanism of this site-specific deletion, point mutations were introduced into the deletion donor sequence (GT to GG or GA transversion). Deletion at the original deletion donor site did not occur in these mutants, instead, new (cryptic) donor sites were activated. All of these activated cryptic sites had sequences similar to the splicing consensus sequence. In all cases except one, the original deletion acceptor site was used. These results can be most readily explained by postulating that the site-specific deletion occurs by reverse transcription of spliced viral RNA. This frequent site-specific deletion was not observed in other strains. For a virus which replicates by reverse transcription, a mechanism to regulate the rate of splicing is required to ensure the intactness of the viral genome. We discuss the possibility that the S strain has a mutation in this regulatory mechanism. ImagesFig. 1.Fig. 3.Fig. 5.Fig. 7. PMID:16453624

  11. Hitching a Ride on Vesicles: Cauliflower Mosaic Virus Movement Protein Trafficking in the Endomembrane System1[W][OPEN

    PubMed Central

    Carluccio, Anna Vittoria; Zicca, Stefania; Stavolone, Livia

    2014-01-01

    The transport of a viral genome from cell to cell is enabled by movement proteins (MPs) targeting the cell periphery to mediate the gating of plasmodesmata. Given their essential role in the development of viral infection, understanding the regulation of MPs is of great importance. Here, we show that cauliflower mosaic virus (CaMV) MP contains three tyrosine-based sorting signals that interact with an Arabidopsis (Arabidopsis thaliana) μA-adaptin subunit. Fluorophore-tagged MP is incorporated into vesicles labeled with the endocytic tracer N-(3-triethylammoniumpropyl)-4-(6-(4-(diethylamino)phenyl)hexatrienyl)pyridinium dibromide. The presence of at least one of the three endocytosis motifs is essential for internalization of the protein from the plasma membrane to early endosomes, for tubule formation, and for CaMV infection. In addition, we show that MP colocalizes in vesicles with the Rab GTPase AtRAB-F2b, which is resident in prevacuolar late endosomal compartments that deliver proteins to the vacuole for degradation. Altogether, these results demonstrate that CaMV MP traffics in the endocytic pathway and that virus viability depends on functional host endomembranes. PMID:24477592

  12. A role for plant microtubules in the formation of transmission-specific inclusion bodies of Cauliflower mosaic virus.

    PubMed

    Martinière, Alexandre; Gargani, Daniel; Uzest, Marilyne; Lautredou, Nicole; Blanc, Stéphane; Drucker, Martin

    2009-04-01

    Interactions between microtubules and viruses play important roles in viral infection. The best-characterized examples involve transport of animal viruses by microtubules to the nucleus or other intracellular destinations. In plant viruses, most work to date has focused on interaction between viral movement proteins and the cytoskeleton, which is thought to be involved in viral cell-to-cell spread. We show here, in Cauliflower mosaic virus (CaMV)-infected plant cells, that viral electron-lucent inclusion bodies (ELIBs), whose only known function is vector transmission, require intact microtubules for their efficient formation. The kinetics of the formation of CaMV-related inclusion bodies in transfected protoplasts showed that ELIBs represent newly emerging structures, appearing at late stages of the intracellular viral life cycle. Viral proteins P2 and P3 are first produced in multiple electron-dense inclusion bodies, and are later specifically exported to transiently co-localize with microtubules, before concentrating in a single, massive ELIB in each infected cell. Treatments with cytoskeleton-affecting drugs suggested that P2 and P3 might be actively transported on microtubules, by as yet unknown motors. In addition to providing information on the intracellular life cycle of CaMV, our results show that specific interactions between host cell and virus may be dedicated to a later role in vector transmission. More generally, they indicate a new unexpected function for plant cell microtubules in the virus life cycle, demonstrating that microtubules act not only on immediate intracellular or intra-host phenomena, but also on processes ultimately controlling inter-host transmission. PMID:19077170

  13. A phylogeographical study of the cauliflower mosaic virus population in mid-Eurasia Iran using complete genome analysis.

    PubMed

    Farzadfar, Shirin; Pourrahim, Reza; Ebrahimi, Hassan

    2014-06-01

    The full-length sequences of 34 Iranian cauliflower mosaic virus (CaMV) isolates were compared with others from public nucleotide sequence databases to provide a comprehensive overview of the genetic variability and patterns of genetic exchange in CaMV isolates from Iran. Based on the severity of symptoms and their ability to infect Brassica oleracea var. capitata, Iranian CaMV isolates were grouped into two distinct biotypes: latent/mild mottle (LI/MMo) and severe (S) infection. Recombination breakpoints were detected between the large intergenic region (LIR) and open reading frame (ORF) V (event 2); between ORF VII and ORF II (event 3), between ORF I and ORF III (event 4), and within ORF VI (event 1). Phylogenetic analysis indicated that Iranian CaMV isolates clustered into two subgroups belonging to group I (GI) that were distinct from North American and European isolates from group II (GII). Northeast Iranian isolates (subgroup B) and CaMV isolates from subgroup A closely corresponded to the S and LI/MMo biological groups, respectively. Genome-wide pairwise identity analysis of the CaMV isolates revealed three regions of pairwise identity representation: 92-94 % for GII and 94-96 % and 98-100 % for subgroups A and B. The within-population diversity was lower than the between-population diversity, suggesting the contribution of a founder effect on diversification of CaMV isolates. Amino acid sequences were conserved, with ω values ranging from 0.074 to 0.717 in different proteins. Thirteen amino acids in the deduced proteins of ORFs I, II, III, VI and VII were under positive selection (ω > 1), whereas purifying selection applied to the proteins encoded by ORFs IV and V. This study suggests that variation in the CaMV population can be explained by host-range differentiation and selection pressure. Moreover, recombination analysis revealed that a genomic exchange is responsible for the emergence of CaMV strains, providing valuable new information for

  14. Association of the P6 Protein of Cauliflower mosaic virus with Plasmodesmata and Plasmodesmal Proteins1[W][OPEN

    PubMed Central

    Rodriguez, Andres; Angel, Carlos A.; Lutz, Lindy; Leisner, Scott M.; Nelson, Richard S.; Schoelz, James E.

    2014-01-01

    The P6 protein of Cauliflower mosaic virus (CaMV) is responsible for the formation of inclusion bodies (IBs), which are the sites for viral gene expression, replication, and virion assembly. Moreover, recent evidence indicates that ectopically expressed P6 inclusion-like bodies (I-LBs) move in association with actin microfilaments. Because CaMV virions accumulate preferentially in P6 IBs, we hypothesized that P6 IBs have a role in delivering CaMV virions to the plasmodesmata. We have determined that the P6 protein interacts with a C2 calcium-dependent membrane-targeting protein (designated Arabidopsis [Arabidopsis thaliana] Soybean Response to Cold [AtSRC2.2]) in a yeast (Saccharomyces cerevisiae) two-hybrid screen and have confirmed this interaction through coimmunoprecipitation and colocalization assays in the CaMV host Nicotiana benthamiana. An AtSRC2.2 protein fused to red fluorescent protein (RFP) was localized to the plasma membrane and specifically associated with plasmodesmata. The AtSRC2.2-RFP fusion also colocalized with two proteins previously shown to associate with plasmodesmata: the host protein Plasmodesmata-Localized Protein1 (PDLP1) and the CaMV movement protein (MP). Because P6 I-LBs colocalized with AtSRC2.2 and the P6 protein had previously been shown to interact with CaMV MP, we investigated whether P6 I-LBs might also be associated with plasmodesmata. We examined the colocalization of P6-RFP I-LBs with PDLP1-green fluorescent protein (GFP) and aniline blue (a stain for callose normally observed at plasmodesmata) and found that P6-RFP I-LBs were associated with each of these markers. Furthermore, P6-RFP coimmunoprecipitated with PDLP1-GFP. Our evidence that a portion of P6-GFP I-LBs associate with AtSRC2.2 and PDLP1 at plasmodesmata supports a model in which P6 IBs function to transfer CaMV virions directly to MP at the plasmodesmata. PMID:25239023

  15. Cauliflower Ear

    MedlinePlus

    ... Here's Help White House Lunch Recipes What's Cauliflower Ear? KidsHealth > For Kids > What's Cauliflower Ear? Print A A A Text Size Have you ever seen someone whose ear looks bumpy and lumpy? The person might have ...

  16. Reduction of leaf area and symptom severity as proxies of disease-induced plant mortality: the example of the Cauliflower mosaic virus infecting two Brassicaceae hosts.

    PubMed

    Doumayrou, Juliette; Leblaye, Sophie; Froissart, Rémy; Michalakis, Yannis

    2013-09-01

    Disease induced effects on host survival are important to understand the evolution of parasitic virulence and host resistance/tolerance. Unfortunately, experiments evaluating such effects are in most cases logistically demanding justifying the measurement of survival proxies. For plant hosts commonly used proxies are leaf area and the nature and severity of visual qualitative disease symptoms. In this study we tested whether these traits are indeed correlated to the host mortality rate induced by viral infection. We infected Brassica rapa and Arabidopsis thaliana plants with different natural isolates of Cauliflower mosaic virus (CaMV) and estimated over time the development of symptoms and the relative reduction of leaf area compared to healthy plants and followed plant mortality. We observed that the mortality of infected plants was correlated with the relative reduction of leaf area of both B. rapa and A. thaliana. Measures of mortality were also correlated with the severity of visual qualitative symptoms but the magnitude of the correlations and the time frame at which they were significant depended on the host plant: stronger and earlier correlations were observed on A. thaliana. PMID:23742852

  17. Development and Validation of a P-35S, T-nos, T-35S and P-FMV Tetraplex Real-time PCR Screening Method to Detect Regulatory Genes of Genetically Modified Organisms in Food.

    PubMed

    Eugster, Albert; Murmann, Petra; Kaenzig, Andre; Breitenmoser, Alda

    2014-10-01

    In routine analysis screening methods based on real-time PCR (polymerase chain reaction) are most commonly used for the detection of genetically modified (GM) plant material in food and feed. Screening tests are based on sequences frequently used for GM development, allowing the detection of a large number of GMOs (genetically modified organisms). Here, we describe the development and validation of a tetraplex real-time PCR screening assay comprising detection systems for the regulatory genes Cauliflower Mosaic Virus 35S promoter, Agrobacterium tumefaciens nos terminator, Cauliflower Mosaic Virus 35S terminator and Figwort Mosaic Virus 34S promoter. Three of the four primer and probe combinations have already been published elsewhere, whereas primers and probe for the 35S terminator have been developed in-house. Adjustment of primer and probe concentrations revealed a high PCR sensitivity with insignificant physical cross-talk between the four detection channels. The sensitivity of each PCR-system is sufficient to detect a GMO concentration as low as 0.05% of the containing respective element. The specificity of the described tetraplex is high when tested on DNA from GM maize, soy, rapeseed and tomato. We also demonstrate the robustness of the system by inter-laboratory tests. In conclusion, this method provides a sensitive and reliable screening procedure for the detection of the most frequently used regulatory elements present in GM crops either authorised or unauthorised for food. PMID:25437161

  18. Cauliflower mosaic virus gene VI product N-terminus contains regions involved in resistance-breakage, self-association and interactions with movement protein

    PubMed Central

    Hapiak, Michael; Li, Yongzhong; Agama, Keli; Swade, Shaddy; Okenka, Genevieve; Falk, Jessica; Khandekar, Sushant; Raikhy, Gaurav; Anderson, Alisha; Pollock, Justin; Zellner, Wendy; Schoelz, James; Leisner, Scott M.

    2008-01-01

    Cauliflower mosaic virus (CaMV) gene VI encodes a multifunctional protein (P6) involved in the translation of viral RNA, the formation of inclusion bodies, and the determination of host range. Arabidopsis thaliana ecotype Tsu-0 prevents the systemic spread of most CaMV isolates, including CM1841. However, CaMV isolate W260 overcomes this resistance. In this paper, the N-terminal 110 amino acids of P6 (termed D1) were identified as the resistance-breaking region. D1 also bound full-length P6. Furthermore, binding of W260 D1 to P6 induced higher β-galactosidase activity and better leucine-independent growth in the yeast two-hybrid system than its CM1841 counterpart. Thus, W260 may evade Tsu-0 resistance by mediating P6 self-association in a manner different from that of CM1841. Because Tsu-0 resistance prevents virus movement, interaction of P6 with P1 (CaMV movement protein) was investigated. Both yeast two-hybrid analyses and maltose-binding protein pull-down experiments show that P6 interacts with P1. Although neither half of P1 interacts with P6, the N-terminus of P6 binds P1. Interestingly, D1 by itself does not interact with P1, indicating that different portions of the P6 N-terminus are involved in different activities. The P1-P6 interactions suggest a role for P6 in virus transport, possibly by regulating P1 tubule formation or the assembly of movement complexes. PMID:18851998

  19. Identification of the domains of cauliflower mosaic virus protein P6 responsible for suppression of RNA silencing and salicylic acid signalling

    PubMed Central

    Laird, Janet; McInally, Carol; Carr, Craig; Doddiah, Sowjanya; Yates, Gary; Chrysanthou, Elina; Khattab, Ahmed; Love, Andrew J.; Geri, Chiara; Sadanandom, Ari; Smith, Brian O.; Kobayashi, Kappei

    2013-01-01

    Cauliflower mosaic virus (CaMV) encodes a 520 aa polypeptide, P6, which participates in several essential activities in the virus life cycle including suppressing RNA silencing and salicylic acid-responsive defence signalling. We infected Arabidopsis with CaMV mutants containing short in-frame deletions within the P6 ORF. A deletion in the distal end of domain D-I (the N-terminal 112 aa) of P6 did not affect virus replication but compromised symptom development and curtailed the ability to restore GFP fluorescence in a GFP-silenced transgenic Arabidopsis line. A deletion in the minimum transactivator domain was defective in virus replication but retained the capacity to suppress RNA silencing locally. Symptom expression in CaMV-infected plants is apparently linked to the ability to suppress RNA silencing. When transiently co-expressed with tomato bushy stunt virus P19, an elicitor of programmed cell death in Nicotiana tabacum, WT P6 suppressed the hypersensitive response, but three mutants, two with deletions within the distal end of domain D-I and one involving the N-terminal nuclear export signal (NES), were unable to do so. Deleting the N-terminal 20 aa also abolished the suppression of pathogen-associated molecular pattern-dependent PR1a expression following agroinfiltration. However, the two other deletions in domain D-I retained this activity, evidence that the mechanisms underlying these functions are not identical. The D-I domain of P6 when expressed alone failed to suppress either cell death or PR1a expression and is therefore necessary but not sufficient for all three defence suppression activities. Consequently, concerns about the biosafety of genetically modified crops carrying truncated ORFVI sequences appear unfounded. PMID:24088344

  20. Development of a general method for detection and quantification of the P35S promoter based on assessment of existing methods

    PubMed Central

    Wu, Yuhua; Wang, Yulei; Li, Jun; Li, Wei; Zhang, Li; Li, Yunjing; Li, Xiaofei; Li, Jun; Zhu, Li; Wu, Gang

    2014-01-01

    The Cauliflower mosaic virus (CaMV) 35S promoter (P35S) is a commonly used target for detection of genetically modified organisms (GMOs). There are currently 24 reported detection methods, targeting different regions of the P35S promoter. Initial assessment revealed that due to the absence of primer binding sites in the P35S sequence, 19 of the 24 reported methods failed to detect P35S in MON88913 cotton, and the other two methods could only be applied to certain GMOs. The rest three reported methods were not suitable for measurement of P35S in some testing events, because SNPs in binding sites of the primer/probe would result in abnormal amplification plots and poor linear regression parameters. In this study, we discovered a conserved region in the P35S sequence through sequencing of P35S promoters from multiple transgenic events, and developed new qualitative and quantitative detection systems targeting this conserved region. The qualitative PCR could detect the P35S promoter in 23 unique GMO events with high specificity and sensitivity. The quantitative method was suitable for measurement of P35S promoter, exhibiting good agreement between the amount of template and Ct values for each testing event. This study provides a general P35S screening method, with greater coverage than existing methods. PMID:25483893

  1. Development of a general method for detection and quantification of the P35S promoter based on assessment of existing methods.

    PubMed

    Wu, Yuhua; Wang, Yulei; Li, Jun; Li, Wei; Zhang, Li; Li, Yunjing; Li, Xiaofei; Li, Jun; Zhu, Li; Wu, Gang

    2014-01-01

    The Cauliflower mosaic virus (CaMV) 35S promoter (P35S) is a commonly used target for detection of genetically modified organisms (GMOs). There are currently 24 reported detection methods, targeting different regions of the P35S promoter. Initial assessment revealed that due to the absence of primer binding sites in the P35S sequence, 19 of the 24 reported methods failed to detect P35S in MON88913 cotton, and the other two methods could only be applied to certain GMOs. The rest three reported methods were not suitable for measurement of P35S in some testing events, because SNPs in binding sites of the primer/probe would result in abnormal amplification plots and poor linear regression parameters. In this study, we discovered a conserved region in the P35S sequence through sequencing of P35S promoters from multiple transgenic events, and developed new qualitative and quantitative detection systems targeting this conserved region. The qualitative PCR could detect the P35S promoter in 23 unique GMO events with high specificity and sensitivity. The quantitative method was suitable for measurement of P35S promoter, exhibiting good agreement between the amount of template and Ct values for each testing event. This study provides a general P35S screening method, with greater coverage than existing methods. PMID:25483893

  2. Consistent transcriptional silencing of 35S-driven transgenes in gentian.

    PubMed

    Mishiba, Kei-ichiro; Nishihara, Masahiro; Nakatsuka, Takashi; Abe, Yoshiko; Hirano, Hiroshi; Yokoi, Takahide; Kikuchi, Akiko; Yamamura, Saburo

    2005-11-01

    In this study, no transgenic gentian (Gentiana triflora x Gentiana scabra) plants produced via Agrobacterium-mediated transformation exhibited transgene (GtMADS, gentian-derived MADS-box genes or sGFP, green fluorescent protein) expression in their leaf tissues, despite the use of constitutive Cauliflower mosaic virus (CaMV) 35S promoter. Strikingly, no expression of the selectable marker gene (bar) used for bialaphos selection was observed. To investigate the possible cause of this drastic transgene silencing, methylation-specific sequences were analysed by bisulfite genomic sequencing using tobacco transformants as a control. Highly methylated cytosine residues of CpG and CpWpG (W contains A or T) sites were distinctively detected in the promoter and 5' coding regions of the transgenes 35S-bar and 35S-GtMADS in all gentian lines analysed. These lines also exhibited various degrees of cytosine methylation in asymmetrical sequences. The methylation frequencies in the other transgene, nopaline synthase (NOS) promoter-driven nptII, and the endogenous GtMADS gene coding region, were much lower and were variable compared with those in the 35S promoter regions. Transgene methylation was observed in the bialaphos-selected transgenic calluses expressing the transgenes, and methylation sequences were distributed preferentially around the as-1 element in the 35S promoter. Calluses derived from leaf tissues of silenced transgenic gentian also exhibited transgene suppression, but expression was recovered by treatment with the methylation inhibitor 5-aza-2'-deoxycytidine (aza-dC). These results indicated that cytosine methylation occurs exclusively in the 35S promoter regions of the expressed transgenes during selection of gentian transformants, causing transcriptional gene silencing. PMID:16262705

  3. Possible consequences of the overlap between the CaMV 35S promoter regions in plant transformation vectors used and the viral gene VI in transgenic plants.

    PubMed

    Podevin, Nancy; du Jardin, Patrick

    2012-01-01

    Multiple variants of the Cauliflower mosaic virus 35S promoter (P35S) are used to drive the expression of transgenes in genetically modified plants, for both research purposes and commercial applications. The genetic organization of the densely packed genome of this virus results in sequence overlap between P35S and viral gene VI, encoding the multifunctional P6 protein. The present paper investigates whether introduction of P35S variants by genetic transformation is likely to result in the expression of functional domains of the P6 protein and in potential impacts in transgenic plants. A bioinformatic analysis was performed to assess the safety for human and animal health of putative translation products of gene VI overlapping P35S. No relevant similarity was identified between the putative peptides and known allergens and toxins, using different databases. From a literature study it became clear that long variants of the P35S do contain an open reading frame, when expressed, might result in unintended phenotypic changes. A flowchart is proposed to evaluate possible unintended effects in plant transformants, based on the DNA sequence actually introduced and on the plant phenotype, taking into account the known effects of ectopically expressed P6 domains in model plants. PMID:22892689

  4. Mosaicism

    MedlinePlus

    ... A diagnosis of mosaicism may cause confusion and uncertainty. A genetic counselor may help answer any questions ... member of Hi-Ethics and subscribes to the principles of the Health on the Net Foundation (www. ...

  5. Aggregates, broccoli and cauliflower

    NASA Astrophysics Data System (ADS)

    Grey, Francois; Kjems, Jørgen K.

    1989-09-01

    Naturally grown structures with fractal characters like broccoli and cauliflower are discussed and compared with DLA-type aggregates. It is suggested that the branching density can be used to characterize the growth process and an experimental method to determine this parameter is proposed.

  6. Detection of nonauthorized genetically modified organisms using differential quantitative polymerase chain reaction: application to 35S in maize.

    PubMed

    Cankar, Katarina; Chauvensy-Ancel, Valérie; Fortabat, Marie-Noelle; Gruden, Kristina; Kobilinsky, André; Zel, Jana; Bertheau, Yves

    2008-05-15

    Detection of nonauthorized genetically modified organisms (GMOs) has always presented an analytical challenge because the complete sequence data needed to detect them are generally unavailable although sequence similarity to known GMOs can be expected. A new approach, differential quantitative polymerase chain reaction (PCR), for detection of nonauthorized GMOs is presented here. This method is based on the presence of several common elements (e.g., promoter, genes of interest) in different GMOs. A statistical model was developed to study the difference between the number of molecules of such a common sequence and the number of molecules identifying the approved GMO (as determined by border-fragment-based PCR) and the donor organism of the common sequence. When this difference differs statistically from zero, the presence of a nonauthorized GMO can be inferred. The interest and scope of such an approach were tested on a case study of different proportions of genetically modified maize events, with the P35S promoter as the Cauliflower Mosaic Virus common sequence. The presence of a nonauthorized GMO was successfully detected in the mixtures analyzed and in the presence of (donor organism of P35S promoter). This method could be easily transposed to other common GMO sequences and other species and is applicable to other detection areas such as microbiology. PMID:18346452

  7. Acute but not chronic exposure to abiotic stress results in transient reduction of expression levels of the transgene driven by the 35S promoter.

    PubMed

    Boyko, Alex; Molinier, Jean; Chatter, Waine; Laroche, André; Kovalchuk, Igor

    2010-02-28

    The transgenic plant performance depends on the stable expression of the integrated transgene. In this paper, we have analyzed the stability of the most frequently used constitutive promoter, the cauliflower mosaic virus (CaMV) 35S promoter. We used several independent Nicotiana tabacum lines transgenic for the luciferase (LUC) or green fluorescence protein (GFP) coding genes driven by the same 35S promoter. As an indication of the expression level, we measured the steady state RNA level, protein level and protein activity. Exposure of plants to an acute single dose of UVC, UVB or X-ray radiation resulted in a decrease of the transgene expression level, whereas exposure to high temperature increased it. In most of the cases, the expression changed at one to two hours post exposure and returned to normal at four hours. By contrast, plants germinated and grown in the presence of a low dose of either UVB radiation or CuSO(4) for two weeks did not show any changes in expression level. We conclude that although the expression level of the transgenes driven by the 35S promoter can be transiently altered by the acute exposure, no substantial changes occur upon constant low exposure. PMID:19800040

  8. Sequence homology requirements for transcriptional silencing of 35S transgenes and post-transcriptional silencing of nitrite reductase (trans)genes by the tobacco 271 locus.

    PubMed

    Thierry, D; Vaucheret, H

    1996-12-01

    The transgene locus of the tobacco plant 271 (271 locus) is located on a telomere and consists of multiple copies of a plasmid carrying an NptII marker gene driven by the cauliflower mosaic virus (CaMV) 19S promoter and the leaf-specific nitrite reductase Nii1 cDNA cloned in the antisense orientation under the control of the CaMV 35S promoter. Previous analysis of gene expression in leaves has shown that this locus triggers both post-transcriptional silencing of the host leaf-specific Nii genes and transcriptional silencing of transgenes driven by the 19S or 35S promoter irrespective of their coding sequence and of their location in the genome. In this paper we show that silencing of transgenes carrying Nii1 sequences occurs irrespective of the promoter driving their expression and of their location within the genome. This phenomenon occurs in roots as well as in leaves although root Nii genes share only 84% identity with leaf-specific Nii1 sequences carried by the 271 locus. Conversely, transgenes carrying the bean Nii gene (which shares 76% identity with the tobacco Nii1 gene) escape silencing by the 271 locus. We also show that transgenes driven by the figwort mosaic virus 34S promoter (which shares 63% identity with the 35S promoter) also escape silencing by the 271 locus. Taken together, these results indicate that a high degree of sequence similarity is required between the sequences of the silencing locus and of the target (trans)genes for both transcriptional and post-transcriptional silencing. PMID:9002606

  9. Recombinase Polymerase Amplification (RPA) of CaMV-35S Promoter and nos Terminator for Rapid Detection of Genetically Modified Crops

    PubMed Central

    Xu, Chao; Li, Liang; Jin, Wujun; Wan, Yusong

    2014-01-01

    Recombinase polymerase amplification (RPA) is a novel isothermal DNA amplification and detection technology that enables the amplification of DNA within 30 min at a constant temperature of 37–42 °C by simulating in vivo DNA recombination. In this study, based on the regulatory sequence of the cauliflower mosaic virus 35S (CaMV-35S) promoter and the Agrobacterium tumefaciens nopaline synthase gene (nos) terminator, which are widely incorporated in genetically modified (GM) crops, we designed two sets of RPA primers and established a real-time RPA detection method for GM crop screening and detection. This method could reliably detect as few as 100 copies of the target molecule in a sample within 15–25 min. Furthermore, the real-time RPA detection method was successfully used to amplify and detect DNA from samples of four major GM crops (maize, rice, cotton, and soybean). With this novel amplification method, the test time was significantly shortened and the reaction process was simplified; thus, this method represents an effective approach to the rapid detection of GM crops. PMID:25310647

  10. Recombinase polymerase amplification (RPA) of CaMV-35S promoter and nos terminator for rapid detection of genetically modified crops.

    PubMed

    Xu, Chao; Li, Liang; Jin, Wujun; Wan, Yusong

    2014-01-01

    Recombinase polymerase amplification (RPA) is a novel isothermal DNA amplification and detection technology that enables the amplification of DNA within 30 min at a constant temperature of 37-42 °C by simulating in vivo DNA recombination. In this study, based on the regulatory sequence of the cauliflower mosaic virus 35S (CaMV-35S) promoter and the Agrobacterium tumefaciens nopaline synthase gene (nos) terminator, which are widely incorporated in genetically modified (GM) crops, we designed two sets of RPA primers and established a real-time RPA detection method for GM crop screening and detection. This method could reliably detect as few as 100 copies of the target molecule in a sample within 15-25 min. Furthermore, the real-time RPA detection method was successfully used to amplify and detect DNA from samples of four major GM crops (maize, rice, cotton, and soybean). With this novel amplification method, the test time was significantly shortened and the reaction process was simplified; thus, this method represents an effective approach to the rapid detection of GM crops. PMID:25310647

  11. Quantification of the 35S promoter in DNA extracts from genetically modified organisms using real-time polymerase chain reaction and specificity assessment on various genetically modified organisms, part I: operating procedure.

    PubMed

    Fernandez, Sophie; Charles-Delobel, Chrystèle; Geldreich, Angèle; Berthier, Georges; Boyer, Francine; Collonnier, Cécile; Coué-Philippe, Géraldine; Diolez, Annick; Duplan, Marie-Noëlle; Kebdani, Naïma; Romaniuk, Marcel; Feinberg, Max; Bertheau, Yves

    2005-01-01

    A highly sensitive quantitative real-time assay targeted on the 35S promoter of a commercial genetically modified organism (GMO) was characterized (sF/sR primers) and developed for an ABI Prism 7700 Sequence Detection System and TaqMan chemistry. The specificity assessment and performance criteria of sF/sR assay were compared to other P35S-targeted published assays. sF/sR primers amplified a 79 base pair DNA sequence located in a part of P35S that is highly conserved among many caulimovirus strains, i.e., this consensus part of CaMV P35S is likely to be present in many GM events. According to the experimental conditions, the absolute limit of detection for Bt176 corn was estimated between 0.2 and 2 copies of equivalent genome (CEG). The limit of quantification was reached below 0.1% Bt176 content. A Cauliflower Mosaic Virus control (CaMV) qualitative assay targeted on the ORF III of the viral genome was also used as a control (primers 3F/3R) to assess the presence of CaMV in plant-derived products. The specificity of this test was assessed on various CaMV strains, including the Figwort Mosaic Virus (FMV) and solanaceous CaMV strains. Considering the performance of sF/sR quantification test, the highly conserved sequence, and the small size of the amplicon, this assay was tested in a collaborative study in order to be proposed as an international standard. PMID:15859083

  12. Expression of. beta. -conglycinin gene driven by CaMV /sup 35/S promoter in transgenic plants

    SciTech Connect

    Nakamura, I.; Dube, P.H.; Beachy, R.N.

    1987-04-01

    ..beta..-conglycinin is a abundant protein stored in protein bodies of soybean seeds. This protein consists of three major subunits, ..cap alpha..' (76 kDa), ..cap alpha.. (72 kDa) and ..beta.. (53 kDa), and accumulates in developing soybean embryos during the mid- to late-maturation stages of seed development. Coding sequence of an ..cap alpha..'-subunit gene was expressed in transgenic petunia plants under control of the promoter from the CaMV (cauliflower mosaic virus) /sup 35/S transcript. Two different types of ..cap alpha..'-protein accumulated in tissues of the transgenic plant; seed-type ..cap alpha..'-protein accumulated only in seeds during mid- to late-maturation stages, while non-seed-type ..cap alpha..'-protein was found in non-seed tissues and in early stages of seed maturation. Seed-type ..cap alpha..'-protein was the same size as soybean ..cap alpha..'-subunit, while non-seed-type ..cap alpha..'-protein was larger by about 4 kDa. Seeds contained approximately 30-fold greater levels of ..cap alpha..'-protein than did non-seed tissues. This is presumably due to differences in protein stability because the amount of ..cap alpha..'-mRNA was equivalent in each of the tissues examined. The ..cap alpha..'-protein in leaves was localized in microsomal membrane fractions. Proteins solubilized from the membranes were sedimented by sucrose gradient centrifugation and analyzed by immuno blot technique. The results suggest that the protein assembles into multimeric forms in leaf membranes, as it does in seed protein bodies.

  13. An improved cucumber mosaic virus-based vector for efficient decoying of plant microRNAs.

    PubMed

    Liao, Qiansheng; Tu, Yifei; Carr, John P; Du, Zhiyou

    2015-01-01

    We previously devised a cucumber mosaic virus (CMV)-based vector system carrying microRNA target mimic sequences for analysis of microRNA function in Arabidopsis thaliana. We describe an improved version in which target mimic cloning is achieved by annealing two partly-overlapping complementary DNA oligonucleotides for insertion into an infectious clone of CMV RNA3 (LS strain) fused to the cauliflower mosaic virus-derived 35S promoter. LS-CMV variants carrying mimic sequences were generated by co-infiltrating plants with Agrobacterium tumefaciens cells harboring engineered RNA3 with cells carrying RNA1 and RNA2 infectious clones. The utility of using agroinfection to deliver LS-CMV-derived microRNA target mimic sequences was demonstrated using a miR165/166 target mimic and three solanaceous hosts: Nicotiana benthamiana, tobacco (N. tabacum), and tomato (Solanum lycopersicum). In all three hosts the miR165/166 target mimic induced marked changes in developmental phenotype. Inhibition of miRNA accumulation and increased target mRNA (HD-ZIP III) accumulation was demonstrated in tomato. Thus, a CMV-derived target mimic delivered via agroinfection is a simple, cheap and powerful means of launching virus-based miRNA mimics and is likely to be useful for high-throughput investigation of miRNA function in a wide range of plants. PMID:26278008

  14. An improved cucumber mosaic virus-based vector for efficient decoying of plant microRNAs

    PubMed Central

    Liao, Qiansheng; Tu, Yifei; Carr, John P.; Du, Zhiyou

    2015-01-01

    We previously devised a cucumber mosaic virus (CMV)-based vector system carrying microRNA target mimic sequences for analysis of microRNA function in Arabidopsis thaliana. We describe an improved version in which target mimic cloning is achieved by annealing two partly-overlapping complementary DNA oligonucleotides for insertion into an infectious clone of CMV RNA3 (LS strain) fused to the cauliflower mosaic virus-derived 35S promoter. LS-CMV variants carrying mimic sequences were generated by co-infiltrating plants with Agrobacterium tumefaciens cells harboring engineered RNA3 with cells carrying RNA1 and RNA2 infectious clones. The utility of using agroinfection to deliver LS-CMV-derived microRNA target mimic sequences was demonstrated using a miR165/166 target mimic and three solanaceous hosts: Nicotiana benthamiana, tobacco (N. tabacum), and tomato (Solanum lycopersicum). In all three hosts the miR165/166 target mimic induced marked changes in developmental phenotype. Inhibition of miRNA accumulation and increased target mRNA (HD-ZIP III) accumulation was demonstrated in tomato. Thus, a CMV-derived target mimic delivered via agroinfection is a simple, cheap and powerful means of launching virus-based miRNA mimics and is likely to be useful for high-throughput investigation of miRNA function in a wide range of plants. PMID:26278008

  15. Establishment of an Agrobacterium-mediated Inoculation System for Cucumber Green Mottle Mosaic Virus

    PubMed Central

    Kang, Minji; Seo, Jang-Kyun; Song, Dami; Choi, Hong-Soo; Kim, Kook-Hyung

    2015-01-01

    The infectious full-length cDNA clones of Cucumber green mottle mosaic virus (CGMMV) isolates KW and KOM, which were isolated from watermelon and oriental melon, respectively, were constructed under the control of the cauliflower mosaic virus 35S promoter. We successfully inoculated Nicotiana benthamiana with the cloned CGMMV isolates KW and KOM by Agrobacterium-mediated infiltration. Virulence and symptomatic characteristics of the cloned CGMMV isolates KW and KOM were tested on several indicator plants. No obvious differences between two cloned isolates in disease development were observed on the tested indicator plants. We also determined full genome sequences of the cloned CGMMV isolates KW and KOM. Sequence comparison revealed that only four amino acids (at positions 228, 699, 1212, and 1238 of the replicase protein region) differ between the cloned isolates KW and KOM. A previous study reported that the isolate KOM could not infect Chenopodium amaranticolor, but the cloned KOM induced chlorotic spots on the inoculated leaves. When compared with the previously reported sequence of the original KOM isolate, the cloned KOM contained one amino acid mutation (Ala to Thr) at position 228 of the replicase protein, suggesting that this mutation might be responsible for induction of chlorotic spots on the inoculated leaves of C. amaranticolor. PMID:26674677

  16. /sup 35/S-glycosaminoglycan and /sup 35/S-glycopeptide metabolism by diabetic glomeruli and aorta

    SciTech Connect

    Brown, D.M.; Klein, D.J.; Michael, A.F.; Oegema, T.R.

    1982-05-01

    /sup 35/S-glycosaminoglycan metabolism by glomeruli isolated from streptozotocin-diabetic and control rats was studied in vivo and in vitro. Total /sup 35/S-glycosaminoglycan synthesis and retention in the matrix by diabetic glomeruli was reduced while degradation was increased. /sup 35/S-glycosaminoglycan content of isolated GBM was similarly decreased. Whereas /sup 35/S-glycosaminoglycan content of glomeruli and GBM was decreased after in vitro incubation with /sup 35/SO/sub 4/, a larger proportion of total /sup 35/S-glycosaminoglycans was found in the incubation medium from diabetic glomeruli. Both control and diabetic glomeruli synthesize /sup 35/S-labeled glycopeptides, the quantity from diabetic glomeruli being reduced. Aorta from /sup 35/SO/sub 4/-injected diabetic rats also synthesized reduced quantities of /sup 35/S-glycosaminoglycans. There were no preferential metabolic alterations of species of /sup 35/S-glycosaminoglycans by diabetic glomeruli or aortas. These studies suggest that synthesis of /sup 35/S-glycosaminoglycans and /sup 35/S-glycopeptides by diabetic glomeruli are altered by disturbances of both synthetic as well as degradative pathways. An alteration of /sup 35/S-glycosaminoglycans interaction with matrix components in diabetes is postulated.

  17. Garden Mosaics

    ERIC Educational Resources Information Center

    Kennedy, Ann Marie; Krasny, Marianne E.

    2005-01-01

    This article describes Garden Mosaics, a program funded by the National Science Foundation. Garden Mosaics combines science learning with intergenerational mentoring, multicultural understanding, and community service. The program's mission is "connecting youth and elders to explore the mosaics of plants, people, and cultures in gardens, to learn…

  18. Mosaic Horses

    ERIC Educational Resources Information Center

    Rudecki, Maryanna

    2009-01-01

    This article describes a lesson inspired by Sicilian mosaics. The author first presented a PowerPoint presentation of mosaics from the Villa Romana del Casale and reviewed complementary and analogous colors. Students then created mosaics using a variety of art materials. They presented their work to their peers and discussed the thought and…

  19. CuO cauliflowers for supercapacitor application: Novel potentiodynamic deposition

    SciTech Connect

    Dubal, Deepak P.; Gund, Girish S.; Lokhande, Chandrakant D.; Holze, Rudolf

    2013-02-15

    Graphical abstract: Schematic experimental setup used for the potentiodynamic mode of electrodeposition for the synthesis of CuO cauliflower onto stainless steel substrate. Highlights: ► Synthesis of CuO using potentiodynamic mode of electrodeposition. ► Uniformly spread cauliflower-like nanostructure. ► CuO cauliflowers provide high specific capacitance with good stability. ► CuO cauliflowers show high power and energy density values. -- Abstract: In present investigation, synthesis and characterization of novel cauliflower-like copper oxide (CuO) and its electrochemical properties have been performed. The utilized CuO cauliflowers were prepared by potentiodyanamic mode from an aqueous alkaline bath. X-ray diffraction pattern confirm the formation of monoclinic CuO cauliflowers. Scanning electron micrograph analysis reveals that CuO cauliflowers are uniformly spread all over the substrate surface with the surface area of 49 m{sup 2} g{sup −1} with bimodal pore size distribution. Electrochemical analysis shows that CuO cauliflower exhibits high specific capacitance of 179 Fg{sup −1} in 1 M Na{sub 2}SO{sub 4} electrolyte with 81% capacity retention after 2000 cycles. The Ragone plot discovers better power and energy densities of cauliflowers-like CuO sample. Present investigation illustrates that the potentiodynamic approach for the direct growth of cauliflower-like CuO is simple and cost-effective and can be applied for synthesis of other metal oxides, polymers etc.

  20. Regulation of the activities of African cassava mosaic virus promoters by the AC1, AC2, and AC3 gene products.

    PubMed

    Haley, A; Zhan, X; Richardson, K; Head, K; Morris, B

    1992-06-01

    DNA fragments comprising each of the promoter regions from the geminivirus African cassava mosaic virus (ACMV) were cloned into the pUC18-based vector, pG1, producing transcriptional fusions with the beta-glucuronidase gene (GUS) and nopaline synthase terminator sequence. The relative activity of each promoter construct was analyzed by a GUS expression assay of extracts from Nicotiana clevelandii protoplasts coelectroporated with the GUS reporter constructs and constructs in which individual ACMV open reading frames (ORFs) were placed under control of a cauliflower mosaic virus 35 S promoter. Results suggest repression of the AC1 gene by its gene product, which is required for ACMV DNA synthesis. The promoter activity observed for the single promoter for the DNA A genes encoding functions of spread and the regulation of replication (AC2 and AC3 ORFs) was unaffected by coelectroporation with any of the ACMV ORF constructs. Promoters for the AV1 (coat protein) gene and the two DNA B genes (BV1 and BC1) were activated by electroporation of the AC2 ORF construct. To a lesser extent promoters for the AV1 and BV1 genes were activated with the AC3 ORF construct. The same pattern of promoter repression and activation was observed when transgenic N. benthamiana plants expressing the GUS reporter constructions were inoculated with ACMV DNA A. PMID:1585657

  1. Mosaic RASopathies

    PubMed Central

    Hafner, Christian; Groesser, Leopold

    2013-01-01

    “RASopathies” are a group of developmental syndromes with partly overlapping clinical symptoms that are caused by germline mutations of genes within the Ras/MAPK signaling pathway. Mutations affecting this pathway can also occur in a mosaic state, resulting in congenital syndromes often distinct from those generated by the corresponding germline mutations. For syndromes caused by mosaic mutations of the Ras/MAPK signaling pathway, the term “mosaic RASopathies” has been proposed. In the following article, genetic and phenotypic aspects of mosaic RASopathies will be discussed. PMID:23255105

  2. Hellas Mosaic

    NASA Technical Reports Server (NTRS)

    1997-01-01

    This mosaic comprises about 50 red-, green-, and violet-filter Viking Orbiter images, mosaiced in an orthographic projection at a scale of 1 km/pixel. The images were acquired in 1980 during late northern summer on Mars. The mosaic covers the region from latitude -70 degrees to 50 degrees and longitude 260 degrees to 360 degrees. The bright white region near the bottom of the image is due to carbon dioxide frost in the Hellas impact basin, which is about 2000 km in diameter. The bright yellow region at top is the Arabia region of Mars.

  3. Metabolic labeling of lutropin with [35S]sulfate.

    PubMed Central

    Hortin, G; Natowicz, M; Pierce, J; Baenziger, J; Parsons, T; Boime, I

    1981-01-01

    Chemical analyses have previously detected sulfate linked to the oligosaccharides of lutropin isolated from bovine and human pituitaries. To determine whether lutropin could be metabolically labeled with sulfate, isolated bovine and rat pituitaries were incubated with [35S]sulfate. In both species, two major labeled products were immunoprecipitated with antisera specific to lutropin subunits. Incorporation into the subunits occurred posttranslationally since it was not blocked by cycloheximide, which did, however, block the incorporation of radiolabeled methionine. Metabolic labeling with [35S]sulfate provides a valuable approach for examining the biosynthetic processing of lutropin and the physiological role of sulfate in this hormone. Images PMID:6950389

  4. Effect of yeast CTA1 gene expression on response of tobacco plants to tobacco mosaic virus infection.

    PubMed

    Talarczyk, Andrzej; Krzymowska, Magdalena; Borucki, Wojciech; Hennig, Jacek

    2002-07-01

    The response of tobacco (Nicotiana tabacum L. cv Xanthi-nc) plants with elevated catalase activity was studied after infection by tobacco mosaic virus (TMV). These plants contain the yeast (Saccharomyces cerevisiae) peroxisomal catalase gene CTA1 under the control of the cauliflower mosaic virus 35S promoter. The transgenic lines exhibited 2- to 4-fold higher total in vitro catalase activity than untransformed control plants under normal growth conditions. Cellular localization of the CTA1 protein was established using immunocytochemical analysis. Gold particles were detected mainly inside peroxisomes, whereas no significant labeling was detected in other cellular compartments or in the intercellular space. The physiological state of the transgenic plants was evaluated in respect to growth rate, general appearance, carbohydrate content, and dry weight. No significant differences were recorded in comparison with non-transgenic tobacco plants. The 3,3'-diaminobenzidine-stain method was applied to visualize hydrogen peroxide (H(2)O(2)) in the TMV infected tissue. Presence of H(2)O(2) could be detected around necrotic lesions caused by TMV infection in non-transgenic plants but to a much lesser extent in the CTA1 transgenic plants. In addition, the size of necrotic lesions was significantly bigger in the infected leaves of the transgenic plants. Changes in the distribution of H(2)O(2) and in lesion formation were not reflected by changes in salicylic acid production. In contrast to the local response, the systemic response in upper noninoculated leaves of both CTA1 transgenic and control plants was similar. This suggests that increased cellular catalase activity influences local but not systemic response to TMV infection. PMID:12114558

  5. Understanding Antarctic sulfur cycle chemistry using cosmogenic 35S

    NASA Astrophysics Data System (ADS)

    Hill-Falkenthal, J.; Priyadarshi, A.; Savarino, J. P.; Thiemens, M. H.

    2011-12-01

    Sulfate aerosols have been recognized to possess strong light scattering abilities and act as cloud condensation nuclei, thus having an impact on Earth's climate and radiation budget. Improved understanding of the sulfate aerosol transport is needed for assessing its influences on climate. Cosmogenically produced 35S (half-life~87 days)(2) exists both in the gas and solid phases, thus making it ideal to trace the atmospheric processes of sulfate oxidation. Here, we present a yearlong sampling of sulfate aerosol in Antarctica with 35S measurements illustrating its boundary layer chemistry and stratospheric- tropospheric mixing. Samples were collected from Dome C station once a week from Jan 2010-Jan 2011. 35S activity in sulfate aerosols shows maximums in summer months between December and February and minimums in winter from June to August. Higher oxidative capacity of the atmosphere coupled with long range transport of mid-latitude air increases 35SO4 activity in the summer, whereas a lack of air mass mixing coupled with low oxidant concentration significantly decreases 35SO4 activity(1). Stratospheric/tropospheric exchange processes like tropopause folding could help explain a random spike in activity that deviates from the normal background activity. In the future, a box model calculation will be done to determine the contribution of stratospheric air mass transported downward during the exchange. The oxygen isotopes will also be measured to see the effect of stratospheric intrusion. References (1)Priyadarshi, A., G. Dominguez, J. Savarino, and M. Thiemens (2011), Cosmogenic 35S: A unique tracer to Antarctic atmospheric chemistry and the polar vortex, Geophys. Res. Lett., 38, L13808, doi:10.1029/2011/GL047469. (2)Lal, D., and B. Peters (1967), Cosmic ray produced radioactivity in the earth, Handb. Phys., 46, 551-612.

  6. Mosaic Messages

    ERIC Educational Resources Information Center

    Baldauf, Annemarie

    2012-01-01

    Through the generosity of a Lowes Toolbox for Education Grant and a grant from the Bill Graham Foundation, an interdisciplinary mosaic mural was created and installed at Riverview Middle School in Bay Point, California. The actual mural, which featured a theme of nurturing students through music, art, sports, science, and math, took about three…

  7. Estimation of cauliflower mass transfer parameters during convective drying

    NASA Astrophysics Data System (ADS)

    Sahin, Medine; Doymaz, İbrahim

    2016-05-01

    The study was conducted to evaluate the effect of pre-treatments such as citric acid and hot water blanching and air temperature on drying and rehydration characteristics of cauliflower slices. Experiments were carried out at four different drying air temperatures of 50, 60, 70 and 80 °C with the air velocity of 2.0 m/s. It was observed that drying and rehydration characteristics of cauliflower slices were greatly influenced by air temperature and pre-treatment. Six commonly used mathematical models were evaluated to predict the drying kinetics of cauliflower slices. The Midilli et al. model described the drying behaviour of cauliflower slices at all temperatures better than other models. The values of effective moisture diffusivities (D eff ) were determined using Fick's law of diffusion and were between 4.09 × 10-9 and 1.88 × 10-8 m2/s. Activation energy was estimated by an Arrhenius type equation and was 23.40, 29.09 and 26.39 kJ/mol for citric acid, blanch and control samples, respectively.

  8. Preventing Cauliflower Ear with a Modified Tie-Through Technique.

    ERIC Educational Resources Information Center

    Dimeff, Robert J.; Hough, David O.

    1989-01-01

    Describes a quick, simple tie-through suture technique (in which a collodion packing is secured to the auricle with two buttons) for preventing cauliflower ear following external ear trauma in wrestlers and boxers. The technique ensures constant compression; multiple treatments for fluid reaccumulation are rarely necessary. (SM)

  9. 77 FR 6772 - United States Standards for Grades of Cauliflower

    Federal Register 2010, 2011, 2012, 2013, 2014

    2012-02-09

    ... amend the color requirement for curds to allow all colors of cauliflower to be certified to a U.S. grade. In addition, AMS proposes to permit mixed color packs, heads less than 4 inches in diameter, and to... develop and improve standards of quality, condition, quantity, grade and packaging and recommend...

  10. EUVI Mosaic

    NASA Technical Reports Server (NTRS)

    2006-01-01

    A mosaic of the extreme ultraviolet images from the STEREO Ahead observatory's SECCHI/Extreme Ultraviolet Imaging Telescope taken on Dec. 4, 2006, its first day of imaging. These false color images show the sun's atmospheres at a range of different temperatures. Clockwise from top left: 1 million degrees Kelvin (171 A), 1.5 million K (195 A), 60,000-80,000 K (304 A), 2.5 million K (286 A).

  11. Triton mosaic

    NASA Technical Reports Server (NTRS)

    1988-01-01

    This picture of Triton is a mosaic of the highest resolution images taken by Voyager 2 on Aug. 25, 1989 from a distance of about 40,000 kilometers (24,800 miles). The mosaic is superimposed on the lower resolution mapping images taken about 2 hours earlier in order to fill in gaps between high resolution images. The smallest features that can be seen on the images are about 0.8 kilometers (0.5 miles) across. The terminator (line separating day and night) is at the top of the picture and is centered at about 30 degrees north latitude and 330 degrees longitude. These highest resolution images were targeted for the terminator region to show details of the topography by the shadows it casts. Near the center of the picture is a depression filled with smooth plains that are probably ices which were once erupted in a fluid state. The depth of the depression is about 300 meters (900 feet) and the prominent fresh impact crater on its floor is about 20 kilometers (12 miles) in diameter and about 1 kilometer (0.6 mile) deep. On the right is an elongate crater with adjacent dark deposits above it. This feature may be an explosive eruption vent formed by gaps within the ice. The linear structure on the left is probably a fracture along which fresh ice has been extruded. The Voyager Mission is conducted by JPL for NASA's Office of Space Science and Applications.

  12. Enhanced resistance to Spodoptera litura in endophyte infected cauliflower plants.

    PubMed

    Thakur, Abhinay; Kaur, Sanehdeep; Kaur, Amarjeet; Singh, Varinder

    2013-04-01

    Endophytic fungi, which live within host plant tissues without causing any visible symptom of disease, are important mediators of plant-herbivore interactions. These endophytes enhance resistance of host plant against insect herbivores mainly by productions of various alkaloid based defensive compounds in the plant tissue or through alterations of plant nutritional quality. Two endophytic fungi, i.e., Nigrospora sp. and Cladosporium sp., were isolated from Tinospora cordifolia (Thunb.) Miers, a traditional indian medicinal plant. Cauliflower (Brassica oleracea L.) plants were inoculated with these two endophytic fungi. The effect of endophyte infected and uninfected cauliflower plants were measured on the survival and development of Spodoptera litura (Fab.), a polyphagous pest. Endophyte infected cauliflower plants showed resistance to S. litura in the form of significant increase in larval and pupal mortality in both the fungi. Inhibitory effects of endophytic fungi also were observed on adult emergence, longevity, reproductive potential, as well as hatchability of eggs. Thus, it is concluded that antibiosis to S. litura could be imparted by artificial inoculation of endophytes and this could be used to develop alternative ecologically safe control strategies. PMID:23575013

  13. Mosaic aging

    PubMed Central

    Walker, Lary C.; Herndon, James G.

    2010-01-01

    Summary Although all multicellular organisms undergo structural and functional deterioration with age, senescence is not a uniform process. Rather, each organism experiences a constellation of changes that reflect the heterogeneous effects of age on molecules, cells, organs and systems, an idiosyncratic pattern that we refer to as mosaic aging. Varying genetic, epigenetic and environmental factors (local and extrinsic) contribute to the aging phenotype in a given individual, and these agents influence the type and rate of functional decline, as well as the likelihood of developing age-associated afflictions such as cardiovascular disease, arthritis, cancer, and neurodegenerative disorders. Identifying key factors that drive aging, clarifying their activities in different systems, and in particular understanding how they interact will enhance our comprehension of the aging process, and could yield insights into the permissive role that senescence plays in the emergence of acute and chronic diseases of the elderly. PMID:20110150

  14. Development of a new vector using Soybean yellow common mosaic virus for gene function study or heterologous protein expression in soybeans.

    PubMed

    Lim, Seungmo; Nam, Moon; Kim, Kil Hyun; Lee, Su-Heon; Moon, Jung-Kyung; Lim, Hyoun-Sub; Choung, Myoung-Gun; Kim, Sang-Mok; Moon, Jae Sun

    2016-02-01

    A new vector using Soybean yellow common mosaic virus (SYCMV) was constructed for gene function study or heterologous protein expression in soybeans. The in vitro transcript with a 5' cap analog m7GpppG from an SYCMV full-length infectious vector driven by a T7 promoter infected soybeans (pSYCMVT7-full). The symptoms observed in the soybeans infected with either the sap from SYCMV-infected leaves or pSYCMVT7-full were indistinguishable, suggesting that the vector exhibits equivalent biological activity as the virus itself. To utilize the vector further, a DNA-based vector driven by the Cauliflower mosaic virus (CaMV) 35S promoter was constructed. The complete sequence of the SYCMV genome was inserted into a binary vector flanked by a CaMV 35S promoter at the 5' terminus of the SYCMV genome and a cis-cleaving ribozyme sequence followed by a nopaline synthase terminator at the 3' terminus of the SYCMV genome (pSYCMV-full). The SYCMV-derived vector was tested for use as a virus-induced gene silencing (VIGS) vector for the functional analysis of soybean genes. VIGS constructs containing either a fragment of the Phytoene desaturase (PDS) gene (pSYCMV-PDS1) or a fragment of the small subunit of ribulose-1,5-bisphosphate carboxylase/oxygenase (RbcS) gene (pSYCMV-RbcS2) were constructed. Plants infiltrated with each vector using the Agrobacterium-mediated inoculation method exhibited distinct symptoms, such as photo-bleaching in plants infiltrated with pSYCMV-PDS1 and yellow or pale green coloring in plants infiltrated with pSYCMV-RbcS2. In addition, down-regulation of the transcripts of the two target genes was confirmed via northern blot analysis. Particle bombardment and direct plasmid DNA rubbing were also confirmed as alternative inoculation methods. To determine if the SYCMV vector can be used for the expression of heterologous proteins in soybean plants, the vector encoding amino acids 135-160 of VP1 of Foot-and-mouth disease virus (FMDV) serotype O1 Campos (O1C

  15. The cauliflower Orange gene enhances petiole elongation by suppressing expression of eukaryotic release factor 1

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The cauliflower Or gene affects plant growth and development in addition to conferring beta-carotene accumulation. This study was undertaken to investigate the molecular basis of the Or gene mutation in controlling plant growth. The OR protein was found to interact with cauliflower and Arabidopsis e...

  16. Raspberry Mosaic Disease Complex

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Raspberry mosaic disease (RMD) is an overarching term used to describe a range of diseases caused by various combinations of different viruses that are each transmitted by aphids. In the scientific literature RMD has been given various alternative names, including red raspberry mosaic, type b mosaic...

  17. (35S)methionine interaction with rat liver tRNA and effect of chemical carcinogens

    SciTech Connect

    Kanduc, D.; Quagliariello, E. )

    1991-07-01

    The interaction of (35S)methionine with hepatic tRNA in normal, carcinogen-treated, and partially hepatectomized rats was studied. tRNA was preferentially labeled following (35S)methionine (1.6 mCi, 25 mg/kg body wt) administration by intraperitoneal injection. The extent of (35S)methionine-tRNA interaction was impaired by partial hepatectomy and by conditions having a carcinogenic potential.

  18. Modification of Cytokinins by Cauliflower Microsomal Enzymes 1

    PubMed Central

    Chen, Chong-Maw; Leisner, Scott M.

    1984-01-01

    N6-(Δ2-isopentenyl)Adenine and N6-(Δ2-isopentenyl)adenosine were hydroxylated, respectively, to 6-(4-hydroxy-3-methyl-trans-2-butenylamino)purine and 6-(4-hydroxy-3-methyl-trans-2-butenylamino) -9-β-ribofuranosylpurine in the presence of NADPH and the microsomal fraction from cauliflowers (Brassica oleracea L.). The hydroxylating reaction was completely inhibited by 10 millimolars metyrapone and partially inactivated by 10-minute treatment of the microsomal preparation with ethylene. The cytokinins were also dealkylated by the microsomal enzymes and formed adenine from cytokinin base and adenosine from cytokinin nucleoside. These results suggest that plant cytochrome P-450 is involved in the conversion of one type of cytokinin to another, and in the modification of cytokinin molecules. PMID:16663640

  19. How-To-Do-It: Using Cauliflower to Demonstrate Plant Tissue Culture.

    ERIC Educational Resources Information Center

    Haldeman, Janice H.; Ellis, Jane P.

    1988-01-01

    Presents techniques used for disinfestation of plant material, preparation of equipment and media, and laboratory procedures for tissue culture using cauliflower. Details methods for preparing solutions and plant propagation by cloning. (CW)

  20. Auricular hematoma and cauliflower deformation of the ear: from art to medicine.

    PubMed

    Mudry, Albert; Pirsig, Wolfgang

    2009-01-01

    Auricular hematoma and cauliflower deformation of the ear are unique in several respects. Knowledge about it began, in antiquity, through artists, particularly Greek and Roman, and then Japanese in the 18th century with their representation of cauliflower deformation of the ear on sculptures and paintings of pugilists and wrestlers. It is only in the 19th century that physicians began to make substantive progress in understanding this abnormality. It was first thought to be associated with mental disease, but by the beginning of the 20th century, its etiology was recognized as being caused by trauma and was then named auricular hematoma. The second step in the understanding of this affliction was the observation that auricular hematoma progresses toward cauliflower deformation of the ear, which was named cauliflower ear. Recognition of this evolution led to the development of therapies. During the second half of the 20th century, different treatments were developed. They included various hematoma drainage techniques with special bandages to prevent hematoma recurrence and ensuing progression to cauliflower ear. In summary, cauliflower deformation of the ear is an old artistic affliction that has only recently received medical attention. PMID:18800018

  1. Gonadotropin hyperstimulation influences the 35S-methionine metabolism of mouse preimplantation embryos.

    PubMed

    Wetzels, A M; Artz, M T; Goverde, H J; Bastiaans, B A; Hamilton, C J; Rolland, R

    1995-11-01

    The effects of gonadotropin stimulation on mouse embryo uptake and incorporation of 35S-methionine were studied. We found that the uptake of 35S-methionine was reduced in embryos of stimulated females in both the two-cell and the blastocyst developmental stage. The incorporation of 35S-methionine into protein was not statistically significantly different between the embryos of stimulated and those of unstimulated females. Qualitatively, protein synthesis was equal in both groups as determined with one-dimensional SDS-PAGE. The results are discussed and we conclude that mouse embryo viability in vivo is decreased by ovarian stimulation. PMID:8624434

  2. K-shell internal ionization and excitation in β decay of 35S

    NASA Astrophysics Data System (ADS)

    Ohsawa, Daisuke; Katano, Rintaro; Isozumi, Yasuhito

    1999-10-01

    Using a flat-crystal x-ray spectrometer designed for low-energy photons from radioactive sources, the K-shell internal ionization and excitation (K-IIE) in the β decay of 35S has been investigated by measuring chlorine K x rays from carefully purified 35S sources. We have succeeded for the first time in obtaining a high-resolution spectrum of the Kα x-ray group emitted after the β decay of 35S, which consists of at least six lines, indicating that multiple ionizations and excitations including L and M shells are dominant in the K-IIE process during the β decay of low-Z nuclides. The K-hole creation probability for 35S determined is (2.8+/-0.5)×10-3 per decay, which agrees well with the previous result by Rubinson and Howland within the standard deviation. The comparison with available theoretical calculations is also given.

  3. Gladiolus plants transformed with single-chain variable fragment antibodies to Cucumber mosaic virus

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Transgenic plants of Gladiolus ‘Peter Pears’ or ‘Jenny Lee’ were developed that contain single-chain variable fragments (scFv) to Cucumber mosaic virus (CMV) subgroup I or II. The CMV subgroup I heavy and light chain scFv fragments were placed under control of either the duplicated CaMV 35S or suga...

  4. [(35)S]GTPγS binding and opioid tolerance and efficacy in mouse spinal cord.

    PubMed

    Madia, Priyanka A; Navani, Dipesh M; Yoburn, Byron C

    2012-03-01

    The present study examined efficacy of a series of opioid agonists and then using chronic in vivo treatment protocols, determined tolerance to opioid agonist stimulated [(35)S]GTPγS (guanosine 5'-O-(3-[(35)S] thio)triphosphate) binding in mouse spinal cord membranes and compared it directly to spinal analgesic tolerance. The [(35)S]GTPγS binding assay was used to estimate efficacy (E(max) and τ; Operational Model of Agonism) of a series of opioid agonists for G-protein activation in mouse spinal cord. The rank order of opioid agonist efficacy determined in the [(35)S]GTPγS assay using the Operational Model and E(max) was similar. These efficacy estimates correlated with historical analgesic efficacy estimates. For tolerance studies, mice were continuously treated s.c. for 7days with morphine, oxycodone, hydromorphone, etorphine or fentanyl and [(35)S]GTPγS studies were conducted in spinal cord membranes. Other mice were tested in i.t. analgesia dose response studies (tailflick). Tolerance to DAMGO ([D-Ala(2),N-MePhe(4),Gly-ol(5)]enkephalin) or morphine stimulated [(35)S]GTPγS binding (decrease in E(max)) was observed following etorphine and fentanyl treatment only. These treatment protocols downregulate μ-opioid receptor density whereas morphine, oxycodone and hydromorphone do not. Spinal analgesic tolerance was observed following all treatment protocols examined (morphine, oxycodone and etorphine). Opioid antagonist treatment that specifically upregulates (chronic naltrexone) or downregulates (clocinnamox) μ-opioid receptor density produced a corresponding change in opioid agonist stimulated [(35)S]GTPγS binding. Although receptor downregulation and G-protein uncoupling are among potential mechanisms of opioid tolerance, the present results suggest that uncoupling in mouse spinal cord plays a minor role and that the [(35)S]GTPγS assay is particularly responsive to changes in μ-opioid receptor density. PMID:22108651

  5. Reaction of Cauliflower Genotypes to Black Rot of Crucifers

    PubMed Central

    da Silva, Lincon Rafael; da Silva, Renan César Dias; Cardoso, Atalita Francis; de Mello Pelá, Gláucia; Carvalho, Daniel Diego Costa

    2015-01-01

    This study aimed to evaluate six cauliflower genotypes regarding their resistance to black rot and their production performance. To do so, it was conducted two field experiments in Ipameri, Goiás, Brazil, in 2012 and 2013. It was used a randomized block design, with four replications (total of 24 plots). Each plot consisted of three planting lines 2.5 m long (six plants/line), spaced 1.0 m apart, for a total area of 7.5 m2. Evaluations of black rot severity were performed at 45 days after transplanting, this is, 75 days after sowing (DAS), and yield evaluations at 90 to 105 DAS. The Verona 184 genotype was the most resistant to black rot, showing 1.87 and 2.25% of leaf area covered by black rot symptom (LACBRS) in 2012 and 2013. However, it was not among the most productive materials. The yield of the genotypes varied between 15.14 and 25.83 t/ha in both years, Lisvera F1 (21.78 and 24.60 t/ha) and Cindy (19.95 and 23.56 t/ha) being the most productive. However, Lisvera F1 showed 6.37 and 9.37% of LACBRS and Cindy showed 14.25 and 14.87% of LACBRS in 2012 and 2013, being both considered as tolerant to black rot. PMID:26060437

  6. Structure of newly synthesized (/sup 35/S)-proteoglycans and (/sup 35/S)-proteoglycan turnover products of cartilage explant cultures from dogs with experimental osteoarthritis

    SciTech Connect

    Carney, S.L.; Billingham, M.E.; Muir, H.; Sandy, J.D.

    1985-01-01

    The structure of newly synthesized proteoglycans from explant cultures of cartilage from joints subjected to transection of the anterior cruciate ligament (osteoarthritic) and from normal (non- or sham-operated) joints was examined. The structure of the products of proteoglycan turnover was also examined using explants of normal and osteoarthritic cartilage maintained in culture for a 48 h chase period. The findings were as follows: Newly synthesized (/sup 35/S)-proteoglycans extracted from cartilage explants from osteoarthritic joints whether examined 3 weeks, 3 months, or 6 months after surgery were larger than those from corresponding normal cartilage. This can be explained by the synthesis in osteoarthritic cartilage of abnormally long chondroitin sulfate chains on newly synthesised proteoglycans. The extracts also contained a newly formed small proteoglycan species that was unable to interact with hyaluronic acid. The proportion of this species was higher in osteoarthritic cartilage compared with normal, examined 3 weeks after surgery, but was generally absent from cartilage obtained 3 and 6 months after surgery. Compared with controls, a smaller proportion of the (/sup 35/S)-proteoglycans released into the maintenance medium of explant cultures of osteoarthritic cartilage during a 48 h chase period was able to interact with hyaluronic acid. However, although furnished with longer (/sup 35/S)-glycosaminoglycan chains, these proteoglycans were smaller than those from control explants.

  7. North America Mosaic

    Atmospheric Science Data Center

    2014-05-15

    article title:  Natural Color Mosaic of North America     View Larger ... at lower right. In addition to the contiguous United States, the scene spans from British Columbia in the northwest to Newfoundland ...

  8. Mosaic image compression

    NASA Astrophysics Data System (ADS)

    Chaudhari, Kapil A.; Reeves, Stanley J.

    2005-02-01

    Most consumer-level digital cameras use a color filter array to capture color mosaic data followed by demosaicking to obtain full-color images. However, many sophisticated demosaicking algorithms are too complex to implement on-board a camera. To use these algorithms, one must transfer the mosaic data from the camera to a computer without introducing compression losses that could generate artifacts in the demosaicked image. The memory required for losslessly stored mosaic images severely restricts the number of images that can be stored in the camera. Therefore, we need an algorithm to compress the original mosaic data losslessly so that it can later be transferred intact for demosaicking. We propose a new lossless compression technique for mosaic images in this paper. Ordinary image compression methods do not apply to mosaic images because of their non-canonical color sampling structure. Because standard compression methods such as JPEG, JPEG2000, etc. are already available in most digital cameras, we have chosen to build our algorithms using a standard method as a key part of the system. The algorithm begins by separating the mosaic image into 3 color (RGB) components. This is followed by an interpolation or down-sampling operation--depending on the particular variation of the algorithm--that makes all three components the same size. Using the three color components, we form a color image that is coded with JPEG. After appropriately reformatting the data, we calculate the residual between the original image and the coded image and then entropy-code the residual values corresponding to the mosaic data.

  9. Cosmogenic 35S: A unique tracer to Antarctic atmospheric chemistry and the polar vortex

    NASA Astrophysics Data System (ADS)

    Priyadarshi, Antra; Dominguez, Gerardo; Savarino, Joel; Thiemens, Mark

    2011-07-01

    The cosmogenic radionuclide 35S (half life ˜87 d) exists in both 35SO2 gas and 35SO42- aerosol phase in the atmosphere. Cosmogenic 35S fulfils a unique niche in that it has an ideal half-life for use as a tracer of atmospheric processes, possesses a gas phase precursor and undergoes gas to particle conversion, providing a chronometer that complements other measurements of radiogenic isotopes of different half lives and chemical properties. Based on radiogenic 35S measurements and concomitant model calculations, we demonstrate that 35S is a unique tracer to understand stratospheric-tropospheric air mass transport dynamics and the atmospheric oxidation capacity on a short time scale. Reported are the first measurements of 35S contained in SO42- aerosols (bulk and size aggregated) at Antarctica. 35SO42- concentrations at Dome C and Dumont D'Urville exhibit summer maxima and winter minima with a secondary winter peak. Higher oxidative capacity of the atmosphere and long range transport of mid latitude air increases 35SO42- activity in summer whereas a lack of air mass mixing coupled with low oxidant concentration in winter significantly decreases 35SO42- activity. A 3% contribution from stratospheric 35SO42- into the free troposphere during stratosphere-troposphere air mass mixing accounts for the secondary winter 35SO42- peak. In the future, this work will be extended to 35S activity measurements of both gas and aerosol phases to further understand gas to particle conversion, vortex dynamics and trace polar stratospheric cloud sedimentation frequency.

  10. Sensory, physicochemical and microbiological quality of irradiated minimally processed cauliflower [rapid communication

    NASA Astrophysics Data System (ADS)

    Bib, Nizakat; Khan, Misal; Badshah, Amal; Ashraf Chaudry, Muhammad

    2005-08-01

    Minimally processed cauliflower samples were irradiated, stored at 5 °C for 2 weeks and analyzed for sensory, physicochemical and microbiological qualities at 0th, 7th and 14th days. The data showed highest mean values of 7.93 and 7.57 for appearance and flavor, respectively, for 1.0 kGy treated samples. The D10 values of contaminating microorganisms on cauliflower were 0.20 ( Escherischia coli) and 0.24 kGy ( Salmonella paratyphae A.) and the resulting 5 D10 value was 1.2 kGy. The study revealed that a dose of ⩾1.5 kGy is enough for retention of quality and reduction of microbial load to 5 D10 values in cauliflower during 2 weeks storage at refrigerated temperature.

  11. THEMIS Global Mosaics

    NASA Astrophysics Data System (ADS)

    Gorelick, N. S.; Christensen, P. R.

    2005-12-01

    We have developed techniques to make seamless, controlled global mosaics from the more than 50,000 multi-spectral infrared images of the Mars returned by the THEMIS instrument aboard the Mars Odyssey spacecraft. These images cover more than 95% of the surface at 100m/pixel resolution at both day and night local times. Uncertainties in the position and pointing of the spacecraft, varying local time, and imaging artifacts make creating well-registered mosaics from these datasets a challenging task. In preparation for making global mosaics, many full-resolution regional mosaics have been made. These mosaics typically cover an area 10x10 degrees or smaller, and are constructed from only a few hundred images. To make regional mosaics, individual images are geo-rectified using the USGS ISIS software. This dead-reckoning is sufficient to approximate position to within 400m in cases where the SPICE information was downlinked. Further coregistration of images is handled in two ways: grayscale differences minimization in overlapping regions through integer pixel shifting, or through automatic tie-point generation using a radial symmetry transformation (RST). The RST identifies points within an image that exhibit 4-way symmetry. Martian craters tend to to be very radially symmetric, and the RST can pin-point a crater center to sub-pixel accuracy in both daytime and nighttime images, independent of lighting, time of day, or seasonal effects. Additionally, the RST works well on visible-light images, and in a 1D application, on MOLA tracks, to provide precision tie-points across multiple data sets. The RST often finds many points of symmetry that aren't related to surface features. These "false-hits" are managed using a clustering algorithm that identifies constellations of points that occur in multiple images, independent of scaling or other affine transformations. This technique is able to make use of data in which the "good" tie-points comprise even less than 1% of total

  12. Enzymic Capacities of Purified Cauliflower Bud Plastids for Lipid Synthesis and Carbohydrate Metabolism 1

    PubMed Central

    Journet, Etienne-Pascal; Douce, Roland

    1985-01-01

    Isolated cauliflower (Brassica oleracea) bud plastids, purified by isopycnic centrifugation in density gradients of Percoll, were found to be highly intact, to be practically devoid of extraplastidial contaminations, and to retain all the enzymes involved in fatty acid, phosphatidic acid, and monogalactosyldiacylglycerol synthesis. Purified plastids possess all the enzymes needed to convert triose phosphate to starch and vice versa, and are capable of conversion of glycerate 3-phosphate to pyruvate for fatty acid synthesis. They are also capable of oxidation of hexose phosphate and conversion to triose phosphate via the oxidative pentosephosphate pathway. Cauliflower bud plastids prove to be, therefore, biochemically very flexible organelles. Images Fig. 1 PMID:16664432

  13. Optical properties and defect related measurement of SnO2 cauliflower

    NASA Astrophysics Data System (ADS)

    Dutta, Dipa; Bahadur, D.

    2013-02-01

    Tin dioxide (SnO2) cauliflower arrays were successfully fabricated using a hydrothermal method with high yield. The product was characterized by X-ray diffraction and field-emission scanning electron Microscopy (FESEM). The results show that the products have a cauliflower like morphology with size around 1 μm. Room temperature photoluminescence (PL) and Raman spectra were carried out to investigate their optical and defect related properties. The presence of a band at 567 cm-1 in Raman spectra arises from surface related defects. PL study reveals the presence of oxygen vacancies and tin interstitials defects.

  14. Foliar leaching, translocation, and biogenic emission of 35S in radiolabeled loblolly pines

    SciTech Connect

    Garten Jr, Charles T

    1990-02-01

    Foliar leaching, basipetal (downard) translocation, and biogenic emission of sulfur (S), as traced by {sup 35}S, were examined in a field study of loblolly pines. Four trees were radiolabeled by injection with amounts of {sup 35}S in the MBq range, and concentrations in needle fall, stemflow, throughfall, and aboveground biomass were measured over a period of 15-20 wk after injection. The contribution of dry deposition to sulfate-sulfur (SO{sub 4}{sup 2-}-S) concentrations in net throughfall (throughfall SO{sub 4}{sup 2-}-S concentration minus that in incident precipitation) beneath all four trees was >90%. Calculations indicated that about half of the summertime SO{sub 2}2 dry deposition flux to the loblolly pines was fixes in the canopy and not subsequently leached by rainfall. Based on mass balance calculations, {sup 35}S losses through biogenic emissions from girdled trees were inferred to be 25-28% of the amount injected. Estimates based on chamber methods and mass balance calculations indicated a range in daily biogenic S emission of 0.1-10 {micro}g/g dry needles. Translocation of {sup 35}S to roots in nongirdled trees was estimated to be between 14 and 25% of the injection. It is hypothesized that biogenic emission and basipetal translocation of S (and not foliar leaching) are important mechanisms by which forest trees physiologically adapt to excess S in the environment.

  15. Foliar leaching, translocation, and biogenic emission of sup 35 S in radiolabeled loblolly pines

    SciTech Connect

    Garten, C.T. Jr. )

    1990-02-01

    Foliar leaching, basipetal (downward) translocation, and biogenic emission of sulfur (S), as traced by {sup 35}S, were examined in a field study of loblolly pines. Four trees were radiolabeled by injection with amounts of {sup 35}S in the 6-8 MBq range, and concentrations in needle fall, stemflow, throughfall, and aboveground biomass were measured over a period of 15-20 wk after injection. The contribution of dry deposition to sulfate-sulfur (SO{sub 4}{sup 2{minus}}-S) concentrations in net throughfall (throughfall SO{sub 4}{sup 2{minus}}-S concentration minus that in incident precipitation) beneath all four trees was > 90%. Calculations indicated that about half of the summertime SO{sub 2} dry deposition flux to the loblolly pines was fixed in the canopy and not subsequently leached by rainfall. Based on mass balance calculations, {sup 35}S losses through biogenic emissions from girdled trees were inferred to be 25-28% of the amount injected. Estimates based on chamber methods and mass balance calculations indicated a range in daily biogenic S emission of 0.1-10 {mu}g/g dry needles. Translocation of {sup 35}S to roots in nongirdled trees was estimated to be between 14 and 25% of the injection. It is hypothesized that biogenic emission and basipetal translocation of S (and not foliar leaching) are important mechanisms by which forest trees physiologically adapt to excess S in the environment.

  16. Relay cropping cauliflower with lettuce as a means to manage first-generation cabbage maggot (Diptera: Anthomyiidae) and minimize cauliflower yield loss.

    PubMed

    Parsons, C K; Dixon, P L; Colbo, M

    2007-06-01

    First-generation cabbage maggot, Delia radicum (L.) (Diptera: Anthomyiidae), can cause extensive damage to newly transplanted brassica crops. This study investigated the use of relay cropping, a form of intercropping that involves overlapping two crops in the same field for a short period, as a means to 1) reduce first-generation D. radicum egg numbers by disrupting female host finding and 2) minimize yield loss by reducing the time that crops overlap. Because of the high incidence of two other Delia species, Delia platura (Meigen) and Delia florilega (Zetterstedt), treatment effects on these insects also were considered. In both years of the study (2003 and 2004), there were fewer D. radicum eggs collected from the base of cauliflower, Brassica oleracea variety botrytis, plants relay cropped with lettuce, Lactuca sativa L., than in monoculture. D. platura/D. florilega also laid fewer eggs on cauliflower in the relay crop than in monoculture in 2003, but in 2004 the opposite was true, there were more D. platura/D. florilega eggs laid on the relay-cropped cauliflower. After peak D. radicum oviposition, the lettuce was harvested. Cauliflower curd weights and diameters were comparable between treatments in both years. Plant loss because of D. platura/ D. florilega feeding in the 2004 relay-cropped plots resulted in reduced yields in these plots compared with the monoculture. Although further investigation is needed into the effects of relay cropping on other pests within this system, this is the first study to demonstrate that relay cropping can reduce egg laying by D. radicum at the scale studied while minimizing competition between component crops for key resources. PMID:17598546

  17. The fate of dissolved dimethylsulfoniopropionate (DMSP) in seawater: tracer studies using 35S-DMSP

    NASA Astrophysics Data System (ADS)

    Kiene, Ronald P.; Linn, Laura J.

    2000-08-01

    The algal osmolyte dimethylsulfoniopropionate (DMSP) is distributed globally in the marine euphotic zone, where it represents a major form of reduced sulfur. Previous investigations of DMSP cycling have focused mainly on its degradation to the volatile sulfur species dimethylsulfide (DMS) and little is known about the other possible fates of the sulfur. In this study 35S-DMSP was used to trace the biogeochemical fate of sulfur in the natural pool of dissolved DMSP in seawater. Dissolved 35S-DMSP added to seawater was degraded within hours, with the 35S partitioning into three major, relatively stable, operational pools: particulates, dissolved non-volatile degradation products (DNVS), and volatiles. The mean values for partitioning of DMSP obtained from 20 different seawater incubations were (in terms of sulfur): particulates (33%; range 6-85%;); DNVS (46%; range 21-74%); and volatiles (9%; range 2-21%). Oceanic water samples had lower incorporation of DMSP-S into particulates and higher incorporation into DNVS as compared with coastal-shelf samples. Transient accumulation of untransformed 35S-DMSP in bacteria accounted for some of the particulate 35S, but most of the cell-associated DMSP was rapidly transformed and the sulfur incorporated into relatively stable macromolecules. 35S-labeled DNVS accumulated steadily during DMSP metabolism and approximately half of this pool was confirmed to be sulfate, implying that oxidation of DMSP-sulfur takes place on time scales of minutes to hours. Volatile products were produced rapidly from 35S-DMSP, but most were consumed within 1-3 h. Experiments showed that methanethiol (MeSH) was the major volatile compound produced from tracer DMSP, with longer-lived DMS formed in lower amounts. Tracer additions of 35S-MeSH to seawater resulted in incorporation of sulfur into cellular macromolecules and DNVS, suggesting MeSH was an intermediate in the conversion of DMSP into these pools. Experiments with 35S-DMS revealed that turnover

  18. Sequence of figwort mosaic virus DNA (caulimovirus group).

    PubMed Central

    Richins, R D; Scholthof, H B; Shepherd, R J

    1987-01-01

    The nucleotide sequence of an infectious clone of figwort mosaic virus (FMV) was determined using the dideoxynucleotide chain termination method. The double-stranded DNA genome (7743 base pairs) contained eight open reading frames (ORFs), seven of which corresponded approximately in size and location to the ORFs found in the genome of cauliflower mosaic virus (CaMV) and carnation etched ring virus (CERV). ORFs I and V of FMV demonstrated the highest degrees of nucleotide and amino acid sequence homology with the equivalent coding regions of CaMV and CERV. Regions II, III and IV showed somewhat less homology with the analogous regions of CaMV and CERV, and ORF VI showed homology with the corresponding gene of CaMV and CERV in only a short segment near the middle of the putative gene product. A 16 nucleotide sequence, complementary to the 3' terminus of methionine initiator tRNA (tRNAimet) and presumed to be the primer binding site for initiation of reverse transcription to produce minus strand DNA, was found in the FMV genome near the discontinuity in the minus strand. Sequences near the three interruptions in the plus strand of FMV DNA bear strong resemblance to similarly located sequences of 3 other caulimoviruses and are inferred to be initiation sites for second strand DNA synthesis. Additional conserved sequences in the small and large intergenic regions are pointed out including a highly conserved 35 bp sequence that occurs in the latter region. PMID:3671088

  19. Sequence of figwort mosaic virus DNA (caulimovirus group).

    PubMed

    Richins, R D; Scholthof, H B; Shepherd, R J

    1987-10-26

    The nucleotide sequence of an infectious clone of figwort mosaic virus (FMV) was determined using the dideoxynucleotide chain termination method. The double-stranded DNA genome (7743 base pairs) contained eight open reading frames (ORFs), seven of which corresponded approximately in size and location to the ORFs found in the genome of cauliflower mosaic virus (CaMV) and carnation etched ring virus (CERV). ORFs I and V of FMV demonstrated the highest degrees of nucleotide and amino acid sequence homology with the equivalent coding regions of CaMV and CERV. Regions II, III and IV showed somewhat less homology with the analogous regions of CaMV and CERV, and ORF VI showed homology with the corresponding gene of CaMV and CERV in only a short segment near the middle of the putative gene product. A 16 nucleotide sequence, complementary to the 3' terminus of methionine initiator tRNA (tRNAimet) and presumed to be the primer binding site for initiation of reverse transcription to produce minus strand DNA, was found in the FMV genome near the discontinuity in the minus strand. Sequences near the three interruptions in the plus strand of FMV DNA bear strong resemblance to similarly located sequences of 3 other caulimoviruses and are inferred to be initiation sites for second strand DNA synthesis. Additional conserved sequences in the small and large intergenic regions are pointed out including a highly conserved 35 bp sequence that occurs in the latter region. PMID:3671088

  20. Analysis of figwort mosaic virus (plant pararetrovirus) polyadenylation signal.

    PubMed

    Sanfaçon, H

    1994-01-01

    Analysis of the cauliflower mosaic virus (CaMV) polyadenylation (poly(A)) signal has revealed several striking differences to poly(A) signals from animal genes such as the absence of activating sequences downstream from the cleavage site. Instead, upstream sequences were shown to induce recognition of an AAUAAA sequence. To test whether these features are representative of other plant pararetrovirus poly(A) signals, a characterization of the figwort mosaic virus (FMV) poly(A) signal is presented here. The FMV RNAs were isolated from infected plants and mapped, and the different elements composing the FMV poly(A) signal were identified. Multiple upstream sequences were found to be essential for efficient processing at the FMV poly(A) site and could be replaced by the CaMV upstream elements. The FMV upstream sequences showed homologies to other characterized upstream sequences from CaMV, from animal viruses, and from plant poly(A) signals. Surprisingly, neither the FMV nor the CaMV upstream elements could induce recognition of an AAUAAA sequence present in the FMV poly(A) signal, instead a UAUAAA sequence 55 nucleotides further downstream was utilized. It is proposed that additional features may be required for appropriate cleavage such as the context of the AAUAAA-like sequence or perhaps the cleavage site itself. PMID:8259677

  1. MOSAIC: a new wavefront metrology

    SciTech Connect

    Anderson, Christopher; Naulleau, Patrick

    2009-02-02

    MOSAIC is a new wavefront metrology that enables complete wavefront characterization from print or aerial image based measurements. Here we describe MOSAIC and verify its utility with a model-based proof of principle.

  2. Callisto Scarp Mosaic

    NASA Technical Reports Server (NTRS)

    1997-01-01

    This mosaic of two images shows an area within the Valhalla region on Jupiter's moon, Callisto. North is to the top of the mosaic and the Sun illuminates the surface from the left. The smallest details that can be discerned in this picture are knobs and small impact craters about 155 meters (170 yards) across. The resolution is 46 meters (50 yards) per picture element, and the mosaic covers an area approximately 33 kilometers (20 miles) across. A prominent fault scarp crosses the mosaic. This scarp is one of many structural features that form the Valhalla multi-ring structure, which has a diameter of 4,000 kilometers (2,485 miles). Scientists believe Valhalla is the result of a large impact early in the history of Callisto. Several smaller ridges are found parallel to the prominent scarp. Numerous impact craters ranging in size from 155 meters (170 yards) to 2.5 kilometers (1.5 miles) are seen in the mosaic. The images which form this mosaic were obtained by the solid state imaging system aboard NASA's Galileo spacecraft on Nov. 4, 1996 (Universal Time).

    The Jet Propulsion Laboratory, Pasadena, CA manages the mission for NASA's Office of Space Science, Washington, DC.

    This image and other images and data received from Galileo are posted on the World Wide Web Galileo mission home page at http://galileo.jpl.nasa.gov. Background information and educational context for the images can be found at http://www.jpl.nasa.gov/galileo/sepo.

  3. [Adding calcium salts and sulphur dioxide for preserving firmness and colour of frozen cauliflower (author's transl)].

    PubMed

    Polesello, A; Pizzocaro, F

    1975-01-01

    The results of trials aimed to keep colour and firmness of frozen cauliflower during storage, by pretreatments based on Calcium salts and SO2 impregnation are referred here. Among the different procedures tested, that of introducing under vacuum gaseous SO2 at low pressure, followed by soaking in CaCl2 0,1 N solution has shown the best efficaceousness. PMID:1243936

  4. Bioactive Compounds and Antioxidant Activity of Fresh and Processed White Cauliflower

    PubMed Central

    Ahmed, Fouad A.; Ali, Rehab F. M.

    2013-01-01

    Brassica species are very rich in health-promoting phytochemicals, including phenolic compounds, vitamin C, and minerals. The objective of this study was to investigate the effect of different blanching (i.e., water and steam) and cooking (i.e., water boiling, steam boiling, microwaving, and stir-frying) methods on the nutrient components, phytochemical contents (i.e., polyphenols, carotenoids, flavonoid, and ascorbic acid), antioxidant activity measured by DPPH assay, and phenolic profiles of white cauliflower. Results showed that water boiling and water blanching processes had a great effect on the nutrient components and caused significant losses of dry matter, protein, and mineral and phytochemical contents. However, steam treatments (blanching and cooking), stir-frying, and microwaving presented the lowest reductions. Methanolic extract of fresh cauliflower had significantly the highest antioxidant activity (68.91%) followed by the extracts of steam-blanched, steam-boiled, stir-fried, and microwaved cauliflower 61.83%, 59.15%, 58.93%, and 58.24%, respectively. HPLC analysis revealed that the predominant phenolics of raw cauliflower were protocatechuic acid (192.45), quercetin (202.4), pyrogallol (18.9), vanillic acid (11.90), coumaric acid (6.94), and kaempferol (25.91) mg/100 g DW, respectively. PMID:24171164

  5. Effect of the cauliflower Or transgene on carotenoid accumulation and chromoplast formation in transgenic potato tubers

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Transgenic plants have facilitated our understanding of the functional roles of genes and the metabolic processes affected in plants. Recently, we isolated the Or gene from an orange cauliflower mutant and showed that the Or gene could serve as a novel genetic tool to enrich carotenoid content in tr...

  6. The purple cauliflower arises from activation of a MYB transcription factor

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Anthocyanins are responsible for the color of many flowers, fruits, and vegetables. An interesting and unique Purple (Pr) gene mutation in cauliflower confers an abnormal pattern of anthocyanin accumulation, giving the striking mutant phenotype of intense purple color in curds and a few other tissue...

  7. The purple cauliflower arises from activation of a myb transcription factor

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Anthocyanins are responsible for the color of many flowers, fruits, and vegetables. An interesting and unique Purple (Pr) gene mutation in cauliflower (Brassica oleracea var botrytis) confers an abnormal pattern of anthocyanin accumulation, giving the striking mutant phenotype of intense purple colo...

  8. Optoelectronic properties of cauliflower like ZnO-ZnO nanorod/p-Si heterostructure

    NASA Astrophysics Data System (ADS)

    Rajabi, M.; Dariani, R. S.; Iraji zad, A.; Zahedi, F.

    2013-02-01

    The cauliflower like ZnO nanostructures are grown on ZnO nanorods using spray pyrolysis method. First, ZnO nanorod arrays are grown on p-type silicon substrate without catalyst by chemical vapor transport and condensation method in a horizontal tube furnace. Afterwards, the cauliflower like ZnO nanostructures is deposited on top of the ZnO nanorod array. The PL spectra of cauliflower like ZnO nanostructures consist of UV emission bands around 387 nm and a visible emission at ˜440 nm. The current-voltage (I-V) measurement under dark and UV illumination condition are performed to study photodetection of the cauliflower like ZnO-ZnO nanorod/p-Si heterostructure. The experimental data of dark I-V curve show that the tunneling-recombination model is the dominant current transport mechanism in our device heterostructure below 2 V. It is observed that UV photons are absorbed in ZnO and device exhibit 0.07 A/W responsivity at 5 V reverse bias which correspond to quantum efficiency of 26%.

  9. The missing flux in a 35S budget for the soils of a small polluted catchment

    USGS Publications Warehouse

    Novak, M.; Michel, R.L.; Prechova, E.; Stepanova, M.

    2004-01-01

    A combination of cosmogenic and artificial 35S was used to assess the movement of sulfur in a steep Central European catchment affected by spruce die-back. The Jezer??i?? catchment, Krus??ne?? Hory Mts. (Czech Republic) is characterized by a large disproportion between atmospheric S input and S output via stream discharge, with S output currently exceeding S input three times. A relatively high natural concentration of cosmogenic 35S (42 mBq L-1) was found in atmospheric deposition into the catchment in winter and spring of 2000. In contrast, stream discharge contained only 2 mBq L-1. Consequently, more than 95% of the deposited S is cycled or retained within the catchment for more than several months, while older S is exported via surface water. In spring, when the soil temperature is above 0 ??C, practically no S from instantaneous rainfall is exported, despite the steepness of the slopes and the relatively short mean residence time of water in the catchment (6.5 months). Sulfur cycling in the soil includes not just adsorption of inorganic sulfate and biological uptake, but also volatilization of S compounds back into the atmosphere. Laboratory incubations of an Orthic Podzol from Jezer??i?? spiked with h 720 kBq of artificial 35S showed a 20% loss of the spike within 18 weeks under summer conditions. Under winter conditions, the 35S loss was insignificant (< 5%). This missing S flux was interpreted as volatilized hydrogen sulfide resulting from intermittent dissimilatory bacterial sulfate reduction. The missing S flux is comparable to the estimated uncertainty in many catchment S mass balances (??10%), or even larger, and should be considered in constructing these mass balances. In severely polluted forest catchments, such as Jezer??i??, sulfur loss to volatilization may exceed 13 kg ha-1 a-1, which is more than the current total atmospheric S input in large parts of North America and Europe. ?? 2004 Kluwer Academic Publishers.

  10. Handmade Tile Mosaics

    ERIC Educational Resources Information Center

    Keeler, Rusty

    2007-01-01

    Just like the classroom, children's outdoor environments should be filled with artistic creations that add sparkle and imagination to the space. One of the author's favorite ways to add art to the outdoors is by installing a mosaic mural of child-made tiles. The process of making the tiles is fun for all; each tile is a charming work of art in…

  11. The Tobacco Mosaic Virus.

    ERIC Educational Resources Information Center

    Sulzinski, Michael A.

    1992-01-01

    Explains how the tobacco mosaic virus can be used to study virology. Presents facts about the virus, procedures to handle the virus in the laboratory, and four laboratory exercises involving the viruses' survival under inactivating conditions, dilution end point, filterability, and microscopy. (MDH)

  12. Middle East Mosaic

    Atmospheric Science Data Center

    2013-04-16

    ... camera (right) are comprised of data covering World Reference System-2 paths 165-179 for the period August 16 - August 30, ... mosaic. Because these images are created from 400-kilometer wide orbital swaths acquired on different dates, discontinuities are visible ...

  13. Large-Scale Mosaics

    ERIC Educational Resources Information Center

    Shafer, Jaime

    2010-01-01

    Greater Latrobe Senior High School in Latrobe, Pennsylvania, is a school where art is supported both by the administration and the local community. While the school was undergoing renovations, this author was given the task of creating a six-foot round mosaic in the entrance of the school. The design was to be student-created and was to represent…

  14. Differential degradation of [35S]methionine polypeptides in Duchenne muscular dystrophy skin fibroblasts in vitro.

    PubMed Central

    Rodemann, H P; Bayreuther, K

    1986-01-01

    Rates of protein turnover have been measured in three normal and three Duchenne muscular dystrophy (DMD) skin fibroblast cell lines. Cell populations were analyzed at identical states with regard to cell number, state of topoinhibition, and cumulative population doublings (CPD). Net protein synthesis measured by the incorporation of [35S]methionine in an 18-hr pulse was reduced by an average of 34%; degradation of total cellular protein measured after an 18-hr pulse with [35S]methionine and a 24-hr chase was enhanced by an average of 50% in DMD fibroblasts. Two-dimensional gel electrophoresis analyses revealed that the breakdown of the majority of [35S]methionine polypeptides was markedly increased in DMD fibroblasts. Quantitative determinations of the differential degradation rates of 10 selected proteins in the tropomyosin region of two-dimensional gels were undertaken by scintillation counting and computer analyses. In three series of experiments, the degradation of the 10 proteins in DMD fibroblasts was enhanced by individual polypeptides between 12.0% and 151.2% as measured by scintillation counting or between 0.8% and 128% as determined by computer analyses. Images PMID:3457376

  15. Quantifying groundwater travel time near managed recharge operations using 35S as an intrinsic tracer

    DOE PAGESBeta

    Urióstegui, Stephanie H.; Bibby, Richard K.; Esser, Bradley K.; Clark, Jordan F.

    2016-04-23

    By identifying groundwater retention times near managed aquifer recharge (MAR) facilities is a high priority for managing water quality, especially for operations that incorporate recycled wastewater. In order to protect public health, California guidelines for Groundwater Replenishment Reuse Projects require a minimum 2–6 month subsurface retention time for recycled water depending on the level of disinfection, which highlights the importance of quantifying groundwater travel times on short time scales. This study developed and evaluated a new intrinsic tracer method using the naturally occurring radioisotope sulfur-35 (35S). The 87.5 day half-life of 35S is ideal for investigating groundwater travel times onmore » the <1 year timescale of interest to MAR managers. Natural concentrations of 35S found in water as dissolved sulfate (35SO4) were measured in source waters and groundwater at the Rio Hondo Spreading Grounds in Los Angeles County, CA, and Orange County Groundwater Recharge Facilities in Orange County, CA. 35SO4 travel times are comparable to travel times determined by well-established deliberate tracer studies. The study also revealed that 35SO4 in MAR source water can vary seasonally and therefore careful characterization of 35SO4 is needed to accurately quantify groundwater travel time. But, more data is needed to fully assess whether or not this tracer could become a valuable tool for managers.« less

  16. Self-assembly of Fe 3 O 4 nanocrystal-clusters into cauliflower-like architectures: Synthesis and characterization

    NASA Astrophysics Data System (ADS)

    Zhu, Lu-Ping; Liao, Gui-Hong; Bing, Nai-Ci; Wang, Lin-Lin; Xie, Hong-Yong

    2011-09-01

    Large-scale cauliflower-like Fe 3O 4 architectures consist of well-assembled magnetite nanocrystal clusters have been synthesized by a simple solvothermal process. The as-synthesized Fe 3O 4 samples were characterized by XRD, XPS, FT-IR, SEM, TEM, etc. The results show that the samples exhibit cauliflower-like hierarchical microstructures. The influences of synthesis parameters on the morphology of the samples were experimentally investigated. Magnetic properties of the Fe 3O 4 cauliflower-like hierarchical microstructures have been detected by VSM at room temperature, showing a relatively low saturation magnetization of 65 emu/g and an enhanced coercive force of 247 Oe.

  17. A 1-kb bacteriophage lambda fragment functions as an insulator to effectively block enhancer-promoter interactions in Arabidopsis thaliana

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The 35S cauliflower mosaic virus (CaMV) promoter contains an enhancer element that is able to override the tissue-, organ- and developmental-stage specificity of nearby promoters. Consequently, the precise control of transgene expression in transgenic plants, which often contain the 35S CaMV promot...

  18. One-pot solvothermal route to self-assembly of cauliflower-shaped CdS microspheres

    NASA Astrophysics Data System (ADS)

    Ge, Ming; Cui, Yao; Liu, Lu; Zhou, Zhen

    2011-05-01

    Nearly monodispersed cauliflower-shaped CdS microspheres were prepared through a simple one-step solvothermal route on a large scale by employing sodium dodecyl sulfate (SDS) as the surfactant. Images by field emission scanning electron microscope (FESEM) and transmission electron microscope (TEM) indicate that cauliflower-shaped CdS microspheres with diameters in the range from 1.3 to 4.5 μm are assembled by nanoparticles with an average diameter of approximately 30 nm. The possible formation mechanism of the cauliflower-shaped CdS microspheres was also proposed. The photovoltaic activity of cauliflower-shaped CdS architectures has been investigated, indicating that the as-obtained CdS microspheres exhibited higher photovoltaic performance in comparison with CdS nanoparticles.

  19. Seasonal variations in 35S and Δ17O of sulfate aerosols on the Antarctic plateau

    NASA Astrophysics Data System (ADS)

    Hill-Falkenthal, Jason; Priyadarshi, Antra; Savarino, Joel; Thiemens, Mark

    2013-08-01

    The first reported seasonal Δ17O anomaly in sulfate aerosols and measurements of radioactive 35SO42- activities collected from Dome C, Antarctica, are reported. Δ17O values exhibit minima during summer (as low as 0.91‰) when tropospheric oxidation patterns are dominated by OH/H2O2 mechanisms. Significant enrichment during autumn and spring is observed (up to 2.40‰) as ozone oxidation increases in the troposphere relative to summer and both stratospheric sources and long-range transport become more significant to the total sulfate budget. An unexpected decrease in Δ17O is seen as winter progresses. This decline is concluded to potentially arise due to a reduction in vertical mixing in the troposphere or linked to variations in the long-range transport of sulfur species to Antarctica. 35SO42- activities exhibit maxima during summer (up to 1219 atoms 35S/m3) that correlate with the peak in stratospheric flux and minima during winter (as low as 146 atoms 35S/m3) when the lack of solar radiation substantially reduces photochemical activity. It is shown that 35S offers the potential to be used as an additional tracer to study stratospheric and tropospheric interactions and is used to estimate stratospheric input of sulfur (combination of SO2 and SO42-). Stratospheric sulfur input produces maxima during summer/autumn with an upper limit of 5.5 ng/m3 and minima during winter/spring with an upper limit of 1.1 ng/m3. From these results, it is concluded that the variation in Δ17O is more reliant upon shifts in tropospheric oxidation mechanisms and long-range transport than on changes in the stratospheric flux.

  20. Detection of radioactive 35S at Fukushima and other Japanese sites

    NASA Astrophysics Data System (ADS)

    Priyadarshi, Antra; Hill-Falkenthal, Jason; Thiemens, Mark H.; Yoshida, Naohiro; Toyoda, Sakae; Yamada, Keita; Mukotaka, Arata; Fujii, Ayako; Uematsu, Mitsuo; Hatakeyama, Shiro; Noguchi, Izumi; Nojiri, Yukihiro; Tanimoto, Hiroshi

    2013-01-01

    The Fukushima nuclear power plant was severely damaged by an earthquake and concomitant tsunami during March 2011. An effect of this disaster was secondary formation of radioactive 35S via the 35Cl(n,p)35S reaction, when neutrons from the partially melted reactor cores activated the coolant sea water. Here we report the first measurements of 35S in sulfate aerosols and rain water collected at six Japanese sampling sites, Hokkaido, Tsukuba, Kashiwa, Fuchu, Yokohama, and Fukushima, during March-September 2011. The measured 35SO42- concentrations in aerosols vary significantly. The Kashiwa (AORI) site shows the highest 35SO42- concentration (6.1 × 104 ± 200 atoms/m3) on 1 April 2011, which is nearly 100 times higher than the natural background activity. Considering the percentage loss of 35SO42- resulting from dry and wet deposition and dilution of the radiation plume in the boundary layer during transport, it was determined that the surface air concentration of 35SO42- at the Fukushima would have been 2.8 × 105 atoms/m3 during the week after the earthquake, which is in agreement with the model prediction [Priyadarshi et al.]. 35SO42- activity in rain water collected during March-May 2011 at Tokyo Tech Yokohama varies from 1.1 × 105 to 9.8 × 105 atoms/liter, whereas stream water collected near Fukushima was found to have 1.2 × 105 atoms/liter during April. Even after 6 months, 35SO42- activity remains very high (9.9 × 104 ± 770 atoms/m3) in the marine boundary layer in the Fukushima region, which implies that the reactor core was producing radioactive sulfur.

  1. Moon - North Pole Mosaic

    NASA Technical Reports Server (NTRS)

    1992-01-01

    This view of the Moon's north pole is a mosaic assembled from 18 images taken by Galileo's imaging system through a green filter as the spacecraft flew by on December 7, 1992. The left part of the Moon is visible from Earth; this region includes the dark, lava-filled Mare Imbrium (upper left); Mare Serenitatis (middle left); Mare Tranquillitatis (lower left), and Mare Crisium, the dark circular feature toward the bottom of the mosaic. Also visible in this view are the dark lava plains of the Marginis and Smythii Basins at the lower right. The Humboldtianum Basin, a 650-kilometer (400-mile) impact structure partly filled with dark volcanic deposits, is seen at the center of the image. The Moon's north pole is located just inside the shadow zone, about a third of the way from the top left of the illuminated region.

  2. Measurement of cosmogenic radionuclide 35S in sulfate aerosol in Antarctica

    NASA Astrophysics Data System (ADS)

    Pandey, A.; Savarino, J. P.; Thiemens, M. H.

    2010-12-01

    We report the first measurement of cosmogenically produced radionuclide 35S activity in sulfate aerosols collected at inland (Dome C: latitude 75.6, longitude 123.24, altitude 3233 m) and coastal site (Dumont D’Urville: latitude 66.39, longitude 140.01, altitude 43 m) in Antarctica. Sulfate aerosol samples were collected using a High-Volume aerosol sampler on a glass fiber filter paper for 7 days once a month for a year. The radioactivity was measured using low noise liquid scintillation spectrometer1.The measurements reveal a maximum abundance of 35SO4 in spring-summer (500-1200 35S atoms/m3) and minimum (50-200 atoms/m3) during winter. This variation is explained by considering the relative seasonality of the air circulation patterns prevailing at inland and the costal sites. Tropospheric-stratospheric air mixing in summer leads to higher 35SO4, whereas a lack of mixing within the winter polar vortex causes a significant decrease in 35SO4. The 35S activity was found to be higher in fine sulfate aerosol particle (PM 2.5) as compared to coarse (PM10) at DDU. The normalised activity, the ratio of 35SO4 to the total sulfate concentration, shows no link of 35SO4 (or activity) concentration to the local meteorological conditions responsible for sulfate aerosol formation. Rather, the observed high value indicates higher air mass mixing between the stratosphere and troposphere. A secondary 35SO4 peak is observed at both stations during July and August. Based on a preliminary model, an additional 4-6% stratospheric contribution, either due to the stratospheric air mass intrusion into the troposphere or evaporation of 35SO4 from cloud particles during Polar Stratospheric Cloud sedimentation is required to explain this enhancement during the polar winter. 1 Brother, L.A., G. Dominguez, A. Abramian, A. Corbin, Ben Bluen, and M. H. Thiemens, Otimized low-level liquid scintillation spectroscopy of 35S for atmospheric and biogeochemical chemistry applications, Proceedings

  3. Mosaic of Saturn's rings

    NASA Technical Reports Server (NTRS)

    2000-01-01

    This detailed mosaic of the underside of the Cassini Division was obtained by Voyager 1 with a resolution of about 10 kilometers. The classical Cassini Division appears here to the right of center as five bright rings with substantial blacks gap on either side. The inner edge of the A Ring, to the left of center, is the brightest part of this image. The fine-scale wave structure in this region has been interpreted as being the result of gravitational density waves.

  4. Callisto Crater Chain Mosaic

    NASA Technical Reports Server (NTRS)

    1997-01-01

    This mosaic of three images shows an area within the Valhalla region on Jupiter's moon, Callisto. North is to the top of the mosaic and the Sun illuminates the surface from the left. The smallest details that can be discerned in this picture are knobs and small impact craters about 160 meters (175 yards) across. The mosaic covers an area approximately 45 kilometers (28 miles) across. It shows part of a prominent crater chain located on the northern part of the Valhalla ring structure.

    Crater chains can form from the impact of material ejected from large impacts (forming secondary chains) or by the impact of a fragmented projectile, perhaps similar to the Shoemaker-Levy 9 cometary impacts into Jupiter in July 1994. It is believed this crater chain was formed by the impact of a fragmented projectile. The images which form this mosaic were obtained by the solid state imaging system aboard NASA's Galileo spacecraft on Nov. 4, 1996 (Universal Time).

    Launched in October 1989, Galileo entered orbit around Jupiter on December 7, 1995. The spacecraft's mission is to conduct detailed studies of the giant planet, its largest moons and the Jovian magnetic environment. The Jet Propulsion Laboratory, Pasadena, CA manages the mission for NASA's Office of Space Science, Washington, DC.

    This image and other images and data received from Galileo are posted on the World Wide Web Galileo mission home page at http://galileo.jpl.nasa.gov. Background information and educational context for the images can be found at http:// www.jpl.nasa.gov/galileo/sepo.

  5. Synthesis and electrochemical behavior of nanostructured cauliflower-shape Co-Ni/Co-Ni oxides composites

    SciTech Connect

    Gupta, Vinay Kawaguchi, Toshikazu; Miura, Norio

    2009-01-08

    Nanostructured Co-Ni/Co-Ni oxides were electrochemically deposited onto stainless steel electrode by electrochemical method and characterized for their structural and supercapacitive properties. The SEM images indicated that the obtained Co-Ni/Co-Ni oxides had cauliflower-type nanostructure. The X-ray diffraction pattern showed the formation of Co{sub 3}O{sub 4}, NiO, Co and Ni. The EDX elemental mapping images indicated that Ni, Co and O are distributed uniformly. The deposited Co-Ni/Co-Ni oxides showed good supercapacitive characteristics with a specific capacitance of 331 F/g at 1 mA/cm{sup 2} current density in 1 M KOH electrolyte. A mechanism of the formation of cauliflower-shape Co-Ni/Co-Ni oxides was proposed. A variety of promising applications in the fields such as energy storage devices and sensors can be envisioned from Co-Ni/Co-Ni oxides.

  6. Enhanced spectral emissivity of CeO2 coating with cauliflower-like microstructure

    NASA Astrophysics Data System (ADS)

    Huang, Jianping; Li, Yibin; He, Xiaodong; Song, Guangping; Fan, Chenglei; Sun, Yue; Fei, Weidong; Du, Shanyi

    2012-10-01

    Cerium dioxide is a transparent oxide with high refractive index (from 1.6 to 2.5 at 633 nm) in the visible and near-IR spectral regions. However, little attention has been paid to its optical property in mid-IR (2.5-25 μm). Here we report that the cauliflower-like microstructured CeO2 coating deposited by electron beam physical vapor deposition technique shows high emissivity up to 0.9 at 873 K in the mid-IR spectral region. The high emissivity is attributed to the coupling between free propagating waves and space-variant polarizations caused by the cauliflower-like microstructure. This high emissivity coating shows a potential application in high temperature components.

  7. Mosaic of Io

    NASA Technical Reports Server (NTRS)

    1997-01-01

    Mosaic of images of Io acquired during orbit C3, showing more than half of Io's surface. These are the best images available to show topographic features over most of this region. The map projection is called Simple Cylindrical, and the grid lines mark 10 degree intervals of latitude and longitude.

    The mosaic covers an area of about 8 million square kilometers, and the finest details that can discerned are about 2.5 kilometers in size. North is to the top of the picture and the sun illuminates the surface from the left. The images which form this mosaic were obtained through the clear filter of the Solid State Imaging (CCD) system aboard NASA's Galileo spacecraft on Nov. 6, 1996 (Universal Time) at a range which varied from 245,719 kilometers to 403,100 kilometers.

    The Jet Propulsion Laboratory, Pasadena, CA manages the mission for NASA's Office of Space Science, Washington, DC.

    This image and other images and data received from Galileo are posted on the World Wide Web, on the Galileo mission home page at URL http://galileo.jpl.nasa.gov. Background information and educational context for the images can be found at URL http://www.jpl.nasa.gov/galileo/sepo

  8. Effect of Sugarcane Mosaic caused by Sorghum mosaic virus on sugarcane in Louisiana

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Sugarcane mosaic is caused by two viruses, Sugarcane mosaic virus (SCVM) or Sorghum mosaic virus (SrMV). In Louisiana, SrMV is the predominant mosaic pathogen affecting sugarcane. In a field experiment established in 2012, plots were planted with seed cane with or without mosaic symptoms. The mosaic...

  9. Mutations in cauliflower and sprout broccoli grown from seeds flown in space

    NASA Astrophysics Data System (ADS)

    Wu, Hong; Huang, Congli; Zhang, Keping; Sun, Yeqing

    2010-11-01

    Cauliflower and sprout broccoli are widely planted vegetables particularly in Fujian Province, China. To study the mutation in these two types of vegetables induced from spaceflight, we flew the seeds on the 20th Chinese recoverable satellite which orbited the Earth for 18 days. After returning to the Earth, the cauliflower seeds were planted for two generations and the sprout broccoli seeds for one generation at the Xiamen Agriculture Research Institute. Of the 12 cauliflowers planted for the first generation, two showed significant phenotypical changes in both the size of the plant and the weight of the flower head. In addition, most of the space flown plants were found to be resistant to the black rot attack in the field. Cauliflowers planted for the second generation from the seeds in one of the two plants that displayed phenotypical changes in the first generation showed similar mutations. For the first generation of sprout broccoli, the rate of emergence from the flown seeds was lower than that of the control by 30%. No significant changes in the phenotype between the sprout broccolis planted from the flown seeds and the control were observed except one of the mutated sprout broccolis showed a change in the appearance in the lesser bud of the chief flower head. Results of the study demonstrated that DNA damages in some of the genes may have occurred in the seeds flown in space, and some of the changes in the genes may have inherited from the first to the second generation. The improved resistance to the black rot attack and increased size of the flower head are apparently beneficial.

  10. N-linked glycosylation of native and recombinant cauliflower xyloglucan endotransglycosylase 16A.

    PubMed Central

    Henriksson, Hongbin; Denman, Stuart E; Campuzano, Iain D G; Ademark, Pia; Master, Emma R; Teeri, Tuula T; Brumer, Harry

    2003-01-01

    The gene encoding a XET (xyloglucan endotransglycosylase) from cauliflower ( Brassica oleracea var. botrytis ) florets has been cloned and sequenced. Sequence analysis indicated a high degree of similarity to other XET enzymes belonging to glycosyl hydrolase family 16 (GH16). In addition to the conserved GH16 catalytic sequence motif EIDFE, there exists one potential N-linked glycosylation site, which is also highly conserved in XET enzymes from this family. Purification of the corresponding protein from extracts of cauliflower florets allowed the fractionation of a single, pure glycoform, which was analysed by MS techniques. Accurate protein mass determination following the enzymic deglycosylation of this glycoform indicated the presence of a high-mannose-type glycan of the general structure GlcNAc2Man6. LC/MS and MS/MS (tandem MS) analysis provided supporting evidence for this structure and confirmed that the glycosylation site (underlined) was situated close to the predicted catalytic residues in the conserved sequence YLSSTNNEHDEIDFEFLGNRTGQPVILQTNVFTGGK. Heterologous expression in Pichia pastoris produced a range of protein glycoforms, which were, on average, more highly mannosylated than the purified native enzyme. This difference in glycosylation did not influence the apparent enzymic activity of the enzyme significantly. However, the removal of high-mannose glycosylation in recombinant cauliflower XET by endoglycosidase H, quantified by electrospray-ionization MS, caused a 40% decrease in the transglycosylation activity of the enzyme. No hydrolytic activity was detected in native or heterologously expressed BobXET16A, even when almost completely deglycosylated. PMID:12826015

  11. Universality of cauliflower-like fronts: from nanoscale thin films to macroscopic plants

    NASA Astrophysics Data System (ADS)

    Castro, Mario; Cuerno, Rodolfo; Nicoli, Matteo; Vázquez, Luis; Buijnsters, Josephus G.

    2012-10-01

    Chemical vapor deposition (CVD) is a widely used technique to grow solid materials with accurate control of layer thickness and composition. Under mass-transport-limited conditions, the surface of thin films thus produced grows in an unstable fashion, developing a typical motif that resembles the familiar surface of a cauliflower plant. Through experiments on CVD production of amorphous hydrogenated carbon films leading to cauliflower-like fronts, we provide a quantitative assessment of a continuum description of CVD interface growth. As a result, we identify non-locality, non-conservation and randomness as the main general mechanisms controlling the formation of these ubiquitous shapes. We also show that the surfaces of actual cauliflower plants and combustion fronts obey the same scaling laws, proving the validity of the theory over seven orders of magnitude in length scales. Thus, a theoretical justification is provided, which had remained elusive so far, for the remarkable similarity between the textures of surfaces found for systems that differ widely in physical nature and typical scales.

  12. In Situ Mosaic Brightness Correction

    NASA Technical Reports Server (NTRS)

    Deen, Robert G.; Lorre, Jean J.

    2012-01-01

    In situ missions typically have pointable, mast-mounted cameras, which are capable of taking panoramic mosaics comprised of many individual frames. These frames are mosaicked together. While the mosaic software applies radiometric correction to the images, in many cases brightness/contrast seams still exist between frames. This is largely due to errors in the radiometric correction, and the absence of correction for photometric effects in the mosaic processing chain. The software analyzes the overlaps between adjacent frames in the mosaic and determines correction factors for each image in an attempt to reduce or eliminate these brightness seams.

  13. Center of parcel with mosaics. Mosaics consist of everyday throwaway ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    Center of parcel with mosaics. Mosaics consist of everyday throwaway objects of all kinds set in concrete mortar on ground. Leaning Tower of Bottle Village in front of Rumpus Room primary façade with 12' scale (in tenths). Camera facing north. - Grandma Prisbrey's Bottle Village, 4595 Cochran Street, Simi Valley, Ventura County, CA

  14. Comparison of the mutagenic effects of 35S decay in Escherichia coli strains WP-2 and WP-2S.

    PubMed

    Pluciennik, H; Kański, R

    1975-01-01

    Comparison was made of the lethal and mutagenic efficiency of 35S yields 35Cl transmutation of incorporated 35S in cells of Escherichia coli strain WP-2 and WP-2S (UV-sensitive). Bacteria were stored at minus 196 degrees. 35S yields 35Cl transmutation induced a higher lethal effect in strain WP-2 than in the UV-sensitive strain WP-2S. Reversions try yields try+ were induced with an approximately similar efficiency in both strains compared. PMID:1090114

  15. Global Mercator Mosaic

    NASA Technical Reports Server (NTRS)

    1983-01-01

    Io's volcanic plains are shown in this Voyager 1 image mosaic which covers the area roughly from latitude 60 degrees N. to latitude 60 degrees S. and longitude 100-345. North is up. Numerous volcanic calderas, lava flows, and volcanic eruption plumes are visible here. The composition of Io's volcanic plains and lava flows has not been determined, but they could consist dominantly of sulfur with surface frosts of sulfur dioxide or of silicates (such as basalt) encrusted with sulfur and sulfur dioxide condensates. The bright whitish patches probably consist of freshly deposited sulfur dioxide frost.

  16. Jovian Ring System Mosaic

    NASA Technical Reports Server (NTRS)

    2000-01-01

    NASA's Galileo spacecraft acquired this mosaic of Jupiter's ring system (top) when the spacecraft was in Jupiter's shadow looking back toward the Sun. Jupiter's ring system (inset diagram) is composed of three parts: an outermost gossamer ring, a flat main ring, and an innermost donut-shaped halo. These rings are made up of dust-sized particles that are blasted off of the nearby inner satellites by small impacts. This image was taken on November 9, 1996 at a distance of 2.3 million kilometers (1.4 million miles).

  17. Mosaic neurofibromatosis type 1.

    PubMed

    Liang, Christine; Schaffer, Julie V

    2008-01-01

    A 24-year-old man presented with numerous lentigines and multiple cafe-au-lait macules on both sides of the face, neck, and trunk as well as on the proximal area of the upper extremities and in the axillae. The pigmented lesions had a Blaschko-linear distribution on the upper trunk and were limited to the left side of the abdomen, with a sharp demarcation at the midline. Multiple, cutaneous neurofibromas were found on the trunk, and ophthalmologic examination showed a Lisch nodule in the left iris. The clinical findings and their widespread but segmental distribution were consistent with a diagnosis of mosaic neurofibromatosis type 1. PMID:18627742

  18. Rock Garden Mosaic

    NASA Technical Reports Server (NTRS)

    1997-01-01

    This image mosaic of part of the 'Rock Garden' was taken by the Sojourner rover's left front camera on Sol 71 (September 14). The rock 'Shark' is at left center and 'Half Dome' is at right. Fine-scale textures on the rocks are clearly seen. Broken crust-like material is visible at bottom center.

    Mars Pathfinder is the second in NASA's Discovery program of low-cost spacecraft with highly focused science goals. The Jet Propulsion Laboratory, Pasadena, CA, developed and manages the Mars Pathfinder mission for NASA's Office of Space Science, Washington, D.C. JPL is a division of the California Institute of Technology (Caltech).

  19. Preparation of sup 35 S-labeled polyphosphorothioate oligodeoxyribonucleotides by use of hydrogen phosphonate chemistry

    SciTech Connect

    Stein, A.; Iversen, P.L.; Subasinghe, C.; Cohen, J.S.; Stec, W.J.; Zon, G. )

    1990-07-01

    The title compounds were chemically synthesized as their 5'-dimethoxytrityl derivatives by base-catalyzed reaction of {sup 35}S-enriched elemental sulfur with support-bound hydrogen phosphonate oligomer. This was derived from adamantane carbonyl chloride-activated coupling of nucleotide hydrogen phosphonate monomers, and similarly activated capping with isopropyl phosphite. A convenient, disposable, reversed-phase cartridge was utilized to purify and isolate the 5'-dimethoxytrityl derivative for subsequent in situ detritylation and elution of the final product. The specific activity obtained for the title compounds was ca. 10(7) cpm/mumols-eq P(O)S-. The procedure should be readily adaptable to appropriate syntheses of other P-S containing analogs of DNA and RNA.

  20. Landsat Image Mosaic of Antarctica

    USGS Publications Warehouse

    U.S. Geological Survey

    2007-01-01

    Description Fact sheet introduces the Landsat Image Mosaic of Antarctica (LIMA) with images from a section of the mosaic over McMurdo Station, descriptions of the four versions of LIMA, where to access and download LIMA, and a brief explanation of the Antarctic Web portal.

  1. Satellite Image Mosaic Engine

    NASA Technical Reports Server (NTRS)

    Plesea, Lucian

    2006-01-01

    A computer program automatically builds large, full-resolution mosaics of multispectral images of Earth landmasses from images acquired by Landsat 7, complete with matching of colors and blending between adjacent scenes. While the code has been used extensively for Landsat, it could also be used for other data sources. A single mosaic of as many as 8,000 scenes, represented by more than 5 terabytes of data and the largest set produced in this work, demonstrated what the code could do to provide global coverage. The program first statistically analyzes input images to determine areas of coverage and data-value distributions. It then transforms the input images from their original universal transverse Mercator coordinates to other geographical coordinates, with scaling. It applies a first-order polynomial brightness correction to each band in each scene. It uses a data-mask image for selecting data and blending of input scenes. Under control by a user, the program can be made to operate on small parts of the output image space, with check-point and restart capabilities. The program runs on SGI IRIX computers. It is capable of parallel processing using shared-memory code, large memories, and tens of central processing units. It can retrieve input data and store output data at locations remote from the processors on which it is executed.

  2. Moon - 18 Image Mosaic

    NASA Technical Reports Server (NTRS)

    1992-01-01

    This mosaic picture of the Moon was compiled from 18 images taken with a green filter by Galileo's imaging system during the spacecraft's flyby on December 7, 1992, some 11 hours before its Earth flyby at 1509 UTC (7:09 a.m. Pacific Standard Time) December 8. The north polar region is near the top part of the mosaic, which also shows Mare Imbrium, the dark area on the left; Mare Serenitatis at center; and Mare Crisium, the circular dark area to the right. Bright crater rim and ray deposits are from Copernicus, an impact crater 96 kilometers (60 miles) in diameter. Computer processing has exaggerated the brightness of poorly illuminated features near the day/night terminator in the polar regions, giving a false impression of high reflectivity there. The digital image processing was done by DLR the German aerospace research establishment near Munich, an international collaborator in the Galileo mission. The Galileo project, whose primary mission is the exploration of the Jupiter system in 1995-97, is managed for NASA's Office of Space Science and Applications by the Jet Propulsion Laboratory.

  3. [Morphological features of transgenic tobacco plants expressing the AINTEGUMENTA gene of rape under control of the Dahlia mosaic virus promoter].

    PubMed

    Kuluev, B R; Kniazev, A V; Cheremis, A V; Vakhitov, V A

    2013-01-01

    Transgenic tobacco plants expressing the AINTEGUMENTA gene of rape under control of the 35S promoter and the promoter of dahlia mosaic virus were obtained. The transgenic plants were characterized by increase in the length of the leaves, flower sizes, stem height, and weight of seeds; at the same time, the degree of increase was greater in the case of use of the dahlia mosaic virus promoter as a regulator of transcription. Ectopic expression of the AINTEGUMENTA gene promoted prolongation of leaf growth, while sizes of epidermal cells of the leaves remained unchanged. PMID:23785848

  4. The role of BoFLC2 in cauliflower (Brassica oleracea var. botrytis L.) reproductive development.

    PubMed

    Ridge, Stephen; Brown, Philip H; Hecht, Valérie; Driessen, Ronald G; Weller, James L

    2015-01-01

    In agricultural species that are sexually propagated or whose marketable organ is a reproductive structure, management of the flowering process is critical. Inflorescence development in cauliflower is particularly complex, presenting unique challenges for those seeking to predict and manage flowering time. In this study, an integrated physiological and molecular approach was used to clarify the environmental control of cauliflower reproductive development at the molecular level. A functional allele of BoFLC2 was identified for the first time in an annual brassica, along with an allele disrupted by a frameshift mutation (boflc2). In a segregating F₂ population derived from a cross between late-flowering (BoFLC2) and early-flowering (boflc2) lines, this gene behaved in a dosage-dependent manner and accounted for up to 65% of flowering time variation. Transcription of BoFLC genes was reduced by vernalization, with the floral integrator BoFT responding inversely. Overall expression of BoFT was significantly higher in early-flowering boflc2 lines, supporting the idea that BoFLC2 plays a key role in maintaining the vegetative state. A homologue of Arabidopsis VIN3 was isolated for the first time in a brassica crop species and was up-regulated by two days of vernalization, in contrast to findings in Arabidopsis where prolonged exposure to cold was required to elicit up-regulation. The correlations observed between gene expression and flowering time in controlled-environment experiments were validated with gene expression analyses of cauliflowers grown outdoors under 'natural' vernalizing conditions, indicating potential for transcript levels of flowering genes to form the basis of predictive assays for curd initiation and flowering time. PMID:25355864

  5. Dermatoglyphics in mosaic Down's syndrome.

    PubMed

    Priest, J H; Tishler, P V; Rosner, B

    1976-04-01

    To determine whether quanitative dermal indices are useful in ascertaining the liability for or severity of mosaic Down's syndrome (DS), dermatoglyphics of 107 subjects with proven 46/47,+21 DS were scored by four quantitative dermal indices. The distribution of mosaics by weighted mean percentage of +21 cells ranged from 1 to 95 and was bimodal. Mean maternal age at birth of mosaics (32.9 +/- 7.5 years) was elevated when compared with control maternal ages in the literature. The distribution of quantitative dermal indices for the total mosaic population fell roughly midway between those in the literature for normal and full DS individuals: 73% of mosaics were classified as definitively DS, 21% were in the intermediate range, and 6% were normal. For mosaics who were minimally affected, 24% were DS, 53% intermediate, and 23% normal. One can conclude: (1) For any suspect mosaic, a dermal score in the DS range is highly suggestive of karyotypic pathology. (2) The high prevalence of intermediate scores in normal subjects severely restricts their diagnostic value in screening for mosaics in the general population. For a selected population, such as parents of +21 children, the screening value of quantitative dermal indices remains an open question. Weighted regression analyses demonstrate a highly significant correlation (P less than 0.001) of dermal index score with the weighted mean proportion of +21 cells transformed to the logit scale. One may exploit this correlation to predict the ratio of +21/normal cells in infants, in whom early karyotype evolution can preclude an estimate of the ultimate syndrome based on initial degree of mosaicism. Furthermore, this correlation provides additional indirect evidence that dermal microsymptoms in DS are a reflection of the presence of +21 cells. PMID:131014

  6. Stimulation by Erwinia carotovora of the synthesis of ethylene in cauliflower tissue

    PubMed Central

    Lund, Barbara M.; Mapson, L. W.

    1970-01-01

    The synthesis of ethylene by cauliflower floret tissue was increased when the tissue was inoculated with the soft-rot bacterium Erwinia carotovora. This effect was clearly associated with the production of pectic enzymes by the micro-organism. These enzymes, acting together with the plant enzymes, stimulated the production of ethylene from methionine. The increased synthetic activity was due to the release and increased activity of a glucose oxidase enzyme apparently attached to plant cell-wall material and liberated by the action of pectic enzymes of the bacterium. ImagesPLATE 1 PMID:5488914

  7. Natural Products and Biological Activity of the Pharmacologically Active Cauliflower Mushroom Sparassis crispa

    PubMed Central

    Kimura, Takashi

    2013-01-01

    Sparassis crispa, also known as cauliflower mushroom, is an edible mushroom with medicinal properties. Its cultivation became popular in Japan about 10 years ago, a phenomenon that has been attributed not only to the quality of its taste, but also to its potential for therapeutic applications. Herein, I present a comprehensive summary of the pharmacological activities and mechanisms of action of its bioactive components, such as beta-glucan, and other physiologically active substances. In particular, the immunomodulatory mechanisms of the beta-glucan components are presented herein in detail. PMID:23586068

  8. Reconfigurable mosaic annular arrays.

    PubMed

    Thomenius, Kai E; Wodnicki, Robert; Cogan, Scott D; Fisher, Rayette A; Burdick, Bill; Smith, L Scott; Khuri-Yakub, Pierre; Lin, Der-Song; Zhuang, Xuefeng; Bonitz, Barry; Davies, Todd; Thomas, Glen; Woychik, Charles

    2014-07-01

    Mosaic annular arrays (MAA) based on reconfigurable array (RA) transducer electronics assemblies are presented as a potential solution for future highly integrated ultrasonic transducer subsystems. Advantages of MAAs include excellent beam quality and depth of field resulting from superior elevational focus compared with 1-D electronically scanned arrays, as well as potentially reduced cost, size, and power consumption resulting from the use of a limited number of beamforming channels for processing a large number of subelements. Specific design tradeoffs for these highly integrated arrays are discussed in terms of array specifications for center frequency, element pitch, and electronic switch-on resistance. Large-area RAs essentially function as RC delay lines. Efficient architectures which take into account RC delay effects are presented. Architectures for integration of the transducer and electronics layers of large-area array implementations are reviewed. PMID:24960699

  9. Earth - Antarctica Mosaic

    NASA Technical Reports Server (NTRS)

    1990-01-01

    This color picture of the limb of the Earth, looking north past Antarctica, is a mosaic of 11 images taken during a ten-minute period near 5:45 p.m. PST Dec. 8, 1990, by Galileo's imaging system. Red, green and violet filters were used. The picture spans about 1,600 miles across the south polar latitudes of our planet. The morning day/night terminator is toward the right. The South Pole is out of sight below the picture; the visible areas of Antarctica are those lying generally south of South America. The violet-blue envelope of Earth's atmosphere is prominent along the limb to the left. At lower left, the dark blue Amundsen Sea lies to the left of the Walgreen and Bakutis Coasts. Beyond it, Peter Island reacts with the winds to produce a striking pattern of atmospheric waves.

  10. Tyrrhena Patera Mosaic

    NASA Technical Reports Server (NTRS)

    2004-01-01

    This image of Tyrrhena Patera is a mosaic of daytime thermal infrared images colorized with a mosaic of nighttime temperature images (purple/blue is coldest, yellow/red is warmest).

    The colder nighttime temperatures (blue hues) in the caldera and on the flanks of the volcano indicate that this area is likely covered with finer-grained materals. This contrasts strongly against the warm (red) area to the northwest. These warmer temperatures indicate a rockier surface, possibly even exposed bedrock. This is especially probably where the red hues conform with the topography.

    Note: this THEMIS visual image has not been radiometrically nor geometrically calibrated for this preliminary release. An empirical correction has been performed to remove instrumental effects. A linear shift has been applied in the cross-track and down-track direction to approximate spacecraft and planetary motion. Fully calibrated and geometrically projected images will be released through the Planetary Data System in accordance with Project policies at a later time.

    NASA's Jet Propulsion Laboratory manages the 2001 Mars Odyssey mission for NASA's Office of Space Science, Washington, D.C. The Thermal Emission Imaging System (THEMIS) was developed by Arizona State University, Tempe, in collaboration with Raytheon Santa Barbara Remote Sensing. The THEMIS investigation is led by Dr. Philip Christensen at Arizona State University. Lockheed Martin Astronautics, Denver, is the prime contractor for the Odyssey project, and developed and built the orbiter. Mission operations are conducted jointly from Lockheed Martin and from JPL, a division of the California Institute of Technology in Pasadena.

  11. Registration assisted mosaic generation

    NASA Technical Reports Server (NTRS)

    Lorre, Jean J.; Handley, Thomas H., Jr.

    1997-01-01

    This paper presents a general strategy for assembling mosaics from numerous individual images where uncertainty exists in the position and orientation of those images. Both of the presented applications relate to remotely operated camera platforms, the first being the Galileo solid state imaging (SSI) camera presently in orbit around Jupiter, and the second being the Imager for Mars Pathfinder (IMP) stereo camera on Mars. A basic strategy in both applications is to determine the correct relative camera pointing followed by direct map projection of the images. It is assumed that approximate camera pointing exists sufficient to locate adjacent images and to place initial tiepoints within reach of the correlator. Spatial correlation is used to fix tiepoints whose initial locations are predicted by the camera pointing. We use either an fast fourier transform (fft) algorithm or a variant of Gruen's scheme permitting limited image rotation and skew. The Gruen correlator has three hierarchical modes: 1) A classical spatial least squares correlation on integral pixel boundaries used when rotation is small. 2) An annealing non-deterministic search used when rotations are unknown. A simplex deterministic search used for the end game. The correlation operation can be performed either interactively or autonomously. The final camera pointing solution relies upon a simplex downhill search in 2n or 3n dimensions where n is the number of images comprising the mosaic and the objective function to be minimized is the disagreement between tiepoint locations predicted from the camera pointing with those observed by the correlator. For Galileo the 3n unknowns are euler angles defining camera pointing in planet coordinates, and for Mars Pathfinder they are 2n unknowns representing commanded azimuth and elevation in the Lander coordinate system.

  12. Determination of {sup 35}S in radioisotope wastes by a wet oxidation

    SciTech Connect

    Lee, Heung N.; Sang-Hoon Kang; Hong Joo Ahn; Kwang Yong Jee; Wook Hyun Sohn

    2007-07-01

    The oxidation studies of a sulfur to a sulfate ion by various oxy-halide oxidants in organic (thiourea, methionine) and inorganic (sulfate, thiophosphate) compounds were carried out in an acidic solution. The optimized result of the oxidation reaction was obtained when a bromate compound (BrO{sub 3}{sup -}) as an oxidant and a 3 M HNO{sub 3} solvent. The chemical yield for the oxidation of the organic and inorganic sulfur compounds to a sulfate ion was monitored as 80% for thiophosphate, 87% for methionine, and 100% for thiourea and sulfate within 5% RSD. The oxidation of thiourea required at least 1.6 equivalents of the bromate in an acidic solution. In the case of the oxidation of methionine and thiophosphate, the oxidation yield was above 80% if the bromate was used at 20 times that of the substrates. The chemical yield in the paper sample (WypAll) exceeded 100% because of its background sulfur contents (910 ppm). The sulfate ion was quantitatively measured by using GPC and/or LSC counting of 3 S followed by precipitates of BaSO{sub 4}. The interfering nuclides ({sup 14}C, {sup 32}P) were removed in an acidic condition. The minimum detectable activity (MDA) of {sup 35}S was found to be 0.1 Bq/g. (authors)

  13. The Viking Mosaic Catalog, Volume 2

    NASA Technical Reports Server (NTRS)

    Evans, N.

    1982-01-01

    A collection of more than 500 mosaics prepared from Viking Orbiter images is given. Accompanying each mosaic is a footprint plot, which identifies by location, picture number, and order number, each frame in the mosaic. Corner coordinates and pertinent imaging information are also included. A short text provides the camera characteristics, image format, and data processing information necessary for using the mosaic plates as a research aide. Procedures for ordering mosaic enlargements and individual images are also provided.

  14. A plant 35S CaMV promoter induces long-term expression of luciferase in Atlantic salmon

    PubMed Central

    Seternes, Tore; Tonheim, Tom C.; Myhr, Anne I.; Dalmo, Roy A.

    2016-01-01

    The long-term persistence and activity of a naked plasmid DNA (pGL3-35S) containing a luc gene (reporter gene) controlled by a plant 35S CaMV promoter was studied in Atlantic salmon (Salmo salar L.) after injection. Atlantic salmon (mean weight 70 grams) were injected intramuscularly with 100 μg of plasmid DNA. Blood, different tissues and organs were sampled at different time points up to day 535 after injection. Southern blot analysis suggested the presence of extra-chromosomally open circular, linear and supercoiled topoforms of pGL3-35S at day 150 after injection. At day 536 open circular and supercoiled topoforms were detected. Luciferase activity was detected at the injection site up to 536 days post-injection of pGL3-35S, where it peaked at day 150 and decreased to approximately 17% of its maximum activity by day 536. Our study demonstrated that a plasmid containing the 35S promoter was able to induce expression of a reporter gene/protein in fish in vivo and that the plasmid DNA persisted for a prolonged time after intramuscular injection. PMID:27114167

  15. A plant 35S CaMV promoter induces long-term expression of luciferase in Atlantic salmon.

    PubMed

    Seternes, Tore; Tonheim, Tom C; Myhr, Anne I; Dalmo, Roy A

    2016-01-01

    The long-term persistence and activity of a naked plasmid DNA (pGL3-35S) containing a luc gene (reporter gene) controlled by a plant 35S CaMV promoter was studied in Atlantic salmon (Salmo salar L.) after injection. Atlantic salmon (mean weight 70 grams) were injected intramuscularly with 100 μg of plasmid DNA. Blood, different tissues and organs were sampled at different time points up to day 535 after injection. Southern blot analysis suggested the presence of extra-chromosomally open circular, linear and supercoiled topoforms of pGL3-35S at day 150 after injection. At day 536 open circular and supercoiled topoforms were detected. Luciferase activity was detected at the injection site up to 536 days post-injection of pGL3-35S, where it peaked at day 150 and decreased to approximately 17% of its maximum activity by day 536. Our study demonstrated that a plasmid containing the 35S promoter was able to induce expression of a reporter gene/protein in fish in vivo and that the plasmid DNA persisted for a prolonged time after intramuscular injection. PMID:27114167

  16. Mars Image Collection Mosaic Builder

    NASA Technical Reports Server (NTRS)

    Plesea, Lucian; Hare, Trent

    2008-01-01

    A computer program assembles images from the Mars Global Surveyor (MGS) Mars Observer Camera Narrow Angle (MOCNA) collection to generate a uniform-high-resolution, georeferenced, uncontrolled mosaic image of the Martian surface. At the time of reporting the information for this article, the mosaic covered 7 percent of the Martian surface and contained data from more than 50,000 source images acquired under various light conditions at various resolutions.

  17. Endophyte-mediated interactions between cauliflower, the herbivore Spodoptera litura, and the ectoparasitoid Bracon hebetor.

    PubMed

    Kaur, Tamanreet; Singh, Bahaderjeet; Kaur, Amarjeet; Kaur, Sanehdeep

    2015-10-01

    Fungal endosymbionts in plants may influence interactions among plants, herbivores and their parasitoids through the production of secondary metabolites. We used a lepidopteran pest and its generalist parasitoid to test the effect of endophyte-infected plants on a third trophic level. Endophytic fungi, Aspergillus flavus and Aspergillus niger, isolated from Acacia arabica, were used to infect cauliflower plants. We found that the presence of the endophyte in the plants significantly extended the development period of Spodoptera litura (Fab.) larvae. Feeding of the host on endophyte-infected plants further adversely affected the development and performance of its parasitoid, Bracon hebetor (Say). A negative impact was also recorded for longevity and fecundity of endophyte-naive parasitoid females due to the parasitization of host larvae fed on endophyte-infected plants. The presence of endophytes in the diet of the host larvae significantly prolonged the development of the parasitoid. A strong detrimental effect was also recorded for larval survival and emergence of parasitoid adults. The longevity and parasitism rate of female wasps were reduced significantly due to the ingestion of endophyte-infected cauliflower plants by S. litura larvae. Overall, we found that both endophytic fungi had a negative impact on the parasitoid. PMID:26041060

  18. Effects of heat treatment and dehydration on properties of cauliflower fiber.

    PubMed

    Femenia, A; Selvendran, R R; Ring, S G; Robertson, J A

    1999-02-01

    The effects of heat treatment and dehydration on fiber structure and hydration properties, using cauliflower floret/curd and stem tissues, have been investigated. No major changes in fiber composition resulted from sample treatments, but the degree of esterification of pectic polysaccharides, approximately 60% in fresh cauliflower, decreased by approximately 12% in samples heated at temperatures >40 degrees C. Enzymic activity was considered to be responsible, through pectin methyl esterase activity. De-esterification was temperature and moisture sensitive. Hydration properties were also affected by processing conditions. The solubility of nonstarch polysaccharides in fresh, freeze-dried, and 40 degrees C dried samples was approximately 6% but increased to 12% in boiled samples and decreased in samples dried at 75 degrees C. Similar behavior occurred for swelling and water retention capacity (WRC), with swelling and WRC highest for boiled samples and lowest for samples dried at 75 degrees C. Hence, a decrease in de-esterification was not directly responsible for changes in hydration properties. The results demonstrate the importance of processing history on functional properties and on the preparation of fiber-rich ingredients for successful incorporation into foods. PMID:10563960

  19. Nutritional Status of the Cauliflower Cultivar ‘Verona’ Grown with Omission of out Added Macronutrients

    PubMed Central

    Bianco, Matheus Saraiva; Cecílio Filho, Arthur Bernardes; de Carvalho, Leonardo Bianco

    2015-01-01

    Knowledge of plant nutritional status allows an understanding of the physiological responses of plants to crop fertilization. A hydroponic experiment evaluated the symptoms of macronutrient deficiency in cauliflower ‘Verona’ and determined: a) the macronutrient contents of foliar tissues when visual symptoms were observed, b) macronutrients content of foliar and inflorescence tissues at harvest. The effect of nutrient deficiency on inflorescence mass was also evaluated. Nitrogen deficiency caused chlorosis followed by purple color in the old leaves, while P deficiency caused only chlorosis in old leaves. Chlorosis at the edge of old leaves progressing to the center of the leaves was observed with the omission of K, and after was observed necrosis in the chlorotic areas. Ca deficiency caused tip burn in new leaves, while Mg deficiency caused internerval chlorosis in old leaves. The omission of each macronutrient reduced inflorescence dry matter. This deleterious effect was larger for N, P, and K deficiencies, reducing inflorescence dry matter by 87, 49, and 42%, respectively. When the nutrient solutions without N, P, K, Ca, or Mg were supplied to cauliflower plants, the macronutrient contents at harvest were 8.8, 0.6, 3.5, 13.0, and 0.8 g kg-1 in the foliar tissues and 27.3, 2.2, 21.6, 1.1, and 0.7 g kg-1 in the inflorescence tissues, respectively. PMID:25856380

  20. Nutritional status of the cauliflower cultivar 'verona' grown with omission of out added macronutrients.

    PubMed

    Bianco, Matheus Saraiva; Cecílio Filho, Arthur Bernardes; de Carvalho, Leonardo Bianco

    2015-01-01

    Knowledge of plant nutritional status allows an understanding of the physiological responses of plants to crop fertilization. A hydroponic experiment evaluated the symptoms of macronutrient deficiency in cauliflower 'Verona' and determined: a) the macronutrient contents of foliar tissues when visual symptoms were observed, b) macronutrients content of foliar and inflorescence tissues at harvest. The effect of nutrient deficiency on inflorescence mass was also evaluated. Nitrogen deficiency caused chlorosis followed by purple color in the old leaves, while P deficiency caused only chlorosis in old leaves. Chlorosis at the edge of old leaves progressing to the center of the leaves was observed with the omission of K, and after was observed necrosis in the chlorotic areas. Ca deficiency caused tip burn in new leaves, while Mg deficiency caused internerval chlorosis in old leaves. The omission of each macronutrient reduced inflorescence dry matter. This deleterious effect was larger for N, P, and K deficiencies, reducing inflorescence dry matter by 87, 49, and 42%, respectively. When the nutrient solutions without N, P, K, Ca, or Mg were supplied to cauliflower plants, the macronutrient contents at harvest were 8.8, 0.6, 3.5, 13.0, and 0.8 g kg-1 in the foliar tissues and 27.3, 2.2, 21.6, 1.1, and 0.7 g kg-1 in the inflorescence tissues, respectively. PMID:25856380

  1. Radar Mosaic of Africa

    NASA Technical Reports Server (NTRS)

    1999-01-01

    This is an image of equatorial Africa, centered on the equator at longitude 15degrees east. This image is a mosaic of almost 4,000 separate images obtained in 1996 by the L-band imaging radar onboard the Japanese Earth Resources Satellite. Using radar to penetrate the persistent clouds prevalent in tropical forests, the Japanese Earth Resources Satellite was able for the first time to image at high resolution this continental scale region during single flooding seasons. The area shown covers about 7.4 million square kilometers (2.8 million square miles) of land surface, spans more than 5,000 kilometers(3,100 miles) east and west and some 2,000 kilometers (1,240 miles) north and south. North is up in this image. At the full resolution of the mosaic (100 meters or 330 feet), this image is more than 500 megabytes in size, and was processed from imagery totaling more than 60 gigabytes.

    Central Africa was imaged twice in 1996, once between January and March, which is the major low-flood season in the Congo Basin, and once between October and November, which is the major high-flood season in the Congo Basin. The red color corresponds to the data from the low-flood season, the green to the high-flood season, and the blue to the 'texture' of the low-flood data. The forests appear green as a result, the flooded and palm forests, as well as urban areas, appear yellow, the ocean and lakes appear black, and savanna areas appear blue, black or green, depending on the savanna type, surface topography and other factors. The areas of the image that are black and white were mapped only between January and March 1996. In these areas, the black areas are savanna or open water, the gray are forests, and the white areas are flooded forests or urban areas. The Congo River dominates the middle of the image, where the nearby forests that are periodically flooded by the Congo and its tributaries stand out as yellow. The Nile River flows north from Lake Victoria in the middle right of

  2. [35S]GTP gamma S binding studies of amphiphilic drugs-activated Gi proteins: a caveat.

    PubMed

    Manetti, Dina; Di Cesare Mannelli, Lorenzo; Dei, Silvia; Guandalini, Luca; Martini, Elisabetta; Banchelli, Martina; Ghelardini, Carla

    2009-04-15

    This paper documents a serious problem met during the testing of Gi protein-activating properties of a new series of synthetic compounds by measuring the induced binding of [(35)S]GTPgammaS to different subtypes of Gi protein. The problem arose from the strong affinity between [(35)S]GTPgammaS and the tested compounds, that are characterized by several (2-4) positive charges and high lipophilicity. Apparently, such affinity yields insoluble, labelled complexes that, also in the absence of Gi protein, are retained on the filters and give rise to false positive results. PMID:19289280

  3. Full Jupiter Mosaic

    NASA Technical Reports Server (NTRS)

    2007-01-01

    This image of Jupiter is produced from a 2x2 mosaic of photos taken by the New Horizons Long Range Reconnaissance Imager (LORRI), and assembled by the LORRI team at the Johns Hopkins University Applied Physics Laboratory. The telescopic camera snapped the images during a 3-minute, 35-second span on February 10, when the spacecraft was 29 million kilometers (18 million miles) from Jupiter. At this distance, Jupiter's diameter was 1,015 LORRI pixels -- nearly filling the imager's entire (1,024-by-1,024 pixel) field of view. Features as small as 290 kilometers (180 miles) are visible.

    Both the Great Red Spot and Little Red Spot are visible in the image, on the left and lower right, respectively. The apparent 'storm' on the planet's right limb is a section of the south tropical zone that has been detached from the region to its west (or left) by a 'disturbance' that scientists and amateur astronomers are watching closely.

    At the time LORRI took these images, New Horizons was 820 million kilometers (510 million miles) from home -- nearly 51/2 times the distance between the Sun and Earth. This is the last full-disk image of Jupiter LORRI will produce, since Jupiter is appearing larger as New Horizons draws closer, and the imager will start to focus on specific areas of the planet for higher-resolution studies.

  4. Turnip Yellow Mosaic Virus

    NASA Technical Reports Server (NTRS)

    2000-01-01

    The bumpy exterior of the turnip yellow mosaic virus (TYMV) protein coat, or capsid, was defined in detail by Dr. Alexander McPherson of the University of California, Irvin using proteins crystallized in space for analysis on Earth. TYMV is an icosahedral virus constructed from 180 copies of the same protein arranged into 12 clusters of five proteins (pentamers), and 20 clusters of six proteins (hexamers). The final TYMV structure led to the unexpected hypothesis that the virus releases its RNA by essentially chemical-mechanical means. Most viruses have fairly flat coats, but in TYNV, the fold in each protein, called the jellyroll, is clustered at the points where the protein pentamers and hexamers join. The jellyrolls are almost standing on end, producing a bumpy surface with knobs at all of the pentamers and hexamers. At the inside surface of the pentamers is a void that is not present at the hexamers. The coating had been seen in early stuties of TYMV, but McPherson's atomic structure shows much more detail. The inside surface is strikingly, and unexpectedly, different than the outside. While the pentamers contain a central void on the inside, the hexameric units contain peptides linked to each other, forming a ring or, more accurately, rings to fill the void. Credit: Dr. Alexander McPherson, University of California, Irvine

  5. Mosaic Focal Plane Development

    NASA Astrophysics Data System (ADS)

    Mason, David L.; Horner, Scott D.; Aamodt, Earl K.

    2002-12-01

    Advances in systems engineering, applied sciences, and manufacturing technologies have enabled the development of large ground based and spaced based astronomical instruments having a large Field of View (FOV) to capture a large portion of the universe in a single image. A larger FOV can be accomplished using light weighted optical elements, improved support structures, and the development of mosaic Focal Plane Assemblies (mFPA). A mFPA designed for astronomy can use multiple Charged Coupled Devices (CCD) mounted onto a single camera baseplate integrated at the instrument plane of focus. Examples of current, or proposed, missions utilizing mFPA technology include FAME, GEST, Kepler, GAIA, LSST, and SNAP. The development of a mFPA mandates tighter control on the design trades, component development, CCD characterization, component integration, and performance verification testing. This paper addresses the capability Lockheed Martin Space Systems Company's (LMSSC) Advanced Technology Center (ATC) has developed to perform CCD characterization, mFPA assembly and alignment, and mFPA system level testing.

  6. Mosaic Focal Plane Development

    NASA Astrophysics Data System (ADS)

    Mason, D.; Horner, S.; Aamodt, E.

    Advances in manufacturing and applied sciences have enabled the development of large ground and spaced based astronomical instruments having a Field of View (FOV) large enough to capture a large portion of the universe in a single image. A large FOV can be accomplished using light weighted optics, improved structures, and the development of mosaic Focal Plane Assemblies (mFPAs). A mFPA comprises multiple Charged Coupled Devices (CCD) mounted onto a single baseplate integrated at the focus plane of the instrument. Examples of current, or proposed, missions utilizing mFPA technology include FAME, GEST, Kepler, GAIA, LSST, and SNAP. The development of a mFPA mandates tight control on the design trades of component development, CCD definition and characterization, component integration, and performance verification testing. This paper addresses the results of the Lockheed Martin Space Systems Company (LMSSC), Advanced Technology Center (ATC) developed mFPA. The design trades and performance characterization are services provided by the LMSSC ATC but not detailed in this paper.

  7. FIRST REPORT OF BACTERIAL BLIGHT OF CAULIFLOWER (BRASSICA OLERACEA VAR. BOTRYTIS) CAUSED BY PSEUDOMONAS SYRINGAE PV. ALISALENSIS IN CALIFORNIA

    Technology Transfer Automated Retrieval System (TEKTRAN)

    A novel bacterial blight commercial romanesca (green) cauliflower (Brassica oleracea var. botrytis) was seen for the first time in coastal California in 2005. Koch’s postulates were completed and the etiology of the pathogen was determined. Characterization showed that pathogen was Pseudomonas syrin...

  8. B-CAROTENE ACCUMULATION INDUCED BY THE CAULIFLOWER OR GENE IS NOT DUE TO AN INCREASED CAPACITY OF BIOSYNTHESIS

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The cauliflower (Brassica oleracea L. var. botrytis) Or gene is a rare carotenoid gene mutation that confers a high level of B-carotene accumulation in various tissues of the plant, turning them orange. To investigate the biochemical basis of the Or-induced carotenogenesis, we examined the caroteno...

  9. Steam Cooking Significantly Improves in Vitro Bile Acid Binding of Beets, Eggplant, Asparagus, Carrots, Green Beans and Cauliflower

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The relative healthful potential of cooked beets, okra, eggplant, asparagus, carrots, green beans, cauliflower and turnips was evaluated by determining their in vitro bile acid binding using a mixture of bile acids secreted in human bile at a duodenal physiological pH of 6.3. Six treatments and two...

  10. Cauliflower is a new host of a subgroup 16SrVII-B phytoplasma associated with stunting disease

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Cauliflower stunt has occurred with high levels of incidence and provoked significant yield reduction in Brazilian crops. Phytoplasmas belonging to the subgroups 16SrIII-J and 16SrXV-A were previously reported in association with the disease. In 2014, plants with typical symptoms of the disease were...

  11. Characterization of the regulatory network of BoMYB2 in controlling anthocyanin biosynthesis in purple cauliflower

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Purple cauliflower (Brassica oleracea L. var. botrytis) Graffiti represents a unique mutant in conferring ectopic anthocyanin biosynthesis, which is caused by the tissue specific activation of BoMYB2, an ortholog of Arabidopsis PAP2 or MYB113. To gain a better understanding of the regulatory network...

  12. Multilocus genotyping of a ‘Candidatus Phytoplasma aurantifolia’-related strain associated with cauliflower phyllody disease in China

    Technology Transfer Automated Retrieval System (TEKTRAN)

    A new cauliflower disease characterized by formation of leaf-like inflorescences and malformed flowers occurred in a seed production filed located in Yunnan, a southwest province of China. In the diseased plants, floral organs in three inner whorls (petals, carpels, and stamens) were under-develope...

  13. Transcriptional activation of a MYB gene controls the tissue-specific anthocyanin accumulation in a purple cauliflower mutant

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Flavonoids such as anthocyanins possess significant health benefits to humans and play important physiological roles in plants. An interesting Purple gene mutation in cauliflower confers an abnormal pattern of anthocyanin accumulation, giving intense purple color in very young leaves, curds, and see...

  14. MOSAIC: Software for creating mosaics from collections of images

    NASA Technical Reports Server (NTRS)

    Varosi, F.; Gezari, D. Y.

    1992-01-01

    We have developed a powerful, versatile image processing and analysis software package called MOSAIC, designed specifically for the manipulation of digital astronomical image data obtained with (but not limited to) two-dimensional array detectors. The software package is implemented using the Interactive Data Language (IDL), and incorporates new methods for processing, calibration, analysis, and visualization of astronomical image data, stressing effective methods for the creation of mosaic images from collections of individual exposures, while at the same time preserving the photometric integrity of the original data. Since IDL is available on many computers, the MOSAIC software runs on most UNIX and VAX workstations with the X-Windows or Sun View graphics interface.

  15. Endosperm protein synthesis and L-(/sup 35/S)methionine incorporation in maize kernels cultured in vitro

    SciTech Connect

    Cully, D.E.; Gengenbach, B.G.; Smith, J.A.; Rubenstein, I.; Connely, J.A.; Park, W.D.

    1984-02-01

    This study was conducted to examine protein synthesis and L-(/sup 35/S)methionine incorporation into the endosperm of Zea mays L. kernels developing in vitro. Two-day-old kernels of the inbred line W64A were placed in culture on a defined medium containing 10 microCuries L-(/sup 35/S)methionine per milliliter (13 milliCuries per millimole) and harvested at 10, 15, 20, 25, 30, 35, and 40 days after pollination. Cultured kernels attained a final endosperm mass of 120 milligrams compared to 175 milligrams for field-grown controls. Field and cultured kernels had similar concentrations (microgram per milligram endosperm for total protein, albumin plus globulin, zein, and glutelin fractions at most kernel ages. Sodium, dodecyl sulfate-polyacrylamide gel electrophoresis and isoelectric focusing patterns for endosperm proteins were similar for field and cultured kernels throughout development. By 15 days, over 70% of the L-(/sup 35/S)methionine taken up was present in endosperm proteins. Label incorporation visualized by fluorography generally followed the protein intensity of the stained gels. The high methionine content, low molecular weight zeins (i.e. 15 and 9 kilodaltons) were highly labeled. All of the radioactivity in hydrolyzed zein samples was recovered in the methionine peak indicating minimal conversion to L-(/sup 35/S)cysteine. The procedure described here is suitable for long term culture and labeling experiments in which continued kernel development is required.

  16. Endosperm Protein Synthesis and l-[35S]Methionine Incorporation in Maize Kernels Cultured In Vitro1

    PubMed Central

    Cully, David E.; Gengenbach, Burle G.; Smith, Jane A.; Rubenstein, Irwin; Connelly, James A.; Park, William D.

    1984-01-01

    This study was conducted to examine protein synthesis and l-[35S] methionine incorporation into the endosperm of Zea mays L. kernels developing in vitro. Two-day-old kernels of the inbred line W64A were placed in culture on a defined medium containing 10 microCuries l-[35S] methionine per milliliter (13 milliCuries per millimole) and harvested at 10, 15, 20, 25, 30, 35, and 40 days after pollination. Cultured kernels attained a final endosperm mass of 120 milligrams compared to 175 milligrams for field-grown controls. Field and cultured kernels had similar concentrations (microgram per milligram endospern) for total protein, albumin plus globulin, zein, and glutelin fractions at most kernel ages. Sodium dodecyl sulfate-polyacrylamide gel electrophoresis and isoelectric focusing patterns for endosperm proteins were similar for field and cultured kernels throughout development. By 15 days, over 70% of the l-[35S]methionine taken up was present in endosperm proteins. Label incorporation visualized by fluorography generally followed the protein intensity of the stained gels. The high methionine content, low molecular weight zeins (i.e. 15 and 9 kilodaltons) were highly labeled. All of the radioactivity in hydrolyzed zein samples was recovered in the methionine peak indicating minimal conversion to l-[35S]cysteine. The procedure described here is suitable for long term culture and labeling experiments in which continued kernel development is required. Images Fig. 2 Fig. 3 Fig. 4 PMID:16663428

  17. Mars Digital Image Mosaic Globe

    NASA Technical Reports Server (NTRS)

    2000-01-01

    The photomosaic that forms the base for this globe was created by merging two global digital image models (DIM's) of Mars-a medium-resolution monochrome mosaic processed to emphasize topographic features and a lower resolution color mosaic emphasizing color and albedo variations.

    The medium-resolution (1/256 or roughly 231 m/pixel) monochromatic image model was constructed from about 6,000 images having resolutions of 150-350 m/pixel and oblique illumination (Sun 20 o -45 o above the horizon). Radiometric processing was intended to suppress or remove the effects of albedo variations through the use of a high-pass divide filter, followed by photometric normalization so that the contrast of a given topographic slope would be approximately the same in all images.

    The global color mosaic was assembled at 1/64 or roughly 864 m/pixel from about 1,000 red- and green-filter images having 500-1,000 m/pixel resolution. These images were first mosaiced in groups, each taken on a single orbit of the Viking spacecraft. The orbit mosaics were then processed to remove spatially and temporally varying atmospheric haze in the overlap regions. After haze removal, the per-orbit mosaics were photometrically normalized to equalize the contrast of albedo features and mosaiced together with cosmetic seam removal. The medium-resolution DIM was used for geometric control of this color mosaic. A green-filter image was synthesized by weighted averaging of the red- and violet-filter mosaics. Finally, the product seen here was obtained by multiplying each color image by the medium-resolution monochrome image. The color balance selected for images in this map series was designed to be close to natural color for brighter, redder regions, such as Arabia Terra and the Tharsis region, but the data have been stretched so that the relatively dark regions appear darker and less red than they actually are.

    The images are presented in a projection that portrays the entire surface of Mars in a

  18. Tracing Atmospheric Sulfate Through a Subalpine Ecosystem Using 17O and 35S, Loch Vale Watershed, Colorado

    NASA Astrophysics Data System (ADS)

    Kester, C. L.; Johnson, C. A.; Mast, M. A.; Michel, R. L.

    2002-12-01

    Over the past several decades, sulfur cycles have been examined in numerous watersheds worldwide to assess the impacts of changes in sulfuric acid deposition rates. A thorough understanding of sulfur behavior in these systems requires that the sulfate influxes from bedrock weathering and from atmospheric deposition be known, and that the extent of sulfur uptake by biomass be determined. Following the discovery of excess 17O in atmospheric sulfate (Lee et al, 2001, GRL 28:1783), we used 17O to help constrain sulfur dynamics and fluxes in alpine/subalpine watersheds in the Rocky Mountains of Colorado (Johnson et al, 2001, GRL 28:4483). Building on this work, and on our previous studies employing cosmogenic 35S (t1/2=87 d, Michel et al, 2000, WRR 36:27), we report a combined 17O-35S study of sulfate in an undisturbed subalpine watershed, Loch Vale, Colorado. In this study, both isotopes were measured in sulfate from a suite of stream and spring waters collected in 1999, and in sulfate from the 1999 snowpack. The snowpack sulfate represents the dominant fraction of annual atmospheric deposition to the watershed. Individual sampling sites show linear correlations between excess 17O and 35S, suggesting that there are two dominant sources of surface water sulfate. The data arrays extend neither toward the measured compositions of snowpack sulfate (Δ17O=1.3‰ , 35S=53 mBq/mg sulfate at Julian day 90), nor toward the compositions characteristic of sulfate from bedrock weathering (Δ17O =0, 35S=0). Thus, the mixing components are themselves composites of different sulfate types. One component appears to be sulfate from bedrock weathering plus atmospheric sulfate with watershed residence times great enough for its 35S to have decayed to below detection (> approx 1 yr). The second mixing component is atmospheric sulfate, a portion of which was subject to redox cycling in soil organic matter - thereby erasing the excess 17O fingerprint - on timescales short enough that 35S is

  19. Asgard Scarp Mosaic

    NASA Technical Reports Server (NTRS)

    1997-01-01

    Low-resolution color data were combined with a higher resolution mosaic to produce this infrared composite image of a pair of ancient multi-ringed impact basins on Jupiter's moon, Callisto. The region imaged is on the leading hemisphere of Callisto near 26 degrees north, 142 degrees west, and is almost 1,400 kilometers (860 miles) across. North is toward the top of the picture and the Sun illuminates the surface from the east. Dominating the scene is the impact structure, Asgard, centered on the smooth, bright region near the middle of the picture and surrounded by concentric rings up to 1,700 kilometers (about 1,050 miles) in diameter. A second ringed structure with a diameter of about 500 kilometers (310 miles) can be seen to the north of Asgard, partially obscured by the more recent, bright-rayed crater, Burr. The icy materials excavated by the younger craters contrast sharply with the darker and redder coatings on older surfaces of Callisto.

    Launched in October 1989, Galileo entered orbit around Jupiter on Dec. 7, 1995. The spacecraft's mission is to conduct detailed studies of the giant planet, its largest moons and the Jovian magnetic environment. The Jet Propulsion Laboratory, Pasadena, CA, manages the mission for NASA's Office of Space Science, Washington, DC.

    This image and other images and data received from Galileo are posted on the World Wide Web Galileo mission home page at http://galileo.jpl.nasa.gov. Background information and educational context for the images can be found at http://www.jpl.nasa.gov/galileo/sepo.

  20. Arsia Mons Mosaic

    NASA Technical Reports Server (NTRS)

    2005-01-01

    Arsia Mons is the southernmost of the Tharsis volcanoes. It is 270 miles in diameter, almost 12 miles high, and the summit caldera is 72 miles wide. For comparison, the largest volcano on Earth is Mauna Loa. From its base on the sea floor, Mauna Loa measures only 6.3 miles high and 75 miles in diameter. The image here is a mosaic of several daytime IR images. The indentations on the SW and NE sides align with the Pavonis Mons and Ascreaus Mons to the NE. This may indicate a large fracture/vent system was responsible for the eruptions that formed all three volcanoes.

    Note: this THEMIS visual image has not been radiometrically nor geometrically calibrated for this preliminary release. An empirical correction has been performed to remove instrumental effects. A linear shift has been applied in the cross-track and down-track direction to approximate spacecraft and planetary motion. Fully calibrated and geometrically projected images will be released through the Planetary Data System in accordance with Project policies at a later time.

    NASA's Jet Propulsion Laboratory manages the 2001 Mars Odyssey mission for NASA's Office of Space Science, Washington, D.C. The Thermal Emission Imaging System (THEMIS) was developed by Arizona State University, Tempe, in collaboration with Raytheon Santa Barbara Remote Sensing. The THEMIS investigation is led by Dr. Philip Christensen at Arizona State University. Lockheed Martin Astronautics, Denver, is the prime contractor for the Odyssey project, and developed and built the orbiter. Mission operations are conducted jointly from Lockheed Martin and from JPL, a division of the California Institute of Technology in Pasadena.

  1. Mosaic Postcards from Mercury

    NASA Astrophysics Data System (ADS)

    Hallau, K. G.; Chapman, C. R.; Edmonds, J.; Goldstein, J.; Hirshon, B.; Solomon, S. C.; Vanhala, H.; Weir, H. M.; Messenger Education; Public Outreach Team

    2010-12-01

    On its journey to become the first spacecraft to orbit Mercury, NASA’s MErcury Surface, Space ENvironment, GEochemistry, and Ranging (MESSENGER) spacecraft has followed a trajectory that included three flybys of the innermost planet. During the flybys, images captured by the Mercury Dual Imaging System revealed parts of the planet’s surface never before seen at close range, as well as high-resolution views of craters, crater rays, scarps, faults, and volcanic vents and flows. To help students and teachers better understand this revealing new look at Mercury, the MESSENGER Education and Public Outreach team will share these high-resolution images of Mercury's surface throughout the upcoming Year of the Solar System. By means of an intriguing format that mimics methods used by the MESSENGER team, a series of images printed at large postcard size will each highlight a small "slice" of Mercury, such as a crater or fault. The individual cards can then be pieced together, puzzle-style, on a poster-sized grid to reveal a larger mosaic view of the planet. Each card contains engaging text, the URL for an accompanying website, and coordinates for that region of the planet, helping students understand scientific concepts related to and revealed by MESSENGER's journey. The first set of cards will feature scarps, volcanic plains, the topography of a crater and the composition of its interior units, rayed craters, nested craters, and a deposit produced by explosive volcanic eruptions. Cards will be available for free on the accompanying website, distributed by MESSENGER Educator Fellows, or handed out at meetings, conferences, and workshops.

  2. Structural and chemical properties of highly oriented cadmium sulfide (CdS) cauliflower films

    NASA Astrophysics Data System (ADS)

    Vemuri, R. S.; Gullapalli, S. K.; Zubia, D.; McClure, J. C.; Ramana, C. V.

    2010-08-01

    Cadmium sulfide (CdS) films have been produced by sputter-deposition varying the sputtering-power ( P) in the range of 60-120 W. The crystal structure, morphology and chemical quality of the CdS films has been investigated employing X-ray diffraction (XRD), scanning electron microscopy (SEM), X-ray photoelectron spectroscopy (XPS), and X-ray spectrometry (EDS). Structural characterization indicates that all the CdS layers exhibit cauliflower morphology. Highly oriented, single phase hexagonal-CdS films can be produced at P = 75-105 W while the films at other power contain mixed phases. Characterization using XPS and EDS indicate that the CdS layers are nearly stoichiometric at P = 75-105 W, at which point S-deficiency is induced resulting in Cd-rich-CdS layers.

  3. Mosaicism for trisomy 21: a review.

    PubMed

    Papavassiliou, Paulie; Charalsawadi, Chariyawan; Rafferty, Kelly; Jackson-Cook, Colleen

    2015-01-01

    The clinical and cytogenetic findings associated with mosaicism for trisomy 21/Down syndrome are the focus of this review. The primary topics discussed in this overview of the extant literature include the history of this condition and its diagnosis, the incidence of mosaicism, the meiotic and/or mitotic chromosomal malsegregation events resulting in mosaicism, the observation of mosaicism in the parents of children with the non-mosaic form of Down syndrome, and the variation in phenotypic outcome for both constitutional and acquired traits present in people with mosaicism for trisomy 21/Down syndrome, including cognition, fertility, and overall phenotypic findings. Additional topics reviewed include the social conditions of people with mosaicism, as well as age-related and epigenetic alterations observed in people with mosaicism for trisomy 21/Down syndrome. . PMID:25412855

  4. Influence of exposure to light on the sensorial quality of minimally processed cauliflower.

    PubMed

    Sanz Cervera, Susana; Olarte, Carmen; Echávarri, J Federico; Ayala, Fernando

    2007-01-01

    The impact of lighting on minimally processed cauliflower packaged in 4 different film types (PVC and 3 P-Plus) has been measured and quantified. The effect on the sensorial quality of storage at 4 degrees C in darkness and partial or continuous lighting was evaluated. The gas concentrations in the packages and the weight losses were also determined. Atmosphere composition inside the packages depended on both the permeability of the film used for the packaging and exposure to light. Samples stored with lighting maintained the gaseous exchange between plant tissue and the atmosphere inside the packages for longer periods than in samples kept in darkness. This prompted a greater loss of water vapor as well as the development of atmospheres with low levels of O2 and high levels of CO2 in the samples packed with less permeable films. The most important aspect in sensory evaluation was color. In instrumental color evaluation, coordinates h* and L* were the main means for estimating color evolution. The presence of light accelerated browning in the cut zones. The development of abnormal coloring in these areas marked the end of shelf life for minimally processed cauliflower. Among the sensory attributes studied, color was the most affected by exposure to light. Samples packed in P-Plus 120 film displayed the lowest level of color deterioration in the cut zones. However, under lit conditions, the low permeability of this film caused atmospheres with very low O2 contents and high CO2 contents. These atmospheres produced a loss of texture and the development of off-odors. PMID:17995892

  5. Somatic mosaicism and variable expressivity.

    PubMed

    Gottlieb, B; Beitel, L K; Trifiro, M A

    2001-02-01

    For more than 50 years geneticists have assumed that variations in phenotypic expression are caused by alterations in genotype. Recent evidence shows that 'simple' mendelian disorders or monogenic traits are often far from simple, exhibiting phenotypic variation (variable expressivity) that cannot be explained entirely by a gene or allelic alteration. In certain cases of androgen insensitivity syndrome caused by identical mutations in the androgen receptor gene, phenotypic variability is caused by somatic mosaicism, that is, somatic mutations that occur only in certain androgen-sensitive cells. Recently, more than 30 other genetic conditions that exhibit variable expressivity have been linked to somatic mosaicism. Somatic mutations have also been identified in diseases such as prostate and colorectal cancer. Therefore, the concept of somatic mutations and mosaicism is likely to have far reaching consequences for genetics, in particular in areas such as genetic counseling. PMID:11173116

  6. Neurocutaneous Manifestations of Genetic Mosaicism.

    PubMed

    van Steensel, Maurice A M

    2015-09-01

    Genetic mosaicism is defined as the presence of two or more genetically distinct cell populations in a single individual. Ever more disorders are found to be manifestations of mosaicism and together constitute a significant proportion of the morbidity confronting pediatric specialists. An emerging category is that of overgrowth syndromes with skin manifestations and neurological or developmental abnormalities, such as the well-known Proteus syndrome. In recent years, we have seen dramatic advances in our understanding of these disorders and we now know the genetic basis of many of them. This has profound consequences for diagnosis, counselling, and even treatment, with therapies targeted to specific pathways becoming available for clinical use. Recognizing such overgrowth syndromes, therefore, is more important than ever. Fortunately, their skin manifestations can provide important diagnostic clues when evaluated in the entire phenotypic context. In this review, I provide an overview of the most frequently seen mosaic neurocutaneous phenotypes and discuss their molecular basis. PMID:27617125

  7. Mosaic of coded aperture arrays

    DOEpatents

    Fenimore, Edward E.; Cannon, Thomas M.

    1980-01-01

    The present invention pertains to a mosaic of coded aperture arrays which is capable of imaging off-axis sources with minimum detector size. Mosaics of the basic array pattern create a circular on periodic correlation of the object on a section of the picture plane. This section consists of elements of the central basic pattern as well as elements from neighboring patterns and is a cyclic version of the basic pattern. Since all object points contribute a complete cyclic version of the basic pattern, a section of the picture, which is the size of the basic aperture pattern, contains all the information necessary to image the object with no artifacts.

  8. Highest Resolution Gaspra Mosaic

    NASA Technical Reports Server (NTRS)

    1992-01-01

    This picture of asteroid 951 Gaspra is a mosaic of two images taken by the Galileo spacecraft from a range of 5,300 kilometers (3,300 miles), some 10 minutes before closest approach on October 29, 1991. The Sun is shining from the right; phase angle is 50 degrees. The resolution, about 54 meters/pixel, is the highest for the Gaspra encounter and is about three times better than that in the view released in November 1991. Additional images of Gaspra remain stored on Galileo's tape recorder, awaiting playback in November. Gaspra is an irregular body with dimensions about 19 x 12 x 11 kilometers (12 x 7.5 x 7 miles). The portion illuminated in this view is about 18 kilometers (11 miles) from lower left to upper right. The north pole is located at upper left; Gaspra rotates counterclockwise every 7 hours. The large concavity on the lower right limb is about 6 kilometers (3.7 miles) across, the prominent crater on the terminator, center left, about 1.5 kilometers (1 mile). A striking feature of Gaspra's surface is the abundance of small craters. More than 600 craters, 100-500 meters (330-1650 feet) in diameter are visible here. The number of such small craters compared to larger ones is much greater for Gaspra than for previously studied bodies of comparable size such as the satellites of Mars. Gaspra's very irregular shape suggests that the asteroid was derived from a larger body by nearly catastrophic collisions. Consistent with such a history is the prominence of groove-like linear features, believed to be related to fractures. These linear depressions, 100-300 meters wide and tens of meters deep, are in two crossing groups with slightly different morphology, one group wider and more pitted than the other. Grooves had previously been seen only on Mars's moon Phobos, but were predicted for asteroids as well. Gaspra also shows a variety of enigmatic curved depressions and ridges in the terminator region at left. The Galileo project, whose primary mission is the

  9. Gaspra - Highest Resolution Mosaic

    NASA Technical Reports Server (NTRS)

    1992-01-01

    This picture of asteroid 951 Gaspra is a mosaic of two images taken by the Galileo spacecraft from a range of 5,300 kilometers (3,300 miles), some 10 minutes before closest approach on October 29, 1991. The Sun is shining from the right; phase angle is 50 degrees. The resolution, about 54 meters/pixel, is the highest for the Gaspra encounter and is about three times better than that in the view released in November 1991. Additional images of Gaspra remain stored on Galileo's tape recorder, awaiting playback in November. Gaspra is an irregular body with dimensions about 19 x 12 x 11 kilometers (12 x 7.5 x 7 miles). The portion illuminated in this view is about 18 kilometers (11 miles) from lower left to upper right. The north pole is located at upper left; Gaspra rotates counterclockwise every 7 hours. The large concavity on the lower right limb is about 6 kilometers (3.7 miles) across, the prominent crater on the terminator, center left, about 1.5 kilometers (1 mile). A striking feature of Gaspra's surface is the abundance of small craters. More than 600 craters, 100-500 meters (330-1650 feet) in diameter are visible here. The number of such small craters compared to larger ones is much greater for Gaspra than for previously studied bodies of comparable size such as the satellites of Mars. Gaspra's very irregular shape suggests that the asteroid was derived from a larger body by nearly catastrophic collisions. Consistent with such a history is the prominence of groove-like linear features, believed to be related to fractures. These linear depressions, 100-300 meters wide and tens of meters deep, are in two crossing groups with slightly different morphology, one group wider and more pitted than the other. Grooves had previously been seen only on Mars's moon Phobos, but were predicted for asteroids as well. Gaspra also shows a variety of enigmatic curved depressions and ridges in the terminator region at left. The Galileo project, whose primary mission is the

  10. Detection of viral genomes in the liver by in situ hybridization using 35S-, bromodeoxyuridine-, and biotin-labeled probes

    SciTech Connect

    Niedobitek, G.; Finn, T.; Herbst, H.; Stein, H.

    1989-03-01

    Methods employing /sup 35/S-, biotin-, and bromodeoxyuridine (BrdUrd)-labeled DNA probes were compared for the detection of hepatitis B virus (HBV) and cytomegalovirus (CMV) in the liver. The results demonstrate that: 1) HBV can be detected reliably only by the use of radiolabeled probes, whereas methods employing nonradioactive probes obviously are not sensitive enough for this virus. The use of /sup 35/S-labeled probes shortens the exposure times considerably in comparison to tritiated probes. 2) Biotin-labeled probes are of limited value for in situ hybridization on liver tissues because the presence of endogenous avidin-binding activity often leads to false positive results. 3) Brd-Urd-labeled probes are a useful alternative to biotinylated probes for the detection of CMV. In comparison with biotinylated probes, BrdUrd-labeled probes produce a specific signal of similar staining intensity in the absence of background staining in the liver.

  11. Language: Mosaic or Special Faculty?

    ERIC Educational Resources Information Center

    McArthur, Douglas

    1995-01-01

    Describes the "special destiny-special faculty" paradigm that has dominated western thinking about the nature and origins of language and argues instead that language systems are like technologies and that language acquisition and use involves a range of capacities and skills, a view that could be called the "mosaic development paradigm." (15…

  12. Method for the typing of Clostridium difficile based on polyacrylamide gel electrophoresis of (/sup 35/S)methionine-labeled proteins

    SciTech Connect

    Tabaqchali, S.; O'Farrell, S.; Holland, D.; Silman, R.

    1986-01-01

    A typing method for Clostridium difficile based on the incorporation of (/sup 35/S)methionine into cellular proteins, their separation by sodium dodecyl sulfate-polyacrylamide gel electrophoresis, and their visualization by autoradiography is described. On analysis of the radiolabeled-protein profiles, nine distinct groups were observed (A to E and W to Z). The method, which is simple, reproducible, and readily expandable, has been applied in epidemiological studies to demonstrate cross-infection and hospital acquisition of C. difficile.

  13. Biosynthesis of lutropin in ovine pituitary slices: incorporation of (/sup 35/S)sulfate in carbohydrate units

    SciTech Connect

    Anumula, K.R.; Bahl, O.P.

    1983-02-01

    Sulfate incorporation into carbohydrate of lutropin (LH) has been studied in sheep pituitary slices using H/sub 2/(/sup 35/)SO/sub 4/. Labeled ovine LH was purified to homogeneity by Sephadex G-100 and carboxymethyl-Sephadex chromatography from both the incubation medium and tissue extract. Autoradiography of the gel showed only two protein bands which comigrated with the alpha and beta subunits of ovine LH in both the purified ovine LH and the immunoprecipitate obtained with LH-specific rabbit antiserum. Furthermore, (/sup 35/S)sulfate was also incorporated into several other proteins in addition to LH. The location of /sup 35/SO/sub 2-(4)/ in the oligosaccharides of ovine LH was evidenced by its presence in the glycopeptides obtained by exhaustive Pronase digestion. The location and the point of attachment of sulfate in the carbohydrate unit were established by the isolation of 4-O-(/sup 35/S)sulfo-N-acetylhexosaminyl-glycerols and 4-O-(/sup 35/S) sulfo-N-acetylglucosaminitol from the Smith degradation products and by the release of /sup 35/SO/sub 2-(4)/ by chondro-4-sulfatase. Thus, the present line of experimentation indicates the presence of sulfate on both the terminal N-acetylglucosamine and N-acetylgalactosamine in the oligosaccharide chains of the labeled ovine LH.

  14. Valorization of cauliflower (Brassica oleracea L. var. botrytis) by-products as a source of antioxidant phenolics.

    PubMed

    Llorach, Rafael; Espín, Juan Carlos; Tomás-Barberán, Francisco A; Ferreres, Federico

    2003-04-01

    The present study reports the development of two extraction protocols, with potential industrial applicability, to valorize cauliflower (Brassica oleracea L. var. botrytis) byproducts as a source of antioxidant phenolics. In addition, the nonionic polystyrene resin Amberlite XAD-2 was used to obtain purified extracts. The extract yield, phenolic content, phenolic yield, and correlation between the antioxidant activity and the phenolic content were studied. The water and ethanol protocols yield a phenolic content of 33.8 mg/g freeze-dried extract and 62.1 mg/g freeze-dried extract, respectively. This percentage increased considerably when the extracts were purified using Amberlite XAD-2 yielding a phenolic content of 186 mg/g freeze-dried extract (water extract) and 311.1 mg/g freeze-dried extract (ethanol extract). Cauliflower byproduct extracts showed significant free radical scavenging activity (vs both DPPH(*) and ABTS(*)(+) radicals), ferric reducing ability (FRAP assay), and capacity to inhibit lipid peroxidation (ferric thiocyanate assay). In addition, the antioxidant activity was linearly correlated with the phenolics content. The results obtained indicate that the cauliflower byproducts are a cheap source of antioxidant phenolics very interesting from both the industrial point of view and the possible usefulness as ingredients to functionalize foodstuffs. PMID:12670153

  15. Persistence of insecticides in ready-mix formulations and their efficacy against Lipaphis erysimi (Kalt) in cauliflower.

    PubMed

    Gupta, Suman; Sharma, R K; Gajbhiye, V T; Gupta, R K

    2013-03-01

    Persistence of cypermethrin, deltamethrin, profenofos, and triazophos in cauliflower curd was studied, following application of two premix formulations viz: Roket 44EC (profenofos 40 % + cypermethrin 4 %) and Anaconda Plus 36EC (triazophos 35 % + deltamethrin 1 %) at recommended (1.0 L ha(-1)) and double doses (2.0 L ha(-1)). In the case of Roket 44EC, residues of cypermethrin dissipated with the half-life values of 1.5-2.1 days, whereas residues of profenofos dissipated with the half-life of 2.9-3.3 days on cauliflower curd. In the case of Anaconda, residues of triazophos and deltamethrin dissipated from curd with the half-life values of 2.6-3.0 and 2.2-2.6 days, respectively. Both the combination mix significantly reduced the aphid population up to 14 days after spray and increased the yield by 155-160 % over control. Anaconda (2.0 L ha(-1)) treated plots yielded the highest number of marketable curds. Based on risk assessment analysis, safe waiting period of 3 and 5 days has been suggested for Roket 44EC and Anaconda Plus 36EC, respectively, in cauliflower at recommended dose of application. PMID:22648021

  16. Adenosine A1( )receptors are selectively coupled to Gα(i-3) in postmortem human brain cortex: Guanosine-5'-O-(3-[(35)S]thio)triphosphate ([(35)S]GTPγS) binding/immunoprecipitation study.

    PubMed

    Odagaki, Yuji; Kinoshita, Masakazu; Ota, Toshio; Meana, J Javier; Callado, Luis F; García-Sevilla, Jesús A

    2015-10-01

    By means of guanosine-5'-O-(3-[(35)S]thio)triphosphate ([(35)S]GTPγS) binding assay combined with immunoprecipitation using anti-Gα subunit antibody, we recently reported 5-HT2A receptor- and M1 muscarinic acetylcholine receptor-mediated Gαq activation in rat cerebral cortical membranes (Odagaki et al., 2014). In the present study, this method has been applied to postmortem human brains, with focusing on adenosine receptor-mediated G-protein activation. In the exploratory experiments using a series of agonists and the antibodies specific to each Gα subtypes in the presence of low (10 nM) or high (50 μM) concentration of GDP, the most prominent increases in specific [(35)S]GTPγS binding in the membranes prepared from human prefrontal cortex were obtained for the combinations of adenosine (1mM)/anti-Gαi-3 in the presence of 50 μM GDP as well as 5-HT (100 μM)/anti-Gαq and carbachol (1mM)/anti-Gαq in the presence of 10nM GDP. Adenosine-induced activation of Gαi-3 emerged only when GDP concentrations were increased higher than 10 μM, and the following experiments were performed in the presence of 300 μM GDP. Adenosine increased specific [(35)S]GTPγS binding to Gαi-3 in a concentration-dependent manner to 251.4% of the basal unstimulated binding, with an EC50 of 1.77 μM. The involvement of adenosine A1 receptor was verified by the experiments using selective agonists and antagonists at adenosine A1 or A3 receptor. Among the α subunits of Gi/o class (Gαi-1, Gαi-2, Gαi-3, and Gαo.), only Gαi-3 was activated by 1mM adenosine, indicating that human brain adenosine A1 receptor is coupled preferentially, if not exclusively, to Gαi-3. PMID:26213104

  17. Map characteristics of Landsat mosaics

    NASA Technical Reports Server (NTRS)

    Zobrist, A. L.; Bryant, N. A.

    1979-01-01

    Map characteristics of the Landsat mosaics developed at JPL are considered. Procedures for digital mosaicking of Landsat frames to standard map projections were used to mosaic at full resolution ten scenes over the California desert region and twenty-one scenes over Arizona. The procedures are analyzed for horizontal positioning error (global and local) and the potential for classification error associated with the adjustment of brightness of Z values between frames; the use of this technology for the mapping of extensive features is discussed. Mosaicking facilities, techniques, mapping accuracy, and thematic mapping characteristics are described. A comparative analysis of Landsat mosaicking technology developed at Goddard Space Flight Center, IBM Gaithersburg, and USGS Flagstaff is made, and suggestions are given for algorithm development to improve systems capacity and ability to handle a variety of cases.

  18. Cauliflower waste incorporation into cane molasses improves ethanol production using Saccharomyces cerevisiae MTCC 178.

    PubMed

    Dhillon, Gurpreet Singh; Bansal, Sunil; Oberoi, Harinder Singh

    2007-12-01

    Diluted cane molasses having total sugar and reducing sugar content of 9.60 and 3.80% (w/v) respectively was subjected to ethanol production by Saccharomyces cerevisiae MTCC 178. Incorporation of dried Cauliflower Waste (CW) in molasses at the level of 15 % increased ethanol production by nearly 36 % compared to molasses alone. Addition of 0.2 % yeast extract improved ethanol production by nearly 49 % as compared to molasses alone. When the medium containing diluted molasses and 0.2 % yeast extract was supplemented with 15 % CW, 29 % more ethanol was produced compared to molasses with 0.2 % yeast extract. Cell biomass, ethanol production, final ethanol concentration and fermentation efficiency of 2.65 mg mL(-1), 41.2 gL(-1), 0.358 gg(-1) and 70.11 % respectively were found to be best at 15% CW supplementation level besides reduction in fermentation time but further increase in CW level resulted in decline on account of all the above parameters. This is probably the first report to our knowledge, in which CW was used in enhancing ethanol production significantly using a small quantity of yeast extract. PMID:23100689

  19. Large-scale cauliflower-shaped hierarchical copper nanostructures for efficient photothermal conversion.

    PubMed

    Fan, Peixun; Wu, Hui; Zhong, Minlin; Zhang, Hongjun; Bai, Benfeng; Jin, Guofan

    2016-08-14

    Efficient solar energy harvesting and photothermal conversion have essential importance for many practical applications. Here, we present a laser-induced cauliflower-shaped hierarchical surface nanostructure on a copper surface, which exhibits extremely high omnidirectional absorption efficiency over a broad electromagnetic spectral range from the UV to the near-infrared region. The measured average hemispherical absorptance is as high as 98% within the wavelength range of 200-800 nm, and the angle dependent specular reflectance stays below 0.1% within the 0-60° incident angle. Such a structured copper surface can exhibit an apparent heating up effect under the sunlight illumination. In the experiment of evaporating water, the structured surface yields an overall photothermal conversion efficiency over 60% under an illuminating solar power density of ∼1 kW m(-2). The presented technology provides a cost-effective, reliable, and simple way for realizing broadband omnidirectional light absorptive metal surfaces for efficient solar energy harvesting and utilization, which is highly demanded in various light harvesting, anti-reflection, and photothermal conversion applications. Since the structure is directly formed by femtosecond laser writing, it is quite suitable for mass production and can be easily extended to a large surface area. PMID:27430171

  20. Biology and life table parameters of Brevicoryne brassicae (Hemiptera: Aphididae) on cauliflower cultivars.

    PubMed

    Jahan, Fatemeh; Abbasipour, Habib; Askarianzadeh, Alireza; Hassanshahi, Golamhossein; Saeedizadeh, Ayatallah

    2014-01-01

    In this article, the biology and fertility life table parameters of the cabbage aphid, Brevicoryne brassicae (L.) (Hemiptera: Aphididae), were studied on cauliflower leaves, Brassica oleracea var. botrytis (Brassicales: Brassicaceae), of the cultivars Smilla, Snow mystique, White cloud, Buris, Galiblanka, Snow crown, SG, and Tokita. This study was conducted under controlled conditions: 25 ± 2°C, 65 ± 5% relative humidity (RH), and 16:8 (L:D) h photoperiods. Statistical analysis showed that there was a significant difference (P < 0.05) between the different growth stages and the mean number of laid nymphs. Further, the maximum and minimum growth periods were observed on Galiblanka and Buris cultivars, respectively. The shortest nymphal instar growth period was observed on the Smilla cultivar (6.70 d), and the longest lifespan was seen on the White cloud (8.10 d). The Smilla cultivar (39%), in an adult emergence stage, and the SG (88%) revealed the lowest and highest rates of survival, respectively. Aphids reared on the Smilla cultivar were found to have increased due to the high intrinsic (r(m)) and finite (λ) rate of increase and the low doubling time (DT). The results indicated that the application of cultivars affecting adult reproductive parameters could be a good solution to cabbage aphid control management. PMID:25527591

  1. Detection of the 35S promoter in transgenic maize via various isothermal amplification techniques: a practical approach.

    PubMed

    Zahradnik, Celine; Kolm, Claudia; Martzy, Roland; Mach, Robert L; Krska, Rudolf; Farnleitner, Andreas H; Brunner, Kurt

    2014-11-01

    In 2003 the European Commission introduced a 0.9% threshold for food and feed products containing genetically modified organism (GMO)-derived components. For commodities containing GMO contents higher than this threshold, labelling is mandatory. To provide a DNA-based rapid and simple detection method suitable for high-throughput screening of GMOs, several isothermal amplification approaches for the 35S promoter were tested: strand displacement amplification, nicking-enzyme amplification reaction, rolling circle amplification, loop-mediated isothermal amplification (LAMP) and helicase-dependent amplification (HDA). The assays developed were tested for specificity in order to distinguish between samples containing genetically modified (GM) maize and non-GM maize. For those assays capable of this discrimination, tests were performed to determine the lower limit of detection. A false-negative rate was determined to rule out whether GMO-positive samples were incorrectly classified as GMO-negative. A robustness test was performed to show reliable detection independent from the instrument used for amplification. The analysis of three GM maize lines showed that only LAMP and HDA were able to differentiate between the GMOs MON810, NK603, and Bt11 and non-GM maize. Furthermore, with the HDA assay it was possible to realize a detection limit as low as 0.5%. A false-negative rate of only 5% for 1% GM maize for all three maize lines shows that HDA has the potential to be used as an alternative strategy for the detection of transgenic maize. All results obtained with the LAMP and HDA assays were compared with the results obtained with a previously reported real-time PCR assay for the 35S promoter in transgenic maize. This study presents two new screening assays for detection of the 35S promoter in transgenic maize by applying the isothermal amplification approaches HDA and LAMP. PMID:24880871

  2. Development of rolling circle amplification based surface-enhanced Raman spectroscopy method for 35S promoter gene detection.

    PubMed

    Guven, Burcu; Boyaci, Ismail Hakki; Tamer, Ugur; Acar-Soykut, Esra; Dogan, Uzeyir

    2015-05-01

    In this study, we developed the genetically modified organism detection method by using the combination of rolling circle amplification (RCA) and surface-enhanced Raman spectroscopy (SERS). An oligonucleotide probe which is specific for 35S DNA promoter target was immobilised onto the gold slide and a RCA reaction was performed. A self-assembled monolayer was formed on gold nanorods using 5,5'-dithiobis(2-nitrobenzoic acid) (DTNB) and the second probe of the 35S DNA promoter target was immobilised on the activated gold coated slide surfaces. Probes on the nanoparticles were hybridised with the target oligonucleotide. Quantification of the target concentration was performed via SERS spectra of DTNB on the nanorods. SERS spectra of target molecules were enhanced through the RCA reaction and the detection limit was found to be 6.3fM. The sensitivity of the developed RCA-SERS method was compared with another method which had been performed without using RCA reaction, and the detection limit was found to be 0.1pM. The correlation between the target concentration and the SERS signal was found to be linear, within the range of 1pM to 10nM for the traditional assay and 100fM to 100nM for the RCA assay. For the developed RCA-SERS assay, the specificity tests were performed using the 35S promoter of Bt-176 maize gene. It was found out that the developed RCA-SERS sandwich assay method is quite sensitive, selective and specific for target sequences in model and real systems. PMID:25702987

  3. Evidence of neutron leakage at the Fukushima nuclear plant from measurements of radioactive 35S in California.

    PubMed

    Priyadarshi, Antra; Dominguez, Gerardo; Thiemens, Mark H

    2011-08-30

    A recent earthquake and the subsequent tsunami have extensively damaged the Fukushima nuclear power plant, releasing harmful radiation into the environment. Despite the obvious implication for human health and the surrounding ecology, there are no quantitative estimates of the neutron flux leakage during the weeks following the earthquake. Here, using measurements of radioactive (35)S contained in sulfate aerosols and SO(2) gas at a coastal site in La Jolla, California, we show that nearly 4 × 10(11) neutrons per m(2) leaked at the Fukushima nuclear power plant before March 20, 2011. A significantly higher (35)SO(2-)(4) activity as measured on March 28 is in accord with neutrons escaping the reactor core and being absorbed by the coolant seawater (35)Cl to produce (35)S by a (n, p) reaction. Once produced, (35)S oxidizes to (35)SO(2) and (35)SO(2-)(4) and was then transported to Southern California due to the presence of strong prevailing westerly winds at this time. Based on a moving box model, we show that the observed activity enhancement in (35)SO(2-)(4) is compatible with long-range transport of the radiation plume from Fukushima. Our model predicts that (35)SO(2-)(4), the concentration in the marine boundary layer at Fukushima, was approximately 2 × 10(5) atoms per m(3), which is approximately 365 times above expected natural concentrations. These measurements and model calculations imply that approximately 0.7% of the total radioactive sulfate present at the marine boundary layer at Fukushima reached Southern California as a result of the trans-Pacific transport. PMID:21844372

  4. Evidence of neutron leakage at the Fukushima nuclear plant from measurements of radioactive 35S in California

    PubMed Central

    Priyadarshi, Antra; Dominguez, Gerardo; Thiemens, Mark H.

    2011-01-01

    A recent earthquake and the subsequent tsunami have extensively damaged the Fukushima nuclear power plant, releasing harmful radiation into the environment. Despite the obvious implication for human health and the surrounding ecology, there are no quantitative estimates of the neutron flux leakage during the weeks following the earthquake. Here, using measurements of radioactive 35S contained in sulfate aerosols and SO2 gas at a coastal site in La Jolla, California, we show that nearly 4 × 1011 neutrons per m2 leaked at the Fukushima nuclear power plant before March 20, 2011. A significantly higher activity as measured on March 28 is in accord with neutrons escaping the reactor core and being absorbed by the coolant seawater 35Cl to produce 35S by a (n, p) reaction. Once produced, 35S oxidizes to and and was then transported to Southern California due to the presence of strong prevailing westerly winds at this time. Based on a moving box model, we show that the observed activity enhancement in is compatible with long-range transport of the radiation plume from Fukushima. Our model predicts that , the concentration in the marine boundary layer at Fukushima, was approximately 2 × 105 atoms per m3, which is approximately 365 times above expected natural concentrations. These measurements and model calculations imply that approximately 0.7% of the total radioactive sulfate present at the marine boundary layer at Fukushima reached Southern California as a result of the trans-Pacific transport. PMID:21844372

  5. [Examination of processed vegetable foods for the presence of common DNA sequences of genetically modified tomatoes].

    PubMed

    Kitagawa, Mamiko; Nakamura, Kosuke; Kondo, Kazunari; Ubukata, Shoji; Akiyama, Hiroshi

    2014-01-01

    The contamination of processed vegetable foods with genetically modified tomatoes was investigated by the use of qualitative PCR methods to detect the cauliflower mosaic virus 35S promoter (P35S) and the kanamycin resistance gene (NPTII). DNA fragments of P35S and NPTII were detected in vegetable juice samples, possibly due to contamination with the genomes of cauliflower mosaic virus infecting juice ingredients of Brassica species and soil bacteria, respectively. Therefore, to detect the transformation construct sequences of GM tomatoes, primer pairs were designed for qualitative PCR to specifically detect the border region between P35S and NPTII, and the border region between nopaline synthase gene promoter and NPTII. No amplification of the targeted sequences was observed using genomic DNA purified from the juice ingredients. The developed qualitative PCR method is considered to be a reliable tool to check contamination of products with GM tomatoes. PMID:25743587

  6. Differential identification of Candida species and other yeasts by analysis of (/sup 35/S)methionine-labeled polypeptide profiles

    SciTech Connect

    Shen, H.D.; Choo, K.B.; Tsai, W.C.; Jen, T.M.; Yeh, J.Y.; Han, S.H.

    1988-12-01

    This paper describes a scheme for differential identification of Candida species and other yeasts based on autoradiographic analysis of protein profiles of (/sup 35/S)methionine-labeled cellular proteins separated by sodium dodecyl sulfate-polyacrylamide gel electrophoresis. Using ATCC strains as references, protein profile analysis showed that different Candida and other yeast species produced distinctively different patterns. Good agreement in results obtained with this approach and with other conventional systems was observed. Being accurate and reproducible, this approach provides a basis for the development of an alternative method for the identification of yeasts isolated from clinical specimens.

  7. High performance liquid chromatography (HPLC) study of (/sup 35/S)- and (/sup 3/H)-labeled mucus glycoproteins secreted by the isolated mucociliated gill epithelium of Mytilus edulis

    SciTech Connect

    Sabouni, A.; Ma, J.K.; Malanga, C.J.

    1986-03-05

    HPLC combined with (/sup 35/S)-sulfate/(/sup 3/H)-glucosamine radiolabeling were employed to study the synthesis and secretion of mucous glycoproteins. The radiolabeled secreted glycoproteins were separated from the medium by precipitation with a mixture of trichloroacetic-phosphotungstic acids (TCA/PTA). The redissolved glycoproteins were chromatographed on an anion exchange protein column at varying pH of the mobile phase and fractions were collected for liquid scintillation counting. Varying the pH of the mobile phase from pH 3 to 7 resulted in a decrease of glycoprotein bound (/sup 35/S) from 69.5 to 0.5% of the total recovered (/sup 35/S)-sulfate with the remainder recovered as free (/sup 35/S)-sulfate. The (/sup 3/H)-labeled glycoprotein recovered under the uV peaks at this pH range was 99.5%. When high performance size exclusion chromatography was performed the change in mobile phase pH did not affect the 100% recovery of either (/sup 35/S)- or (/sup 3/H)-labels under the uV peaks. No free (/sup 35/S)-sulfate was obtained when (/sup 35/S)-labeled glycoproteins were separated form the medium using dialysis. These data suggest that the standard method of TCA/PTA precipitation of (/sup 35/S)-labeled glycoproteins may cleave the (/sup 35/S)-sulfate ester linkages to the oligosaccharide chains. The (/sup 35/S)-sulfate may then rebind to the macromolecule by a relatively strong noncovalent bond. This may prove critical in anion exchange protein HPLC studies.

  8. Source of error in the chromatographic study of /sup 35/S-sulfate labeled mucous glycoproteins secreted by the gill epithelium of Mytilus edulis

    SciTech Connect

    Sabouni, A.H.; Ma, J.K.; Malanga, C.J.

    1986-01-01

    HPLC combined with (/sup 35/S)-sulfate/(/sup 3/H)-glucosamine radiolabeling were employed to study the synthesis and secretion of mucous glycoproteins. The secreted radiolabeled glycoproteins were separated from the medium by precipitation with a mixture of trichloroacetic-phosphotungstic acids (TCA/PTA). The redissolved glycoproteins were chromatographed on an anion exchange protein column at varying pH of the mobile phase and fractions were collected for liquid scintillation counting. Varying the pH of the mobile phase from pH 3 to 7 resulted in a decrease of glycoprotein bound (/sup 35/S) from 69.5 to 0.5% of the total recovered (/sup 35/S)-sulfate with the remainder recovered as free (/sup 35/S)-sulfate. The (/sup 3/H)-labeled glycoprotein recovered under the uV peaks at this pH range was 99.5%. When high performance size exclusion chromatography was performed the change in mobile phase pH did not affect the 100% recovery of either (/sup 35/S)-or (/sup 3/H)-labels under the uV peaks. No free (/sup 35/S)-sulfate was obtained when (/sup 35/S)-labeled glycoproteins were separated from the medium using dialysis. These data suggest that the standard method of TCA/PTA precipitation of (/sup 35/S)-labeled glycoproteins may cleave the (/sup 35/S)-sulfate ester linkages to the oligosaccharide chains. The (/sup 35/S)-sulfate may then rebind to the macromolecule by a relatively strong noncovalent bond. This may prove critical in anion exchange protein HPLC studies.

  9. Near Global Mosaic of Mercury

    NASA Astrophysics Data System (ADS)

    Becker, K. J.; Robinson, M. S.; Becker, T. L.; Weller, L. A.; Turner, S.; Nguyen, L.; Selby, C.; Denevi, B. W.; Murchie, S. L.; McNutt, R. L.; Solomon, S. C.

    2009-12-01

    In 2008 the MESSENGER spacecraft made two close flybys (M1 and M2) of Mercury and imaged about 74% of the planet at a resolution of 1 km per pixel, and at higher resolution for smaller portions of the planet. The Mariner 10 spacecraft imaged about 42% of Mercury’s surface more than 30 years ago. Combining image data collected by the two missions yields coverage of about 83% of Mercury’s surface. MESSENGER will perform its third and final flyby of Mercury (M3) on 29 September 2009. This will yield approximately 86% coverage of Mercury, leaving only the north and south polar regions yet to be imaged by MESSENGER after orbit insertion in March 2011. A new global mosaic of Mercury was constructed using 325 images containing 3566 control points (8110 measures) from M1 and 225 images containing 1465 control points (3506 measures) from M2. The M3 flyby is shifted in subsolar longitude only by 4° from M2, so the added coverage is very small. However, this small slice of Mercury fills a gore in the mosaic between the M1 and M2 data and allows a complete cartographic tie around the equator. We will run a new bundle block adjustment with the additional images acquired from M3. This new edition of the MESSENGER Mercury Dual Imaging System (MDIS) Narrow Angle Camera (NAC) global mosaic of Mercury includes many improvements since the M2 flyby in October 2008. A new distortion model for the NAC camera greatly improves the image-to-image registration. Optical distortion correction is independent of pointing error correction, and both are required for a mosaic of high quality. The new distortion model alone reduced residual pointing errors for both flybys significantly; residual pixel error improved from 0.71 average (3.7 max) to 0.13 average (1.7 max) for M1 and from 0.72 average (4.8 max.) to 0.17 average (3.5 max) for M2. Analysis quantifying pivot motor position has led to development of a new model that improves accuracy of the pivot platform attitude. This model improves

  10. Cutaneous mosaicisms: concepts, patterns and classifications*

    PubMed Central

    Kouzak, Samara Silva; Mendes, Marcela Sena Teixeira; Costa, Izelda Maria Carvalho

    2013-01-01

    A mosaic is an organism composed of two or more genetically distinct cell populations derived from a genetically homogeneous zygote. Cutaneous mosaicisms are the clinical expressions of these disorders. The main event which allows the existence of mosaicism is a genetic mutation, either structural or functional. Cutaneous mosaicisms usually manifest by specific patterns on the skin and the archetypic pattern is the system of Blaschko lines, but others include checkerboard, phylloid, large patches without midline separation and lateralization. Since 1901, when Blaschko lines were first described, the study of mosasicism has helped to elucidate the behavior of numerous genetic diseases, generating therapeutic perspectives for these pathologies, including the promising gene therapy. PMID:24068120

  11. Large-scale cauliflower-shaped hierarchical copper nanostructures for efficient photothermal conversion

    NASA Astrophysics Data System (ADS)

    Fan, Peixun; Wu, Hui; Zhong, Minlin; Zhang, Hongjun; Bai, Benfeng; Jin, Guofan

    2016-07-01

    Efficient solar energy harvesting and photothermal conversion have essential importance for many practical applications. Here, we present a laser-induced cauliflower-shaped hierarchical surface nanostructure on a copper surface, which exhibits extremely high omnidirectional absorption efficiency over a broad electromagnetic spectral range from the UV to the near-infrared region. The measured average hemispherical absorptance is as high as 98% within the wavelength range of 200-800 nm, and the angle dependent specular reflectance stays below 0.1% within the 0-60° incident angle. Such a structured copper surface can exhibit an apparent heating up effect under the sunlight illumination. In the experiment of evaporating water, the structured surface yields an overall photothermal conversion efficiency over 60% under an illuminating solar power density of ~1 kW m-2. The presented technology provides a cost-effective, reliable, and simple way for realizing broadband omnidirectional light absorptive metal surfaces for efficient solar energy harvesting and utilization, which is highly demanded in various light harvesting, anti-reflection, and photothermal conversion applications. Since the structure is directly formed by femtosecond laser writing, it is quite suitable for mass production and can be easily extended to a large surface area.Efficient solar energy harvesting and photothermal conversion have essential importance for many practical applications. Here, we present a laser-induced cauliflower-shaped hierarchical surface nanostructure on a copper surface, which exhibits extremely high omnidirectional absorption efficiency over a broad electromagnetic spectral range from the UV to the near-infrared region. The measured average hemispherical absorptance is as high as 98% within the wavelength range of 200-800 nm, and the angle dependent specular reflectance stays below 0.1% within the 0-60° incident angle. Such a structured copper surface can exhibit an apparent

  12. Metabolism of 35S- and 14C-labeled propylthiouracil in a model in vitro system containing thyroid peroxidase.

    PubMed

    Taurog, A; Dorris, M L; Guziec, F S; Uetrecht, J P

    1989-06-01

    In previous communications we described an in vitro model system containing highly purified thyroid peroxidase (TPO) for studying the mechanism of inhibition of thyroid hormone biosynthesis by the antithyroid drugs, 6-propylthiouracil (PTU) and 1-methyl-2-mercaptoimidazole (MMI). We showed that inhibition of iodination of thyroglobulin in this system may be reversible or irreversible depending on the relative concentrations of iodide and drug and the TPO concentration. Metabolism of the drugs occurred under both conditions, but was more limited under irreversible conditions of inhibition. It was of interest to examine the nature of the drug metabolites associated with reversible and irreversible conditions of inhibition. For this purpose we have employed the 35S- and 14C-labeled drugs and a recently developed reverse phase HPLC procedure. Results of a similar study with MMI were reported in an earlier communication. In the present study we report our findings with PTU. Under conditions of reversible inhibition, PTU was readily metabolized and by 15 min was reduced to a few percent of the starting value. The earliest detectable metabolite with both [35S]- and [14C]PTU was the disulfide, which reached a peak in about 15 min and then slowly declined. Coincident with the decline in the disulfide was the appearance of more polar metabolites. In the case of [35S]PTU, these corresponded to sulfate/sulfite, PTU sulfonate, and a product tentatively identified as PTU sulfinate. The latter two were also observed as 14C-labeled metabolites produced from [14C]PTU. Two nonpolar desulfurated 14C-labeled metabolites were also observed. Surprisingly, these did not correspond to either propyluracil or propyldeoxyuracil, the anticipated most likely products of PTU desulfuration. The identity of these desulfurated metabolites of PTU in the TPO model system remains to be determined. Under conditions of irreversible inhibition of iodination, a relatively small fraction of PTU was

  13. Goltz Syndrome and PORCN Mosaicism

    PubMed Central

    Stevenson, D.A.; Chirpich, M.; Contreras, Y.; Hanson, H.; Dent, K.

    2014-01-01

    Goltz syndrome, also known as focal dermal hypoplasia, is characterized primarily by ectodermal and mesodermal defects. Manifestations include cutis aplasia, dermal hypoplasia, papillomas, chorioretinal colobomas, absent/dysplastic teeth, and skeletal anomalies. Goltz syndrome is an X-linked disorder due to mutations in PORCN, with a predominance of females affected. Germline mutations in PORCN are thought to result in embryonically lethality in males. We present a boy with a phenotype consistent with Goltz syndrome with low level mosaicism for a novel mutation in PORCN from peripheral blood (c.956dupA; p.Asn320GlufsX99). PMID:25040319

  14. Making Mosaics Of SAR Imagery

    NASA Technical Reports Server (NTRS)

    Curlander, John C.; Kwok, Ronald; Pang, Shirley S.; Pang, Amy A.

    1990-01-01

    Spaceborne synthetic-aperture-radar (SAR) images useful for mapping of planets and investigations in Earth sciences. Produces multiframe mosaic by combining images along ground track, in adjacent cross-track swaths, or in ascending and descending passes. Images registered with geocoded maps such as ones produced by MAPJTC (NPO-17718), required as input. Minimal intervention by operator required. MOSK implemented on DEC VAX 11/785 computer running VMS 4.5. Most subroutines in FORTRAN, but three in MAXL and one in APAL.

  15. Mosaic: NCSA Internet Network Navigational Tool.

    ERIC Educational Resources Information Center

    Machovec, George S.

    1994-01-01

    Describes Mosaic, an Internet resource locator and navigation tool developed at the University of Illinois' National Center for Super-Computing Applications (NCSA). Topics discussed include the relationship with the World Wide Web; flexibility; obtaining Mosaic client software; and file transfer protocol instructions. (Contains seven references.)…

  16. Mental Development in Down Syndrome Mosaicism.

    ERIC Educational Resources Information Center

    Fishler, Karol; Koch, Richard

    1991-01-01

    Comparison of the mental status of 30 subjects with Down's Syndrome mosaicism and 30 matched subjects with trisomy 21 Down's Syndrome found that the mean intelligent quotient of the mosaic Down's Syndrome group was significantly higher and that this group showed better verbal abilities and more normal visual-perceptual skills. (Author/DB)

  17. CNS depressants accelerate the dissociation of /sup 35/S-TBPS binding and GABA enhances their displacing potencies

    SciTech Connect

    Maksay, G.; Ticku, M.K.

    1988-01-01

    The specific binding of /sup 35/S-t-butylbicyclophosphorothionate (TBPS) was studied in synaptosomal membranes of rat cerebral cortex. The displacing potencies of eleven CNS depressants and three convulsants were determined in the presence of 1 /sup +/M GABA and 10 nM R 5135. GABA enhanced the displacing potencies of depressants of most diverse chemical structures: diaryltriazine (LY 81067), pyrazolopyridine (etazolate), cinnamide, glutarimide, 2,3-benzodiazepine (tofizopam) and alcohol derivatives, barbiturates, (+)etomidate, methaqualone and meprobamate. In contrast, the IC/sub 50/ values of convulsants (picrotoxinin, pentetrazol and the barbiturate enantiomer S(+)MPPB) were not significantly affected. The depressants accelerated either basal or GABA-augmented dissociation of /sup 35/-TBPS mainly by increasing the contribution of its rapid first phase.

  18. Characterization of the regulatory network of BoMYB2 in controlling anthocyanin biosynthesis in purple cauliflower.

    PubMed

    Chiu, Li-Wei; Li, Li

    2012-10-01

    Purple cauliflower (Brassica oleracea L. var. botrytis) Graffiti represents a unique mutant in conferring ectopic anthocyanin biosynthesis, which is caused by the tissue-specific activation of BoMYB2, an ortholog of Arabidopsis PAP2 or MYB113. To gain a better understanding of the regulatory network of anthocyanin biosynthesis, we investigated the interaction among cauliflower MYB-bHLH-WD40 network proteins and examined the interplay of BoMYB2 with various bHLH transcription factors in planta. Yeast two-hybrid studies revealed that cauliflower BoMYBs along with the other regulators formed the MYB-bHLH-WD40 complexes and BobHLH1 acted as a bridge between BoMYB and BoWD40-1 proteins. Different BoMYBs exhibited different binding activity to BobHLH1. Examination of the BoMYB2 transgenic lines in Arabidopsis bHLH mutant backgrounds demonstrated that TT8, EGL3, and GL3 were all involved in the BoMYB2-mediated anthocyanin biosynthesis. Expression of BoMYB2 in Arabidopsis caused up-regulation of AtTT8 and AtEGL3 as well as a subset of anthocyanin structural genes encoding flavonoid 3'-hydroxylase, dihydroflavonol 4-reductase, and leucoanthocyanidin dioxygenase. Taken together, our results show that MYB-bHLH-WD40 network transcription factors regulated the bHLH gene expression, which may represent a critical feature in the control of anthocyanin biosynthesis. BoMYB2 together with various BobHLHs specifically regulated the late anthocyanin biosynthetic pathway genes for anthocyanin biosynthesis. Our findings provide additional information for the complicated regulatory network of anthocyanin biosynthesis and the transcriptional regulation of transcription factors in vegetable crops. PMID:22644767

  19. Use Of Cosmogenic 35S To Trace The Uptake Process Of SO2 In Aerosols In The Atmosphere

    NASA Astrophysics Data System (ADS)

    Abramian, A.; Corbin, A.

    2008-12-01

    Environmental issues, such as acid rain and global warming, are linked to increased sulfur emissions and sulfate production in the atmosphere. Sulfate aerosol particles act as cloud condensation nuclei and can reduce the greenhouse effect by the indirect effect. Our understanding of the chemical and photochemical processes that govern the chemical transformations and transport of sulfur compounds in the atmosphere is still incomplete due to the complex, multivalent nature of sulfur and uncertainties in aerosol chemistry and transport (particularly trans-oceanic). We explore the use of cosmogenically produced 35S (half-life~87 days) to trace the uptake of SO2 gas into aerosols, as a function of aerosol size, in two different environments by simultaneously collecting and measuring [35SO42- ]and [35SO2]. These measurements can in turn be used to understand the time scales of SO2 oxidation to SO42-, aerosol 'age' and boundary layer dynamics. Aerosol samples are collected on glass fiber filters twice a week at Scripps Institute of Oceanography Pier in La Jolla, CA and the San Fernando Valley, CA for a 21-day period. SO2 (g) was collected on KOH impregnated filters placed after a 4-stage aerosol filter stack. We present preliminary results for both fine and coarse aerosol sulfate [35SO4] as well as [35SO2]. These measurements were done using low-noise liquid scintillation spectroscopy. By measuring the activity of each sample repeatedly over a period of 100 days, the exponential decay of 35S was observed, confirming the identity of the radioactive signal. The coastal and inland measurements are compared and implications for the atmospheric chemistry of SO2 and SO4 are discussed. Finally, we assess the potential of using [35SO4]/[nss-SO4] as a tracer of primary sulfate and trans-oceanic transport by coupling the measurements of the cation (Na+, Ca2+, K+, Mg2+, NH4+) and anion (Cl, NO3, SO4) concentrations in the aerosols.

  20. Web Map Services (WMS) Global Mosaic

    NASA Technical Reports Server (NTRS)

    Percivall, George; Plesea, Lucian

    2003-01-01

    The WMS Global Mosaic provides access to imagery of the global landmass using an open standard for web mapping. The seamless image is a mosaic of Landsat 7 scenes; geographically-accurate with 30 and 15 meter resolutions. By using the OpenGIS Web Map Service (WMS) interface, any organization can use the global mosaic as a layer in their geospatial applications. Based on a trade study, an implementation approach was chosen that extends a previously developed WMS hosting a Landsat 5 CONUS mosaic developed by JPL. The WMS Global Mosaic supports the NASA Geospatial Interoperability Office goal of providing an integrated digital representation of the Earth, widely accessible for humanity's critical decisions.

  1. The least square optimization in image mosaic

    NASA Astrophysics Data System (ADS)

    Zhang, Yu-dong; Yang, Yong-yue

    2015-02-01

    Image registration has been a hot research spot in the computer vision technology and image processing. Image registration is one of the key technologies in image mosaic. In order to improve the accuracy of matching feature points, this paper put forward the least square optimization in image mosaic based on the algorithm of matching similarity of matrices. The correlation coefficient method of matrix is used for matching the module points in the overlap region of images and calculating the error between matrices. The error of feature points can be further minimized by using the method of least square optimization. Finally, image mosaic can be achieved by the two pair of feature points with minimized residual sum of squares. The experimental results demonstrate that the least square optimization in image mosaic can mosaic images with overlap region and improve the accuracy of matching feature points.

  2. Mosaic two-lengthscale quasicrystals.

    PubMed

    Dotera, T; Oshiro, T; Ziherl, P

    2014-02-13

    Over the past decade, quasicrystalline order has been observed in many soft-matter systems: in dendritic micelles, in star and tetrablock terpolymer melts and in diblock copolymer and surfactant micelles. The formation of quasicrystals from such a broad range of 'soft' macromolecular micelles suggests that they assemble by a generic mechanism rather than being dependent on the specific chemistry of each system. Indeed, micellar softness has been postulated and shown to lead to quasicrystalline order. Here we theoretically explore this link by studying two-dimensional hard disks decorated with step-like square-shoulder repulsion that mimics, for example, the soft alkyl shell around the aromatic core in dendritic micelles. We find a family of quasicrystals with 10-, 12-, 18- and 24-fold bond orientational order which originate from mosaics of equilateral and isosceles triangles formed by particles arranged core-to-core and shoulder-to-shoulder. The pair interaction responsible for these phases highlights the role of local packing geometry in generating quasicrystallinity in soft matter, complementing the principles that lead to quasicrystal formation in hard tetrahedra. Based on simple interparticle potentials, quasicrystalline mosaics may well find use in diverse applications ranging from improved image reproduction to advanced photonic materials. PMID:24487618

  3. Moon - North Polar Mosaic, Color

    NASA Technical Reports Server (NTRS)

    1996-01-01

    During its flight, the Galileo spacecraft returned images of the Moon. The Galileo spacecraft surveyed the Moon on December 7, 1992, on its way to explore the Jupiter system in 1995-1997. The left part of this north pole view is visible from Earth. This color picture is a mosaic assembled from 18 images taken by Galileo's imaging system through a green filter. The left part of this picture shows the dark, lava-filled Mare Imbrium (upper left); Mare Serenitatis (middle left), Mare Tranquillitatis (lower left), and Mare Crisium, the dark circular feature toward the bottom of the mosaic. Also visible in this view are the dark lava plains of the Marginis and Smythii Basins at the lower right. The Humboldtianum Basin, a 650-kilometer (400-mile) impact structure partly filled with dark volcanic deposits, is seen at the center of the image. The Moon's north pole is located just inside the shadow zone, about a third of the way from the top left of the illuminated region. The Galileo project is managed for NASA's Office of Space Science by the Jet Propulsion Laboratory.

  4. Saturable binding of /sup 35/S-t-butylbicyclophosphorothionate to the sites linked to the GABA receptor and the interaction with gabaergic agents

    SciTech Connect

    Wong, D.T.; Threlkeld, P.G.; Bymaster, F.P.; Squires, R.F.

    1984-02-27

    /sup 35/S-t-Butylbicyclophosphorothionate (/sup 35/S-TBPS) binds in a concentration-saturable manner to specific sites on membranes from rat cerebral cortex. Using a filtration assay at 25/sup 0/C, in 250 mM NaCl, specific binding of /sup 35/S-TBPS constitutes about 84 to 94 percent of total binding, depending on radioligand concentrations. /sup 35/S-TBPS binding is optimal in the presence of NaCl or NaBr and substantially less in the presence of NaI or NaF. It is sensitive to the treatment with 0.05 percent Triton X-100 but not to repeated freezing and thawing, procedures which increase /sup 3/H-GABA binding. Pharmacological studies show that /sup 35/S-TBPS binding is strongly inhibited by GABA-A receptor agonists (e.g., GABA and muscimol) and by the noncompetitive antagonist, picrotoxin, but not the competitive antagonist, bicuculline. Compounds which enhance binding of radioactive GABA and benzodiazepines, such as the pyrazolopyridines, cartazolate and tracazolate, and a diaryltriazine, LY81067, are also potent inhibitors of /sup 35/S-TBPS binding, with LY81067 being the most effective. The effects of GABA, picrotoxin and LY81067 on the saturable binding of /sup 35/S-TBPS in cortical membranes are compared. The present findings are consistent with the interpretation that /sup 35/S-TBPS bind at or near the picrotoxin-sensitive anion recognition sites of the GABA/benzodiazepine/picrotoxin receptor complex.

  5. Self-assembly of Fe{sub 3}O{sub 4} nanocrystal-clusters into cauliflower-like architectures: Synthesis and characterization

    SciTech Connect

    Zhu Luping; Liao Guihong; Bing Naici; Wang Linlin; Xie Hongyong

    2011-09-15

    Large-scale cauliflower-like Fe{sub 3}O{sub 4} architectures consist of well-assembled magnetite nanocrystal clusters have been synthesized by a simple solvothermal process. The as-synthesized Fe{sub 3}O{sub 4} samples were characterized by XRD, XPS, FT-IR, SEM, TEM, etc. The results show that the samples exhibit cauliflower-like hierarchical microstructures. The influences of synthesis parameters on the morphology of the samples were experimentally investigated. Magnetic properties of the Fe{sub 3}O{sub 4} cauliflower-like hierarchical microstructures have been detected by VSM at room temperature, showing a relatively low saturation magnetization of 65 emu/g and an enhanced coercive force of 247 Oe. - Graphical Abstract: Cauliflower-like Fe{sub 3}O{sub 4} architectures consist of well-assembled magnetite nanocrystal clusters have been synthesized by a simple solvothermal process, using FeCl{sub 3}.6H{sub 2}O and EDA as the starting materials. Highlights: > Cauliflower-like Fe{sub 3}O{sub 4} architectures were successfully prepared by a simple solvothermal route. > The cauliflower-like Fe{sub 3}O{sub 4} architectures have a size in the range of 200-300 nm. > They show a low saturation magnetization of 65 emu/g and an enhanced coercive force of 247 Oe. > These Fe{sub 3}O{sub 4} architectures may have potential applications in catalysis and biological fields.

  6. Saturable binding of /sup 35/S-t-butylbicyclophosphorothionate to the sites linked to the GABA receptor and the interaction with gabaergic agents

    SciTech Connect

    Wong, D.T.; Threlkeld, P.G.; Bymaster, F.P.; Squires, R.F.

    1984-02-27

    /sup 35/-S-t-Butylbicyclophosphorothionate (/sup 35/S-TBPS) binds in a concentration-saturable manner to specific sites on membranes from rat cerebral cortex. Using a filtration assay at 25/sup 0/C, in 250 mM NaCl, specific binding of /sup 35/S-TBPS constitutes about 84 to 94 percent of total binding, depending on radioligand concentrations. /sup 35/S-TBPS binding is optimal in the presence of NaCl or NaBr and substantially less in the presence of NaI or NaF. It is sensitive to the treatment with 0.05 percent Triton X-100 but not to repeated freezing and thawing, procedures which increase /sup 3/H-GABA binding. Pharmacological studies show that /sup 35/S-TBPS binding is strongly inhibited by GABA-A receptor agonists (e.g., GABA and muscimol) and by the noncompetitive antagonist, picrotoxin, but not the competitive antagonist, bicuculline. Compounds which enhance binding of radioactive GABA and benzodiazepines, such as the pyrazolopyridines, cartazolate and trazolate, and a diaryl-triazine, LY81067, are also potent inhibitors of /sup 35/S-TBPS binding, with LY81067 being the most effective. The effects of GABA, picrotoxin

  7. Mosaicism

    MedlinePlus

    ... 2011:chap 76. Stankiewicz P, Lupski JR. Gene, genomic, and chromosomal disorders. In: Goldman L, Schafer AI, eds. Goldman's Cecil Medicine . 24th ed. Philadelphia, PA: Elsevier Saunders; 2011:chap ...

  8. Genetic mechanisms of Maize dwarf mosaic virus resistance in maize

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Maize resistance to viruses has been well-characterized at the genetic level, and loci responsible for resistance to potyviruses including Maize dwarf mosaic virus (MDMV), Sugarcane mosaic virus (SCMV), Sorghum mosaic virus (SrMV), and Johnsongrass mosaic virus (JGMV), have been mapped in several ge...

  9. Synthesis of cauliflower-like ZnO-TiO 2 composite porous film and photoelectrical properties

    NASA Astrophysics Data System (ADS)

    Jiang, Yinhua; Yan, Yun; Zhang, Wenli; Ni, Liang; Sun, Yueming; Yin, Hengbo

    2011-05-01

    A series of cauliflower-like TiO 2-ZnO composite porous films with various molar ratios of Zn/Ti were prepared by the screen printing technique on the fluorine-doped SnO 2 (FTO) conducting glasses. The composite films were characterized by field-emission scanning electron microscopy (FE-SEM), X-ray energy-dispersive spectrometry (EDS) and UV-vis transmittance spectrum. The results showed composite film electrode had a novel cauliflower-like morphology, which could effectively increase the dye absorption. The corresponding dye-sensitized solar cells (DSCs) were made by the composite film, and effects of ZnO incorporation on the photovoltaic performances of the DSCs were studied. With the Zn/Ti molar ratio not more than 3% in ZnO-TiO 2 composite film of about 5 μm-thickness, the photocurrent density ( Jsc) and the solar-to-electricity conversion efficiency ( η) were greatly improved compared with those of the DSC based on bare TiO 2 film of same thickness. This increases in efficiency and Jsc were attributed to high electron conductivity of ZnO, the improved dye adsorption and large light transmittance of composite film.

  10. A MOSAIC for the Science Classroom

    NASA Astrophysics Data System (ADS)

    Fish, Vincent L.; Needles, M. M.; Rogers, A. E. E.; Costa, D.; Cadigan, J.; Clements, C.; May, S. K.

    2011-01-01

    MOSAIC (Mesospheric Ozone System for Atmospheric Investigations in the Classroom) is a project to engage secondary and undergraduate students in authentic inquiry-based science learning using a network of inexpensive spectrometers monitoring the mesospheric ozone concentration. The MOSAIC system observes the 11 GHz emission line of ozone using electronics built around satellite television equipment. The possibilities for student investigation are broad and scientifically significant. MOSAIC observations have confirmed diurnal variations in mesospheric ozone concentration and detected semiannual variations that may be due to inter-hemispheric meridional circulation of water vapor. Possible future projects include monitoring the temperature of the mesosphere and correlations with the solar cycle. Students are also encouraged to design their own investigations with MOSAIC data. Early results have been reported in a major scientific journal, and further scientific progress is likely as future MOSAIC systems are deployed -- increasing the sensitivity and geographic coverage of the network. Complete teaching units, including slides, laboratory activities, background information, student worksheets, and conformance with national and Massachusetts educational standards, have been developed to integrate MOSAIC into a classroom environment. One unit introduces the layers of the atmosphere, Earth's energy balance, the greenhouse effect, processes of ozone creation and destruction, noctilucent clouds, heat transfer, the laws of thermodynamics, radio waves (including radio astronomy), and fluid behavior. A second unit, currently being tested in classrooms, uses the MOSAIC system to motivate and deepen understanding of a large portion of electromagnetism in a conceptual physics class. MOSAIC has also been used in a local high school chemistry class. MOSAIC is still in development and is funded by the National Science Foundation.

  11. Mosaic organization of DNA nucleotides

    NASA Technical Reports Server (NTRS)

    Peng, C. K.; Buldyrev, S. V.; Havlin, S.; Simons, M.; Stanley, H. E.; Goldberger, A. L.

    1994-01-01

    Long-range power-law correlations have been reported recently for DNA sequences containing noncoding regions. We address the question of whether such correlations may be a trivial consequence of the known mosaic structure ("patchiness") of DNA. We analyze two classes of controls consisting of patchy nucleotide sequences generated by different algorithms--one without and one with long-range power-law correlations. Although both types of sequences are highly heterogenous, they are quantitatively distinguishable by an alternative fluctuation analysis method that differentiates local patchiness from long-range correlations. Application of this analysis to selected DNA sequences demonstrates that patchiness is not sufficient to account for long-range correlation properties.

  12. Mosaic of Commemorative Microscope Substrate

    NASA Technical Reports Server (NTRS)

    2008-01-01

    Written by electron beam lithography in the Microdevices Laboratory of NASA's Jet Propulsion Laboratory, this Optical Microscope substrate helps the Phoenix Mars Mission science team learn how to assemble individual microscope images into a mosaic by aligning rows of text.

    Each line is about 0.1 millimeter tall, the average thickness of a human hair. Except for the Mogensen twins, the names are of babies born and team members lost during the original development of MECA (the Microscopy, Electrochemistry and Conductivity Analyzer) for the canceled 2001 Mars lander mission. The plaque also acknowledges the MECA 2001 principal investigator, now retired.

    This image was taken by the MECA Optical Microscope on Sol 111, or the 111th day of the Phoenix mission (Sept. 16, 2008).

    The Phoenix Mission is led by the University of Arizona, Tucson, on behalf of NASA. Project management of the mission is by JPL, Pasadena, Calif. Spacecraft development was by Lockheed Martin Space Systems, Denver.

  13. Unrevealed mosaicism in the next-generation sequencing era.

    PubMed

    Gajecka, Marzena

    2016-04-01

    Mosaicism refers to the presence in an individual of normal and abnormal cells that are genotypically distinct and are derived from a single zygote. The incidence of mosaicism events in the human body is underestimated as the genotypes in the mosaic ratio, especially in the low-grade mosaicism, stay unrevealed. This review summarizes various research outcomes and diagnostic questions in relation to different types of mosaicism. The impact of both tested biological material and applied method on the mosaicism detection rate is especially highlighted. As next-generation sequencing technologies constitute a promising methodological solution in mosaicism detection in the coming years, revisions in current diagnostic protocols are necessary to increase the detection rate of the unrevealed mosaicism events. Since mosaicism identification is a complex process, numerous examples of multistep mosaicism investigations are presented and discussed. PMID:26481646

  14. Mars Pathfinder 'Filled Donut' Mosaic

    NASA Technical Reports Server (NTRS)

    2000-01-01

    This image is a product of 3data sets: a color mosaic image of the 'Gallery Panorama', an image which indicates the distance to the nearest object at each pixel location, referred to as a range image, and a digital image of a full-scale museum model of the MPF Lander.

    The Gallery Pan image and the range image were projected onto a continuous cylindrical/perspective coordinate system spanning 360 degrees of azimuth. The range image was then treated as a displacement map with respect to a sphere's surface, and the color image mosaic was draped onto the inside of the sphere so that lines of constant azimuth radiate from the center and lines of constant elevation are concentric circles. The position of the camera is fixed at the sphere's center, while its viewing direction is in this case looking at the south pole of the sphere. This projection preserves the resolution of the original panorama.

    The distortion visible near the edges of this image is due to the large field of view, as well as the limitation introduced by using cylindrically-projected images on the sphere - the effects of which are less apparent when smaller fields of view are used.

    The center of the image consists of the museum model image, which has been geometrically warped to spatially register with the projected Gallery Pandata. The position of the camera was fixed above the model so that the IMPMast was roughly at Nadir.

    The image has been rotated so that the main points of interest, which are the 'Rock Garden', the rover Sojourner and the rock 'Yogi', are visible arching across the upper hemisphere. In fixed Mars Surface coordinates, the top of the image looks out towards a point a few degrees north of West. Color has been enhanced to improve contrast in features, and is derived from IMP spectral filters 5, 9 and 0.

  15. 40 CFR 174.514 - Coat Protein of Watermelon Mosaic Virus-2 and Zucchini Yellow Mosaic Virus; exemption from the...

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... Virus-2 and Zucchini Yellow Mosaic Virus; exemption from the requirement for a tolerance. 174.514... Coat Protein of Watermelon Mosaic Virus-2 and Zucchini Yellow Mosaic Virus; exemption from the requirement for a tolerance. Residues of Coat Protein of Watermelon Mosaic Virus-2 and Zucchini Yellow...

  16. 40 CFR 174.514 - Coat Protein of Watermelon Mosaic Virus-2 and Zucchini Yellow Mosaic Virus; exemption from the...

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... Virus-2 and Zucchini Yellow Mosaic Virus; exemption from the requirement for a tolerance. 174.514... Coat Protein of Watermelon Mosaic Virus-2 and Zucchini Yellow Mosaic Virus; exemption from the requirement for a tolerance. Residues of Coat Protein of Watermelon Mosaic Virus-2 and Zucchini Yellow...

  17. 40 CFR 174.514 - Coat Protein of Watermelon Mosaic Virus-2 and Zucchini Yellow Mosaic Virus; exemption from the...

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... Virus-2 and Zucchini Yellow Mosaic Virus; exemption from the requirement for a tolerance. 174.514... Coat Protein of Watermelon Mosaic Virus-2 and Zucchini Yellow Mosaic Virus; exemption from the requirement for a tolerance. Residues of Coat Protein of Watermelon Mosaic Virus-2 and Zucchini Yellow...

  18. 40 CFR 174.514 - Coat Protein of Watermelon Mosaic Virus-2 and Zucchini Yellow Mosaic Virus; exemption from the...

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... Virus-2 and Zucchini Yellow Mosaic Virus; exemption from the requirement for a tolerance. 174.514... Coat Protein of Watermelon Mosaic Virus-2 and Zucchini Yellow Mosaic Virus; exemption from the requirement for a tolerance. Residues of Coat Protein of Watermelon Mosaic Virus-2 and Zucchini Yellow...

  19. 40 CFR 174.514 - Coat Protein of Watermelon Mosaic Virus-2 and Zucchini Yellow Mosaic Virus; exemption from the...

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... Virus-2 and Zucchini Yellow Mosaic Virus; exemption from the requirement for a tolerance. 174.514... Coat Protein of Watermelon Mosaic Virus-2 and Zucchini Yellow Mosaic Virus; exemption from the requirement for a tolerance. Residues of Coat Protein of Watermelon Mosaic Virus-2 and Zucchini Yellow...

  20. In vitro screening of psychoactive drugs by [(35)S]GTPgammaS binding in rat brain membranes.

    PubMed

    Nonaka, Ryouichi; Nagai, Fumiko; Ogata, Akio; Satoh, Kanako

    2007-12-01

    We constructed a reproducible, simple, and small-scale determination method of the psychoactive drugs that acted directly on the monoamine receptor by measuring the activation of [(35)S]guanosine-5'-O-(3-thio)-triphosphate binding to guanine nucleotide-binding proteins (G proteins). This method can simultaneously measure the effects of three monoamines, namely dopamine (DA), serotonin (5-HT), and norepinephrine (NE), in rat brain membranes using a 96-well microplate. Activation of D(1) and D(2) receptors in striatal membranes by DA as well as 5-HT and NEalpha(2) receptors in cortical membranes could be measured. Of 12 tested phenethylamines, 2,5-dimethoxy-4-chlorophenethylamine (2C-C), 2,5-dimethoxy-4-ethylphenethylamine (2C-E), and 2,5-dimethoxy-4-iodophenethylamine (2C-I) stimulated G protein binding. The other phenethylamines did not affect G protein binding. All 7 tryptamines tested stimulated G protein binding with the following rank order of potency; 5-methoxy-N,N-dimethyltryptamine (5-MeO-DMT)>5-methoxy-N,N-diallyltryptamine (5-MeO-DALT)>5-methoxy-alpha-methyltryptamine (5-MeO-AMT)>or=5-methoxy-N,N-methylisopropyltryptamine (5-MeO-MIPT)>5-methoxy-N,N-diisopropyltryptamine (5-MeO-DIPT)>N,N-dipropyltryptamine (DPT)>or=alpha-methyltryptamine (AMT). This assay system was able to designate psychoactive drugs as prohibited substances in accordance with criteria set forth by the Tokyo Metropolitan government. PMID:18057721

  1. Unexpected high 35S concentration revealing strong downward transport of stratospheric air during the monsoon transitional period in East Asia

    NASA Astrophysics Data System (ADS)

    Lin, Mang; Zhang, Zhisheng; Su, Lin; Su, Binbin; Liu, Lanzhong; Tao, Jun; Fung, Jimmy C. H.; Thiemens, Mark H.

    2016-03-01

    October is the monsoon transitional period in East Asia (EA) involving a series of synoptic activities that may enhance the downward transport of stratospheric air to the planetary boundary layer (PBL). Here we use cosmogenic 35S in sulfate aerosols (35SO42-) as a tracer for air masses originating from the stratosphere and transported downward to quantify these mixing processes. From 1 year 35SO42- measurements (March 2014 to February 2015) at a background station in EA we find remarkably enhanced 35SO42- concentration (3150 atoms m-3) in October, the highest value ever reported for natural sulfate aerosols. A four-box 1-D model and meteorological analysis reveal that strong downward transport from the free troposphere is a vital process entraining aged stratospheric air masses to the PBL. The aged stratospheric masses are accumulated in the PBL, accelerating the SO2 transformation to SO42-. Implications for the tropospheric O3 budget and the CO2 biogeochemical cycle are discussed.

  2. Comparison of 35S and biotin as labels for in situ hybridization: Use of an HPV model system

    SciTech Connect

    Unger, E.R.; Hammer, M.L.; Chenggis, M.L. )

    1990-01-01

    Colorimetric in situ hybridization is a method of potential importance in diagnosis and research. The largest criticism of the method has been a perceived loss of sensitivity compared with autoradiographic techniques. Our more positive experience with automation of colorimetric in situ hybridization led us to undertake a direct comparison of the sensitivity of 35S- and biotin-labeled probes. Serial sections of formalin-fixed, paraffin-embedded cell pellets from four human cervical carcinoma cell lines with known copies of HPV (CaSki, 400-600 copies HPV 16; HeLa, 10-50 copies HPV 18; SiHa, 1-2 copies HPV 16; HTB31, no known copies HPV) were hybridized with protocols optimized for autoradiographic or colorimetric detection. Both methods gave comparable results, with differences in each technique seen at the limits of sensitivity. The 1-2 copies of HPV 16 per SiHa cell can be detected with both methods; however, grain counting is required for interpretation of the autoradiographic result. This degree of sensitivity for colorimetric in situ hybridization in formalin-fixed, paraffin-embedded material is achieved through careful optimization of probe size and labeling, adequate tissue digestion, and removal of background. Autoradiography may be preferred in situations where quantitation is required, but colorimetric detection retains the advantages of speed, potential for automation, and improved localization of signal with comparable sensitivity.

  3. Autoradiography of serotonin 5-HT1A receptor-activated G proteins in guinea pig brain sections by agonist-stimulated [35S]GTPgammaS binding.

    PubMed

    Dupuis, D S; Palmier, C; Colpaert, F C; Pauwels, P J

    1998-03-01

    G protein activation mediated by serotonin 5-HT1A and 5-HT(1B/D) receptors in guinea pig brain was investigated by using quantitative autoradiography of agonist-stimulated [35S]GTPgammaS binding to brain sections. [35S]GTPgammaS binding was stimulated by the mixed 5-HT1A/5-HT(1B/D) agonist L694247 in brain structures enriched in 5-HT1A binding sites, i.e., hippocampus (+140 +/- 14%), dorsal raphe (+70 +/- 8%), lateral septum (+52 +/- 12%), cingulate (+36 +/- 8%), and entorhinal cortex (+34 +/- 5%). L694247 caused little or no stimulation of [35S]GTPgammaS binding in brain regions with high densities of 5-HT(1B/D) binding sites (e.g., substantia nigra, striatum, central gray, and dorsal subiculum). The [35S]GTPgammaS binding response was antagonized by WAY100635 (10 microM) and methiothepin (10 microM). In contrast, the 5-HT1B inverse agonist SB224289 (10 microM) did not affect the L694247-mediated [35S]GTPgammaS binding response, and the mixed 5-HT(1B/D) antagonist GR127935 (10 microM) yielded a partial blockade. The distribution pattern of the [35S]GTPgammaS binding response and the antagonist profile suggest the L694247-mediated response in guinea pig brain to be mediated by 5-HT1A receptors. In addition to L694247, 8-hydroxy-2-(di-n-propylamino)tetralin, and flesinoxan also stimulated [35S]GTPgammaS binding; their maximal responses varied between 46 and 52% compared with L694247, irrespective of the brain structure being considered. Sumatriptan, rizatriptan, and zolmitriptan (10 microM) stimulated [35S]GTPgammaS binding in the hippocampus by 20-50%. Naratriptan, CP122638, and dihydroergotamine stimulated [35S]GTPgammaS binding to a similar level as L694247 in hippocampus, lateral septum, and dorsal raphe. It appears that under the present experimental conditions, G protein activation through 5-HT1A but not 5-HT(1B/D) receptors can be measured in guinea pig brain sections. PMID:9489749

  4. Preparing for Themis Controlled Global Mars Mosaics

    NASA Technical Reports Server (NTRS)

    Archinal, B. A.; Weller, L.; Sides, S.; Cushing, G.; Kirk, R. L.; Soderblom, L. A.; Duxbury, T. C.

    2004-01-01

    We have begun work to prepare for producing controlled 2001 Mars Odyssey THEMIS infrared (IR) and visible (VIS) global mosaics of Mars. This effort is being coordinated with colleagues from Arizona State University and on the THEMIS team who plan to address radiometric issues in making such mosaics. We are concentrating on geometric issues. Several areas of investigation are now in progress, including: a) characterizing the absolute pointing accuracy of THEMIS images; b) investigating whether automatic tie point matching algorithms could be used to provide connections between overlapping THEMIS images; c) developing algorithms to allow for the photogrammetric (bundle) adjustment of the THEMIS IR (line scanner) camera images. Our primary goal in this pilot study effort will be to make several test control THEMIS mosaics and better determine which methods could be used, which require development, and what level of effort is required, in order to make large regional or global controlled THEMIS mosaics.

  5. Recurrence risk for germinal mosaics revisited.

    PubMed Central

    van der Meulen, M A; van der Meulen, M J; te Meerman, G J

    1995-01-01

    A formula to calculate recurrence risk for germline mosaicism published by Hartl in 1971 has been updated to include marker information. For practical genetic counselling new, more elaborate tables are given. PMID:7760316

  6. NEAR MSI Mosaics of 433 Eros

    NASA Astrophysics Data System (ADS)

    Robinson, M. S.; Bussey, D. B. J.; Edmonds, J.; Lutsey, J.; Milne, A.; Moore, K.; Prockter, L.; Wilcox, B.

    2002-03-01

    We have produced over 300 handlaid mosaics of Eros with resolutions ranging from ~20 m/pixel down to 2 cm pixel. These data are available to assist both the science community and education and outreach activities.

  7. Somatic Mosaicism in the Human Genome

    PubMed Central

    Freed, Donald; Stevens, Eric L.; Pevsner, Jonathan

    2014-01-01

    Somatic mosaicism refers to the occurrence of two genetically distinct populations of cells within an individual, derived from a postzygotic mutation. In contrast to inherited mutations, somatic mosaic mutations may affect only a portion of the body and are not transmitted to progeny. These mutations affect varying genomic sizes ranging from single nucleotides to entire chromosomes and have been implicated in disease, most prominently cancer. The phenotypic consequences of somatic mosaicism are dependent upon many factors including the developmental time at which the mutation occurs, the areas of the body that are affected, and the pathophysiological effect(s) of the mutation. The advent of second-generation sequencing technologies has augmented existing array-based and cytogenetic approaches for the identification of somatic mutations. We outline the strengths and weaknesses of these techniques and highlight recent insights into the role of somatic mosaicism in causing cancer, neurodegenerative, monogenic, and complex disease. PMID:25513881

  8. A rare case: mosaic trisomy 22.

    PubMed

    Basaran, N; Berkil, H; Ay, N; Durak, B; Ataman, C; Ozdemir, M; Ozon, Y H; Kaya, I

    2001-01-01

    A 9-year-old female child of healthy parents (mother: 43 years, father: 44 years) was referred to our center because of severe mental retardation. While pedigree analysis was not contributory, two older sibs were normal and healthy. Physical examination revealed facial dysmorphism, microcephaly and hyperflexibility of all joints. Her chromosome constitution showed a mosaic pattern; mos 46,XX[98]/47,XX,+22[2]. So skin biopsy was performed and mosaic trisomy 22 was confirmed with FISH analysis (46,XX[73]/47,XX,+22[27]). Physical features of this case seemed consistent with her mosaic constitution. This report would be a demonstrative example to show the significant contribution of FISH in states of mosaicism. PMID:11755102

  9. Mosaicism and uniparental disomy in prenatal diagnosis.

    PubMed

    Eggermann, Thomas; Soellner, Lukas; Buiting, Karin; Kotzot, Dieter

    2015-02-01

    Chromosomal mosaicism is the presence of numerous cell lines with different chromosomal complements in the same individual. Uniparental disomy (UPD) is the inheritance of two homologous chromosomes from the same parent. These genetic anomalies arise from errors in meiosis and/or mitosis and can occur independently or in combination. Due to the formation mechanisms of UPD, low-level or undetected mosaicisms are assumed for a significant number of UPD cases. The pre- and postnatal clinical consequences of mosaicism for chromosomal aberrations and/or UPD depend on the gene content of the involved chromosome. In prenatal evaluation of chromosomal mosaicism and UPD, genetic counseling should be offered before any laboratory testing. PMID:25547535

  10. Superconductivity versus structural phase transition in the closely related Bi2Rh3.5S2 and Bi2Rh3S2

    DOE PAGESBeta

    Kaluarachchi, Udhara S.; Xie, Weiwei; Lin, Qisheng; Taufour, Valentin; Bud'ko, Sergey L.; Miller, Gordon J.; Canfield, Paul C.

    2015-05-19

    Single crystals of Bi2Rh3S2 and Bi2Rh3.5S2 were synthesized by solution growth, and the crystal structures and thermodynamic and transport properties of both compounds were studied. In the case of Bi2Rh3S2, a structural first-order transition at around 165 K is identified by single-crystal diffraction experiments, with clear signatures visible in resistivity, magnetization, and specific heat data. No superconducting transition for Bi2Rh3S2 was observed down to 0.5 K. In contrast, no structural phase transition at high temperature was observed for Bi2Rh3.5S2; however, bulk superconductivity with a critical temperature, Tc ≈ 1.7 K, was observed. The Sommerfeld coefficient γ and the Debye temperaturemore » (ΘD) were found to be 9.41 mJ mol–1K–2 and 209 K, respectively, for Bi2Rh3S2, and 22 mJ mol–1K–2 and 196 K, respectively, for Bi2Rh3.5S2. As a result, the study of the specific heat in the superconducting state of Bi2Rh3.5S2 suggests that Bi2Rh3.5S2 is a weakly coupled, BCS superconductor.« less

  11. Superconductivity versus structural phase transition in the closely related Bi2Rh3.5S2 and Bi2Rh3S2

    NASA Astrophysics Data System (ADS)

    Kaluarachchi, Udhara S.; Xie, Weiwei; Lin, Qisheng; Taufour, Valentin; Bud'ko, Sergey L.; Miller, Gordon J.; Canfield, Paul C.

    2015-05-01

    Single crystals of Bi2Rh3S2 and Bi2Rh3.5S2 were synthesized by solution growth, and the crystal structures and thermodynamic and transport properties of both compounds were studied. In the case of Bi2Rh3S2 , a structural first-order transition at around 165 K is identified by single-crystal diffraction experiments, with clear signatures visible in resistivity, magnetization, and specific heat data. No superconducting transition for Bi2Rh3S2 was observed down to 0.5 K. In contrast, no structural phase transition at high temperature was observed for Bi2Rh3.5S2 ; however, bulk superconductivity with a critical temperature, Tc≈1.7 K, was observed. The Sommerfeld coefficient γ and the Debye temperature (ΘD ) were found to be 9.41 mJ mol-1K-2 and 209 K, respectively, for Bi2Rh3S2 , and 22 mJ mol-1K-2 and 196 K, respectively, for Bi2Rh3.5S2 . Study of the specific heat in the superconducting state of Bi2Rh3.5S2 suggests that Bi2Rh3.5S2 is a weakly coupled, BCS superconductor.

  12. Mosaic Neurocutaneous Disorders and Their Causes.

    PubMed

    Ruggieri, Martino; Praticò, Andrea D

    2015-12-01

    Neurocutaneous disorders are a heterogeneous group of conditions (mainly) affecting the skin [with pigmentary/vascular abnormalities and/or cutaneous tumours] and the central and peripheral nervous system [with congenital abnormalities and/or tumours]. In a number of such disorders, the skin abnormalities can assume a mosaic patterning (usually arranged in archetypical patterns). Alternating segments of affected and unaffected skin or segmentally arranged patterns of abnormal skin often mirror similar phenomena occurring in extra-cutaneous organs/tissues [eg, eye, bone, heart/vessels, lung, kidney and gut]. In some neurocutaneous syndromes the abnormal mosaic patterning involve mainly the skin and the nervous system configuring a (true) mosaic neurocutaneous disorder; or an ordinary trait of a neurocutaneous disorder is sometimes superimposed by a pronounced linear or otherwise segmental involvement; or, lastly, a neurocutaneous disorder can occur solely in a mosaic pattern. Recently, the molecular genetic and cellular bases of an increasing number of neurocutaneous disorders have been unravelled, shedding light on the interplays between common intra- and extra-neuronal signalling pathways encompassing receptor-protein and protein-to-protein cascades (eg, RAS, MAPK, mTOR, PI3K/AKT and GNAQ pathways), which are often responsible of the mosaic distribution of cutaneous and extra-cutaneous features. In this article we will focus on the well known, and less defined mosaic neurocutaneous phenotypes and their related molecular/genetic bases, including the mosaic neurofibromatoses and their related forms (ie, spinal neurofibromatosis and schwannomatosis); Legius syndrome; segmental arrangements in tuberous sclerosis; Sturge-Weber and Klippel-Trenaunay syndromes; microcephaly/megalencephaly-capillary malformation; blue rubber bleb nevus syndrome; Wyburn-Mason syndrome; mixed vascular nevus syndrome; PHACE syndrome; Incontinentia pigmenti; pigmentary mosaicism of the Ito

  13. HIGH-RESOLUTION GENETIC MAPPING OF OR, A GENE THAT INDUCES BETA-CAROTENE ACCUMULATION IN CAULIFLOWER (BRASSICA OLERACEA L. VAR. BOTRYTIS)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The cauliflower Or gene is a semi-dominant, single-locus mutation that causes the accumulation of beta-carotene in various tissues of the plant, turning them orange. To elucidate the molecular basis of Or in the regulation of carotenoid accumulation in the plant, we initiated the isolation of Or by...

  14. Genome-Wide Single-Nucleotide Polymorphisms Discovery and High-Density Genetic Map Construction in Cauliflower Using Specific-Locus Amplified Fragment Sequencing

    PubMed Central

    Zhao, Zhenqing; Gu, Honghui; Sheng, Xiaoguang; Yu, Huifang; Wang, Jiansheng; Huang, Long; Wang, Dan

    2016-01-01

    Molecular markers and genetic maps play an important role in plant genomics and breeding studies. Cauliflower is an important and distinctive vegetable; however, very few molecular resources have been reported for this species. In this study, a novel, specific-locus amplified fragment (SLAF) sequencing strategy was employed for large-scale single nucleotide polymorphism (SNP) discovery and high-density genetic map construction in a double-haploid, segregating population of cauliflower. A total of 12.47 Gb raw data containing 77.92 M pair-end reads were obtained after processing and 6815 polymorphic SLAFs between the two parents were detected. The average sequencing depths reached 52.66-fold for the female parent and 49.35-fold for the male parent. Subsequently, these polymorphic SLAFs were used to genotype the population and further filtered based on several criteria to construct a genetic linkage map of cauliflower. Finally, 1776 high-quality SLAF markers, including 2741 SNPs, constituted the linkage map with average data integrity of 95.68%. The final map spanned a total genetic length of 890.01 cM with an average marker interval of 0.50 cM, and covered 364.9 Mb of the reference genome. The markers and genetic map developed in this study could provide an important foundation not only for comparative genomics studies within Brassica oleracea species but also for quantitative trait loci identification and molecular breeding of cauliflower. PMID:27047515

  15. Genetic variation of temperature-regulated curd induction in cauliflower: elucidation of floral transition by genome-wide association mapping and gene expression analysis

    PubMed Central

    Matschegewski, Claudia; Zetzsche, Holger; Hasan, Yaser; Leibeguth, Lena; Briggs, William; Ordon, Frank; Uptmoor, Ralf

    2015-01-01

    Cauliflower (Brassica oleracea var. botrytis) is a vernalization-responsive crop. High ambient temperatures delay harvest time. The elucidation of the genetic regulation of floral transition is highly interesting for a precise harvest scheduling and to ensure stable market supply. This study aims at genetic dissection of temperature-dependent curd induction in cauliflower by genome-wide association studies and gene expression analysis. To assess temperature-dependent curd induction, two greenhouse trials under distinct temperature regimes were conducted on a diversity panel consisting of 111 cauliflower commercial parent lines, genotyped with 14,385 SNPs. Broad phenotypic variation and high heritability (0.93) were observed for temperature-related curd induction within the cauliflower population. GWA mapping identified a total of 18 QTL localized on chromosomes O1, O2, O3, O4, O6, O8, and O9 for curding time under two distinct temperature regimes. Among those, several QTL are localized within regions of promising candidate flowering genes. Inferring population structure and genetic relatedness among the diversity set assigned three main genetic clusters. Linkage disequilibrium (LD) patterns estimated global LD extent of r2 = 0.06 and a maximum physical distance of 400 kb for genetic linkage. Transcriptional profiling of flowering genes FLOWERING LOCUS C (BoFLC) and VERNALIZATION 2 (BoVRN2) was performed, showing increased expression levels of BoVRN2 in genotypes with faster curding. However, functional relevance of BoVRN2 and BoFLC2 could not consistently be supported, which probably suggests to act facultative and/or might evidence for BoVRN2/BoFLC-independent mechanisms in temperature-regulated floral transition in cauliflower. Genetic insights in temperature-regulated curd induction can underpin genetically informed phenology models and benefit molecular breeding strategies toward the development of thermo-tolerant cultivars. PMID:26442034

  16. Incidence of Wheat streak mosaic virus, Triticum mosaic virus, and Wheat mosaic virus in wheat curl mites recovered from maturing winter wheat spikes

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Wheat curl mites (WCM; Aceria tosichella) transmit Wheat streak mosaic virus (WSMV), Triticum mosaic virus (TriMV), and Wheat mosaic virus (WMoV) to wheat (Triticum aestivum L.) in the Great Plains region of the United States. These viruses can be detected in single, double, or triple combinations i...

  17. Bean Common Mosaic Virus and Bean Common Mosaic Necrosis Virus (Genus Potyvirus; Potyviridae)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Bean common mosaic virus (BCMV) and Bean common mosaic necrosis virus (BCMNV) are species within the genus Potyvirus, family Potyviridae and cause some of the most economically important diseases of legume crops worldwide. Both viruses occur essentially wherever bean and cowpea (including Phaseolus...

  18. Multiplex Real Time PCR For Detection of Wheat Streak Mosaic Virus and Triticum Mosaic Virus

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Wheat streak mosaic virus (WSMV) and Triticum mosaic virus (TRIMV) are widespread throughout the southwestern Great Plains states. Using conventional diagnostics such as Enzyme-Linked Immunosorbent Assays (ELISA), these two viruses are commonly found together in infected wheat samples. Methods for m...

  19. Spherical cauliflower-like carbon dust formed by interaction between deuterium plasma and graphite target and its internal structure

    NASA Astrophysics Data System (ADS)

    Ohno, N.; Yoshimi, M.; Tokitani, M.; Takamura, S.; Tokunaga, K.; Yoshida, N.

    2009-06-01

    Simulated experiments to produce carbon dust particles with cauliflower structure have been performed in a liner plasma device, NAGDIS-II by exposing high density deuterium plasma to a graphite sample (IG-430U). Formation of carbon dust depends on the surface temperature and the incident ion energy. At a surface temperature 600-700 K, a lot of isolated spherical dust particles are observed on the graphite target. The internal structure of an isolated dust particle was observed with Focused Ion Beam (FIB) system and Transmission Electron Microscope (TEM) in detail. FIB analysis clearly shows there exist honey-combed cell structure with thin carbon walls in the dust particle and the dust particle grows from the graphite surface. TEM image also shows that the dust particle is made of amorphous carbon with crystallized grains with diameters of 10-50 nm.

  20. Lithium Sulfur Primary Battery with Super High Energy Density: Based on the Cauliflower-like Structured C/S Cathode

    NASA Astrophysics Data System (ADS)

    Ma, Yiwen; Zhang, Hongzhang; Wu, Baoshan; Wang, Meiri; Li, Xianfeng; Zhang, Huamin

    2015-10-01

    The lithium-sulfur primary batteries, as seldom reported in the previous literatures, were developed in this work. In order to maximize its practical energy density, a novel cauliflower-like hierarchical porous C/S cathode was designed, for facilitating the lithium-ions transport and sulfur accommodation. This kind of cathode could release about 1300 mAh g-1 (S) capacity at sulfur loading of 6 ~ 14 mg cm-2, and showed excellent shelf stability during a month test at room temperature. As a result, the assembled Li-S soft package battery achieved an energy density of 504 Wh kg-1 (654 Wh L-1), which was the highest value ever reported to the best of our knowledge. This work might arouse the interests on developing primary Li-S batteries, with great potential for practical application.

  1. Lithium Sulfur Primary Battery with Super High Energy Density: Based on the Cauliflower-like Structured C/S Cathode

    PubMed Central

    Ma, Yiwen; Zhang, Hongzhang; Wu, Baoshan; Wang, Meiri; Li, Xianfeng; Zhang, Huamin

    2015-01-01

    The lithium-sulfur primary batteries, as seldom reported in the previous literatures, were developed in this work. In order to maximize its practical energy density, a novel cauliflower-like hierarchical porous C/S cathode was designed, for facilitating the lithium-ions transport and sulfur accommodation. This kind of cathode could release about 1300 mAh g−1 (S) capacity at sulfur loading of 6 ~ 14 mg cm−2, and showed excellent shelf stability during a month test at room temperature. As a result, the assembled Li-S soft package battery achieved an energy density of 504 Wh kg−1 (654 Wh L−1), which was the highest value ever reported to the best of our knowledge. This work might arouse the interests on developing primary Li-S batteries, with great potential for practical application. PMID:26456914

  2. Lithium Sulfur Primary Battery with Super High Energy Density: Based on the Cauliflower-like Structured C/S Cathode.

    PubMed

    Ma, Yiwen; Zhang, Hongzhang; Wu, Baoshan; Wang, Meiri; Li, Xianfeng; Zhang, Huamin

    2015-01-01

    The lithium-sulfur primary batteries, as seldom reported in the previous literatures, were developed in this work. In order to maximize its practical energy density, a novel cauliflower-like hierarchical porous C/S cathode was designed, for facilitating the lithium-ions transport and sulfur accommodation. This kind of cathode could release about 1300 mAh g(-1) (S) capacity at sulfur loading of 6 ~ 14 mg cm(-2), and showed excellent shelf stability during a month test at room temperature. As a result, the assembled Li-S soft package battery achieved an energy density of 504 Wh kg(-1) (654 Wh L(-1)), which was the highest value ever reported to the best of our knowledge. This work might arouse the interests on developing primary Li-S batteries, with great potential for practical application. PMID:26456914

  3. Turnip Yellow Mosaic Virus Structure

    NASA Technical Reports Server (NTRS)

    2000-01-01

    The bumpy exterior of the turnip yellow mosaic virus (TYMV) protein coat, or capsid, was defined in detail by Dr. Alexander McPherson of the University of California, Irvin using protein crystallized in space for analysis on Earth. TYMV is an icosahedral virus constructed from 180 copies of the same protein arranged into 12 clusters of five proteins (pentamers), and 20 clusters of six proteins (hexamers). The final TYMV structure led to the enexpected hypothesis that the virus release its RNA by essentially chemical-mechanical means. Most viruses have farly flat coats, but in TYMV, the fold in each protein, called the jellyroll, is clustered at the points where the protein pentamers and hexamers join. The jellyrolls are almost standing on end, producing a bumpy surface with knobs at all of the pentamers and hexamers. At the inside surface of the pentamers is a void that is not present at the hexamers. The coating had been seen in early studies of TYMV, but McPhereson's atomic structure shows much more detail. The inside surface is strikingly, and unexpectedly, different than the outside. While the pentamers contain a central viod on the inside, the hexameric units contain peptides liked to each other, forming a ring or, more accurately, rings to fill the voild. Credit: Dr. Alexander McPherson, University of California, Irvine.

  4. Generating Mosaics of Astronomical Images

    NASA Technical Reports Server (NTRS)

    Bergou, Attila; Berriman, Bruce; Good, John; Jacob, Joseph; Katz, Daniel; Laity, Anastasia; Prince, Thomas; Williams, Roy

    2005-01-01

    "Montage" is the name of a service of the National Virtual Observatory (NVO), and of software being developed to implement the service via the World Wide Web. Montage generates science-grade custom mosaics of astronomical images on demand from input files that comply with the Flexible Image Transport System (FITS) standard and contain image data registered on projections that comply with the World Coordinate System (WCS) standards. "Science-grade" in this context signifies that terrestrial and instrumental features are removed from images in a way that can be described quantitatively. "Custom" refers to user-specified parameters of projection, coordinates, size, rotation, and spatial sampling. The greatest value of Montage is expected to lie in its ability to analyze images at multiple wavelengths, delivering them on a common projection, coordinate system, and spatial sampling, and thereby enabling further analysis as though they were part of a single, multi-wavelength image. Montage will be deployed as a computation-intensive service through existing astronomy portals and other Web sites. It will be integrated into the emerging NVO architecture and will be executed on the TeraGrid. The Montage software will also be portable and publicly available.

  5. Satellite Tobacco Mosaic Virus Structure

    NASA Technical Reports Server (NTRS)

    2000-01-01

    The structure of the Satellite Tobacco Mosaic Viurus (STMV)--one of the smallest viruses known--has been successfully reduced using STMV crystals grown aboard the Space Shuttle in 1992 and 1994. The STMV crystals were up to 30 times the volume of any seen in the laboratory. At the time they gave the best resolution data ever obtained on any virus crystal. STMV is a small icosahedral plant virus, consisting of a protein shell made up of 60 identical protein subunits of molecular weight 17,500. Particularly noteworthy is the fact that, in contrast to the crystals grown on Earth, the crystals grown under microgravity conditions were visually perfect, with no striations or clumping of crystals. Furthermore, the x-ray diffraction data obtained from the space-grown crystals was of a much higher quality than the best data available at that time from ground-based crystals. This stylized ribbon model shows the protein coat in white and the nucleic acid in yellow. STMV is used because it is a simple protein to work with; studies are unrelated to tobacco. Credit: Dr. Alex McPherson, University of California at Irvin.

  6. Satellite Tobacco Mosaic Virus (STMV)

    NASA Technical Reports Server (NTRS)

    2000-01-01

    The structure of the Satellite Tobacco Mosaic Virus (STMV)--one of the smallest viruses known--has been successfully deduced using STMV crystals grown aboard the Space Shuttle in 1992 and 1994. The STMV crystals were up to 30 times the volume of any seen in the laboratory. At the same time they gave the best resolution data ever obtained on any virus crystal. STMV is a small icosahedral plant virus, consisting of a protein shell made up of 60 identical protein subunits of molecular weight 17,500. Particularly noteworthy is the fact that, in contrast to the crystal grown on Earth, the crystals grown under microgravity conditions were viusally perfect, with no striations or clumping of crystals. Furthermore, the X-ray diffraction data obtained from the space-grown crystals was of a much higher quality than the best data available at that time from ground-based crystals. This computer model shows the external coating or capsid. STMV is used because it is a simple protein to work with; studies are unrelated to tobacco. Credit: Dr. Alex McPherson, Univeristy of California at Irvin.

  7. Graph models of habitat mosaics.

    PubMed

    Urban, Dean L; Minor, Emily S; Treml, Eric A; Schick, Robert S

    2009-03-01

    Graph theory is a body of mathematics dealing with problems of connectivity, flow, and routing in networks ranging from social groups to computer networks. Recently, network applications have erupted in many fields, and graph models are now being applied in landscape ecology and conservation biology, particularly for applications couched in metapopulation theory. In these applications, graph nodes represent habitat patches or local populations and links indicate functional connections among populations (i.e. via dispersal). Graphs are models of more complicated real systems, and so it is appropriate to review these applications from the perspective of modelling in general. Here we review recent applications of network theory to habitat patches in landscape mosaics. We consider (1) the conceptual model underlying these applications; (2) formalization and implementation of the graph model; (3) model parameterization; (4) model testing, insights, and predictions available through graph analyses; and (5) potential implications for conservation biology and related applications. In general, and for a variety of ecological systems, we find the graph model a remarkably robust framework for applications concerned with habitat connectivity. We close with suggestions for further work on the parameterization and validation of graph models, and point to some promising analytic insights. PMID:19161432

  8. The cauliflower-like black crusts on sandstones: A natural passive sampler to evaluate the surrounding environmental pollution.

    PubMed

    Morillas, Héctor; Maguregui, Maite; García-Florentino, Cristina; Carrero, Jose Antonio; Salcedo, Isabel; Madariaga, Juan Manuel

    2016-05-01

    Black crust in buildings can be formed as a result of different kind of chemical and physical reactions between the stone surface and environmental factors (e.g. acid aerosols emitted to the atmosphere, airborne particulate matter, etc.). Moreover, biological colonizations can also be present on them. This kind of pathology is widely present in limestones, but fewer are the case study dealing with the characterization of black crusts on sandstones. In this work we present an innovative methodology based on the use of cauliflower-like black crusts formed on sandstone material as natural passive sampler to evaluate the environmental pollution related with the emission of natural (crustal particles and marine aerosol particles) and metallic elements in the airborne particulate matter from the surrounding atmosphere. To illustrate its usefulness, different cauliflower-like black crusts growing in areas protected from the rain growing in an historical construction, La Galea Fortress, made up of sandstone and placed in the Abra Bay (Getxo, Basque Country, Spain) were characterized. This area suffers the anthropogenic emissions coming from the surrounding industry, traffic, sea port, and the natural ones coming from the surrounding marine atmosphere. The applied analytical methodology began with a previous elemental in situ screening in order to evaluate and compare the presence of the metals trapped in black crusts from different orientations using a hand-held energy dispersive X-Ray Fluorescence spectrometer. After this preliminary study, samples of black crusts were taken in order to characterize them in the laboratory using molecular techniques (Raman spectroscopy and XRD) and elemental techniques (ICP-MS, SEM-EDS and micro energy dispersive X-Ray Fluorescence). With the last two elemental techniques, imaging analyses were performed at different lateral resolutions in order to observe the distribution of the metals and other kind of particles trapped in the black

  9. Genetic and Epigenetic Alterations of Brassica nigra Introgression Lines from Somatic Hybridization: A Resource for Cauliflower Improvement.

    PubMed

    Wang, Gui-Xiang; Lv, Jing; Zhang, Jie; Han, Shuo; Zong, Mei; Guo, Ning; Zeng, Xing-Ying; Zhang, Yue-Yun; Wang, You-Ping; Liu, Fan

    2016-01-01

    Broad phenotypic variations were obtained previously in derivatives from the asymmetric somatic hybridization of cauliflower "Korso" (Brassica oleracea var. botrytis, 2n = 18, CC genome) and black mustard "G1/1" (Brassica nigra, 2n = 16, BB genome). However, the mechanisms underlying these variations were unknown. In this study, 28 putative introgression lines (ILs) were pre-selected according to a series of morphological (leaf shape and color, plant height and branching, curd features, and flower traits) and physiological (black rot/club root resistance) characters. Multi-color fluorescence in situ hybridization revealed that these plants contained 18 chromosomes derived from "Korso." Molecular marker (65 simple sequence repeats and 77 amplified fragment length polymorphisms) analysis identified the presence of "G1/1" DNA segments (average 7.5%). Additionally, DNA profiling revealed many genetic and epigenetic differences among the ILs, including sequence alterations, deletions, and variation in patterns of cytosine methylation. The frequency of fragments lost (5.1%) was higher than presence of novel bands (1.4%), and the presence of fragments specific to Brassica carinata (BBCC 2n = 34) were common (average 15.5%). Methylation-sensitive amplified polymorphism analysis indicated that methylation changes were common and that hypermethylation (12.4%) was more frequent than hypomethylation (4.8%). Our results suggested that asymmetric somatic hybridization and alien DNA introgression induced genetic and epigenetic alterations. Thus, these ILs represent an important, novel germplasm resource for cauliflower improvement that can be mined for diverse traits of interest to breeders and researchers. PMID:27625659

  10. Genetic and Epigenetic Alterations of Brassica nigra Introgression Lines from Somatic Hybridization: A Resource for Cauliflower Improvement

    PubMed Central

    Wang, Gui-xiang; Lv, Jing; Zhang, Jie; Han, Shuo; Zong, Mei; Guo, Ning; Zeng, Xing-ying; Zhang, Yue-yun; Wang, You-ping; Liu, Fan

    2016-01-01

    Broad phenotypic variations were obtained previously in derivatives from the asymmetric somatic hybridization of cauliflower “Korso” (Brassica oleracea var. botrytis, 2n = 18, CC genome) and black mustard “G1/1” (Brassica nigra, 2n = 16, BB genome). However, the mechanisms underlying these variations were unknown. In this study, 28 putative introgression lines (ILs) were pre-selected according to a series of morphological (leaf shape and color, plant height and branching, curd features, and flower traits) and physiological (black rot/club root resistance) characters. Multi-color fluorescence in situ hybridization revealed that these plants contained 18 chromosomes derived from “Korso.” Molecular marker (65 simple sequence repeats and 77 amplified fragment length polymorphisms) analysis identified the presence of “G1/1” DNA segments (average 7.5%). Additionally, DNA profiling revealed many genetic and epigenetic differences among the ILs, including sequence alterations, deletions, and variation in patterns of cytosine methylation. The frequency of fragments lost (5.1%) was higher than presence of novel bands (1.4%), and the presence of fragments specific to Brassica carinata (BBCC 2n = 34) were common (average 15.5%). Methylation-sensitive amplified polymorphism analysis indicated that methylation changes were common and that hypermethylation (12.4%) was more frequent than hypomethylation (4.8%). Our results suggested that asymmetric somatic hybridization and alien DNA introgression induced genetic and epigenetic alterations. Thus, these ILs represent an important, novel germplasm resource for cauliflower improvement that can be mined for diverse traits of interest to breeders and researchers. PMID:27625659

  11. The categories of cutaneous mosaicism: A proposed classification.

    PubMed

    Happle, Rudolf

    2016-02-01

    Mosaic disorders can most easily be studied in the skin. This article presents a comprehensive overview of the different forms of cutaneous mosaicism. Major categories are genomic versus epigenetic mosaicism and nonsegmental versus segmental mosaicism. The class of nonsegmental mosaics includes single point mosaicism as exemplified by solitary benign or malignant skin tumors; disseminated mosaicism as noted in autosomal dominant tumor syndromes such as neurofibromatosis 1; and patchy mosaicism without midline separation as found in giant melanocytic nevus. The class of segmental mosaics includes segmental manifestation of lethal genes surviving by mosaicism as noted in Proteus syndrome; type 1 segmental mosaicism of autosomal dominant skin disorders reflecting heterozygosity for a postzygotic new mutation; type 2 segmental mosaicism of autosomal dominant skin disorders reflecting loss of heterozygosity that occurred at an early developmental stage in a heterozygous embryo; and isolated or superimposed segmental mosaicism of common polygenic skin disorders such as psoriasis or atopic dermatitis. A particular form of genomic mosaicism is didymosis (twin spotting). Revertant mosaicism is recognizable as one or more areas of healthy skin in patients with epidermolysis bullosa or other serious genodermatoses. The category of epigenetic mosaicism includes several X-linked, male lethal disorders such as incontinentia pigmenti, and the patterns of lyonization as noted in X-linked non-lethal disorders such as hypohidrotic ectodermal dysplasia of the Christ-Siemens-Touraine type. An interesting field of future research will be the concept of epigenetic autosomal mosaicism that may explain some unusual cases of autosomal transmission of linear hypo- or hypermelanosis. PMID:26494396

  12. Effects of cysteamine administration on the in vivo incorporation of (/sup 35/S)cysteine into somatostatin-14, somatostatin-28, arginine vasopressin, and oxytocin in rat hypothalamus

    SciTech Connect

    Cameron, J.L.; Fernstrom, J.D.

    1986-09-01

    The effect of cysteamine injection on the in vivo incorporation of (/sup 35/S)cysteine into somatostatin-14 (SRIF-14), SRIF-28, arginine vasopressin (AVP), and oxytocin (OXT) in rat hypothalamus was studied. (/sup 35/S)Cysteine was injected into the third ventricle 1 h, 4 h, or 1 week after cysteamine (300 mg/kg, sc) injection; animals were killed 4 h later. The drug was found to substantially reduce immunoreactive SRIF levels, but not OXT or AVP, 4 h after its injection. Cysteamine also caused large reductions in label incorporation into SRIF-14, SRIF-28, and OXT 1 and 4 h after drug injection. However, (/sup 35/S)cysteine incorporation into AVP was increased substantially at these time points, while that into acid-precipitable protein was normal. One week after cysteamine injection, label incorporation into all hypothalamic peptides was normal. Cysteine specific activity was also measured after (/sup 35/S)cysteine injection and was found to be similar in treatment and control groups. The results suggest that cysteamine inhibits the syntheses of SRIF-14, SRIF-28, and OXT and stimulates that of AVP.

  13. Dimethyl sulfoxide: an antagonist in scintillation proximity assay [(35)S]-GTPgammaS binding to rat 5-HT(6) receptor cloned in HEK-293 cells?

    PubMed

    Mereghetti, Ilario; Cagnotto, Alfredo; Mennini, Tiziana

    2007-03-15

    We have tested by [(35)S]-GTPgammaS binding the intrinsic activity of three full agonists (serotonin, 5-methoxytryptamine and 5-methoxy-2-methyl-N,N-dimethyltryptamine) on rat 5-HT(6) receptors cloned in HEK-293 cells, using the scintillation proximity assay. Serotonin and 5-methoxytryptamine are soluble in water, while the agonist 5-methoxy-2-methyl-N,N-dimethyltryptamine is soluble in dimethyl sulfoxide (DMSO). In [(35)S]-GTPgammaS binding 5-HT and 5-methoxytryptamine were able to increase basal binding, while 5-methoxy-2-methyl-N,N-dimethyltryptamine surprisingly showed an inverse agonist activity. So we have tested 5-HT and 5-methoxytryptamine in the presence of DMSO: in this condition the two agonists behaved as antagonists. This interfering effect of DMSO was not observed when GTP-europium filtration binding was used in place of scintillation proximity assay using [(35)S]-GTPgammaS. In addition, DMSO did not affect [(3)H]-5HT binding or cAMP accumulation in cloned HEK-293 cells expressing rat 5-HT(6) receptors. In conclusion, we demonstrated that DMSO, the most common solvent used to dissolve compounds insoluble in water, interferes with the method of scintillation proximity assay using [(35)S]-GTPgammaS. DMSO does not affect basal signal, nor the GTPgammaS binding itself, as indicated by the experiments with GTP-europium. Therefore its interfering effect is likely to occur at the binding of antibodies in the scintillation proximity assay. PMID:17049618

  14. Detectable Clonal Mosaicism in the Human Genome

    PubMed Central

    Machiela, Mitchell J.; Chanock, Stephen J.

    2013-01-01

    Human genetic mosaicism is the presence of two or more cellular populations with distinct genotypes in an individual who developed from a single fertilized ovum. While initially observed across a spectrum of rare genetic disorders, detailed assessment of data from genome-wide association studies now reveal that detectable clonal mosaicism involving large structural alterations (> 2 Mb) can also be seen in populations of apparently healthy individuals. The first generation of descriptive studies have generated new interest in understanding the molecular basis of the affected genomic regions, percent of the cellular subpopulation involved, and developmental timing of the underlying mutational event, which could reveal new insights into the initiation, clonal expansion and phenotypic manifestations of mosaic events. Early evidence indicates detectable clonal mosaicism increases in frequency with age and could preferentially occur in males. The observed pattern of recurrent events affecting specific chromosomal regions indicates some regions are more susceptible to these events, which could reflect inter-individual differences in genomic stability. Moreover, it is also plausible that the presence of large structural events could be associated with cancer risk. The characterization of detectable genetic mosaicism reveals that there could be important dynamic changes in the human genome associated with the aging process, which could be associated with risk for common disorders, such as cancer, cardiovascular disease, diabetes, and neurological disorders. PMID:24246702

  15. Thermographic mosaic of Yellowstone National Park

    USGS Publications Warehouse

    Williams, Richard S., Jr.; Hasell, Philip G., Jr.; Sellman, Albert N.; Smedes, Harry W.

    1976-01-01

    An uncontrolled thermographic mosaic, which covers most of the area of Yellowstone National Park, has been compiled. The recording of aerial thermographic data on videotape is established as one of the prerequisites for the preparation of more accurate mosaics. Post-mission processing of the videotape record can rectify the nadir line to a topographic map base, correct for v/h variations in adjacent flight lines, correct for yaw distortions, rectify distortions caused by pitch, and rectify distortions produced by non-linearity of the side-wise scan. Installation of a thermal infrared scanning radiometer in a gyrostabilized mount and post-mission processing of the videotape record (principally rectification of side-wise scan distortion) would yield a controlled, photogrammetrically accurate thermographic mosaic. However, the techniques used in the preparation of the uncontrolled thermographic mosaic of Yellowstone National Park can be immediately applied to the preparation of regional thermographic mosaics, important to geologists and other scientists and engineers in studies of geothermal and volcanic areas, and to other types of environmental investigations such as pollution studies of large water bodies (e.g., harbors, estuaries, lakes, etc.), where a precise planimetric image is not critical.

  16. Genetic Mosaics and the Germ Line Lineage

    PubMed Central

    Samuels, Mark E.; Friedman, Jan M.

    2015-01-01

    Genetic mosaics provide information about cellular lineages that is otherwise difficult to obtain, especially in humans. De novo mutations act as cell markers, allowing the tracing of developmental trajectories of all descendants of the cell in which the new mutation arises. De novo mutations may arise at any time during development but are relatively rare. They have usually been observed through medical ascertainment, when the mutation causes unusual clinical signs or symptoms. Mutational events can include aneuploidies, large chromosomal rearrangements, copy number variants, or point mutations. In this review we focus primarily on the analysis of point mutations and their utility in addressing questions of germ line versus somatic lineages. Genetic mosaics demonstrate that the germ line and soma diverge early in development, since there are many examples of combined somatic and germ line mosaicism for de novo mutations. The occurrence of simultaneous mosaicism in both the germ line and soma also shows that the germ line is not strictly clonal but arises from at least two, and possibly multiple, cells in the embryo with different ancestries. Whole genome or exome DNA sequencing technologies promise to expand the range of studies of genetic mosaics, as de novo mutations can now be identified through sequencing alone in the absence of a medical ascertainment. These technologies have been used to study mutation patterns in nuclear families and in monozygotic twins, and in animal model developmental studies, but not yet for extensive cell lineage studies in humans. PMID:25898403

  17. Anterior segment dysgenesis in mosaic Turner syndrome

    PubMed Central

    Lloyd, I; Haigh, P; Clayton-Smith, J; Clayton, P; Price, D; Ridgway, A; Donnai, D

    1997-01-01

    AIMS/BACKGROUND—Females with Turner syndrome commonly exhibit ophthalmological abnormalities, although there is little information in the literature documenting findings specific to Turner syndrome mosaics. Ophthalmic findings are described in four patients with mosaic Turner syndrome. All had anterior chamber abnormalities and all four had karyotypic abnormalities with a 45, X cell line. The possible relation between the karyotypic and the phenotypic findings in these patients is discussed.
METHODS—Four girls with mosaic Turner syndrome underwent a full ophthalmological assessment, including examination under anaesthesia where indicated.
RESULTS—Three of the four patients presented with congenital glaucoma. Two had the karyotype 45, X/46, X, idic(Y) and one a 45, X/47, XXX karyotype. The remaining child had a Rieger malformation of the iris and the karyotype 45, X/46, X, r(X).
CONCLUSIONS—These findings suggest that Turner syndrome mosaicism (where there are two abnormal cell lines) is associated with anterior segment dysgenesis. The findings in these four patients are compared with those seen in other mosaic phenotypes and it is postulated that the presence of two or more genetically different cell lines may have an adverse effect on anterior segment development.

 PMID:9349149

  18. Mosaic Convergence of Rodent Dentitions

    PubMed Central

    Lazzari, Vincent; Charles, Cyril; Tafforeau, Paul; Vianey-Liaud, Monique; Aguilar, Jean-Pierre; Jaeger, Jean-Jacques; Michaux, Jacques; Viriot, Laurent

    2008-01-01

    Background Understanding mechanisms responsible for changes in tooth morphology in the course of evolution is an area of investigation common to both paleontology and developmental biology. Detailed analyses of molar tooth crown shape have shown frequent homoplasia in mammalian evolution, which requires accurate investigation of the evolutionary pathways provided by the fossil record. The necessity of preservation of an effective occlusion has been hypothesized to functionally constrain crown morphological changes and to also facilitate convergent evolution. The Muroidea superfamily constitutes a relevant model for the study of molar crown diversification because it encompasses one third of the extant mammalian biodiversity. Methodology/Principal Findings Combined microwear and 3D-topographic analyses performed on fossil and extant muroid molars allow for a first quantification of the relationships between changes in crown morphology and functionality of occlusion. Based on an abundant fossil record and on a well resolved phylogeny, our results show that the most derived functional condition associates longitudinal chewing and non interlocking of cusps. This condition has been reached at least 7 times within muroids via two main types of evolutionary pathways each respecting functional continuity. In the first type, the flattening of tooth crown which induces the removal of cusp interlocking occurs before the rotation of the chewing movement. In the second type however, flattening is subsequent to rotation of the chewing movement which can be associated with certain changes in cusp morphology. Conclusion/Significance The reverse orders of the changes involved in these different pathways reveal a mosaic evolution of mammalian dentition in which direction of chewing and crown shape seem to be partly decoupled. Either can change in respect to strong functional constraints affecting occlusion which thereby limit the number of the possible pathways. Because convergent

  19. Mosaic of Europa's Ridges, Craters

    NASA Technical Reports Server (NTRS)

    1997-01-01

    This view of the icy surface of Jupiter's moon, Europa, is a mosaic of two pictures taken by the Solid State Imaging system on board the Galileo spacecraft during a close flyby of Europa on February 20, 1997. The pictures were taken from a distance of 2,000 kilometers (1,240 miles). The area shown is about 14 kilometers by 17 kilometers (8.7 miles by 10.6 miles), and has a resolution of 20 meters (22 yards) per pixel. Illumination is from the right (east). The picture is centered at about 14.8 north latitude, 273.8 west longitude, in Europa's trailing hemisphere.

    One of the youngest features seen in this area is the double ridge cutting across the picture from the lower left to the upper right. This double ridge is about 2.6 kilometers (1.6 miles) wide and stands some 300 meters (330 yards) high. Small craters are most easily seen in the smooth deposits along the south margin of the prominent double ridge, and in the rugged ridged terrain farther south. The complexly ridged terrain seen here shows that parts of the icy crust of Europa have been modified by intense faulting and disruption, driven by energy from the planet's interior.

    The Jet Propulsion Laboratory, Pasadena, CA, manages the mission for NASA's Office of Space Science, Washington D.C. This image and other images and data received from Galileo are posted on the World Wide Web Galileo mission home page at: http://galileo.jpl.nasa.gov.

  20. Global Color Mosaic of Triton

    NASA Technical Reports Server (NTRS)

    1980-01-01

    Global color mosaic of Triton, taken in 1989 by Voyager 2 during its flyby of the Neptune system. Color was synthesized by combining high- resolution images taken through orange, violet, and ultraviolet filters; these images were displayed as red, green, and blue images and combined to create this color version. With a radius of 1,350 (839 mi), about 22% smaller than Earth's moon, Triton is by far the largest satellite of Neptune. It is one of only three objects in the Solar System known to have a nitrogen-dominated atmosphere (the others are Earth and Saturn's giant moon, Titan). Triton has the coldest surface known anywhere in the Solar System (38 K, about -391 degrees Farenheit); it is so cold that most of Triton's nitrogen is condensed as frost, making it the only satellite in the Solar System known to have a surface made mainly of nitrogen ice. The pinkish deposits constitute a vast south polar cap believed to contain methane ice, which would have reacted under sunlight to form pink or red compounds. The dark streaks overlying these pink ices are believed to be an icy and perhaps carbonaceous dust deposited from huge geyser-like plumes, some of which were found to be active during the Voyager 2 flyby. The bluish-green band visible in this image extends all the way around Triton near the equator; it may consist of relatively fresh nitrogen frost deposits. The greenish areas include what is called the cataloupe terrain, whose origin is unknown, and a set of 'cryovolcanic' landscapes apparently produced by icy-cold liquids (now frozen) erupted from Triton's interior.

  1. Global Color Mosaic of Triton

    NASA Technical Reports Server (NTRS)

    1980-01-01

    Global color mosaic of Triton, taken in 1989 by Voyager 2 during its flyby of the Neptune system. Color was synthesized by combining high-resolution images taken through orange, violet, and ultraviolet filters; these images were displayed as red, green, and blue images and combined to create this color version. With a radius of 1,350 (839 mi), about 22% smaller than Earth's moon, Triton is by far the largest satellite of Neptune. It is one of only three objects in the Solar System known to have a nitrogen-dominated atmosphere (the others are Earth and Saturn's giant moon, Titan). Triton has the coldest surface known anywhere in the Solar System (38 K, about -391 degrees Fahrenheit); it is so cold that most of Triton's nitrogen is condensed as frost, making it the only satellite in the Solar System known to have a surface made mainly of nitrogen ice. The pinkish deposits constitute a vast south polar cap believed to contain methane ice, which would have reacted under sunlight to form pink or red compounds. The dark streaks overlying these pink ices are believed to be an icy and perhaps carbonaceous dust deposited from huge geyser-like plumes, some of which were found to be active during the Voyager 2 flyby. The bluish-green band visible in this image extends all the way around Triton near the equator; it may consist of relatively fresh nitrogen frost deposits. The greenish areas includes what is called the cantaloupe terrain, whose origin is unknown, and a set of 'cryovolcanic' landscapes apparently produced by icy-cold liquids (now frozen) erupted from Triton's interior.

  2. Ex vivo binding of t-( sup 35 S) butylbicyclophosphorothionate: A biochemical tool to study the pharmacology of ethanol at the gamma-aminobutyric acid-coupled chloride channel

    SciTech Connect

    Sanna, E.; Concas, A.; Serra, M.; Santoro, G.; Biggio, G. )

    1991-03-01

    The effects of acute administration of ethanol on t-(35S)Butylbiclophosphorothionate (35S-TBPS) binding measured ex vivo in unwashed membrane preparations of rat cerebral cortex were investigated. Ethanol, given i.g., decreased in a dose-related (0.5-4 g/kg) and time-dependent manner the binding of 35S-TBPS. This effect was similar to that induced by the administration of diazepam (0.5-4 mg/kg i.p.). Scatchard plot analysis of this radioligand binding revealed that ethanol, differently from diazepam, decreased the apparent affinity of 35S-TBPS recognition sites whereas it failed to change the density of these binding sites. The effect of ethanol on 35S-TBPS binding could not be reversed by the previous administration to rats of the benzodiazepine receptor antagonist, Ro 15-1788 (ethyl-8-fluoro-5,6-dihydro-5-methyl-6-oxo-4H- imidazo (1,5a) (1,4) benzodiazepine-3-carboxylate). Vice versa, the benzodiazepine receptor partial inverse agonist, Ro 15-4513 (ethyl-8-azido-5,6-dihydro-5-methyl-6-oxo-4H- imidazo (1,5a) (4,4) benzodiazepine-3-carboxylate) (8 mg/kg i.p.), prevented completely ethanol-induced decrease of 35S-TBPS binding. The ability of Ro 15-4513 to prevent the action of ethanol was shared by the anxiogenic and proconvulsant beta-carboline derivatives, FG 7142 (N-methyl-beta-carboline-3-carboxamide) (12.5 mg/kg i.p.) and ethyl-beta-carboline-3-carboxylate (0.6 mg/kg i.v.), which, per se, enhanced this parameter. Moreover, ethanol (0.5-4 g/kg) was able to reverse the increase of 35S-TBPS binding elicited by the s.c. injection of isoniazid (350 mg/kg) and to clearly attenuate the severity of tonic-clonic seizures produced by this inhibitor of the GABAergic transmission.

  3. Differentiating atmospheric and mineral sources of sulfur during snowmelt using δ 34S, 35S activity, and δ 18O of sulfate and water as tracers

    NASA Astrophysics Data System (ADS)

    Shanley, J. B.; Mayer, B.; Mitchell, M. J.; Michel, R. L.; Bailey, S.; Kendall, C.

    2003-12-01

    The biogeochemical cycling of sulfur was studied during the 2000 snowmelt at Sleepers River Research Watershed in northeastern Vermont, USA using a combination of isotopic, chemical, and hydrometric measurements. The snowpack and 10 streams of varying size and land use were sampled for sulfate concentrations and isotopic analyses of 35S, δ 34S, and δ 18O of sulfate. Values of δ 18O of water were measured at one of the streams. Apportionment of atmospheric and mineral S sources based on δ 34S was possible at 7 of the 10 streams. Weathering of S-containing minerals was a major contributor to sulfate flux in streamwater, but atmospheric contributions exceeded 50% in several of the streams at peak snowmelt and averaged 41% overall. In contrast, δ 18Osulfate values of streamwater remained significantly lower than those of atmospheric sulfate throughout the melt period, indicating that atmospheric sulfate undergoes microbial redox reactions in the soil that replace the oxygen of atmospheric sulfate with isotopically lighter oxygen from soil water. Streamwater 35S activities were low relative to those of the snowpack; the youngest 35S-ages of the atmospheric S component in each of the 7 streams ranged from 184 to 320 days. Atmospheric S contributions to streamwater, as determined by δ 34S values, co-varied both with 35S activity and new water contributions as determined by δ 18Owater. However, the δ 18Osulfate and 35S ages clearly show that this new water carries very little of the atmospheric sulfate entering with the current snowmelt to the stream. Most incoming atmospheric sulfate first cycles through the organic soil S pool and ultimately reaches the stream as pedogenic sulfate.

  4. Monochorionic twins discordant for mosaic trisomy 14.

    PubMed

    He, Mai; Pepperell, John R; Gundogan, Fusun; De Paepe, Monique E; Maggio, Lindsay; Lu, Shaolei; Kostadinov, Stefan; O'Brien, Barbara; Delamonte, Suzanne; Pinar, Halit; Tantravahi, Umadevi

    2014-05-01

    Monochorionic-diamniotic twins are usually monozygotic twins and known to be associated with adverse obstetric and perinatal outcomes. Cases of discordant karyotype of monozygotic twins are rare and most involves sex chromosomes. We present the first case of monochorionic twins with discordant karyotype manifested as mosaic trisomy 14 in one twin (B) and a normal karyotype in the other (A). We describe the postmortem pathological and imaging findings of the trisomic twin and for the first time neuropathological findings of this entity. Metaphase chromosome analysis of twin B using fetal tissue showed a 47,XX, +14 karyotype. Chromosomal microarray analysis (CMA) using fetal tissue revealed 38% mosaicism. CMA with placental tissue from both sides demonstrated normal karyotype and confirmed monozygosity, highlighting the value of array based testing on diagnosing mosaicism and zygosity. PMID:24458767

  5. An image mosaic method based on corner

    NASA Astrophysics Data System (ADS)

    Jiang, Zetao; Nie, Heting

    2015-08-01

    In view of the shortcomings of the traditional image mosaic, this paper describes a new algorithm for image mosaic based on the Harris corner. Firstly, Harris operator combining the constructed low-pass smoothing filter based on splines function and circular window search is applied to detect the image corner, which allows us to have better localisation performance and effectively avoid the phenomenon of cluster. Secondly, the correlation feature registration is used to find registration pair, remove the false registration using random sampling consensus. Finally use the method of weighted trigonometric combined with interpolation function for image fusion. The experiments show that this method can effectively remove the splicing ghosting and improve the accuracy of image mosaic.

  6. Genetic diversity of viruses causing mosaic in Louisiana sugarcane

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Mosaic caused by Sugarcane mosaic virus (SCMV) contributed to the near collapse of Louisiana’s sugarcane industry in the early 20th Century. By the 1950s, the cultivation of resistant cultivars eliminated mosaic as a major disease problem; however, new strains arose among previously resistant cultiv...

  7. Triticum mosaic virus isolates in the southern Great Plains

    Technology Transfer Automated Retrieval System (TEKTRAN)

    In 2006, a Wheat streak mosaic virus (WSMV)-resistant wheat variety RonL was found to have mosaic symptoms similar to WSMV. The virus inducing the symptoms was determined to be previously unknown and given the name Triticum mosaic virus (TriMV). Since, TriMV has been found in plant samples isolate...

  8. Development of an agroinoculation system for full-length and GFP-tagged cDNA clones of cucumber green mottle mosaic virus.

    PubMed

    Zheng, Hongying; Xiao, Caili; Han, Kelei; Peng, Jiejun; Lin, Lin; Lu, Yuwen; Xie, Li; Wu, Xiaohua; Xu, Pei; Li, Guojing; Chen, Jianping; Yan, Fei

    2015-11-01

    The complete 6243-nucleotide sequence of a cucumber green mottle mosaic virus (CGMMV) isolate from bottle gourd in Zhejiang province, China, was determined. A full-length cDNA clone of this isolate was constructed by inserting the cDNA between the 35S promoter and the ribozyme in the binary plasmid pCB301-CH. A suspension of an Agrobacterium tumefaciens EHA105 clone carrying this construct was highly infectious in Nicotiana benthamiana and bottle gourd. Another infectious clone containing the green fluorescence protein (GFP) reporter gene was also successfully constructed. This study is the first report of the efficient use of agroinoculation for generating CGMMV infections. PMID:26323263

  9. Characterization of the Triticum Mosaic Virus Genome and Interactions between Triticum Mosaic Virus and Wheat Streak Mosaic Virus

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The complete genome sequence of Triticum mosaic virus (TriMV) has been determined to be 10,266 nucleotides encoding a large polyprotein of 3,112 amino acids. The proteins of TriMV possess only 33-44% (with NIb protein) and 15-29% (with P1 protein) amino acid identity with the reported members of Pot...

  10. Genome-wide identification and characterization of miRNAs in the hypocotyl and cotyledon of cauliflower (Brassica oleracea L. var. botrytis) seedlings.

    PubMed

    Geng, Meijuan; Li, Hui; Jin, Chuan; Liu, Qian; Chen, Chengbin; Song, Wenqin; Wang, Chunguo

    2014-02-01

    MicroRNAs (miRNAs) are a class of small endogenous, non-coding RNAs that have key regulatory functions in plant growth, development, and other biological processes. Hypocotyl and cotyledon are the two major tissues of cauliflower (Brassica oleracea L. var. botrytis) seedlings. Tissue culture experiments have indicated that the regenerative abilities of these two tissues are significantly different. However, the characterization of miRNAs and their roles in regulating organ development in cauliflower remain unexplored. In the present study, two small RNA libraries were sequenced by Solexa sequencing technology. 99 known miRNAs belonging to 28 miRNA families were identified, in which 6 miRNA families were detected only in Brassicaceae. A total of 162 new miRNA sequences with single nucleotide substitutions corresponding to the known miRNAs, and 32 potentially novel miRNAs were also first discovered. Comparative analysis indicated that 42 of 99 known miRNAs and 17 of 32 novel miRNAs exhibited significantly differential expression between hypocotyl and cotyledon, and the differential expression of several miRNAs was further validated by stem-loop RT-PCR. In addition, 235 targets for 89 known miRNAs and 198 targets for 24 novel miRNAs were predicted, and their functions were further discussed. The expression patterns of several representative targets were also confirmed by qRT-PCR analysis. The results identified that the transcriptional expression patterns of miRNAs were negatively correlated with their targets. These findings gave new insights into the characteristics of miRNAs in cauliflower, and provided important clues to elucidate the roles of miRNAs in the tissue differentiation and development of cauliflower. PMID:24170336

  11. Technique for improving solid state mosaic images

    NASA Technical Reports Server (NTRS)

    Saboe, J. M.

    1969-01-01

    Method identifies and corrects mosaic image faults in solid state visual displays and opto-electronic presentation systems. Composite video signals containing faults due to defective sensing elements are corrected by a memory unit that contains the stored fault pattern and supplies the appropriate fault word to the blanking circuit.

  12. Pulling the Internet Together with Mosaic.

    ERIC Educational Resources Information Center

    Sheehan, Mark

    1995-01-01

    Presents the history of the Internet with specific emphasis on Mosaic; discusses hypertext and hypermedia information; and describes software and hardware requirements. Sidebars include information on the National Center for Super Computing Applications (NCSA); World Wide Web browsers for use in Windows, Macintosh, and X-Windows (UNIX); and…

  13. Triploid-diploid mosaic chicken embryo.

    PubMed

    Bloom, S E; Buss, E G

    1966-08-12

    Cytological analysis of an underdeveloped chicken embryo at 6 days of incubation revealed a triploid-diploid mosaic condition. Of the 30 metaphases observed, 19 were triploid and 11 diploid. The triploid cells were 3A-ZZZ and diploid cells 2A-ZZ, as determined for the six largest pairs of chromnosomes. PMID:5328678

  14. Barley stripe mosaic and Barley yellow stripe

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Barley stripe mosaic was described in Wisconsin as "barley false stripe" in 1910, making it perhaps the first cereal virus disease described in the United States. The disease has been reported from most barley-producing areas of the world, including North and South America, Asia, Africa, Europe, an...

  15. The Viking Mosaic catalog, volume 1

    NASA Technical Reports Server (NTRS)

    Evans, N.

    1982-01-01

    Martian geographic location information for Viking Orbiter mosaic images is provided. The photographic sequences were chosen based upon image content. The footprinting task was carried out, post factor, in order to facilitate research activities. Early activities were centered around the examination of candidate landing sites.

  16. Infection of Plants by Tobacco Mosaic Virus.

    ERIC Educational Resources Information Center

    McDaniel, Larry; Maratos, Marina; Farabaugh, Joan

    1998-01-01

    Provides three exercises that introduce high school and college students to a common strain of the tobacco mosaic virus and the study of some basic biological processes. Activities involve inoculation of plants and observing and recording symptom development in infected plants. (DDR)

  17. Mosaic as a Vehicle for Collaborative Learning.

    ERIC Educational Resources Information Center

    Wagner, Robin; Wilson, Bill

    Gettysburg College (Pennsylvania) developed a program which centered on NCSA Mosaic as a vehicle for collaborative learning. The project involved a select number of incoming freshmen who lived together in the then-experimental residential college program. Goals included mastery of basic library and computer skills, gaining familiarity with…

  18. Multicultural Mosaic: A Family Book Club.

    ERIC Educational Resources Information Center

    Dias-Mitchell, Laurie; Harris, Elizabeth

    2001-01-01

    Authors, a library media specialist and a literature/language arts teacher, both recipients of Theodore R. Sizer Fellowships, describe their joint project, "Multicultural Mosaic: A Family Book Club." Their proposal was to strengthen the home-school connection by establishing a book club accessible to all middle and high school students and their…

  19. Software for Viewing Landsat Mosaic Images

    NASA Technical Reports Server (NTRS)

    Watts, Jack; Farve, Catherine L.; Harvey, Craig

    2002-01-01

    A Windows-based computer program has been written to enable novice users (especially educators and students) to view images of large areas of the Earth (e.g., the continental United States) generated from image data acquired in the Landsat observations performed circa the year 1990. The large-area images are constructed as mosaics from the original Landsat images, which were acquired in several wavelength bands and each of which spans an area (in effect, one tile of a mosaic) of 5 in latitude by approximately equal to 6 degrees in longitude. Whereas the original Landsat data are registered on a universal transverse Mercator (UTM) grid, the program converts the UTM coordinates of a mouse pointer in the image to latitude and longitude, which are continuously updated and displayed as the pointer is moved. The mosaic image currently on display can be exported as a Windows bit-map file. Other images (e.g., of state boundaries or interstate highways) can be overlaid on Landsat mosaics. The program interacts with the user via standard toolbar, keyboard, and mouse user interfaces. The program is supplied on a compact disk along with tutorial and educational information.

  20. Software for Viewing Landsat Mosaic Images

    NASA Technical Reports Server (NTRS)

    2002-01-01

    A Windows-based computer program has been written to enable novice users (especially educators and students) to view images of large areas of the Earth (e.g., the continental United States) generated from image data acquired in the Landsat observations performed circa the year 1990. The large-area images are constructed as mosaics from the original Landsat images, which were acquired in several wavelength bands and each of which spans an area (in effect, one tile of a mosaic) of approx. 5 in latitude by approx. 6 deg in longitude. Whereas the original Landsat data are registered on a universal transverse Mercator (UTM) grid, the program converts the UTM coordinates of a mouse pointer in the image to latitude and longitude, which are continuously updated and displayed as the pointer is moved. The mosaic image currently on display can be exported as a Windows bit-map file. Other images (e.g., of state boundaries or interstate highways) can be overlaid on Landsat mosaics. The program interacts with the user via standard toolbar, keyboard, and mouse user interfaces. The program is supplied on a compact disk along with tutorial and educational information.

  1. Tobacco mosaic virus: Proof by synthesis

    Technology Transfer Automated Retrieval System (TEKTRAN)

    A linear, non-self-replicating DNA molecule encoding Tobacco mosaic virus (TMV) was enzymatically synthesized in vitro from DNA templates made from overlapping oligonucleotides. The molecule was a replica of the alphabetic text rendering of the first TMV genome sequence elucidated by Goelet et al. ...

  2. Ultrahigh Thermoelectric Performance in Mosaic Crystals.

    PubMed

    He, Ying; Lu, Ping; Shi, Xun; Xu, Fangfang; Zhang, Tiansong; Snyder, Gerald Jeffrey; Uher, Ctirad; Chen, Lidong

    2015-06-24

    Successful research strategies to enhance the dimensionless figure of merit zT above 2 rely on either bulk nanomaterials or on single crystals. A new physical mechanism of nanoscale mosaicity is shown that goes beyond the approaches in single crystals or conventional nanomaterials. A zT value of 2.1 at 1000 K in bulk nanomaterials is achieved. PMID:25962487

  3. Software for Viewing Landsat Mosaic Images

    NASA Technical Reports Server (NTRS)

    Watts, Zack; Farve, Catharine L.; Harvey, Craig

    2003-01-01

    A Windows-based computer program has been written to enable novice users (especially educators and students) to view images of large areas of the Earth (e.g., the continental United States) generated from image data acquired in the Landsat observations performed circa the year 1990. The large-area images are constructed as mosaics from the original Landsat images, which were acquired in several wavelength bands and each of which spans an area (in effect, one tile of a mosaic) of .5 in latitude by .6 in longitude. Whereas the original Landsat data are registered on a universal transverse Mercator (UTM) grid, the program converts the UTM coordinates of a mouse pointer in the image to latitude and longitude, which are continuously updated and displayed as the pointer is moved. The mosaic image currently on display can be exported as a Windows bitmap file. Other images (e.g., of state boundaries or interstate highways) can be overlaid on Landsat mosaics. The program interacts with the user via standard toolbar, keyboard, and mouse user interfaces. The program is supplied on a compact disk along with tutorial and educational information.

  4. Highland's Mosaic Mural: The Project, the Process.

    ERIC Educational Resources Information Center

    Waggoner, Jan; Imming, Patricia

    1982-01-01

    Describes how a group of upper-elementary students in Highland, Illinois, designed and constructed a large mosaic mural depicting their city. Students were enthusiastic and highly motivated by the project. Widespread publicity excited intense community interest and involvement. The problems of design and construction are discussed. (AM)

  5. Expanding the phenotype of mosaic trisomy 20.

    PubMed

    Willis, Mary J H; Bird, Lynne M; Dell'Aquilla, Marie; Jones, Marilyn C

    2008-02-01

    Mosaic trisomy 20 is one of the more common cytogenetic abnormalities found on amniocentesis or chorionic villus sampling. Studies have shown that outcome is normal in 90-93% of prenatally diagnosed cases. There are however, reports in the literature of children with mosaic trisomy 20 described as having an assortment of dysmorphic features and varying levels of developmental delay. Unfortunately, the literature has not defined a specific phenotype for this entity. Here we report on three patients with mosaic trisomy 20, two of whom were identified prenatally. Over a number of years of follow-up it has become apparent that there are some striking similarities among the three. Comparison between our patients and the literature cases indicates a more consistent phenotype than has previously been suggested. Recurring features include; spinal abnormalities (including spinal stenosis, vertebral fusion, and kyphosis), hypotonia, lifelong constipation, sloped shoulders, and significant learning disabilities despite normal intelligence. These findings may be overlooked on routine history and physical exam or assumed to be standard pediatric problems. It is not our intention to suggest that there is a distinctive face for this entity but to suggest that a subtle phenotype does exist. We have attempted to identify a set of findings for which any child diagnosed with mosaic trisomy 20 should be assessed or followed even in the presence of an apparently normal physical exam at birth. PMID:18203170

  6. Genetics of seed transmission Soybean mosaic virus

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Soybean mosaic virus (SMV) is an aphid- and seed-transmitted member of the Potyviridae that infects soybean plants and, in years when virus infections are widespread, can cause significant reductions in the quantity and quality of seed harvested. Because seed-borne infections are the primary sources...

  7. Distributions of /sup 35/S-sulfate and /sup 3/H-glucosamine in the angular region of the hamster: light and electron microscopic autoradiography

    SciTech Connect

    Ohnishi, Y.; Taniguchi, Y.

    1983-06-01

    The distribution of /sup 35/S-sulfate and /sup 3/H-glucosamine in the angular region of the hamster was studied by light and electron microscopic autoradiography following intraperitoneal injection of these compounds to hamsters. Exposed silver grains of /sup 35/S-sulfate were concentrated in the trabecular meshwork, sclera, and cornea, and grains of /sup 3/H-glucosamine were localized in the trabecular region. The radioactivity of both isotopes was observed in the Golgi apparatuses of the endothelial cells of the angular aqueous plexus and the trabecular meshwork. The grains were noted over the entire cytoplasm, except for the nucleus, and then were incorporated into the amorphous substance and collagen fibers in the region adjacent to the angular aqueous sinus. These results suggest that endothelial cells in the angular region synthesize and secrete the sulfated glycosaminoglycans and hyaluronic acid.

  8. Decoloration and solubilization of plant tissue prior to determination of /sup 3/H, /sup 14/C, and /sup 35/S by liquid scintillation

    SciTech Connect

    Smith, I.K.; Lang, A.L.

    1987-08-01

    A method is described for the decoloration and partial solubilization of plant tissue with 2% sodium hypochlorite. Following treatment of the digest with ammonia, the samples are suitable for the determination of /sup 3/H, /sup 14/C, and /sup 35/S by liquid scintillation counting. The color quenching is negligible and counting efficiencies are high: 30-40% for /sup 3/H and 90-95% for /sup 14/C.

  9. Human 5-HT1F receptor-stimulated [35S]GTPgammaS binding: correlation with inhibition of guinea pig dural plasma protein extravasation.

    PubMed

    Wainscott, D B; Johnson, K W; Phebus, L A; Schaus, J M; Nelson, D L

    1998-07-01

    To determine the potency and efficacy of 5-HT1F receptor ligands, a [35S]GTPgammaS binding assay was developed and optimized for the human 5-HT1F receptor. Compounds which are known to be effective in the abortive treatment of migraine were tested for efficacy and potency in this assay. Naratriptan, sumatriptan, zolmitriptan, and rizatriptan all had agonist activity. The 5-HT1F receptor ligand LY334370 (4-fluoro-N-[3-(1-methyl-4-piperidinyl)-1H-indol-5-yl]-benzamide) was the most potent compound tested with an EC50 of 2.13 +/- 0.15 nM. LY302148 (5-fluoro-3-[1-[2-(1-methyl-1H-pyrazol-4-yl)ethyl]-4-piperidinyl]-1H-ind ole), methysergide, LY306258 (3-dimethylamino-2,3,4,9-tetrahydro-1H-carbazol-6-ol), dihydroergotamine (DHE), L-694,247 and CP-122,288 were also investigated for potency and efficacy. There was a statistically significant correlation between the pEC50 for the stimulation of [35S]GTPgammaS binding and the pID50 for the inhibition of trigeminal nerve-stimulated dural plasma protein extravasation in the guinea pig. In the course of these studies, it was found that the purportedly selective 5-HT1D receptor antagonist GR127935 inhibited 5-HT1F receptor-stimulated [35S]GTPgammaS binding with a Ki of 39.6 +/- 9.5 nM. These studies demonstrate that 5-HT1F receptor-mediated stimulation of [35S]GTPgammaS binding in a clonal cell system is a reproducible, high throughput assay that is predictive of an in vivo model of 5-HT1F receptor activation. PMID:9718276

  10. Cocaine alters mu but not delta or kappa opioid receptor-stimulated in situ [35S]GTPgammaS binding in rat brain.

    PubMed

    Schroeder, Joseph A; Niculescu, Michelle; Unterwald, Ellen M

    2003-01-01

    Chronic cocaine administration produces alterations in mu and kappa opioid receptor density as well as striatal and accumbens opioid-regulated adenylyl cyclase activity, suggesting a psychostimulant responsive interaction between opioidergic and dopaminergic systems. Stimulation of G-protein-coupled opioid receptors inhibits adenylyl cyclase production of cyclic AMP. The present study employed in situ [(35)S]GTPgammaS binding to measure opioid receptor-stimulated activation of G-proteins in response to acute and chronic cocaine exposure. Male Fischer rats received acute (1 or 3 days) or chronic (14 days) binge pattern cocaine administration. Three and 14 days of cocaine injections resulted in greater increases in the ability of the mu receptor agonist DAMGO to stimulate [(35)S]GTPgammaS binding in both the core and the shell of the nucleus accumbens, all regions of the caudate putamen and the cingulate cortex compared with saline-matched controls. The greatest increases in DAMGO-stimulated [(35)S]GTPgammaS binding were observed in the dorsal areas of the caudate putamen in animals that received 14 days of cocaine. No significant changes in delta (DPDPE), or kappa (dynorphin A(1-17)) receptor-stimulated [(35)S]GTPgammaS binding were found in any brain region in response to cocaine administration. These results demonstrate that binge pattern cocaine administration induce changes in mu but not delta or kappa opioid receptor-mediated G-protein activity. This study provides support for the hypothesis that the addictive properties of both psychostimulants and opiates may share common neurochemical signaling substrates. PMID:12422370

  11. Increased chromosome 21 mosaicism in older Down syndrome individuals

    SciTech Connect

    Jenkins, E.C.; Schupf, N.; Harris, M.

    1994-09-01

    Loss of one chromosome 21 in older Down syndrome individuals has been reported recently. During a study of the familial aggregation of Down syndrome and Alzheimer disease, our preliminary observations indicated increased mosaicism for the loss of a chromosome 21 in whole blood cultures from Down syndrome individuals who were age 50 or over from a cohort of 22 individuals. We retrospectively reviewed our experience in 189 cases of Down syndrome ranging in age from 1 day to 71 years. In a combined total of 212 individuals, 39 were age 50 or more of whom 7 or 18% were mosaic, while 169 were under age 50 of whom 4 or 2% were mosaic. Therefore the occurrence of mosaicism was strikingly increased in the group of individuals who were age 50 or over ({chi}{sup 2}=12.8, p<.001). Our observations confirm the above reports of increased mosaicism for chromosome 21 loss in lymphocyte cultures from older Down syndrome individuals. Since the older individuals were not karyotyped at birth, it is not possible to determine whether the age-related increase in mosaicism is due to increased survival of mosaic individuals or acquired mosaicism. Assuming 1% mosaicism at birth for Down syndrome and assuming the general population`s death rates for these mosaic individuals, life table methods showed that the expected proportion of these individuals at age 70 was 5%. This was less than 1/3 of our observations suggesting that acquired mosaicism was the predominant mechanism for our findings.

  12. MOSAIC for multiple-reward environments.

    PubMed

    Sugimoto, Norikazu; Haruno, Masahiko; Doya, Kenji; Kawato, Mitsuo

    2012-03-01

    Reinforcement learning (RL) can provide a basic framework for autonomous robots to learn to control and maximize future cumulative rewards in complex environments. To achieve high performance, RL controllers must consider the complex external dynamics for movements and task (reward function) and optimize control commands. For example, a robot playing tennis and squash needs to cope with the different dynamics of a tennis or squash racket and such dynamic environmental factors as the wind. In addition, this robot has to tailor its tactics simultaneously under the rules of either game. This double complexity of the external dynamics and reward function sometimes becomes more complex when both the multiple dynamics and multiple reward functions switch implicitly, as in the situation of a real (multi-agent) game of tennis where one player cannot observe the intention of her opponents or her partner. The robot must consider its opponent's and its partner's unobservable behavioral goals (reward function). In this article, we address how an RL agent should be designed to handle such double complexity of dynamics and reward. We have previously proposed modular selection and identification for control (MOSAIC) to cope with nonstationary dynamics where appropriate controllers are selected and learned among many candidates based on the error of its paired dynamics predictor: the forward model. Here we extend this framework for RL and propose MOSAIC-MR architecture. It resembles MOSAIC in spirit and selects and learns an appropriate RL controller based on the RL controller's TD error using the errors of the dynamics (the forward model) and the reward predictors. Furthermore, unlike other MOSAIC variants for RL, RL controllers are not a priori paired with the fixed predictors of dynamics and rewards. The simulation results demonstrate that MOSAIC-MR outperforms other counterparts because of this flexible association ability among RL controllers, forward models, and reward

  13. Landsat Thematic Mapper Image Mosaic of Colorado

    USGS Publications Warehouse

    Cole, Christopher J.; Noble, Suzanne M.; Blauer, Steven L.; Friesen, Beverly A.; Bauer, Mark A.

    2010-01-01

    The U.S. Geological Survey (USGS) Rocky Mountain Geographic Science Center (RMGSC) produced a seamless, cloud-minimized remotely-sensed image spanning the State of Colorado. Multiple orthorectified Landsat 5 Thematic Mapper (TM) scenes collected during 2006-2008 were spectrally normalized via reflectance transformation and linear regression based upon pseudo-invariant features (PIFS) following the removal of clouds. Individual Landsat scenes were then mosaicked to form a six-band image composite spanning the visible to shortwave infrared spectrum. This image mosaic, presented here, will also be used to create a conifer health classification for Colorado in Scientific Investigations Map 3103. An archive of past and current Landsat imagery exists and is available to the scientific community (http://glovis.usgs.gov/), but significant pre-processing was required to produce a statewide mosaic from this information. Much of the data contained perennial cloud cover that complicated analysis and classification efforts. Existing Landsat mosaic products, typically three band image composites, did not include the full suite of multispectral information necessary to produce this assessment, and were derived using data collected in 2001 or earlier. A six-band image mosaic covering Colorado was produced. This mosaic includes blue (band 1), green (band 2), red (band 3), near infrared (band 4), and shortwave infrared information (bands 5 and 7). The image composite shown here displays three of the Landsat bands (7, 4, and 2), which are sensitive to the shortwave infrared, near infrared, and green ranges of the electromagnetic spectrum. Vegetation appears green in this image, while water looks black, and unforested areas appear pink. The lines that may be visible in the on-screen version of the PDF are an artifact of the export methods used to create this file. The file should be viewed at 150 percent zoom or greater for optimum viewing.

  14. In vivo biosynthesis of L-(/sup 35/S)Cys-arginine vasopressin, -oxytocin, and -somatostatin: rapid estimation using reversed phase high pressure liquid chromatography. [Rats

    SciTech Connect

    Franco-Bourland, R.E.; Fernstrom, J.D.

    1981-01-01

    L(/sup 35/S)Cys-arginine vasopressin, -oxytocin, and -somatostatin were purified from hypothalami and neurohypophyses 4 h after rats received L(/sup 35/S)Cys via the third ventricle. After acetic acid extraction, Sephadex G-25 filtration, and chemoadsorption to C18-silica (Sep-Pak cartridges), the labeled peptides were rapidly separated by gradient elution, reversed phase, high pressure liquid chromatography (HPLC). The identity and isotopic purity of the labeled peptides were determined by several reversed phase HPLC procedures in conjunction with chemical modification. The labeled peptide fractions were at least 50% radiochemically pure. Using this HPLC isolation procedure, incorporation of L-(/sup 35/S)Cys into each peptide was determined in hydrated and dehydrated rats. Label incorporation into arginine vasopressin and oxytocin in the hypothalamus and the neurohypophysis of dehydrated rats was 2-3 times greater than that in hydrated rats. Incorporation of label into hypothalamic and neurohypophyseal somatostatin was unaffected by the hydration state of the animal. This procedure thus provides a very rapid, but sensitive, set of techniques for studying the control of small peptide biosynthesis in the brain.

  15. A Single-Step Purification of Cauliflower Lysozyme and Its Dual Role Against Bacterial and Fungal Plant Pathogens.

    PubMed

    Manikandan, Muthu; Balasubramaniam, R; Chun, Se-Chul

    2015-09-01

    A novel lysozyme from cauliflower was purified in a single step, for the first time, using Sephadex G100 column chromatography. The purified lysozyme exhibited a homogenized single band in sodium dodecyl sulfate polyacrylamide gel electrophoresis (SDS-PAGE), and its molecular mass was calculated to be 22.0 kDa. The purified lysozyme showed activity between 30 to 60 °C with 40 °C as the optimum temperature for its maximal activity. Although the purified lysozyme was functional at pH ranges between 3.0 and 9.0, the optimum pH for the enzyme activity was 8.0. By Michaelis-Menten equation, the threshold substrate concentration for the optimal enzyme activity was calculated to be 133.0 μg. The purified lysozyme showed extraordinary activity against plant pathogenic bacteria and fungi. At 10-μg concentrations, it inhibited the growth of plant pathogenic bacteria such as Pseudomonas syringae, Xanthomonas campestris, and Erwinia carotovora exhibiting 4.28, 5.90, and 3.88-fold inhibition, respectively. Further, it also completely inhibited the conidial germination of Archemonium obclavatum and, to a very large extent, other fungal species such as Fusarium solani (79.3 %), Leptosphaeria maculans (88.6 %), Botrytis cinera (73.3 %), Curvularia lunata (68 %), Rhizoctonia solani (79.6 %), and Alternaria alternata (83.6 %). PMID:26208688

  16. Genetic manipulation of gamma-linolenic acid (GLA) synthesis in a commercial variety of evening primrose (Oenothera sp.).

    PubMed

    de Gyves, Emilio Mendoza; Sparks, Caroline A; Sayanova, Olga; Lazzeri, Paul; Napier, Johnathan A; Jones, Huw D

    2004-07-01

    A robust Agrobacterium-mediated transformation procedure was developed for Rigel, a commercial cultivar of evening primrose, and used to deliver a cDNA encoding a Delta(6)-desaturase from borage under the control of a cauliflower mosaic virus (CaMV) 35S promoter. Analysis of the transformed plants demonstrated an altered profile of polyunsaturated fatty acids, with an increase in gamma-linolenic acid and octadecatetraenoic acid in leaf tissues when compared with control lines. PMID:17134396

  17. Generation of Resistance to the Diphenyl Ether Herbicide, Oxyfluorfen, via Expression of the Bacillus subtilis Protoporphyrinogen Oxidase Gene in Transgenic Tobacco Plants.

    PubMed

    Choi, K W; Han, O; Lee, H J; Yun, Y C; Moon, Y H; Kim, M; Kuk, Y I; Han, S U; Guh, J O

    1998-01-01

    In an effort to develop transgenic plants resistant to diphenyl ether herbicides, we introduced the protoporphyrinogen oxidase (EC 1.3.3.4) gene of Bacillus subtilis into tobacco plants. The results from a Northern analysis and leaf disc assay indicate that the expression of the B. subtilis protoporphyrinogen oxidase gene under the cauliflower mosaic virus 35S promoter generated resistance to the diphenyl ether herbicide, oxyfluorfen, in transgenic tobacco plants. PMID:27315932

  18. Landsat Image Mosaic of Antarctica (LIMA)

    USGS Publications Warehouse

    U.S. Geological Survey

    2007-01-01

    For most of us, Antarctica was at best a distant acquaintance. Now, with the Landsat Image Mosaic of Antarctica (LIMA), we are on intimate terms. In stunning, up-close and personal detail, LIMA brings Antarctica to life. Explore this virtually cloudless, seamless, most geometrically accurate, and highest resolution satellite mosaic of Antarctica. A team of scientists from the U.S. Geological Survey, the British Antarctic Survey, and the National Aeronautics and Space Administration, with funding from the National Science Foundation, created LIMA in support of the International Polar Year (IPY; 2007?08). As the first major scientific outcome of the IPY, LIMA truly fulfills the IPY goals. LIMA is an international effort, supports current scientific polar research, encourages new projects, and helps the general public visualize Antarctica and changes happening in this southernmost environment. Researchers and the general public can download LIMA and all component Landsat scenes at no charge.

  19. Towards Luminescence Dating Of Mosaic Glass

    NASA Astrophysics Data System (ADS)

    Galli, A.; Martini, M.; Sibila, E.; Villa, I.

    The possibility of dating archaeological glass by means of luminescent techniques has been investigated in recent years, despite the difficulties of this application, mainly linked to the amorphous structure of the material. We focused in particular on mosaic glass, after the encouraging results obtained on byzantine and medieval samples. Further studies were devoted to the comprehension of the luminescent mechanisms in silica glasses, and to the investigation of the relationships between luminescence, colouring or opacifier ions and crystalline phase of the vitreous matrix. The results of a study on the dosimetric characteristics of thermoluminescence (TL) and Optically Stimulated Luminescence (OSL) of a few medieval blue-green mosaic glasses from the San Lorenzo church (Milan) are presented, and the experimental protocols established to identify their suitability for dating are discussed.

  20. Mosaic Infrared Sensor for Space Astronomy (MIRSSA)

    NASA Technical Reports Server (NTRS)

    1983-01-01

    The development of mosaic infrared detector/focal plane arrays for space astronomy is reported. The Mosaic IR Sensor for Space Astronomy (MIRSSA) Program is an effort to develop PV HgCdTe detector arrays with the spectral response of up to 5 micron and silicon CCDs for low temperature applications. Desired background-limited performance (BLIP) for space applications requires an extremely high R sub A product which can be achieved by selecting the detector materials and the operating temperature. The parameters were determined by measurement of HgCdTe PV detector arrays at various temperatures in the SW and MW spectral bands. It is demonstrated that high performance PV HgCdTe detectors can be fabricated for low temperature applications.

  1. Mosaic double aneuploidy: Down syndrome and XYY.

    PubMed

    Parihar, Mayur; Koshy, Beena; Srivastava, Vivi Miriam

    2013-07-01

    Chromosomal abnormalities are seen in nearly 1% of live born infants. We report a 5-year-old boy with the clinical features of Down syndrome, which is the most common human aneuploidy. Cytogenetic analysis showed a mosaicism for a double aneuploidy, Down syndrome and XYY. The karyotype was 47, XY,+21[19]/48, XYY,+21[6]. ish XYY (DXZ1 × 1, DYZ1 × 2). Mosaic double aneuploidies are very rare and features of only one of the aneuploidies may predominate in childhood. Cytogenetic analysis is recommended even if the typical features of a recognized aneuploidy are present so that any associated abnormality may be detected. This will enable early intervention to provide the adequate supportive care and management. PMID:24339550

  2. Digital Elevation Model Mosaic of Mercury

    NASA Technical Reports Server (NTRS)

    Cook, A. C.; Watters, T. R.; Robinson, M. S.

    2001-01-01

    At CEPS (Center for Earth and Planetary Studies) work has been underway since 2000 to semi-automatically stereo match all Mariner 10 stereo pairs. The resulting matched image coordinates are converted into longitude, latitude, and height points and then combined to form a map projected Digital Elevation Model (DEM) mosaic of the planet's surface. Stereo images from Mariner 10 cover one quarter of the planet's surface, mostly in the southern hemisphere. Additional information is contained in the original extended abstract.

  3. Forest bird demography in a landscape mosaic

    SciTech Connect

    Urban, D.L.

    1986-12-01

    A tandem approach of field studies and simulation modeling was used to examine avian demography in a landscape mosaic of habitat patches. A particular goal was to attempt to account for the regional decline in abundance of a subset of bird species sensitive to forest fragmentation. Species abundance patterns in forest patches were framed as the consequence of individual birds' demographics, constrained by their landscape context; this context was partitioned to emphasize habitat availability (or area), accessibility (or isolation), and localized factors affecting reproductive success (nest predation and brood parasitism). Each of these constraints was examined in turn, to assess their relative contribution to species abundance patterns observed in landscape mosaics. A forest simulation model was used to develop a theoretical basis for the importance of microhabitat pattern in forest bird communities. Hypotheses about microhabitat variety and bird species distribution in landscapes were not supported by data from woodlots in Cadiz Township, southern Wisconsin. The hierarchical conceptual model developed in this study represents a synthetic general model, a framework that can be simplified under specified scenarios to provide predictions about bird species abundance patterns in landscape mosaics.

  4. Confined placental mosaicisms and uniparental disomy

    SciTech Connect

    Kalousek, D.K.; Langlois, S.; Harrison, K.J.

    1994-09-01

    Approximately 2% of pregnancies studied with chorionic villous sampling (CVS) show confined placental mosaicism (CPM) which persists to term in 50-70% of cases. An increased frequency of complications, such as intrauterine fetal growth restriction or intrauterine death, is observed in these pregnancies. As trisomic zygote rescue is a common mechanism responsible for CPM, fetal uniparental disomy (UPD), resulting from the loss of the extra trisomic chromosome in the embryonic stem cells, would be expected to occur in a proportion of pregnancies with CPM. We have studied 27 pregnancies with CPM involving trisomies for chromosomes 2, 7, 9, 10, 12, and 16 for involvement of specific cell lineage(s) and levels of mosaicism in term placentas. Also, DNA from the parents and infant was analyzed for UPD or biparental disomy (BPD). Five infants with UPD for chromosome 16 and one infant with UPD for chromosome 7 were detected. All other infants showed BPD for the chromosome involved in CPM. For trisomy 16 mosaic gestations, a close correlation between high levels of trisomic cells in placenta and intrauterine fetal growth restriction has been found irrespective of the type of disomy present in the infant. The effect of other trisomies (2, 7, 9, 10, 12) on placental function appears to be similar, but the low numbers of pregnancies studied and lack of detection of UPD for chromosomes 2, 9, 10 and 12 does not allow a definitive conclusion.

  5. The Landsat Image Mosaic of Antarctica

    USGS Publications Warehouse

    Bindschadler, R.; Vornberger, P.; Fleming, A.; Fox, A.; Mullins, J.; Binnie, D.; Paulsen, S.J.; Granneman, B.; Gorodetzky, D.

    2008-01-01

    The Landsat Image Mosaic of Antarctica (LIMA) is the first true-color, high-spatial-resolution image of the seventh continent. It is constructed from nearly 1100 individually selected Landsat-7 ETM+ scenes. Each image was orthorectified and adjusted for geometric, sensor and illumination variations to a standardized, almost seamless surface reflectance product. Mosaicing to avoid clouds produced a high quality, nearly cloud-free benchmark data set of Antarctica for the International Polar Year from images collected primarily during 1999-2003. Multiple color composites and enhancements were generated to illustrate additional characteristics of the multispectral data including: the true appearance of the surface; discrimination between snow and bare ice; reflectance variations within bright snow; recovered reflectance values in regions of sensor saturation; and subtle topographic variations associated with ice flow. LIMA is viewable and individual scenes or user defined portions of the mosaic are downloadable at http://lima.usgs.gov. Educational materials associated with LIMA are available at http://lima.nasa.gov.

  6. Hypothesis: Somatic Mosaicism and Parkinson Disease

    PubMed Central

    Kim, Han-Joon

    2014-01-01

    Mutations causing genetic disorders can occur during mitotic cell division after fertilization, which is called somatic mutations. This leads to somatic mosaicism, where two or more genetically distinct cells are present in one individual. Somatic mutations are the most well studied in cancer where it plays an important role and also have been associated with some neurodegenerative disorders. The study of somatic mosaicism in Parkinson disease (PD) is only in its infancy, and a case with somatic mutation has not yet been described. However, we can speculate that a somatic mutation affecting cells in the central nervous system including substantia nigra dopaminergic neurons could lead to the development of PD through the same pathomechanisms of genetic PD even in the absence of a germ-line mutation. Theoretically, a number of genes could be candidates for genetic analysis for the presence of somatic mosaicism. Among them, SNCA and PARK2 could be the best candidates to analyze. Because analyzing brain tissues in living patients is impossible, alternative tissues could be used to indicate the genetic status of the brain. Performance of the technology is another factor to consider when analyzing the tissues. PMID:25548528

  7. Resistance to Cucumber mosaic virus in Gladiolus plants transformed with either a defective replicase or coat protein subgroup II gene from Cucumber mosaic virus.

    PubMed

    Kamo, Kathryn; Jordan, Ramon; Guaragna, Mary Ann; Hsu, Hei-Ti; Ueng, Peter

    2010-07-01

    Transgenic Gladiolus plants that contain either Cucumber mosaic virus (CMV) subgroup I coat protein, CMV subgroup II coat protein, CMV replicase, a combination of the CMV subgroups I and II coat proteins, or a combination of the CMV subgroup II coat protein and replicase genes were developed. These plants were multiplied in vitro and challenged with purified CMV isolated from Gladiolus using a hand-held gene gun. Three out of 19 independently transformed plants expressing the replicase gene under control of the duplicated CaMV 35S promoter were found to be resistant to CMV subgroup I. Three out of 21 independently transformed plants with the CMV subgroup II coat protein gene under control of the Arabidopsis UBQ3 promoter were resistant to CMV subgroup II. Eighteen independently transformed plants with either the CMV subgroup I coat protein or a combination of CMV subgroups I and II coat proteins were challenged and found to be susceptible to both CMV subgroups I or II. Virus resistant plants with the CMV replicase transgene expressed much lower RNA levels than resistant plants expressing the CMV subgroup II coat protein. This work will facilitate the evaluation of virus resistance in transgenic Gladiolus plants to yield improved floral quality and productivity. PMID:20411391

  8. Resolving the impact of stratosphere-to-troposphere transport on the sulfur cycle and surface ozone over the Tibetan Plateau using a cosmogenic 35S tracer

    NASA Astrophysics Data System (ADS)

    Lin, Mang; Zhang, Zhisheng; Su, Lin; Hill-Falkenthal, Jason; Priyadarshi, Antra; Zhang, Qianggong; Zhang, Guoshuai; Kang, Shichang; Chan, Chuen-Yu; Thiemens, Mark H.

    2016-01-01

    The Himalayas were recently identified as a global hot spot for deep stratosphere-to-troposphere transport (STT) in spring. Although the STT in this region may play a vital role in tropospheric chemistry, the hydrological cycle and aquatic ecosystems in Asia, there is no direct measurement of a chemical stratospheric tracer to verify and evaluate its possible impacts. Here we use cosmogenic 35S as a tracer for air masses originating in the stratosphere and transported downward. We measure concentrations of 35S in fresh surface snow and river runoff samples collected from Mount Everest in April 2013 to be more than 10 times higher than previously reported by any surface measurement, in support of the Himalayas as a gateway of springtime STT. In light of this result, measurements of 35SO2 and 35SO42- at Nam Co in spring 2011 are reanalyzed to investigate the magnitudes of stratospheric air masses from the Himalayas to the tropospheric sulfur cycle and surface O3 level over the Tibetan Plateau. A simple one-box model reveals that the oxidative lifetime of SO2 is reduced in aged STT plumes. Triple oxygen isotopic measurements of sulfate samples suggest that enhanced O3 levels may shift the oxidation pathway of SO2 in the troposphere, which may be constrained by further intensive sampling and measurements. Comparison with surface O3 measurements and traditional meteorological tracing methods shows that 35S is a potentially unique and sensitive tracer to quantify the contribution of stratospheric air to surface O3 levels in fresh or aged STT plumes.

  9. Repeated reunions and splits feature the highly dynamic evolution of 5S and 35S ribosomal RNA genes (rDNA) in the Asteraceae family

    PubMed Central

    2010-01-01

    Background In flowering plants and animals the most common ribosomal RNA genes (rDNA) organisation is that in which 35S (encoding 18S-5.8S-26S rRNA) and 5S genes are physically separated occupying different chromosomal loci. However, recent observations established that both genes have been unified to a single 35S-5S unit in the genus Artemisia (Asteraceae), a genomic arrangement typical of primitive eukaryotes such as yeast, among others. Here we aim to reveal the origin, distribution and mechanisms leading to the linked organisation of rDNA in the Asteraceae by analysing unit structure (PCR, Southern blot, sequencing), gene copy number (quantitative PCR) and chromosomal position (FISH) of 5S and 35S rRNA genes in ~200 species representing the family diversity and other closely related groups. Results Dominant linked rDNA genotype was found within three large groups in subfamily Asteroideae: tribe Anthemideae (93% of the studied cases), tribe Gnaphalieae (100%) and in the "Heliantheae alliance" (23%). The remaining five tribes of the Asteroideae displayed canonical non linked arrangement of rDNA, as did the other groups in the Asteraceae. Nevertheless, low copy linked genes were identified among several species that amplified unlinked units. The conserved position of functional 5S insertions downstream from the 26S gene suggests a unique, perhaps retrotransposon-mediated integration event at the base of subfamily Asteroideae. Further evolution likely involved divergence of 26S-5S intergenic spacers, amplification and homogenisation of units across the chromosomes and concomitant elimination of unlinked arrays. However, the opposite trend, from linked towards unlinked arrangement was also surmised in few species indicating possible reversibility of these processes. Conclusions Our results indicate that nearly 25% of Asteraceae species may have evolved unusual linked arrangement of rRNA genes. Thus, in plants, fundamental changes in intrinsic structure of rDNA units

  10. Hypocholesterolemic Effects of the Cauliflower Culinary-Medicinal Mushroom, Sparassis crispa (Higher Basidiomycetes), in Diet-Induced Hypercholesterolemic Rats.

    PubMed

    Hong, Ki Bae; Hong, Sung-Yong; Joung, Eun Young; Kim, Byung Hee; Bae, Song-Hwan; Park, Yooheon; Suh, Hyung Joo

    2015-01-01

    The cauliflower culinary-medicinal mushroom, Sparassis crispa, possesses various biological activities that have been widely reported to have therapeutic applications. We examined the effects of S. crispa on serum cholesterol, hepatic enzymes related to cholesterol metabolism, and fecal sterol excretion in rats fed a cholesterol-rich diet for 4 weeks. Male Sprague-Dawley rats (8 weeks old) were randomly divided into 5 groups (n = 6 mice per group): normal diet (normal control [NC]), cholesterol-rich diet (cholesterol control [CC]), cholesterol-rich diet plus S. crispa fruiting body (SC), cholesterol-rich diet plus S. crispa extract (SCE), and cholesterol-rich diet plus S. crispa residue (SCR). SCE supplementation significantly enhanced hepatic cholesterol catabolism through the upregulation of cholesterol 7α-hydroxylase (CYP7A1) messenger RNA (mRNA) expression (2.55-fold compared with that in the NC group; P < 0.05) and the downregulation of 3-hydroxy-3-methylglutaryl coenzyme A (HMG-CoA) reductase mRNA expression (0.57-fold compared with that in the NC group; P < 0.05). Additionally, the SCE diet resulted in the highest fecal excretion of cholesterol and bile acid in hypercholesterolemic rats. In conclusion, mRNA expression of CYP7A1 and HMG-CoA reductase were significantly modulated by the absorption of SCE samples. Also, SCE samples had a significant effect on fecal bile acid and cholesterol excretion. These results suggest that SCE samples can induce hypocholesterolic effects through cholesterol metabolism and the reduction of circulating cholesterol levels. PMID:26756188

  11. Variability of pesticide residues in cauliflower units collected from a field trial and market places in Greece.

    PubMed

    Prodhan, M D H; Papadakis, Emmanouil-N; Papadopoulou-Mourkidou, Euphemia

    2016-09-01

    To estimate the variability of pesticide residue levels present in cauliflower units, a total of 142 samples were collected from a field trial of a cooperative farmer, and 120 samples were collected from different market places in Thessaloniki, Greece. The collected samples were extracted using the quick, easy, cheap, effective, rugged, and safe (QuEChERS) extraction technique, and the residues were determined by liquid chromatography-tandem mass spectrometry. The developed method was validated by evaluating the accuracy, precision, linearity, limit of detection (LOD), and limit of quantification (LOQ). The average recoveries for all the analytes, derived from the data of control samples fortified at 0.01, 0.05, 0.1, and 0.2 mg/kg, ranged from 74 to 110% with a relative standard deviation of ≤8%. The correlation coefficient (R(2)) was ≥0.997 for all the analytes using matrix-matched calibration standards. The LOD values ranged from 0.001 to 0.003 mg/kg, and the LOQ was determined at 0.01 mg/kg for all the sought analytes. The matrix effect was found to be at a considerable level, especially for cypermethrin and deltamethrin, amounting to +90% and +145%, respectively. For the field samples, the unit-to-unit variability factors (VFs) calculated for cypermethrin and deltamethrin were 2.38 and 2.32, respectively, while the average VF for the market basket samples was 5.11. In the market basket samples, residues of cypermethrin, deltamethrin, chlorpyrifos, and indoxacarb were found at levels ≥LOQ and their respective VFs were 7.12, 5.67, 5.28, and 2.40. PMID:27229457

  12. Unique and redundant functional domains of APETALA1 and CAULIFLOWER, two recently duplicated Arabidopsis thaliana floral MADS-box genes.

    PubMed

    Alvarez-Buylla, Elena R; García-Ponce, Berenice; Garay-Arroyo, Adriana

    2006-01-01

    APETALA1 (AP1) and CAULIFLOWER (CAL) are closely related MADS box genes that are partially redundant during Arabidopsis thaliana floral meristem determination. AP1 is able to fully substitute for CAL functions, but not vice versa, and AP1 has unique sepal and petal identity specification functions. In this study, the unique and redundant functions of these two genes has been mapped to the four protein domains that characterize type-II MADS-domain proteins by expressing all 15 chimeric combinations of AP1 and CAL cDNA regions under control of the AP1 promoter in ap1-1 loss-of-function plants. The "in vivo" function of these chimeric genes was analysed in Arabidopsis plants by expressing the chimeras. Rescue of flower meristem and sepal/petal identities was scored in single and multiple insert homozygous transgenic lines. Using these chimeric lines, it was found that distinct residues of the AP1 K domain not shared by the same CAL domain are necessary and sufficient for complete recovery of floral meristem identity, in the context of the CAL protein sequence, while both AP1 COOH and K domains are indispensable for complete rescue of sepal identity. By contrast, either one of these two AP1 domains is necessary and sufficient for complete petal identity recovery. It was also found that there were positive and negative synergies among protein domains and their combinations, and that multiple-insert lines showed relatively better rescue than equivalent single-insert lines. Finally, several lines had flowers with extra sepals and petals suggesting that chimeric proteins yield abnormal transcriptional complexes that may alter the expression or regulation of genes that control floral organ number under normal conditions. PMID:16893974

  13. Constitutional trisomy 8 mosaicism syndrome: case report and review

    PubMed Central

    Udayakumar, Achandira M.; Al-Kindy, Adila

    2013-01-01

    Trisomy 8 mosaicism (Warkany syndrome) is a rare viable condition with variable phenotypes, ranging from mild dysmorphic features to severe malformations. Karyotyping and fluorescence in-situ hybridization potentially help detecting this low mosaic clone to confirm the diagnosis of patients with classical and unusual clinical presentations. This report reviews few previous cases to describe our case - a boy who had trisomy 8 mosaicism with severe dysmorphic features, born to a consanguineous Arabic couple. This study concludes that careful cytogenetic diagnoses of trisomy 8 mosaicism is essential for appropriate management and follow up of this rare disorder.

  14. A 3D mosaic algorithm using disparity map

    NASA Astrophysics Data System (ADS)

    Yu, Bo; Kakeya, Hideki

    2015-03-01

    Conventionally there exist two major methods to create mosaics in 3D videos. One is to duplicate the area of mosaics from the image of one viewpoint (the left view or the right view) to that of the other viewpoint. This method, which is not capable of expressing depth, cannot give viewers a natural perception in 3D. The other method is to create the mosaics separately in the left view and the right view. With this method the depth is expressed in the area of mosaics, but 3D perception is not natural enough. To overcome these problems, we propose a method to create mosaics by using a disparity map. In the proposed method the mosaic of the image from one viewpoint is made with the conventional method, while the mosaic of the image from the other viewpoint is made based on the data of the disparity map so that the mosaic patterns of the two images can give proper depth perception to the viewer. We confirm that the proposed mosaic pattern using a disparity map gives more natural depth perception of the viewer by subjective experiments using a static image and two videos.

  15. Response of maize (Zea mays L.) lines carrying Wsm1, Wsm2 and Wsm3 to the potyviruses Johnsongrass mosaic virus and Sorghum mosaic virus

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Maize dwarf mosaic disease is one of the most important viral diseases of maize throughout the world. It is caused by a set of related viruses in the family Potyviridae, genus Potyvirus, including Maize dwarf mosaic virus (MDMV), Sugarcane mosaic virus (SCMV), Johnsongrass mosaic virus (JGMV), and S...

  16. Effects of recombinant eel growth hormone on the uptake of ( sup 35 S)sulfate by ceratobranchial cartilages of the Japanese eel, Anguilla japonica

    SciTech Connect

    Duan, C.M.; Inui, Y. )

    1990-08-01

    Effects of growth hormone (GH) on the synthesis of mucopolysaccharide by ceratobranchial cartilages of the Japanese eel, Anguilla japonica, were examined by monitoring the in vitro uptake of ({sup 35}S)sulfate. The ({sup 35}S)sulfate uptake decreased rapidly to one-third of the initial level during the first 3 days after hypophysectomy, and decreased gradually thereafter. When hypophysectomized eels were injected intramuscularly with recombinant eel GH (2 micrograms/g), the plasma GH concentrations increased maximally after 6 hr, and declined rapidly thereafter. On the other hand, the sulfate uptake increased significantly after 12 hr, and high levels were maintained until 48 hr. The stimulating effect of GH was dose dependent (0.02-2 micrograms/g). However, the addition of eel GH (0.05-5 micrograms/ml) to the culture medium did not affect the sulfate uptake by hypophysectomized eel cartilages, suggesting that the stimulative action of GH on the sulfate uptake by the cartilages is indirect.

  17. Synthesis and microwave absorption property of graphene oxide/carbon nanotubes modified with cauliflower-like Fe3O4 nanospheres

    NASA Astrophysics Data System (ADS)

    Yan, Shaojiu; Wang, Lina; Wang, Tihong; Zhang, Liqiang; Li, Yongfeng; Dai, Shenglong

    2016-03-01

    We report a simple procedure to fabricate graphene oxide/carbon nanotube hybrids coated with cauliflower-like Fe3O4 sphere. Characterizations have been carried out to investigate the morphology, crystalline structure of the composites by scanning electron microscopy, transmission electron microscopy and X-ray diffraction. Fe3O4 particles have the morphologies of multi-lacuna; moreover, some spheres are hollow. As a kind of potential microwave absorption material, the composites are lightweight and exhibit excellent microwave absorbing ability in the range of 2-16 GHz.

  18. First report of blueberry mosaic disease caused by blueberry mosaic associated virus in Kentucky

    Technology Transfer Automated Retrieval System (TEKTRAN)

    In 2011, a grower in Casey County Kentucky observed persistent yellow, green, and red mosaic patterns on leaves of highbush blueberry plants. Twenty-three randomly-scattered ‘Bluecrop’ plants out of approximately 1,400 5-year-old plants showed symptoms, with coverage ranging from 5% to 100%. Asympto...

  19. First report of Sorghum mosaic virus causing mosaic in Miscanthus sinesis

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Miscanthus is being evaluated as a bioenergy feedstock because of its potentially significant biomass production, perennial habit, and lack of major diseases and pests. It is also a valuable parent in the sugarcane breeding program as source of cold tolerance. Mosaic symptoms were observed on a clo...

  20. High-Resolution South Polar Cap Mosaics

    NASA Technical Reports Server (NTRS)

    2000-01-01

    The layered terrains of the polar regions of Mars are among the most exotic planetary landscapes in our Solar System. The layers exposed in the south polar residual cap, vividly shown in the top view, are thought to contain detailed records of Mars' climate history over the last 100 million years or so. The materials that comprise the south polar layers may include frozen carbon dioxide, water ice, and fine dust. The bottom picture shows complex erosional patterns that have developed on the south polar cap, perhaps by a combination of sublimation, wind erosion, and ground-collapse. Because the south polar terrains are so strange and new to human eyes, no one (yet) has entirely adequate explanations as to what is being seen.

    These images were acquired by the Mars Orbiter Camera aboard the Mars Global Surveyor spacecraft during the southern spring season in October 1999. Each of these two pictures is a mosaic of many individual MOC images acquired at about 12 m/pixel scale that completely cover the highest latitude (87oS) visible to MOC on each orbital pass over the polar region. Both mosaics cover areas of about 10 x 4 kilometers (6.2 x 2.5 miles) near 87oS, 10oW in the central region of the permanent--or residual--south polar cap. They show features at the scale of a small house. Sunlight illuminates each scene from the left.'Gaps' at the upper and lower right of the second mosaic, above, are areas that were not covered by MOC in October 1999.

  1. The Landsat Image Mosaic of Antarctica

    NASA Astrophysics Data System (ADS)

    Bindschadler, R.; Vornberger, P.; Fleming, A.; Fox, A.; Morin, P.

    2008-12-01

    The first-ever true-color, high-resolution digital mosaic of Antarctica has been produced from nearly 1100 Landsat-7 ETM+ images collected between 1999 and 2003. The Landsat Image Mosaic of Antarctica (LIMA) project was an early benchmark data set of the International Polar Year and represents a close and successful collaboration between NASA, USGS, the British Antarctic Survey and the National Science Foundation. The mosaic was successfully merged with lower resolution MODIS data south of Landsat coverage to produce a complete true-color data set of the entire continent. LIMA is being used as a platform for a variety of education and outreach activities. Central to this effort is the NASA website 'Faces of Antarctica' that offers the web visitor the opportunity to explore the data set and to learn how these data are used to support scientific research. Content is delivered through a set of mysteries designed to pique the user's interest and to motivate them to delve deeper into the website where there are various videos and scientific articles for downloading. Detailed lesson plans written by teachers are provided for classroom use and Java applets let the user track the motion of ice in sequential Landsat images. Web links take the user to other sites where they can roam over the imagery using standard pan and zoom functions, or search for any named feature in the Antarctic Geographic Names data base that returns to the user a centered true-color view of any named feature. LIMA also has appeared is a host of external presentations from museum exhibits, to postcards and large posters. It has attracted various value-added providers that increase LIMA's accessibility by allowing users to specify subsets of the very large data set for individual downloads. The ultimate goal of LIMA in the public and educational sector is to enable everyone to become more familiar with Antarctica.

  2. Germline mosaicism at the fragile X locus

    SciTech Connect

    Papp, A.C.; Snyder, P.J.; Sedra, M.S.

    1994-09-01

    The fragile X full mutation, which is associated with the phenotypic expression of the disorder, is characterized by an expansion of CGG repeat and hypermethylation of the CpG island adjacent to the FMR1 gene. New mutations leading to amplification of the CGG repeat have not been reported. We have identified a fragile X syndrome pedigree where the disorder is associated with a molecular deletion. The deletion was present in the DNA of two affected sons but was absent in the mother`s somatic cell (lymphocyte) DNA. This was confirmed by dosage analysis of the Southern blot using StB12-3 and an additional probe against the dystrophin gene and by PCR analysis of DXS548 alleles. The results are consistent with the deletion arising as a postzygotic event in the mother, who therefore is germinally mosaic. The case reported here clearly demonstrates that FMR1 deletions, unlike the expansions, are not always inherited and the finding of heterozygosity or normal dosage from lymphocyte DNA in the mother of a deletion case does not necessarily rule out the possibility of having a second affected child. The deletion of FMR1 gene may be responsible for a small but significant number of fragile X cases. Therefore, it is imperative that those involved in genetic counseling recognize this diagnostic pitfall. Since it depends upon the size of the mutant clone in the mosaic mother, the exact recurrence risk in germline carriers is unknown. However, prenatal and carrier testing should be performed independently of the outcome of the mother. Furthermore, it is possible that the deletion may not be restricted to the germline, and therefore the mother may actually be a somatic mosaic.

  3. Immunochromatographic purification of Bean Yellow Mosaic Virus.

    PubMed

    Bujarski, J J; Wiatroszak, I

    1981-01-01

    The method of immunoadsorptional purification of Bean Yellow Mosaic Virus has been worked out. Immunosorbents were obtained by coupling the antibody (IgG) fraction isolated from anti-BYMV and anti-pea leaf protein antisera with CNBr-activated 1% agarose beads. Conditions for preparation of immunosorbents, for BYMV adsorption and elution as well as the method of plant protein separation from BYMV were pointed out. The purity of BYMV was checked by double immunodiffusion as well as by SDS-acrylamide gel electrophoresis. Also biological activity was determined. TMV was used as the model virus for further BYMV studies. PMID:7025790

  4. Goldenhar sequence and mosaic trisomy 22

    SciTech Connect

    Pridjian, G.; Gill, W.L.; Shapira, E.

    1995-12-04

    We describe a term infant with facio-auriculo-vertebral {open_quotes}dysplasia{close_quotes} (Goldenhar sequence), hypertelorism, and mosaic trisomy 22: peripheral blood, 46, XY/47, XY,+22 (72%/28%); skin fibroblasts, 47, XY,+22(100%). This is the second report of Goldenbar anomaly with epibulbar dermoids in a live-born infant with aneuploidy. Hypertelorism is rare in Goldenhar sequence, but typical of trisomy 22. We recommend chromosome analysis in all patients with Goldenhar sequence. Those with hypertelorism may be more likely to have aneuploidy as well. 19 refs., 3 figs.

  5. Thermographic mosaic of Yellowstone National Park

    NASA Technical Reports Server (NTRS)

    Williams, R. S., Jr.; Hasell, P. G., Jr.; Sellman, A. N.; Smedes, H. W.

    1976-01-01

    An uncontrolled aerial thermographic mosaic of Yellowstone National Park was assembled from the videotape record of 13 individual thermographs obtained with linescan radiometers. Post mission processing of the videotape record rectified the nadir line to a topographic map base, corrected for v/h variations in adjacent flight lanes, corrected for yaw and pitch distortions, and distortions produced by nonlinearity of the side-wise scan. One of the purposes of the thermographic study was to delineate the areas of thermal emission (hot springs, geysers, etc.) throughout the Park, a study which could have great value in reconnaissance surveys of geothermal areas in remote regions or regions of high relief.

  6. First Report of Pepino Mosaic Virus Infecting Tomato in Mexico

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Pepino mosaic has become endemic greenhouse tomato disease in many countries around the world. Its occurrence in Mexico has yet to be determined. In early spring of 2010, symptoms of yellow mosaic, chlorotic patches and fruit marbling were observed in approximately 50% of tomato plants in a commerc...

  7. Global Digital Image Mosaics of Mars: Assessment of Geodetic Accuracy

    NASA Technical Reports Server (NTRS)

    Kirk, R.; Archinal, B. A.; Lee, E. M.; Davies, M. E.; Colvin, T. R.; Duxbury, T. C.

    2001-01-01

    A revised global image mosaic of Mars (MDIM 2.0) was recently completed by USGS. Comparison with high-resolution gridded Mars Orbiter Laser Altimeter (MOLA) digital image mosaics will allow us to quantify its geodetic errors; linking the next MDIM to the MOLA data will help eliminate those errors. Additional information is contained in the original extended abstract.

  8. Sex mosaics in a male dimorphic ant Cardiocondyla kagutsuchi

    NASA Astrophysics Data System (ADS)

    Yoshizawa, Juri; Mimori, Kohei; Yamauchi, Katsusuke; Tsuchida, Koji

    2009-01-01

    Gynandromorphy, or the development of organisms with a combination of male and female morphological features, is common in Hymenoptera. The underlying mechanism is likely associated with the sex-determination system, and studying this phenomenon should lead to a deeper understanding of both embryonic development and sex determination. The reproductive capabilities of gynandromorphs (hereafter, sex mosaics) remain unclear. We studied gynandromorphy in the Malaysian ant Cardiocondyla kagutsuchi, which has sex mosaics of queens (gynandromorphs; mosaic of queens and winged male) and workers (ergatandromorphs; mosaic of worker and wingless ergatoid male). These sex mosaics were classified into seven morphological categories. Most individuals had more male than female body areas. Behavioral observations revealed that sex mosaics behave more in accordance with the “sex” of their brain than that of the reproductive organs (gaster). Relative DNA quantities showed that both female and male regions contained haploid and diploid nuclei, irrespective of their phenotypic appearance, indicating that external appearance did not reflect internal tissues. Nearly one third of the adults were sex mosaics and they were not infected with Wolbachia. Our results suggest that the production of sex mosaics in this species does not pose a substantial cost to colonies and that the underlying causes are therefore not strongly selected against.

  9. An Experimental Host Range of Triticum Mosaic Virus

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Triticum mosaic virus (TriMV) is a newly discovered virus isolated from wheat. This study was conducted to determine an experimental host range for TriMV and identify species that could serve as differential hosts for isolating TriMV from Wheat streak mosaic virus (WSMV). Plants tested were mechan...

  10. New Viruses Identified in Fig Trees Exhibiting Fig Mosaic Disease

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Fig mosaic disease has been known for decades, but the causal agent has been elusive. Here we present data on the incidence of at least four new viruses isolated from fig trees exhibiting mosaic symptoms. One of the viruses is closely related to the recently identified European mountain ash ringspo...

  11. Facile synthesis of nano cauliflower and nano broccoli like hierarchical superhydrophobic composite coating using PVDF/carbon soot particles via gelation technique.

    PubMed

    Sahoo, Bichitra Nanda; Balasubramanian, Kandasubramanian

    2014-12-15

    We have elucidated a cost effective fabrication technique to produce superhydrophobic polyvinylidene fluoride (PVDF/DMF/candle soot particle and PVDF/DMF/camphor soot particle composite) porous materials. The water repellent dry composite was formed by the interaction of non-solvent (methanol) into PVDF/carbon soot particles suspension in N,N-dimethylformamide (DMF). It is seen that longer quenching time effectively changes the surface morphology of dry composites. The nano broccoli like hierarchical microstructure with micro or nano scaled roughen surface was obtained for PVDF/DMF/camphor soot particle, which reveals water contact angle of 172° with roll off angle of 2°. However, composite coating of PVDF/DMF/candle soot particle shows nano cauliflower like hierarchical, which illustrates water contact angle of 169° with roll off angle of 3°. To elucidate the enhancement of water repellent property of PVDF composites, we further divulge the evolution mechanism of nano cauliflower and nano broccoli structure. In order to evaluate the water contact angle of PVDF composites, surface diffusion of water inside the pores is investigated. Furthermore, the addition of small amount of carbon soot particles in composite not only provides the crystallization of PVDF, but also leads to dramatical amendment of surface morphology which increases the surface texture and roughness for superhydrophobicity. PMID:25268814

  12. The Cauliflower Or Gene Encodes a DnaJ Cysteine-Rich Domain-Containing Protein That Mediates High Levels of β-Carotene Accumulation[W

    PubMed Central

    Lu, Shan; Van Eck, Joyce; Zhou, Xiangjun; Lopez, Alex B.; O'Halloran, Diana M.; Cosman, Kelly M.; Conlin, Brian J.; Paolillo, Dominick J.; Garvin, David F.; Vrebalov, Julia; Kochian, Leon V.; Küpper, Hendrik; Earle, Elizabeth D.; Cao, Jun; Li, Li

    2006-01-01

    Despite recent progress in our understanding of carotenogenesis in plants, the mechanisms that govern overall carotenoid accumulation remain largely unknown. The Orange (Or) gene mutation in cauliflower (Brassica oleracea var botrytis) confers the accumulation of high levels of β-carotene in various tissues normally devoid of carotenoids. Using positional cloning, we isolated the gene representing Or and verified it by functional complementation in wild-type cauliflower. Or encodes a plastid-associated protein containing a DnaJ Cys-rich domain. The Or gene mutation is due to the insertion of a long terminal repeat retrotransposon in the Or allele. Or appears to be plant specific and is highly conserved among divergent plant species. Analyses of the gene, the gene product, and the cytological effects of the Or transgene suggest that the functional role of Or is associated with a cellular process that triggers the differentiation of proplastids or other noncolored plastids into chromoplasts for carotenoid accumulation. Moreover, we demonstrate that Or can be used as a novel genetic tool to induce carotenoid accumulation in a major staple food crop. We show here that controlling the formation of chromoplasts is an important mechanism by which carotenoid accumulation is regulated in plants. PMID:17172359

  13. Gene VI of figwort mosaic virus (caulimovirus group) functions in posttranscriptional expression of genes on the full-length RNA transcript.

    PubMed

    Gowda, S; Wu, F C; Scholthof, H B; Shepherd, R J

    1989-12-01

    Experimental evidence for a molecular function for gene VI of the caulimoviruses is presented. Based on experiments with the figwort mosaic virus (FMV), it appears that gene VI has a role in the posttranscriptional expression of the closely packed genes (VII and I-V), which appear on the larger, full-length RNA transcript of this virus. Gene VI with its flanking 5'/3' expression signals included as a separate plasmid during electroporation of DNA into protoplasts of Nicotiana edwardsonii shows an unusual type of transactivation of a chloramphenicol acetyltransferase (CAT) gene fused at its 5' end to a small open reading frame (gene VII) of the long 5' leader of the full-length RNA transcript of the FMV genome. The level of activity of the CAT gene is increased up to 20-fold over the activity of control plasmids when gene VI is included in the electroporation mixture. Mutagenesis of the coding portions of gene VI of pGS1 RVI, a transactivating plasmid used in the electroporation experiments, demonstrated that it was probably the polypeptide product of gene VI that was responsible for the transactivating effect. Experiments with various portions of the 5' leader of the large, full-length RNA of FMV showed that the coding region of gene VII is necessary for the transactivation event. Clones of cauliflower mosaic virus (CaMV) or FMV with intact gene VI were found to reciprocally transactivate gene VII-CAT fusions (FMV) or gene I-CAT fusions (CaMV) located downstream of the 5' leader sequences of either viral genome. PMID:2594762

  14. Barley stripe mosaic virus: Structure and relationship to the tobamoviruses

    SciTech Connect

    Kendall, Amy; Williams, Dewight; Bian, Wen; Stewart, Phoebe L.; Stubbs, Gerald

    2013-09-01

    Barley stripe mosaic virus (BSMV) is the type member of the genus Hordeivirus, rigid, rod-shaped viruses in the family Virgaviridae. We have used fiber diffraction and cryo-electron microscopy to determine the helical symmetry of BSMV to be 23.2 subunits per turn of the viral helix, and to obtain a low-resolution model of the virus by helical reconstruction methods. Features in the model support a structural relationship between the coat proteins of the hordeiviruses and the tobamoviruses. - Highlights: • We report a low-resolution structure of barley stripe mosaic virus. • Barley stripe mosaic virus has 23.2 subunits per turn of the viral helix. • We compare barley stripe mosaic virus with tobacco mosaic virus.

  15. A Spontaneous Dominant-Negative Mutation within a 35S::AtMYB90 Transgene Inhibits Flower Pigment Production in Tobacco

    PubMed Central

    Velten, Jeff; Cakir, Cahid; Cazzonelli, Christopher I.

    2010-01-01

    Background In part due to the ease of visual detection of phenotypic changes, anthocyanin pigment production has long been the target of genetic and molecular research in plants. Specific members of the large family of plant myb transcription factors have been found to play critical roles in regulating expression of anthocyanin biosynthetic genes and these genes continue to serve as important tools in dissecting the molecular mechanisms of plant gene regulation. Findings A spontaneous mutation within the coding region of an Arabidopsis 35S::AtMYB90 transgene converted the activator of plant-wide anthocyanin production to a dominant-negative allele (PG-1) that inhibits normal pigment production within tobacco petals. Sequence analysis identified a single base change that created a premature nonsense codon, truncating the encoded myb protein. The resulting mutant protein lacks 78 amino acids from the wild type C-terminus and was confirmed as the source of the white-flower phenotype. A putative tobacco homolog of AtMYB90 (NtAN2) was isolated and found to be expressed in flower petals but not leaves of all tobacco plants tested. Using transgenic tobacco constitutively expressing the NtAN2 gene confirmed the NtAN2 protein as the likely target of PG-1-based inhibition of tobacco pigment production. Conclusions Messenger RNA and anthocyanin analysis of PG-1Sh transgenic lines (and PG-1Sh x purple 35S::NtAN2 seedlings) support a model in which the mutant myb transgene product acts as a competitive inhibitor of the native tobacco NtAN2 protein. This finding is important to researchers in the field of plant transcription factor analysis, representing a potential outcome for experiments analyzing in vivo protein function in test transgenic systems that over-express or mutate plant transcription factors. PMID:20360951

  16. Forest bird demography in a landscape mosaic

    SciTech Connect

    Urban, D.L.; Shugart, H.H. Jr.; DeAngelis, D.L.; O'Neill, R.V.

    1988-07-01

    A tandem approach of field studies and simulation modeling was used to examine avian demography in a landscape mosaic of habitat patches. A particular goal was to attempt to account for the regional decline in abundance of a subset of bird species sensitive to forest fragmentation. Species abundance patterns in forest patches were framed as the consequence of individual birds' demographics, constrained by their landscape context; this context was partitioned to emphasize habitat availability (or area), accessibility (or isolation), and localized factors affecting reproductive success (nest predation and brood parasitism). Each of these constraints was examined in turn, to assess their relative contribution to species abundance patterns observed in landscape mosaics. A forest simulation model was used to develop a theoretical basis for the importance of microhabitat pattern in forest bird communities. Simulated patterns in microhabitat availability could provide for successional trends in bird species diversity, a relation between niche position and species abundance, the occurrence of more rare species than common ones, and a species/area effect. Hypotheses about microhabitat variety and bird species distribution in landscapes were not supported by data from woodlots in Cadiz Township, southern Wisconsin. 39 refs., 41 figs., 10 tabs.

  17. Mosaic Neurofibromatosis Type 1: A Systematic Review.

    PubMed

    García-Romero, Maria Teresa; Parkin, Patricia; Lara-Corrales, Irene

    2016-01-01

    Confusion is widespread regarding segmental or mosaic neurofibromatosis type 1 (MNF1). Physicians should use the same terms and be aware of its comorbidities and risks. The objective of the current study was to identify and synthesize data for cases of MNF1 published from 1977 to 2012 to better understand its significance and associations. After a literature search in PubMed, we reviewed all available relevant articles and abstracted and synthetized the relevant clinical data about manifestations, associated findings, family history and genetic testing. We identified 111 articles reporting 320 individuals. Most had pigmentary changes or neurofibromas only. Individuals with pigmentary changes alone were identified at a younger age. Seventy-six percent had localized MNF1 restricted to one segment; the remainder had generalized MNF1. Of 157 case reports, 29% had complications associated with NF1. In one large case series, 6.5% had offspring with complete NF1. The terms "segmental" and "type V" neurofibromatosis should be abandoned, and the correct term, mosaic NF1 (MNF1), should be used. All individuals with suspected MNF1 should have a complete physical examination, genetic testing of blood and skin, counseling, and health surveillance. PMID:26338194

  18. Quantification of yield loss caused by Triticum mosaic virus and Wheat streak mosaic virus in winter wheat under field conditions

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Triticum mosaic virus (TriMV) and Wheat streak mosaic virus (WSMV) infect winter wheat in the Great Plains region of the United States. The two viruses are transmitted by wheat curl mites, which also transmit High Plains virus. In a field study conducted in 2011 and 2012, winter wheat cultivars Mi...

  19. Resistance to wheat streak mosaic virus and Triticum mosaic virus in wheat lines carrying Wsm1 and Wsm3

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Wheat streak mosaic virus (WSMV) and Triticum mosaic virus (TriMV) are important viruses of wheat (Triticum aestivum L.) in the Great Plains of United States. In addition to agronomic practices to prevent damage from these viruses, temperature sensitive resistance genes Wsm1, Wsm2 and Wsm3, have bee...

  20. Attempts to Improve the Method of Screening Cowpea Germplasm for Resistance to Cucumber Mosaic Virus and Blackeye Cowpea Mosaic Virus

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Use of visual symptom screening for cowpea plants in field plots improved screening for Blackeye Cowpea Mosaic Virus (BICMV)-resistance. However, the method failed to improve the speed or accuracy of screening for Cucumber Mosaic Virus (CMV)-resistance. Plants that displayed few visual virus sympt...

  1. Transcriptional silencing induced by Arabidopsis T-DNA mutants is associated with 35S promoter siRNAs and requires genes involved in siRNA-mediated chromatin silencing.

    PubMed

    Mlotshwa, Sizolwenkosi; Pruss, Gail J; Gao, Zhihuan; Mgutshini, Nomathamsanqa L; Li, Junjie; Chen, Xuemei; Bowman, Lewis H; Vance, Vicki

    2010-11-01

    The utility of many T-DNA insertion mutant lines of Arabidopsis is compromised by their propensity to trigger transcriptional silencing of transgenes expressed from the CaMV 35S promoter. To try to circumvent this problem, we characterized the genetic requirements for maintenance of 35S promoter homology-dependent transcriptional gene silencing induced by the dcl3-1 (SALK_005512) T-DNA insertion mutant line. Surprisingly, even though DCL3 and RDR2 are known components of the siRNA-dependent transcriptional gene silencing pathway, transcriptional gene silencing of a 35S promoter-driven GUS hairpin transgene did occur in plants homozygous for the dcl3-1 T-DNA insertion and was unaffected by loss of function of RDR2. However, the transcriptional gene silencing was alleviated in dcl2 dcl3 dcl4 triple mutant plants and also by mutations in AGO4, NRPD2, HEN1 and MOM1. Thus, some T-DNA insertion mutant lines induce 35S promoter homology-dependent transcriptional silencing that requires neither DCL3 nor RDR2, but involves other genes known to function in siRNA-dependent transcriptional silencing. Consistent with these results, we detected 35S promoter siRNAs in dcl3-1 SALK line plants, suggesting that the 35S promoter homology-dependent silencing induced by some T-DNA insertion mutant lines is siRNA-mediated. PMID:21070421

  2. Preparation of titania nanotube-Cd0.65Zn0.35S nanocomposite by a hydrothermal sulfuration method for efficient visible-light-driven photocatalytic hydrogen production

    NASA Astrophysics Data System (ADS)

    Li, Juan; Wu, Liangpeng; Long, Lizhen; Xi, Min; Li, Xinjun

    2014-12-01

    Titania nanotube-Cd0.65Zn0.35S nanocomposite (Cd0.65Zn0.35S-TiO2) was synthesized from titanate nanotubes for ion change of Cd2+ and Zn2+ followed by hydrothermal sulfuration treatment using thiourea as sulfur source. The Cd0.65Zn0.35S-TiO2 with enhanced crystallinity of TiO2 nanotube can be obtained by increasing hydrothermal temperature from 90 °C to 120 °C. And further increasing hydrothermal temperature to 150 °C, TiO2 nanotubes collapse and transform into irregular shaped particles. The photocatalytic activity for hydrogen production of the prepared Cd0.65Zn0.35S-TiO2 with different hydrothermal temperature was investigated under visible-light irradiation. The result shows that the Cd0.65Zn0.35S-TiO2 with hydrothermal temperature of 120 °C presents the highest hydrogen evolution rate and photostability, which can be attributed to a rapid charge transfer at the interface between Cd0.65Zn0.35S and TiO2 nanotube due to the increased crystallinity and unique 1-D nanotubular structure of TiO2.

  3. Detection of Corchorus golden mosaic virus Associated with Yellow Mosaic Disease of Jute (Corchorus capsularis).

    PubMed

    Ghosh, Raju; Palit, Paramita; Paul, Sujay; Ghosh, Subrata Kumar; Roy, Anirban

    2012-06-01

    Yellow mosaic disease, caused by a whitefly transmitted New World Begomovirus, named Corchorus golden mosaic virus (CoGMV), is emerging as a serious biotic constraint for jute fibre production in Asia. For rapid and sensitive diagnosis of the Begomovirus associated with this disease, a non-radiolabelled diagnostic probe, developed against the DNA A component of the east Indian isolate of CoGMV, detected the presence of the virus in infected plants and viruliferous whiteflies following Southern hybridization and nucleic acid spot hybridization tests. Presence of the virus was also confirmed when polymerase chain reaction amplification was performed using virus-specific primers on DNA templates isolated from infected plants and viruliferous whiteflies. PMID:23730007

  4. Custom Sky-Image Mosaics from NASA's Information Power Grid

    NASA Technical Reports Server (NTRS)

    Jacob, Joseph; Collier, James; Craymer, Loring; Curkendall, David

    2005-01-01

    yourSkyG is the second generation of the software described in yourSky: Custom Sky-Image Mosaics via the Internet (NPO-30556), NASA Tech Briefs, Vol. 27, No. 6 (June 2003), page 45. Like its predecessor, yourSkyG supplies custom astronomical image mosaics of sky regions specified by requesters using client computers connected to the Internet. Whereas yourSky constructs mosaics on a local multiprocessor system, yourSkyG performs the computations on NASA s Information Power Grid (IPG), which is capable of performing much larger mosaicking tasks. (The IPG is high-performance computation and data grid that integrates geographically distributed 18 NASA Tech Briefs, September 2005 computers, databases, and instruments.) A user of yourSkyG can specify parameters describing a mosaic to be constructed. yourSkyG then constructs the mosaic on the IPG and makes it available for downloading by the user. The complexities of determining which input images are required to construct a mosaic, retrieving the required input images from remote sky-survey archives, uploading the images to the computers on the IPG, performing the computations remotely on the Grid, and downloading the resulting mosaic from the Grid are all transparent to the user

  5. The eMOSAIC model for humanoid robot control.

    PubMed

    Sugimoto, Norikazu; Morimoto, Jun; Hyon, Sang-Ho; Kawato, Mitsuo

    2012-05-01

    In this study, we propose an extension of the MOSAIC architecture to control real humanoid robots. MOSAIC was originally proposed by neuroscientists to understand the human ability of adaptive control. The modular architecture of the MOSAIC model can be useful for solving nonlinear and non-stationary control problems. Both humans and humanoid robots have nonlinear body dynamics and many degrees of freedom. Since they can interact with environments (e.g., carrying objects), control strategies need to deal with non-stationary dynamics. Therefore, MOSAIC has strong potential as a human motor-control model and a control framework for humanoid robots. Yet application of the MOSAIC model has been limited to simple simulated dynamics since it is susceptive to observation noise and also cannot be applied to partially observable systems. Our approach introduces state estimators into MOSAIC architecture to cope with real environments. By using an extended MOSAIC model, we are able to successfully generate squatting and object-carrying behaviors on a real humanoid robot. PMID:22366503

  6. Parallel-Processing Software for Creating Mosaic Images

    NASA Technical Reports Server (NTRS)

    Klimeck, Gerhard; Deen, Robert; McCauley, Michael; DeJong, Eric

    2008-01-01

    A computer program implements parallel processing for nearly real-time creation of panoramic mosaics of images of terrain acquired by video cameras on an exploratory robotic vehicle (e.g., a Mars rover). Because the original images are typically acquired at various camera positions and orientations, it is necessary to warp the images into the reference frame of the mosaic before stitching them together to create the mosaic. [Also see "Parallel-Processing Software for Correlating Stereo Images," Software Supplement to NASA Tech Briefs, Vol. 31, No. 9 (September 2007) page 26.] The warping algorithm in this computer program reflects the considerations that (1) for every pixel in the desired final mosaic, a good corresponding point must be found in one or more of the original images and (2) for this purpose, one needs a good mathematical model of the cameras and a good correlation of individual pixels with respect to their positions in three dimensions. The desired mosaic is divided into slices, each of which is assigned to one of a number of central processing units (CPUs) operating simultaneously. The results from the CPUs are gathered and placed into the final mosaic. The time taken to create the mosaic depends upon the number of CPUs, the speed of each CPU, and whether a local or a remote data-staging mechanism is used.

  7. Two-image mosaic of Saturn's rings

    NASA Technical Reports Server (NTRS)

    1980-01-01

    This computer-assembled two-image mosaic of Saturn's rings, taken by NASA's Voyager 1 on Nov. 6, 1980 at a range of 8 million kilometers (5 million miles), shows approximately 95 individual concentric features in the rings. The extraordinarily complex structure of the rings is easily seen across the entire span of the ring system. The ring structure, once thought to be produced by the gravitational interaction between Saturn's satellites and the orbit of ring particles, has now been found to be too complex for this explanation alone. The 14th satellite of Saturn, discovered by Voyager 1, is seen (upper left) just inside the narrow F-ring, which is less than 150 kilometers (93 miles wide). The Voyager Project is managed for NASA by the Jet Propulsion Laboratory, Pasadena, Calif.

  8. Calibration and Mosaicing of SMART-1 Images

    NASA Astrophysics Data System (ADS)

    Fonseca, J. M.; Grieger, B.; Mora, A.; Almeida, M.; Costa, M.; Antunes, L.; Fernandes, V. A.

    2012-09-01

    Since mid 2010 the scientific community has access to the data collected by SMART-1 mission that orbited the Moon between 2004 and 2006. The onboard camera (AMIE) collected during that period images with the then state-of-the-art resolution and coverage of the lunar surface. The scientific interest of SMART-1 images is historical, as the data offers a snapshot of the lunar surface during the mission period, allowing comparative studies of the lunar surface. Our aim in this work is to build the atlas of the Moon as SMART-1 captured it. During the Earth escape phase, the AMIE CCD was damaged by radiation, invalidating the laboratorial flat field correction algorithm. A new image calibration procedure was developed based on the in-flight images and on theoretical models. This was followed by a mosaicing technique applied to all the 31947 collected images , to select, compensate geometrical distortions and compose a total of 88 maps of the lunar surface.

  9. Think about it: FMR1 gene mosaicism.

    PubMed

    Bonarrigo, Francesca Andrea; Russo, Silvia; Vizziello, Paola; Menni, Francesca; Cogliati, Francesca; Giorgini, Valentina; Monti, Federico; Milani, Donatella

    2014-09-01

    Fragile X syndrome (FXS) is one of the most frequent causes of mental retardation, intellectual disability, and autism. Most cases are the result of an expansion of the CGG trinucleotide repeat in the 5' untranslated region of the FMR1 gene and the subsequent functional loss of the related protein. We describe the case of a 4-year-old boy who clinically presents mild psychomotor delay without any major clinical dysmorphisms. Molecular analysis of the FMR1 gene showed mosaicism in terms of size and methylation, with one normal and 1 fully mutated allele, which is very rare in this syndrome. Physicians should therefore consider a diagnosis of FXS even if the patient's phenotype is mild. Although rare, diagnosing this condition has important consequences for the patient's rehabilitation and the family planning of parents and relatives. PMID:24065579

  10. Methods of Spectral Analysis in C++ (MOSAIC)

    NASA Astrophysics Data System (ADS)

    Engesser, Michael

    2016-06-01

    Stellar spectroscopic classification is most often still done by hand. MOSAIC is a project focused on the collection and classification of astronomical spectra using a computerized algorithm. The code itself attempts to accurately classify stellar spectra according to the broad spectral classes within the Morgan-Keenan system of spectral classification, based on estimated temperature and the relative abundances of certain notable elements (Hydrogen, Helium, etc.) in the stellar atmosphere. The methodology includes calibrating the wavelength for pixels across the image by using the wavelength dispersion of pixels inherent with the spectrograph used. It then calculates the location of the peak in the star's Planck spectrum in order to roughly classify the star. Fitting the graph to a blackbody curve is the final step for a correct classification. Future work will involve taking a closer look at emission lines and luminosity classes.

  11. Uruk Sulcus Mosaic - Galileo over Voyager Data

    NASA Technical Reports Server (NTRS)

    1996-01-01

    A mosaic of four Galileo images of the Uruk Sulcus region on Ganymede (Latitude 11 N, Longitude: 170 W) is shown overlayed on the data obtained by the Voyager 2 spacecraft in 1979. North is to the top of the picture, and the sun illuminates the surface from the lower left, nearly overhead. The area shown is about 120 by 110 kilometers (75 by 68 miles) in extent and the smallest features that can be discerned are 74 meters (243 feet) in size in the Galileo images and 1.3 kilometers (0.8 miles) in the Voyager data. The higher resolution Galileo images unveil the details of parallel ridges and troughs that are principal features in the brighter regions of Ganymede. High photometric activity (large light contrast at high spatial frequencies) of this ice-rich surface was such that the Galileo camera's hardware data compressor was pushed into truncating lines. The north-south running gap between the left and right halves of the mosaic is a result of line truncation from the normal 800 samples per line to about 540. The images were taken on 27 June, 1996 Universal Time at a range of 7,448 kilometers (4,628 miles) through the clear filter of the Galileo spacecraft's imaging system.

    Launched in October 1989, Galileo entered orbit around Jupiter on December 7, 1995. The spacecraft's mission is to conduct detailed studies of the giant planet, its largest moons and the Jovian magnetic environment. The Jet Propulsion Laboratory, Pasadena, CA manages the mission for NASA's Office of Space Science, Washington, DC.

    This image and other images and data received from Galileo are posted on the World Wide Web, on the Galileo mission home page at URL http://galileo.jpl.nasa.gov. Background information and educational context for the images can be found at URL http://www.jpl.nasa.gov/galileo/sepo

  12. Comparison of barley stripe mosaic virus strains.

    PubMed

    Hafez, Elsayed E; Abdel Aleem, Engy E; Fattouh, Faiza A

    2008-01-01

    BSMV (barley stripe mosaic virus) particles were obtained in a pure state from infected host plant tissues of Hordeum vulgare. The three genomic parities (alpha, beta and gamma) were amplified by PCR using specific primers for each particle; each was cloned. Partial sequence of the alpha, beta and gamma segments was determined for the Egyptian isolate of barley stripe mosaic virus (BSMV AE1). Alignment of nucleotide sequences with that of other known strains of the virus, BSMV type strains (CV17, ND18 and China), and the generation of phylogenetic trees was performed. A low level of homology was detected comparing 467 bp of the a and 643 bp of the segments to that of the other strains, and thus BSMV alpha and beta segments were in separate clusters. However, 1154 bp of the gamma segments of BSMV AE1 showed a high level of homology especially to strain BSMV ND18, as they both formed a distinct cluster. Northern blotting of pure BSMV AE1 virus and H. vulgare-infected tissue were compared using an alpha ND18 specific probe. Western blotting using antibodies specific for the coat protein (CP) and the triple gene block 1 (TGB1) protein, which are both encoded by the beta ND18 segment, still indicated a high level of similarity between proteins produced by BSMV ND18 and AE1. We suggest that the BSMV AE1 isolate is a distinct strain of BSMV which reflects the genetic evolutionary divergence among BSMV strains and members of the Hordeivirus group. PMID:18533473

  13. A 2014 nationwide survey of the distribution of Soybean mosaic virus (SMV), Soybean yellow mottle mosaic virus (SYMMV) and Soybean yellow common mosaic virus (SYCMV) major viruses in South Korean soybean fields, and changes..

    Technology Transfer Automated Retrieval System (TEKTRAN)

    In 2014 symptomatic soybean samples were collected throughout Korea, and were tested for the most important soybean viruses found in Korea, namely Soybean mosaic virus (SMV), Soybean yellow common mosaic virus (SYCMV), and Soybean yellow mottle mosaic virus (SYMMV). SYMMV was most commonly detected,...

  14. A 2014 nationwide survey of the distribution of Soybean mosaic virus (SMV), Soybean yellow mottle mosaic virus (SYMMV) and Soybean yellow common mosaic virus (SYCMV) major viruses in South Korean soybean fields, and changes

    Technology Transfer Automated Retrieval System (TEKTRAN)

    In 2014 symptomatic soybean samples were collected throughout Korea, and were tested for the most important soybean viruses found in Korea, namely Soybean mosaic virus (SMV), Soybean yellow common mosaic virus (SYCMV), and Soybean yellow mottle mosaic virus (SYMMV). SYMMV was most commonly detected,...

  15. Synthesis of proteins from ( sup 35 S)methionine by guinea pig megakaryocytes in vivo and time course of appearance of newly synthesized proteins in platelets

    SciTech Connect

    Schick, B.P. )

    1990-09-01

    The relationship of protein synthesis to megakaryocyte maturation has been studied in guinea pigs in vivo. Guinea pigs were injected with a single dose of ({sup 35}S)methionine. Megakaryocytes and platelets were isolated daily for 4 days, and proteins from both cells were isolated by DEAE-Sephacel chromatography and analyzed by sodium dodecyl sulfate-polyacrylamide gel electrophoresis (SDS-PAGE) and fluorography. All proteins in megakaryocytes corresponding to stained bands on the SDS-PAGE gels were radiolabeled at 3 hours after injection. The greatest loss of radioactivity from the megakaryocytes occurred between 1 and 3 days after injection. Only trace labeling of platelet proteins was seen at 3 hours, representing almost entirely three bands at molecular weights 47,000, 52,000, and 66,000. At 24 hours only about 13% of the maximal labeling was present, but not all proteins were labeled. The maximal labeling was at 3 days. The pattern of labeling of platelets at 3 days was identical to that of megakaryocytes at 3 hours. The protein pattern of nonmegakaryocytic marrow cells was different from that of the platelets and megakaryocytes. Data presented here suggest that most protein synthesis in megakaryocytes is completed at least 24 hours before release of the platelets to the circulation, and suggest some specificity in the proteins that are synthesized at the terminal stages of maturation.

  16. Expression of active hBMP2 in transgenic tobacco plants.

    PubMed

    Suo, Guangli; Chen, Bing; Zhang, Jingyu; Gao, Yuan; Wang, Xia; He, Zhengquan; Dai, Jianwu

    2006-12-01

    Bone morphogenetic protein 2 (BMP2) is important for bone tissue repair. The goal of this research is to construct a high level human BMP2 (hBMP2) expression system using transgenic tobacco plants as a bioreactor. Cauliflower mosaic virus (CaMV) 35S promoter, alfalfa mosaic virus (AMV) enhancer, tobacco mosaic virus (TMV) enhancer, matrix attachment regions (MARs) sequence, and "Kozak" sequence were used to construct recombinant expression vectors and the high-expression vectors were screened out through GUS-fusions assay. The promoter is the most important factor; double-CaMV 35S promoter is more effective than single promoter. The AMV or TMV enhancer is able to promote the foreign protein expression. After four-step purification, the activated hBMP2 (0.02% total soluble protein) was obtained. Our results suggested that the transgenic tobacco has great potential to be used as a bioreactor to produce hBMP2. PMID:16819603

  17. Mosaicism for a chromosome 8-derived minute marker chromosome in a patient with manifestations of trisomy 8 mosaicism

    SciTech Connect

    Spinner, N.B.; Grace, K.R.; Owens, N.L.

    1995-03-13

    We describe a patient with manifestations of the mosaic trisomy 8 syndrome and mosaicism for a minute marker chromosome. Fluorescence in situ hybridization (FISH) with a chromosome 8 probe confirmed that the marker was derived from chromosome 8. This is the smallest piece of chromosome 8 to be reported in a patient with mosaic trisomy 8 syndrome. When the clinical picture is strongly suggestive of trisomy for a specific chromosome region, we believe that FISH can be used to test markers in a guided, rather than random, fashion. 8 refs., 3 figs.

  18. Cauliflower-like SnO2 hollow microspheres as anode and carbon fiber as cathode for high performance quantum dot and dye-sensitized solar cells

    NASA Astrophysics Data System (ADS)

    Ganapathy, Veerappan; Kong, Eui-Hyun; Park, Yoon-Cheol; Jang, Hyun Myung; Rhee, Shi-Woo

    2014-02-01

    Cauliflower-like tin oxide (SnO2) hollow microspheres (HMS) sensitized with multilayer quantum dots (QDs) as photoanode and alternative stable, low-cost counter electrode are employed for the first time in QD-sensitized solar cells (QDSCs). Cauliflower-like SnO2 hollow spheres mainly consist of 50 nm-sized agglomerated nanoparticles; they possess a high internal surface area and light scattering in between the microspheres and shell layers. This makes them promising photoanode material for both QDSCs and dye-sensitized solar cells (DSCs). Successive ionic layer adsorption and reaction (SILAR) method and chemical bath deposition (CBD) are used for QD-sensitizing the SnO2 microspheres. Additionally, carbon-nanofiber (CNF) with a unique structure is used as an alternative counter electrode (CE) and compared with the standard platinum (Pt) CE. Their electrocatalytic properties are measured using electrochemical impedance spectroscopy (EIS), cyclic voltammetry (CV), and Tafel-polarization. Under 1 sun illumination, solar cells made with hollow SnO2 photoanode sandwiched with the stable CNF CE showed a power conversion efficiency of 2.5% in QDSCs and 3.0% for DSCs, which is quite promising with the standard Pt CE (QDSCs: 2.1%, and DSCs: 3.6%).Cauliflower-like tin oxide (SnO2) hollow microspheres (HMS) sensitized with multilayer quantum dots (QDs) as photoanode and alternative stable, low-cost counter electrode are employed for the first time in QD-sensitized solar cells (QDSCs). Cauliflower-like SnO2 hollow spheres mainly consist of 50 nm-sized agglomerated nanoparticles; they possess a high internal surface area and light scattering in between the microspheres and shell layers. This makes them promising photoanode material for both QDSCs and dye-sensitized solar cells (DSCs). Successive ionic layer adsorption and reaction (SILAR) method and chemical bath deposition (CBD) are used for QD-sensitizing the SnO2 microspheres. Additionally, carbon-nanofiber (CNF) with a

  19. Development of an efficient bi-directional promoter with tripartite enhancer employing three viral promoters.

    PubMed

    Patro, Sunita; Maiti, Indu B; Dey, Nrisingha

    2013-02-10

    We have developed a novel bi-directional promoter (FsFfCBD) by placing two heterogeneous core-promoters from the Figwort mosaic virus sub-genomic transcript promoter (FsCP, -69 to +31) and Cauliflower mosaic virus 35S promoter (CCP, -89 to +1) respectively on upstream (5') and downstream (3') ends of a tri-hybrid enhancer (FsEFfECE), in reverse orientation. The FsEFfECE domain encompasses three heterologous enhancer fragments from Figwort mosaic virus sub-genomic transcript promoter (FsE, 101 bp, -70 to -170), Figwort mosaic virus full-length transcript promoter (FfE, 196 bp, -249 to -54) and Cauliflower mosaic virus 35S promoter (CE, 254 bp, -343 to -90). The bi-directional nature of the FsFfCBD promoter (coupled to GFP and GUS) was established both in transient systems (onion epidermal cells and tobacco protoplasts) and transgenic plant (Nicotiana tabacum samsun NN) by monitoring the simultaneous expression of GFP and GUS employing fluorescence (for GFP) and biochemical (for GUS) based assays. In transgenic plants, the FsFfCBD promoter was found to be 6.8 and 2.5 times stronger than two parent promoters; Fs and FfC respectively. The bi-directional compound promoter FsFfCBD, composed of three heterologous enhancers with enhanced activity could become a valuable additional tool for efficient plant metabolic engineering and molecular pharming. PMID:23183382

  20. Optimized design of a nanostructured SPCE-based multipurpose biosensing platform formed by ferrocene-tethered electrochemically-deposited cauliflower-shaped gold nanoparticles

    PubMed Central

    Argoubi, Wicem; Saadaoui, Maroua

    2015-01-01

    Summary The demand for on-site nanodevices is constantly increasing. The technology development for the design of such devices is highly regarded. In this work, we report the design of a disposable platform that is structured with cauliflower-shaped gold nanoparticles (cfAuNPs) and we show its applications in immunosensing and enzyme-based detection. The electrochemical reduction of Au(III) allows for the electrodeposition of highly dispersed cauliflower-shaped gold nanoparticles on the surface of screen-printed carbon electrodes (SPCEs). The nanostructures were functionalized using ferrocenylmethyl lipoic acid ester which allowed for the tethering of the ferrocene group to gold, which serves as an electrochemical transducer/mediator. The bioconjugation of the surface with anti-human IgG antibody (α-hIgG) or horseradish peroxidase (HRP) enzyme yields biosensors, which have been applied for the selective electrochemical detection of human IgG (hIgG) or H2O2 as model analytes, respectively. Parameters such as the number of sweeps, amount of charge generated from the oxidation of the electrodeposited gold, time of incubation and concentration of the ferrocene derivatives have been studied using cyclic voltammetry (CV), electrochemical impedance spectroscopy (EIS) and scanning electron microscopy (SEM). Selectivity and specificity tests have been also performed in the presence of potentially interfering substances to either hIgG or H2O2. Results showed that the devised immunosensor is endowed with good selectivity and specificity in the presence of several folds of competitive analytes. The enzyme-based platform showed a good catalytic activity towards H2O2 oxidation which predestined it to potential applications pertaining to enzymatic kinetics studies. The levels of hIgG in human serum and H2O2 in honey were successfully determined and served as assessment tools of the applicability of the platforms for real samples analysis. PMID:26425435

  1. Full genome sequence of a novel circo-like virus detected in an adult European eel Anguilla anguilla showing signs of cauliflower disease.

    PubMed

    Doszpoly, Andor; Tarján, Zoltán L; Glávits, Róbert; Müller, Tamás; Benkő, Mária

    2014-05-13

    An adult European eel Anguilla anguilla, showing typical signs of the so-called cauliflower disease, was subjected to pathological and molecular virological examinations. Samples taken from internal organs and the polypoid proliferative tissue from the mouth were examined by PCR for the detection of several viruses. Positive results were obtained with a nested PCR targeting the rep gene of circoviruses. Analysis of the partial rep sequence indicated the presence of a putative novel circovirus, but attempts to isolate it remained unsuccessful. The missing part of the genome was acquired by an inverse nested PCR with 2 specific primer pairs, designed from the newly determined rep sequence, followed by genome walking. The circular full genome was found to consist of 1378 nt (GenBank accession no. KC469701). Two oppositely oriented open reading frames (ORFs) were present, of which one was unambiguously identified as a circoviral rep gene. However, the predicted product of the other ORF, though it is a clear positional counterpart of the cap genes, showed no obvious homology to any known circoviral capsid proteins. A stem-loop-like element in the intergenic region between the 5' ends of the ORFs was also found. Phylogenetic calculations indicated that the novel virus belongs to the genus Circovirus in the family Circoviridae. The relative amount of the viral DNA in the organ samples was estimated by quantitative real-time PCR. The results suggested that the examined fish was caught in an active viremic state, although the role of this circovirus in the etiology of the cauliflower diseases could not be ascertained. PMID:24991738

  2. Biogenesis of mitochondria in cauliflower (Brassica oleracea var. botrytis) curds subjected to temperature stress and recovery involves regulation of the complexome, respiratory chain activity, organellar translation and ultrastructure.

    PubMed

    Rurek, Michal; Woyda-Ploszczyca, Andrzej M; Jarmuszkiewicz, Wieslawa

    2015-01-01

    The biogenesis of the cauliflower curd mitochondrial proteome was investigated under cold, heat and the recovery. For the first time, two dimensional fluorescence difference gel electrophoresis was used to study the plant mitochondrial complexome in heat and heat recovery. Particularly, changes in the complex I and complex III subunits and import proteins, and the partial disintegration of matrix complexes were observed. The presence of unassembled subunits of ATP synthase was accompanied by impairment in mitochondrial translation of its subunit. In cold and heat, the transcription profiles of mitochondrial genes were uncorrelated. The in-gel activities of respiratory complexes were particularly affected after stress recovery. Despite a general stability of respiratory chain complexes in heat, functional studies showed that their activity and the ATP synthesis yield were affected. Contrary to cold stress, heat stress resulted in a reduced efficiency of oxidative phosphorylation likely due to changes in alternative oxidase (AOX) activity. Stress and stress recovery differently modulated the protein level and activity of AOX. Heat stress induced an increase in AOX activity and protein level, and AOX1a and AOX1d transcript level, while heat recovery reversed the AOX protein and activity changes. Conversely, cold stress led to a decrease in AOX activity (and protein level), which was reversed after cold recovery. Thus, cauliflower AOX is only induced by heat stress. In heat, contrary to the AOX activity, the activity of rotenone-insensitive internal NADH dehydrogenase was diminished. The relevance of various steps of plant mitochondrial biogenesis to temperature stress response and recovery is discussed. PMID:25617518

  3. INTERIOR VIEW OF BATHROOM 1. SHOWING ORIGINAL MOSAIC PATTERN TILE ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    INTERIOR VIEW OF BATHROOM 1. SHOWING ORIGINAL MOSAIC PATTERN TILE FLOOR, TILE WAINSCOT AND SHOWER SURROUND, AND CERAMIC ACCESSORIES. VIEW FACING EAST. - Hickam Field, Officers' Housing Type J, 701 Beard Street, Honolulu, Honolulu County, HI

  4. INTERIOR VIEW OF BATHROOM 2. NOTE THE ORIGINAL MOSAIC PATTERN ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    INTERIOR VIEW OF BATHROOM 2. NOTE THE ORIGINAL MOSAIC PATTERN FLOOR TILE, EXPOSED-CORNER TUB, FLUSH VALVE TOILET, TILE WAINSCOT, AND CERAMIC ACCESSORIES. VIEW FACING NORTHEAST. - Hickam Field, Officers' Housing Type B, 704 Julian Avenue, Honolulu, Honolulu County, HI

  5. 8. 451 MADISON AVENUE, MAIN HALL, SOUTH WALL, MOSAIC TYMPANUM ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    8. 451 MADISON AVENUE, MAIN HALL, SOUTH WALL, MOSAIC TYMPANUM OF THREE FIGURES IN BOLD RELIEF ABOVE FIREPLACE - Villard Houses, 451-457 Madison Avenue & 24 East Fifty-first Street, New York County, NY

  6. 79. DETAIL, MOSAIC FLOOR IN HALL 355 AT ENTRANCE TO ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    79. DETAIL, MOSAIC FLOOR IN HALL 355 AT ENTRANCE TO REGENTS' ROOM, THIRD FLOOR - Smithsonian Institution Building, 1000 Jefferson Drive, between Ninth & Twelfth Streets, Southwest, Washington, District of Columbia, DC

  7. Detail view of floor mosaic in first floor lobby ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    Detail view of floor mosaic in first floor lobby - St. Elizabeths Hospital, Hitchcock Hall, 2700 Martin Luther King Jr. Avenue, Southeast, 588-604 Redwood Street, Southeast, Washington, District of Columbia, DC

  8. Immunogenic compositions comprising human immunodeficiency virus (HIV) mosaic Nef proteins

    DOEpatents

    Korber, Bette T.; Perkins, Simon; Bhattacharya, Tanmoy; Fischer, William M.; Theiler, James; Letvin, Norman; Haynes, Barton F.; Hahn, Beatrice H.; Yusim, Karina; Kuiken, Carla

    2012-02-21

    The present invention relates to mosaic clade M HIV-1 Nef polypeptides and to compositions comprising same. The polypeptides of the invention are suitable for use in inducing an immune response to HIV-1 in a human.

  9. INTERIOR VIEW OF BATHROOM 1. NOTE THE ORIGINAL MOSAIC PATTERN ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    INTERIOR VIEW OF BATHROOM 1. NOTE THE ORIGINAL MOSAIC PATTERN FLOOR TILE, ASBESTOS CEMENT WALL BOARD, AND OPEN TRANSOM OVER THE SHOWER DOORWAY. VIEW FACING WEST. - Hickam Field, Officers' Housing Type D, 111 Beard Avenue, Honolulu, Honolulu County, HI

  10. Mosaic Double Aneuploidy of X and G Chromosomes

    ERIC Educational Resources Information Center

    And Others; Singh, D. N.

    1975-01-01

    Reported are case histories of three severely retarded adolescents with typical Down's Syndrome features but whose cytogenetic analysis revealed a rare chromosomal anomaly of mosaicism of Down's and Turner's syndromes. (CL)

  11. A new national mosaic of state landcover data

    USGS Publications Warehouse

    Thomas, I.

    2000-01-01

    This presentation reviewed current landcover mapping efforts and presented a new preliminary, national mosaic of Gap Analysis Program (GAP) and Multi-Resolution Land Characteristics Consortium (MRLC) landcover data with a discussion of techniques, problems faced, and future refinements.

  12. Update on High-Resolution Geodetically Controlled LROC Polar Mosaics

    NASA Astrophysics Data System (ADS)

    Archinal, B.; Lee, E.; Weller, L.; Richie, J.; Edmundson, K.; Laura, J.; Robinson, M.; Speyerer, E.; Boyd, A.; Bowman-Cisneros, E.; Wagner, R.; Nefian, A.

    2015-10-01

    We describe progress on high-resolution (1 m/pixel) geodetically controlled LROC mosaics of the lunar poles, which can be used for locating illumination resources (for solar power or cold traps) or landing site and surface operations planning.

  13. Global and regional/seasonal color mosaics of Mars

    NASA Technical Reports Server (NTRS)

    Mcewen, Alfred S.; Soderblom, Laurence A.

    1993-01-01

    Four regional mosaics of Mars acquired during different seasons, along with their composite as a single global mosaic, have been completed in two colors (red and violet) at scales of 1/16 and 1/64 degrees/pixel. These mosaics were put together from a set of 51 separate mosaics, each acquired from a single Viking orbiter spacecraft orbital revolution. Special techniques were developed and applied to suppress large variations between mosaics introcued by highly variable, optically thin, condensate hazes. The techniques utilize a combination of the spatial characteristics of the hazes (generally broad, low-frequency) along with their modulation of the reginal color ratios (strongly enhancing the violet/red ratios). Photometric-function normalization was applied following the haze removal. Most of the single-orbit mosaics consist of red and violet or red, green, and violet filters, but a few mosaics with only red-filter data were included to fill gaps in global coverage at high northern latitudes. Global coverage is approximately 99 percent complete in red-filter mosaics and approximately 95 percent and approximately 60 percent complete in corresponding violet- and green-filter mosaics, respectively. All of the mosaics are geometrically tied to the 1/256 deg per pixel Mars Digital Image Map (MDIM), which is available on Compact Disk (CD), and which will be used as the base map for Mars Observer data sets. Early in 1993, the single-orbit color mosaics will be distributed to the science community in a six-volume set of CDs. Perhaps the most scientifically interesting parts of this dataset are the overlap regions, which show significant temporal variations in surface and atmospheric features. Surface changes can be categorized as (1) changes that probably occurred during the great dust storms of 1977; (2) changes that occurred soon after 1977 storms due to removal of redistribution of recently deposited dust; (3) changes in the northern lowlands that probably occurred

  14. 43. CUTTING APART PIECES OF A MOSAIC. WHEN SEPARATED, THE ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    43. CUTTING APART PIECES OF A MOSAIC. WHEN SEPARATED, THE PIECES CAN BE INDIVIDUALLY GLAZED, SMOKED, OR FINISH FIRED TO PRODUCE A MULTI-COLORED IMAGE WHEN REASSEMBLED. NOTE THE SUBSTITUTION OF BUFF FOR RED CLAY IN SEVERAL PIECES OF MOSAIC ON THE LEFT. - Moravian Pottery & Tile Works, Southwest side of State Route 313 (Swamp Road), Northwest of East Court Street, Doylestown, Bucks County, PA

  15. Delineation of a clinical syndrome caused by mosaic trisomy 15

    SciTech Connect

    Buehler, E.M.; Bienz, G.; Straumann, E.; Bosceh, N.

    1996-03-15

    We report on a boy with mosaic trisomy 15. The clinical manifestations are compared with those of the few cases reported up to now. A clinical syndrome is delineated consisting of a characteristic shape of the nose and other minor craniofacial anomalies, as well as typical deformities of the hands and feet. Different degrees of mosaicism may explain the more or less severe manifestations in individual patients. 10 refs., 4 figs., 1 tab.

  16. Detail view looking down at mosaics of everyday objects next ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    Detail view looking down at mosaics of everyday objects next to Living Trailer (rear steps seen frame left). "They Last" tile in center surrounded by tiles, irons, glasses, toy guns, license plates, bottle caps, and plastic parts. The mosaic was created in sections as squares and linear strips, as cement was mixed and objects were collected – the edges of these sections and variation of objects is noticeable. View looking north. - Grandma Prisbrey's Bottle Village, 4595 Cochran Street, Simi Valley, Ventura County, CA

  17. Mosaic trisomy 8 detected by fibroblasts cultured of skin

    PubMed Central

    Gómez, Ana M; Mora, Lina; Suarez-Obando, Fernando; Moreno, Olga

    2016-01-01

    Introduction: Mosaic trisomy 8 or "Warkany's Syndrome" is a chromosomopathy with an estimated prevalance of 1:25,000 to 1:50,000, whose clinical presentation has a wide phenotypic variability. Case Description: Patient aged 14 years old with antecedents of global retardation of development, moderate cognitive deficit and hypothyroidism of possible congenital origin. Clinical Findings: Physical examination revealed palpebral ptosis, small corneas and corectopia, hypoplasia of the upper maxilla and prognathism, dental crowding, high-arched palate, anomalies of the extremities such as digitalization of the thumbs, clinodactyly and bilateral shortening of the fifth finger, shortening of the right femur, columnar deviation and linear brown blotches that followed Blaschko's lines. Cerebral nuclear magnetic resonance revealed type 1 Chiari's malformation and ventriculomegaly. Although the karyotype was normal in peripheral blood (46,XY), based on the finding of cutaneous mosaicism the lesions were biopsied and cytogenetic analysis demonstrated mosaic trisomy 8: mos 47,XY,+8[7]/46,XY[93]. Clinical Relevance: Trisomy 8 is clinically presented as a mosaic, universal cases being unfailingly lethal. In this particular case, cutaneous lesions identified the mosaic in tissue, although the karyotype was normal in peripheral blood. The cutaneous mosaicism represented by brown linear blotches which follow Blaschko's lines is a clinical finding that has not previously been described in Warkany's syndrome. PMID:27546932

  18. Effects of single and double infections of winter wheat by Triticum mosaic virus and Wheat streak mosaic virus on yield determinants

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Triticum mosaic virus (TriMV) is a recently discovered virus infecting wheat (Triticum aestivum L.) in the Great Plains region of the United States. It is transmitted by wheat curl mites (Aceria tosichella Keifer) which also transmit Wheat streak mosaic virus (WSMV) and Wheat mosaic virus. In a gree...

  19. Promoter/leader deletion analysis and plant expression vectors with the figwort mosaic virus (FMV) full length transcript (FLt) promoter containing single or double enhancer domains.

    PubMed

    Maiti, I B; Gowda, S; Kiernan, J; Ghosh, S K; Shepherd, R J

    1997-03-01

    The boundaries required for maximal expression from the promoter/leader region of the full length transcript of figwort mosaic virus (FLt promoter) coupled to reporter genes were defined by 5' and 3' deletion analyses. In transient expression assays using protoplasts of Nicotiana edwardsonii, a 314 bp FLt promoter fragment sequence (-249 to +65 from the transcription start site) was sufficient for strong expression activity. Plant expression vectors developed with modified FLt promoters were tested with GUS or CAT as reporter genes in transgenic plants. The FLt promoter is a strong constitutive promoter, with strength comparable to or greater than that of the CaMV 35S promoter. The FLt promoter with its double enhancer domain linked to GUS or CAT reporter genes provides an average 4-fold greater activity than the FLt promoter with a single enhancer domain (-55 to -249 bp upstream fragment) in tests with transgenic plants and in protoplast transient expression assays. PMID:9090062

  20. Galileo Regio Mosaic - Galileo over Voyager Data

    NASA Technical Reports Server (NTRS)

    1996-01-01

    A mosaic of four Galileo images of the Galileo Regio region on Ganymede (Latitude 18 N, Longitude: 149 W) is shown overlayed on the data obtained by the Voyager 2 spacecraft in 1979. North is to the top of the picture, and the sun illuminates the surface from the lower left, about 58 degrees above the horizon. The smallest features that can be discerned are about 80 meters (262 feet) in size in the Galileo images. These Galileo images show fine details of the dark terrain that makes up about half of the surface of the planet-sized moon. Ancient impact craters of various sizes and states of degradation testify to the great age of the terrain, dating back several billion years. The images reveal distinctive variations in albedo from the brighter rims, knobs, and furrow walls to a possible accumulation of dark material on the lower slopes, and crater floors. High photometric activity (large light contrast at high spatial frequencies) of this ice-rich surface was such that the Galileo camera's hardware data compressor was pushed into truncating lines. The north-south running gap between the left and right halves of the mosaic is a result of line truncation from the normal 800 samples per line to about 540. The images were taken on 27 June, 1996 Universal Time at a range of 7,580 kilometers (4,738 miles) through the clear filter of the Galileo spacecraft's imaging system. Launched in October 1989, Galileo entered orbit around Jupiter on December 7, 1995. The spacecraft's mission is to conduct detailed studies of the giant planet, its largest moons and the Jovian magnetic environment. The Jet Propulsion Laboratory, Pasadena, CA manages the mission for NASA's Office of Space Science, Washington, DC.

    This image and other images and data received from Galileo are posted on the World Wide Web, on the Galileo mission home page at URL http://galileo.jpl.nasa.gov. Background information and educational context for the images can be found at URL http://www.jpl.nasa.gov/galileo/sepo

  1. Mosaic-Detector-Based Fluorescence Spectral Imager

    NASA Technical Reports Server (NTRS)

    Son, Kyung-Ah; Moon, Jeong

    2007-01-01

    A battery-powered, pen-sized, portable instrument for measuring molecular fluorescence spectra of chemical and biological samples in the field has been proposed. Molecular fluorescence spectroscopy is among the techniques used most frequently in laboratories to analyze compositions of chemical and biological samples. Heretofore, it has been possible to measure fluorescence spectra of molecular species at relative concentrations as low as parts per billion (ppb), with a few nm spectral resolution. The proposed instrument would include a planar array (mosaic) of detectors, onto which a fluorescence spectrum would be spatially mapped. Unlike in the larger laboratory-type molecular fluorescence spectrometers, mapping of wavelengths to spatial positions would be accomplished without use of relatively bulky optical parts. The proposed instrument is expected to be sensitive enough to enable measurement of spectra of chemical species at relative concentrations <1 ppb, with spectral resolution that could be tailored by design to be comparable to a laboratory molecular fluorescence spectrometer. The proposed instrument (see figure) would include a button-cell battery and a laser diode, which would generate the monochromatic ultraviolet light needed to excite fluorescence in a sample. The sample would be held in a cell bounded by far-ultraviolet-transparent quartz or optical glass. The detector array would be, more specifically, a complementary metal oxide/ semiconductor or charge-coupled- device imaging photodetector array, the photodetectors of which would be tailored to respond to light in the wavelength range of the fluorescence spectrum to be measured. The light-input face of the photodetector array would be covered with a matching checkerboard array of multilayer thin film interference filters, such that each pixel in the array would be sensitive only to light in a spectral band narrow enough so as not to overlap significantly with the band of an adjacent pixel. The

  2. Studies of internal bremsstrahlung spectrum of (35)S beta emitter in the photon energy region of 1-100 keV.

    PubMed

    Singh, Amrit; Dhaliwal, A S

    2014-12-01

    The internal bremsstrahlung (IB) spectral photon distribution, produced by soft beta particles of (35)S (Wmax=164keV), in the photon energy region of 1-100keV, is measured by using a Si(Li) detector, having high energy resolution and efficiency at low energy region. The measured spectral IB photon distribution is compared with KUB theory and Coulomb corrected IB theories given by Nilsson, and Lewis and Ford. After applying the necessary corrections, the experimental and theoretical IB spectral photon distributions are compared in terms of the number of IB photon of energy k per moc(2) per unit photon yield. In the low energy region (below 10keV), the experimental results are in agreement with all the theories. However, in photon energy region of 10-50keV, experimental results are in agreement with Coulomb corrected Nilsson theory only, within the experimental errors. Further, beyond 50keV, the Nilsson theory is more close to the experimental results than the KUB, and the Lewis and Ford theories. Hence, the Nilsson theory is more accurate than the other theories given by KUB and Lewis and Ford, particularly at a high energy end. The experimental results reported here with Si(Li) detector are free from number of ambiguities in earlier measurements reported with NaI(Tl) and HPGe detectors. The present results are indicating a relook into the theoretical considerations, given by different theories, while taking into account the Coulomb corrections for predicting the IB spectrum, particularly at high photon energy region. PMID:25103247

  3. Dancing together and separate again: gymnosperms exhibit frequent changes of fundamental 5S and 35S rRNA gene (rDNA) organisation

    PubMed Central

    Garcia, S; Kovařík, A

    2013-01-01

    In higher eukaryotes, the 5S rRNA genes occur in tandem units and are arranged either separately (S-type arrangement) or linked to other repeated genes, in most cases to rDNA locus encoding 18S–5.8S–26S genes (L-type arrangement). Here we used Southern blot hybridisation, PCR and sequencing approaches to analyse genomic organisation of rRNA genes in all large gymnosperm groups, including Coniferales, Ginkgoales, Gnetales and Cycadales. The data are provided for 27 species (21 genera). The 5S units linked to the 35S rDNA units occur in some but not all Gnetales, Coniferales and in Ginkgo (∼30% of the species analysed), while the remaining exhibit separate organisation. The linked 5S rRNA genes may occur as single-copy insertions or as short tandems embedded in the 26S–18S rDNA intergenic spacer (IGS). The 5S transcript may be encoded by the same (Ginkgo, Ephedra) or opposite (Podocarpus) DNA strand as the 18S–5.8S–26S genes. In addition, pseudogenised 5S copies were also found in some IGS types. Both L- and S-type units have been largely homogenised across the genomes. Phylogenetic relationships based on the comparison of 5S coding sequences suggest that the 5S genes independently inserted IGS at least three times in the course of gymnosperm evolution. Frequent transpositions and rearrangements of basic units indicate relatively relaxed selection pressures imposed on genomic organisation of 5S genes in plants. PMID:23512008

  4. Mechanism of hydrodesulfurization of dibenzothiophene on Co-Mo/Al[sub 2]O[sub 3] and Co/Al[sub 2]O[sub 3] catalyst by the use of radioisotope [sup 35]S tracer

    SciTech Connect

    Kabe, T.; Qian, W.; Ogawa, S.; Ishihara, A. )

    1993-09-01

    In order to estimate the behavior of sulfur on hydrodesulfurization catalyst, the [sup 35]S-labelled dibenzothiophene ([sup 35]S-DBT) was hydrodesulfurized on sulfided Co-Mo/Al[sub 2]O[sub 3] and Co/Al[sub 2]O[sub 3] in a fixed-bed pressurized flow reactor. During the reaction, the radioactivities of unreacted [sup 35]S-DBT and formed [sup 35]S-H[sub 2]S were monitored. The rate of the release of sulfur on the catalyst was estimated from the rates of an increase and a decrease of the radioactivity in formed [sup 35]S-H[sub 2]S. The activation energies of the release of sulfur were 3.7 and 9.9 kcal/mol for sulfided Co-Mo/Al[sub 2]O[sub 3] and Co/Al[sub 2]O[sub 3], respectively. The amount of labile sulfur (S[sub 0]), which could be calculated from the maximum amount of [sup 35]S accomodated on the catalyst, increased with increasing temperature. When it was assumed that sulfur in sulfided Co-Mo/Al[sub 2]O[sub 3] existed in the form of Co[sub 9]S[sub 8]-MoS[sub 2]/Al[sub 2]O[sub 3], the ratio of labile sulfur to total sulfur did not exceed 50%, even under conditions where the rate of DBT HDS is relatively high. On the contrary, the ratio of labile sulfur to total sulfur for Co/Al[sub 2]O[sub 3] exceeded 80%. 34 refs., 7 figs., 2 tabs.

  5. A New Moon: Improved Lunar Orbiter Mosaics

    NASA Astrophysics Data System (ADS)

    Byrne, Charles J.

    2002-01-01

    Photographs of the five Lunar Orbiter missions in 1965 and 1966 provide comprehensive coverage of the moon at resolutions in the range of about 1 meter to 300 meters. With a few exceptions, they are taken at a moderately low sun angle to clearly show the topography. These photos, especially the set edited by Bowker and Hughes, are still in active use in books, papers, and slide presentations and they are likely to be used in planning the missions of future lunar spacecraft. Scanning artifacts (sometimes called the 'venetian blind effect') detract from the visual quality of the photographs, particularly when they are printed at high contrast to show albedo variations such as rays or subtle topology features such as the margins of lava flows. The author has written a program to estimate and remove the artifacts from the pictures, greatly improving their cosmetic quality. The program detects lines between framelets of a mosaic, removes the lines caused by light leaking between framelets, estimates the systematic streaks caused by cathode ray tube scanning in the spacecraft and the Ground Reconstruction Equipment, and compensates for these streaks. Non-linearity introduced by contrast enhancement in the production of the input photos is considered in the compensation process.

  6. Mosaic nature of the wolbachia surface protein.

    PubMed

    Baldo, Laura; Lo, Nathan; Werren, John H

    2005-08-01

    Lateral gene transfer and recombination play important roles in the evolution of many parasitic bacteria. Here we investigate intragenic recombination in Wolbachia bacteria, considered among the most abundant intracellular bacteria on earth. We conduct a detailed analysis of the patterns of variation and recombination within the Wolbachia surface protein, utilizing an extensive set of published and new sequences from five main supergroups of Wolbachia. Analysis of nucleotide and amino acid sequence variations confirms four hypervariable regions (HVRs), separated by regions under strong conservation. Comparison of shared polymorphisms reveals a complex mosaic structure of the gene, characterized by a clear intragenic recombining of segments among several distinct strains, whose major recombination effect is shuffling of a relatively conserved set of amino acid motifs within each of the four HVRs. Exchanges occurred both within and between the arthropod supergroups. Analyses based on phylogenetic methods and a specific recombination detection program (MAXCHI) significantly support this complex partitioning of the gene, indicating a chimeric origin of wsp. Although wsp has been widely used to define macro- and microtaxonomy among Wolbachia strains, these results clearly show that it is not suitable for this purpose. The role of wsp in bacterium-host interactions is currently unknown, but results presented here indicate that exchanges of HVR motifs are favored by natural selection. Identifying host proteins that interact with wsp variants should help reveal how these widespread bacterial parasites affect and evolve in response to the cellular environments of their invertebrate hosts. PMID:16030235

  7. The mosaic acquisition of grammatical relations.

    PubMed

    Rispoli, M

    1991-10-01

    The view that grammatical relations have substantial essence, designated as 'subject' or 'object' has difficulty in accounting for the variety of naturally acquirable grammatical relations. The acquisition of grammatical relations is examined from a theoretical framework, ROLE AND REFERENCE GRAMMAR, in which grammatical relations are decomposed into two separate types of structure: logical (semantic) structure and information (pragmatic) structure. The acquisition of grammatical relations from four languages is compared: (1) the definite accusative suffix and pragmatically motivated word order of Turkish; (2) Kaluli verb agreement, case and focus marking postpositions, and pragmatically motivated word order; (3) Hungarian definite and indefinite verb conjunction; and (4) Italian participial agreement and anaphoric, accusative case pronouns. Two conditions on structures are found to cause difficulty: the neutralization of a semantic or pragmatic distinction by interfering structures (e.g. Kaluli and Italian), and global case marking which forces the child to discover relevant semantic characteristics of both the actor and the undergoer (e.g. Hungarian and Kaluli). Structures that encode semantic or pragmatic distinctions independently are more easily acquired (e.g. Turkish). Piecing together discrete structures in a mosaic fashion, the child can acquire the great variety of grammatical relations that exist in human languages. PMID:1761612

  8. Further applications for mosaic pixel FPA technology

    NASA Astrophysics Data System (ADS)

    Liddiard, Kevin C.

    2011-06-01

    In previous papers to this SPIE forum the development of novel technology for next generation PIR security sensors has been described. This technology combines the mosaic pixel FPA concept with low cost optics and purpose-designed readout electronics to provide a higher performance and affordable alternative to current PIR sensor technology, including an imaging capability. Progressive development has resulted in increased performance and transition from conventional microbolometer fabrication to manufacture on 8 or 12 inch CMOS/MEMS fabrication lines. A number of spin-off applications have been identified. In this paper two specific applications are highlighted: high performance imaging IRFPA design and forest fire detection. The former involves optional design for small pixel high performance imaging. The latter involves cheap expendable sensors which can detect approaching fire fronts and send alarms with positional data via mobile phone or satellite link. We also introduce to this SPIE forum the application of microbolometer IR sensor technology to IoT, the Internet of Things.

  9. Germline mosaicism in Rubinstein-Taybi syndrome.

    PubMed

    Tajir, Mariam; Fergelot, Patricia; Lancelot, Guenaelle; Elalaoui, Siham Chafai; Arveiler, Benoit; Lacombe, Didier; Sefiani, Abdelaziz

    2013-04-15

    Rubinstein-Taybi syndrome is an autosomal dominant disorder with multiple congenital anomalies and genetic heterogeneity. Clinical manifestations include mental retardation, postnatal growth deficiency, microcephaly, broad thumbs and halluces, and characteristic facial features. Mutations in the gene encoding the transcriptional coactivator CREB-binding protein (CREBBP; OMIM 600140) on chromosome 16p13, account for about 50% to 70% of patients. Most of CREBBP mutations are de novo and the rate of recurrence in a family is low. Families with several affected children are extremely rare. We report here a Moroccan family with two children with RSTS and apparently unaffected parents. The molecular studies showed a heterozygous mutation c.4361T>A (p.Leu1454His) in exon 26 of the CREBBP gene in the two affected siblings. Neither the parents, nor the healthy brother, carry this mutation in hematologic cells. The mutation was also absent in buccal epithelial cells of both parents. We discuss the hypothesis of germinal mosaicism. This concept is very important because it complicates genetic counseling of this family who has a risk of recurrence of the mutation in subsequent pregnancies. PMID:23352794

  10. Sequence diversity of wheat mosaic virus isolates.

    PubMed

    Stewart, Lucy R

    2016-02-01

    Wheat mosaic virus (WMoV), transmitted by eriophyid wheat curl mites (Aceria tosichella) is the causal agent of High Plains disease in wheat and maize. WMoV and other members of the genus Emaravirus evaded thorough molecular characterization for many years due to the experimental challenges of mite transmission and manipulating multisegmented negative sense RNA genomes. Recently, the complete genome sequence of a Nebraska isolate of WMoV revealed eight segments, plus a variant sequence of the nucleocapsid protein-encoding segment. Here, near-complete and partial consensus sequences of five more WMoV isolates are reported and compared to the Nebraska isolate: an Ohio maize isolate (GG1), a Kansas barley isolate (KS7), and three Ohio wheat isolates (H1, K1, W1). Results show two distinct groups of WMoV isolates: Ohio wheat isolate RNA segments had 84% or lower nucleotide sequence identity to the NE isolate, whereas GG1 and KS7 had 98% or higher nucleotide sequence identity to the NE isolate. Knowledge of the sequence variability of WMoV isolates is a step toward understanding virus biology, and potentially explaining observed biological variation. PMID:26590326

  11. Prenatal studies of a family with 4p- mosaicism

    SciTech Connect

    Pulijaal, V.; Ben-Yishay, M.; Nitowsky, H.M.

    1994-09-01

    Mosaicism for an autosomal structural abnormality is rare. Only two cases have been reported for mosaicism involving a deletion of the short arm of number 4 chromosome (one prenatal and one postnatal). We report mosaicism for 4p- in the amniocyte cultures from a G3P2 41-year-old patient who had amniocentesis for advanced maternal age. Chromosome analysis of amniotic cultures by in situ and flask methods in Chang-supplemented McCoy`s medium revealed a mosaic karyotype, 46,XX/46,XX,del(4)(p13) with 15 (62.5%) and 9 (37.5%) metaphases, respectively. Parental blood chromosome studies yielded a paternal mosaic karyotype with 2 out of 98 cells (2%) exhibiting a deletion in the short arm of number 4 chromosome (46,XX,del(4)(p13)) as seen in the fetus. After genetic counseling, the family decided to terminate the pregnancy. Studies of fetal tissue confirmed the amniocentesis results for 4p- mosaicism (18.3%). Cytogenetic studies in father confirmed mosaicism for 4p- in fibroblast cultures from skin (2%). In none of the blood or skin fibroblast cultures was there evidence of a spontaneous fragile site at 4p13. However, cytogenetic studies of peripheral blood under conditions of folate deprivation (medium 199) showed a fragile site at 4q13 in 30% of the metaphases and 4p- cells are absent. The coincidence of the breakpoints and folate-induced fragile site in 4p- may be related phenomena in this family.

  12. Evaluation of constitutive viral promoters in transgenic soybean roots and nodules.

    PubMed

    Govindarajulu, Manjula; Elmore, James M; Fester, Thomas; Taylor, Christopher G

    2008-08-01

    The efficiency of beta-glucuronidase (GUS) expression was evaluated with five viral promoters to identify the most suitable promoter or promoters for use in soybean hairy roots, including applications to study the symbiotic interaction with Bradyrhizobium japonicum. Levels of GUS activity were fluorimetrically and histochemically assayed when the GUS (uidA) gene was driven by the Cauliflower mosaic virus (CaMV) 35S promoter and enhanced 35S (E35S) promoter, the Cassava vein mosaic virus (CsVMV) promoter, the Figwort mosaic virus (FMV) promoter, and the Strawberry vein banding virus (SVBV2) promoter. We demonstrate that GUS activity was highest when driven by the FMV promoter and that the promoter activity of 35S and SVBV2 was significantly lower than that of the CsVMV and E35S promoters when tested in soybean hairy roots. In mature soybean root nodules, strong GUS activity was evident when the FMV, 35S, and CsVMV promoters were used. These results indicate that the FMV promoter facilitates the strong expression of target genes in soybean hairy roots and root nodules. PMID:18616399

  13. Bean Common Mosaic Virus and Bean Common Mosaic Necrosis Virus: Relationships, Biology, and Prospects for Control.

    PubMed

    Worrall, Elizabeth A; Wamonje, Francis O; Mukeshimana, Gerardine; Harvey, Jagger J W; Carr, John P; Mitter, Neena

    2015-01-01

    The closely related potyviruses Bean common mosaic virus (BCMV) and Bean common mosaic necrosis virus (BCMNV) are major constraints on common bean (Phaseolus vulgaris) production. Crop losses caused by BCMV and BCMNV impact severely not only on commercial scale cultivation of this high-value crop but also on production by smallholder farmers in the developing world, where bean serves as a key source of dietary protein and mineral nutrition. In many parts of the world, progress has been made in combating BCMV through breeding bean varieties possessing the I gene, a dominant gene conferring resistance to most BCMV strains. However, in Africa, and in particular in Central and East Africa, BCMNV is endemic and this presents a serious problem for deployment of the I gene because this virus triggers systemic necrosis (black root disease) in plants possessing this resistance gene. Information on these two important viruses is scattered throughout the literature from 1917 onward, and although reviews on resistance to BCMV and BCMNV exist, there is currently no comprehensive review on the biology and taxonomy of BCMV and BCMNV. In this chapter, we discuss the current state of our knowledge of these two potyviruses including fundamental aspects of classification and phylogeny, molecular biology, host interactions, transmission through seed and by aphid vectors, geographic distribution, as well as current and future prospects for the control of these important viruses. PMID:26111585

  14. Over-Expression of the Pikh Gene with a CaMV 35S Promoter Leads to Improved Blast Disease (Magnaporthe oryzae) Tolerance in Rice

    PubMed Central

    Azizi, Parisa; Rafii, Mohd Y.; Abdullah, Siti N. A.; Hanafi, Mohamed M.; Maziah, M.; Sahebi, Mahbod; Ashkani, Sadegh; Taheri, Sima; Jahromi, Mohammad F.

    2016-01-01

    Magnaporthe oryzae is a rice blast fungus and plant pathogen that causes a serious rice disease and, therefore, poses a threat to the world's second most important food security crop. Plant transformation technology has become an adaptable system for cultivar improvement and to functionally analyze genes in plants. The objective of this study was to determine the effects (through over-expressing and using the CaMV 35S promoter) of Pikh on MR219 resistance because it is a rice variety that is susceptible to the blast fungus pathotype P7.2. Thus, a full DNA and coding DNA sequence (CDS) of the Pikh gene, 3172 bp, and 1206 bp in length, were obtained through amplifying the gDNA and cDNA template from a PH9-resistant rice variety using a specific primer. Agrobacterium-mediated transformation technology was also used to introduce the Pikh gene into the MR219 callus. Subsequently, transgenic plants were evaluated from the DNA to protein stages using polymerase chain reaction (PCR), semi-quantitative RT-PCR, real-time quantitative PCR and high performance liquid chromatography (HPLC). Transgenic plants were also compared with a control using a real-time quantification technique (to quantify the pathogen population), and transgenic and control plants were challenged with the local most virulent M. oryzae pathotype, P7.2. Based on the results, the Pikh gene encodes a hydrophilic protein with 18 sheets, 4 helixes, and 21 coils. This protein contains 401 amino acids, among which the amino acid sequence from 1 to 376 is a non-cytoplasmic region, that from 377 to 397 is a transmembrane region, and that from 398 to 401 is a cytoplasmic region with no identified disordered regions. The Pikh gene was up-regulated in the transgenic plants compared with the control plants. The quantity of the amino acid leucine in the transgenic rice plants increased significantly from 17.131 in the wild-type to 47.865 mg g−1 in transgenic plants. The M. oryzae population was constant at 31, 48

  15. Over-Expression of the Pikh Gene with a CaMV 35S Promoter Leads to Improved Blast Disease (Magnaporthe oryzae) Tolerance in Rice.

    PubMed

    Azizi, Parisa; Rafii, Mohd Y; Abdullah, Siti N A; Hanafi, Mohamed M; Maziah, M; Sahebi, Mahbod; Ashkani, Sadegh; Taheri, Sima; Jahromi, Mohammad F

    2016-01-01

    Magnaporthe oryzae is a rice blast fungus and plant pathogen that causes a serious rice disease and, therefore, poses a threat to the world's second most important food security crop. Plant transformation technology has become an adaptable system for cultivar improvement and to functionally analyze genes in plants. The objective of this study was to determine the effects (through over-expressing and using the CaMV 35S promoter) of Pikh on MR219 resistance because it is a rice variety that is susceptible to the blast fungus pathotype P7.2. Thus, a full DNA and coding DNA sequence (CDS) of the Pikh gene, 3172 bp, and 1206 bp in length, were obtained through amplifying the gDNA and cDNA template from a PH9-resistant rice variety using a specific primer. Agrobacterium-mediated transformation technology was also used to introduce the Pikh gene into the MR219 callus. Subsequently, transgenic plants were evaluated from the DNA to protein stages using polymerase chain reaction (PCR), semi-quantitative RT-PCR, real-time quantitative PCR and high performance liquid chromatography (HPLC). Transgenic plants were also compared with a control using a real-time quantification technique (to quantify the pathogen population), and transgenic and control plants were challenged with the local most virulent M. oryzae pathotype, P7.2. Based on the results, the Pikh gene encodes a hydrophilic protein with 18 sheets, 4 helixes, and 21 coils. This protein contains 401 amino acids, among which the amino acid sequence from 1 to 376 is a non-cytoplasmic region, that from 377 to 397 is a transmembrane region, and that from 398 to 401 is a cytoplasmic region with no identified disordered regions. The Pikh gene was up-regulated in the transgenic plants compared with the control plants. The quantity of the amino acid leucine in the transgenic rice plants increased significantly from 17.131 in the wild-type to 47.865 mg g(-1) in transgenic plants. The M. oryzae population was constant at 31, 48

  16. Fusion Based Seamless Mosaic for Remote Sensing Images

    NASA Astrophysics Data System (ADS)

    Lu, Ting; Li, Shutao; Fu, Wei

    2014-11-01

    A fusion based seamless mosaic method for stitching remote sensing images is introduced in this paper. The proposed method focuses on one major problem in the process of mosaic: how to generate visually pleasant stitching result in the cases of misalignment, global and local intensity differences between images. First, two partially overlapped images are decomposed into high-frequency components and low-frequency components with Gaussian low-pass filter. Second, by considering the information characteristics contained in both separated components, different mosaic schemes are designed to accomplish stitching process accordingly. For the low-frequency components consisting of coarse shape and illumination information, two-dimension weighted blending rule is utilized to achieve smoothing transition. For the high-frequency components including rich details, an improved seam searching strategy based on dynamic programming is introduced. With the obtained stitching seam guiding the stitching process, visible structural break can be avoided. Finally, the mosaic result is produced by linearly composing both stitching results of different components together. Experimental results demonstrate the effectiveness of the proposed method in generating seamless mosaic results without introducing any unexpected blurring or artifacts.

  17. Characterization of large structural genetic mosaicism in human autosomes.

    PubMed

    Machiela, Mitchell J; Zhou, Weiyin; Sampson, Joshua N; Dean, Michael C; Jacobs, Kevin B; Black, Amanda; Brinton, Louise A; Chang, I-Shou; Chen, Chu; Chen, Constance; Chen, Kexin; Cook, Linda S; Crous Bou, Marta; De Vivo, Immaculata; Doherty, Jennifer; Friedenreich, Christine M; Gaudet, Mia M; Haiman, Christopher A; Hankinson, Susan E; Hartge, Patricia; Henderson, Brian E; Hong, Yun-Chul; Hosgood, H Dean; Hsiung, Chao A; Hu, Wei; Hunter, David J; Jessop, Lea; Kim, Hee Nam; Kim, Yeul Hong; Kim, Young Tae; Klein, Robert; Kraft, Peter; Lan, Qing; Lin, Dongxin; Liu, Jianjun; Le Marchand, Loic; Liang, Xiaolin; Lissowska, Jolanta; Lu, Lingeng; Magliocco, Anthony M; Matsuo, Keitaro; Olson, Sara H; Orlow, Irene; Park, Jae Yong; Pooler, Loreall; Prescott, Jennifer; Rastogi, Radhai; Risch, Harvey A; Schumacher, Fredrick; Seow, Adeline; Setiawan, Veronica Wendy; Shen, Hongbing; Sheng, Xin; Shin, Min-Ho; Shu, Xiao-Ou; VanDen Berg, David; Wang, Jiu-Cun; Wentzensen, Nicolas; Wong, Maria Pik; Wu, Chen; Wu, Tangchun; Wu, Yi-Long; Xia, Lucy; Yang, Hannah P; Yang, Pan-Chyr; Zheng, Wei; Zhou, Baosen; Abnet, Christian C; Albanes, Demetrius; Aldrich, Melinda C; Amos, Christopher; Amundadottir, Laufey T; Berndt, Sonja I; Blot, William J; Bock, Cathryn H; Bracci, Paige M; Burdett, Laurie; Buring, Julie E; Butler, Mary A; Carreón, Tania; Chatterjee, Nilanjan; Chung, Charles C; Cook, Michael B; Cullen, Michael; Davis, Faith G; Ding, Ti; Duell, Eric J; Epstein, Caroline G; Fan, Jin-Hu; Figueroa, Jonine D; Fraumeni, Joseph F; Freedman, Neal D; Fuchs, Charles S; Gao, Yu-Tang; Gapstur, Susan M; Patiño-Garcia, Ana; Garcia-Closas, Montserrat; Gaziano, J Michael; Giles, Graham G; Gillanders, Elizabeth M; Giovannucci, Edward L; Goldin, Lynn; Goldstein, Alisa M; Greene, Mark H; Hallmans, Goran; Harris, Curtis C; Henriksson, Roger; Holly, Elizabeth A; Hoover, Robert N; Hu, Nan; Hutchinson, Amy; Jenab, Mazda; Johansen, Christoffer; Khaw, Kay-Tee; Koh, Woon-Puay; Kolonel, Laurence N; Kooperberg, Charles; Krogh, Vittorio; Kurtz, Robert C; LaCroix, Andrea; Landgren, Annelie; Landi, Maria Teresa; Li, Donghui; Liao, Linda M; Malats, Nuria; McGlynn, Katherine A; McNeill, Lorna H; McWilliams, Robert R; Melin, Beatrice S; Mirabello, Lisa; Peplonska, Beata; Peters, Ulrike; Petersen, Gloria M; Prokunina-Olsson, Ludmila; Purdue, Mark; Qiao, You-Lin; Rabe, Kari G; Rajaraman, Preetha; Real, Francisco X; Riboli, Elio; Rodríguez-Santiago, Benjamín; Rothman, Nathaniel; Ruder, Avima M; Savage, Sharon A; Schwartz, Ann G; Schwartz, Kendra L; Sesso, Howard D; Severi, Gianluca; Silverman, Debra T; Spitz, Margaret R; Stevens, Victoria L; Stolzenberg-Solomon, Rachael; Stram, Daniel; Tang, Ze-Zhong; Taylor, Philip R; Teras, Lauren R; Tobias, Geoffrey S; Viswanathan, Kala; Wacholder, Sholom; Wang, Zhaoming; Weinstein, Stephanie J; Wheeler, William; White, Emily; Wiencke, John K; Wolpin, Brian M; Wu, Xifeng; Wunder, Jay S; Yu, Kai; Zanetti, Krista A; Zeleniuch-Jacquotte, Anne; Ziegler, Regina G; de Andrade, Mariza; Barnes, Kathleen C; Beaty, Terri H; Bierut, Laura J; Desch, Karl C; Doheny, Kimberly F; Feenstra, Bjarke; Ginsburg, David; Heit, John A; Kang, Jae H; Laurie, Cecilia A; Li, Jun Z; Lowe, William L; Marazita, Mary L; Melbye, Mads; Mirel, Daniel B; Murray, Jeffrey C; Nelson, Sarah C; Pasquale, Louis R; Rice, Kenneth; Wiggs, Janey L; Wise, Anastasia; Tucker, Margaret; Pérez-Jurado, Luis A; Laurie, Cathy C; Caporaso, Neil E; Yeager, Meredith; Chanock, Stephen J

    2015-03-01

    Analyses of genome-wide association study (GWAS) data have revealed that detectable genetic mosaicism involving large (>2 Mb) structural autosomal alterations occurs in a fraction of individuals. We present results for a set of 24,849 genotyped individuals (total GWAS set II [TGSII]) in whom 341 large autosomal abnormalities were observed in 168 (0.68%) individuals. Merging data from the new TGSII set with data from two prior reports (the Gene-Environment Association Studies and the total GWAS set I) generated a large dataset of 127,179 individuals; we then conducted a meta-analysis to investigate the patterns of detectable autosomal mosaicism (n = 1,315 events in 925 [0.73%] individuals). Restricting to events >2 Mb in size, we observed an increase in event frequency as event size decreased. The combined results underscore that the rate of detectable mosaicism increases with age (p value = 5.5 × 10(-31)) and is higher in men (p value = 0.002) but lower in participants of African ancestry (p value = 0.003). In a subset of 47 individuals from whom serial samples were collected up to 6 years apart, complex changes were noted over time and showed an overall increase in the proportion of mosaic cells as age increased. Our large combined sample allowed for a unique ability to characterize detectable genetic mosaicism involving large structural events and strengthens the emerging evidence of non-random erosion of the genome in the aging population. PMID:25748358

  18. Relative time NDVI mosaics as an indicator of crop growth

    NASA Astrophysics Data System (ADS)

    Savin, Igor Y.; Negre, Thierry

    2003-03-01

    Relative time NDVI mosaics are proposed as a tool for crop growth monitoring and yield forecasting. The mosaics are constructed for the region of interest for a given phenological phase of crop development (for example, flowering). Mosaics for different years, created for the same characteristic time of crop development, are used for crop growth monitoring and yield forecasting. The approach is illustrated through two case studies: - forecasting of wheat yield in the countries of Northern Africa (relative time NDVI mosaics are constructed for the flowering stage of crop development); - assessing winter crop status in southern areas of Russia after the winter season (mosaics are constructed two dekads before the establishment of snow cover and two dekads after its disappearance). NDVI values, calculated from SPOT4-Vegetation data, were used in both cases. Dates of crop phenological phases were determined applying the WOFOST crop growth model and ECMWF-derived meteorological grid data. Results demonstrate the validity of the approach and the improvements obtained as compared with traditional methods.

  19. Report of a Case with Trisomy 9 Mosaicism

    PubMed Central

    Miryounesi, Mohammad; Dianatpour, Mehdi; Shadmani, Zahra; Ghafouri-Fard, Soudeh

    2016-01-01

    Trisomy 9 is a rare chromosome disorder with high neonatal mortality. It is often seen in mosaic form. Most patients who survive are severely mentally retarded. The main features of this syndrome are “bulbous” nose, microphthalmia, dislocated limbs, and other anomalies of skeletal, cardiac, genitourinary, and central nervous system. Most patients have developmental and cognitive impairment. Patients with mosaicism survive longer than non-mosaics, but it was believed that the degree of mosaicism in lymphocytes or fibroblasts does not associate with survival or degree of impairment. In this report, we present a 2.5-year-old male case of mosaic trisomy 9, to show the wide range of clinical findings in this chromosome disorder. The patient had cardiac anomalies, inguinal hernia, and undescendent testes. He had low-set slightly malformed ears, deeply-set malformed eyes, small palpebral fissures, micrognathia, developmental delay and unilateral optic hypoplasia. The most prominent facial anomaly in this patient was eye anomalies. Cytogenetic analysis with G banding showed karyotype 47XY,+9 in 44% of peripheral lymphocytes examined (47XY,+9[22], 46XY[28]). His parents’ karyotypes were normal. Moderate developmental delay, which was detected in this patient shows that the range of motor and cognitive impairment in this chromosomal disorder is quite broad. This fact should be considered in genetic counseling as well as prenatal diagnosis of this chromosomal disorder. PMID:27217611

  20. The mosaic of "seronegative" antiphospholipid syndrome.

    PubMed

    Conti, Fabrizio; Capozzi, Antonella; Truglia, Simona; Lococo, Emanuela; Longo, Agostina; Misasi, Roberta; Alessandri, Cristiano; Valesini, Guido; Sorice, Maurizio

    2014-01-01

    In the clinical practice it is possible to find patients with clinical signs suggestive of antiphospholipid syndrome (APS), who are persistently negative for the laboratory criteria of APS, that is, anti-cardiolipin antibodies (aCL), anti-β2-GPI antibodies and lupus anticoagulant. Therefore, it was proposed for these cases the term of seronegative APS (SN-APS). In order to detect autoantibodies with different methodological approaches, sera from 24 patients with SN-APS were analysed for anti-phospholipid antibodies using TLC immunostaining, for anti-vimentin/cardiolipin antibodies by enzyme-linked immunosorbent assay (ELISA), and for anti-annexin V and anti-prothrombin antibodies by ELISA and dot blot. Control groups of our study were 25 patients with APS, 18 with systemic lupus erythematosus (SLE), and 32 healthy controls. Results revealed that 13/24 (54.2%) SN-APS sera were positive for aCL (9 of whom were also positive for lysobisphosphatidic acid) by TLC immunostaining, 11/24 (45.8%) for anti-vimentin/cardiolipin antibodies, 3/24 (12.5%) for anti-prothrombin antibodies, and 1/24 (4.2%) for anti-annexin V antibodies. These findings suggest that in sera from patients with SN-APS, antibodies may be detected using "new" antigenic targets (mainly vimentin/cardiolipin) or methodological approaches different from traditional techniques (mainly TLC immunostaining). Thus, SN-APS represents a mosaic, in which antibodies against different antigenic targets may be detected. PMID:24741593

  1. Robust matching algorithm for image mosaic

    NASA Astrophysics Data System (ADS)

    Zeng, Luan; Tan, Jiu-bin

    2010-08-01

    In order to improve the matching accuracy and the level of automation for image mosaic, a matching algorithm based on SIFT (Scale Invariant Feature Transform) features is proposed as detailed below. Firstly, according to the result of cursory comparison with the given basal matching threshold, the collection corresponding SIFT features which contains mismatch is obtained. Secondly, after calculating all the ratio of Euclidean distance from the closest neighbor to the distance of the second closest of corresponding features, we select the image coordinates of corresponding SIFT features with the first eight smallest ratios to solve the initial parameters of pin-hole camera model, and then calculate maximum error σ between transformation coordinates and original image coordinates of the eight corresponding features. Thirdly, calculating the scale of the largest original image coordinates of the eight corresponding features to the entire image size, the scale is regarded as control parameter k of matching error threshold. Finally, computing the difference of the transformation coordinates and the original image coordinates of all the features in the collection of features, deleting the corresponding features with difference larger than 3kσ. We can then obtain the exact collection of matching features to solve the parameters for pin-hole camera model. Experimental results indicate that the proposed method is stable and reliable in case of the image having some variation of view point, illumination, rotation and scale. This new method has been used to achieve an excellent matching accuracy on the experimental images. Moreover, the proposed method can be used to select the matching threshold of different images automatically without any manual intervention.

  2. Mosaic retroposon insertion patterns in placental mammals

    PubMed Central

    Churakov, Gennady; Kriegs, Jan Ole; Baertsch, Robert; Zemann, Anja; Brosius, Jürgen; Schmitz, Jürgen

    2009-01-01

    One and a half centuries after Charles Darwin and Alfred Russel Wallace outlined our current understanding of evolution, a new scientific era is dawning that enables direct observations of genetic variation. However, pure sequence-based molecular attempts to resolve the basal origin of placental mammals have so far resulted only in apparently conflicting hypotheses. By contrast, in the mammalian genomes where they were highly active, the insertion of retroelements and their comparative insertion patterns constitute a neutral, virtually homoplasy-free archive of evolutionary histories. The “presence” of a retroelement at an orthologous genomic position in two species indicates their common ancestry in contrast to its “absence” in more distant species. To resolve the placental origin controversy we extracted ∼2 million potentially phylogenetically informative, retroposon-containing loci from representatives of the major placental mammalian lineages and found highly significant evidence challenging all current single hypotheses of their basal origin. The Exafroplacentalia hypothesis (Afrotheria as the sister group to all remaining placentals) is significantly supported by five retroposon insertions, the Epitheria hypothesis (Xenarthra as the sister group to all remaining placentals) by nine insertion patterns, and the Atlantogenata hypothesis (a monophyletic clade comprising Xenarthra and Afrotheria as the sister group to Boreotheria comprising all remaining placentals) by eight insertion patterns. These findings provide significant support for a “soft” polytomy of the major mammalian clades. Ancestral successive hybridization events and/or incomplete lineage sorting associated with short speciation intervals are viable explanations for the mosaic retroposon insertion patterns of recent placental mammals and for the futile search for a clear root dichotomy. PMID:19261842

  3. Mosaic retroposon insertion patterns in placental mammals.

    PubMed

    Churakov, Gennady; Kriegs, Jan Ole; Baertsch, Robert; Zemann, Anja; Brosius, Jürgen; Schmitz, Jürgen

    2009-05-01

    One and a half centuries after Charles Darwin and Alfred Russel Wallace outlined our current understanding of evolution, a new scientific era is dawning that enables direct observations of genetic variation. However, pure sequence-based molecular attempts to resolve the basal origin of placental mammals have so far resulted only in apparently conflicting hypotheses. By contrast, in the mammalian genomes where they were highly active, the insertion of retroelements and their comparative insertion patterns constitute a neutral, virtually homoplasy-free archive of evolutionary histories. The "presence" of a retroelement at an orthologous genomic position in two species indicates their common ancestry in contrast to its "absence" in more distant species. To resolve the placental origin controversy we extracted approximately 2 million potentially phylogenetically informative, retroposon-containing loci from representatives of the major placental mammalian lineages and found highly significant evidence challenging all current single hypotheses of their basal origin. The Exafroplacentalia hypothesis (Afrotheria as the sister group to all remaining placentals) is significantly supported by five retroposon insertions, the Epitheria hypothesis (Xenarthra as the sister group to all remaining placentals) by nine insertion patterns, and the Atlantogenata hypothesis (a monophyletic clade comprising Xenarthra and Afrotheria as the sister group to Boreotheria comprising all remaining placentals) by eight insertion patterns. These findings provide significant support for a "soft" polytomy of the major mammalian clades. Ancestral successive hybridization events and/or incomplete lineage sorting associated with short speciation intervals are viable explanations for the mosaic retroposon insertion patterns of recent placental mammals and for the futile search for a clear root dichotomy. PMID:19261842

  4. Transgenic cassava resistance to African cassava mosaic virus is enhanced by viral DNA-A bidirectional promoter-derived siRNAs.

    PubMed

    Vanderschuren, Hervé; Akbergenov, Rashid; Pooggin, Mikhail M; Hohn, Thomas; Gruissem, Wilhelm; Zhang, Peng

    2007-07-01

    Expression of double-stranded RNA (dsRNA) homologous to virus sequences can effectively interfere with RNA virus infection in plant cells by triggering RNA silencing. Here we applied this approach against a DNA virus, African cassava mosaic virus (ACMV), in its natural host cassava. Transgenic cassava plants were developed to express small interfering RNAs (siRNA) from a CaMV 35S promoter-controlled, intron-containing dsRNA cognate to the common region-containing bidirectional promoter of ACMV DNA-A. In two of three independent transgenic lines, accelerated plant recovery from ACMV-NOg infection was observed, which correlates with the presence of transgene-derived siRNAs 21-24 nt in length. Overall, cassava mosaic disease symptoms were dramatically attenuated in these two lines and less viral DNA accumulation was detected in their leaves than in those of wild-type plants. In a transient replication assay using leaf disks from the two transgenic lines, strongly reduced accumulation of viral single-stranded DNA was observed. Our study suggests that a natural RNA silencing mechanism targeting DNA viruses through production of virus-derived siRNAs is turned on earlier and more efficiently in transgenic plants expressing dsRNA cognate to the viral promoter and common region. PMID:17492253

  5. Art with Stones: From the Cave Age until Today with Parallels Seen in the Artistic, Symbolic and Creative Development of Young Children's Mosaic Making.

    ERIC Educational Resources Information Center

    Matejovsky-Nikoltsos, Catherine

    This paper first gives a historical overview of mosaics, discussing mosaic masks made by the Aztecs and floor mosaics made by the Greeks, as well as the Roman mosaics at Pompeii and the Byzantine decorative mosaics exemplified by those at Ravenna. The paper then elaborates on children's mosaic making observed during research conducted between 1986…

  6. Complete Genome Sequence of Tomato Mosaic Virus Isolated from Jasmine in the United States.

    PubMed

    Fillmer, Kornelia; Adkins, Scott; Pongam, Patchara; D'Elia, Tom

    2015-01-01

    Tomato mosaic virus was reported from jasmine in Florida. We present the first complete genome sequence of a tomato mosaic virus isolate from this woody perennial plant in the United States. PMID:26159525

  7. First Complete Genome Sequence of a Watermelon Mosaic Virus Isolated from Watermelon in the United States

    PubMed Central

    Rajbanshi, Naveen

    2016-01-01

    Watermelon mosaic virus was first reported in 1965 from the Rio Grande Valley, TX. We report here the first complete genome sequence of a watermelon mosaic virus isolate from watermelon collected from the Rio Grande Valley of Texas. PMID:27103724

  8. First Complete Genome Sequence of a Watermelon Mosaic Virus Isolated from Watermelon in the United States.

    PubMed

    Rajbanshi, Naveen; Ali, Akhtar

    2016-01-01

    Watermelon mosaic virus was first reported in 1965 from the Rio Grande Valley, TX. We report here the first complete genome sequence of a watermelon mosaic virus isolate from watermelon collected from the Rio Grande Valley of Texas. PMID:27103724

  9. Ultra(high)-pressure liquid chromatography-electrospray ionization-time-of-flight-ion mobility-high definition mass spectrometry for the rapid identification and structural characterization of flavonoid glycosides from cauliflower waste.

    PubMed

    Gonzales, Gerard Bryan; Raes, Katleen; Coelus, Sofie; Struijs, Karin; Smagghe, Guy; Van Camp, John

    2014-01-01

    In this paper, a strategy for the detection and structural elucidation of flavonoid glycosides from a complex matrix in a single chromatographic run using U(H)PLC-ESI-IMS-HDMS/MS(E) is presented. This system operates using alternative low and high energy voltages that is able to perform the task of conventional MS/MS in a data-independent way without re-injection of the sample, which saves analytical time. Also, ion mobility separation (IMS) was employed as an additional separation technique for compounds that are co-eluting after U(H)PLC separation. First, the fragmentation of flavonoid standards were analyzed and criteria was set for structural elucidation of flavonoids in a plant extract. Based on retention times, UV spectra, exact mass, and MS fragment characteristics, such as abundances of daughter ions and the presence of radical ions ([Y0-H](-)), a total 19 flavonoid glycosides, of which 8 non-acylated and 11 acylated, were detected and structurally characterized in a cauliflower waste extract. Kaempferol and quercetin were the main aglycones detected while sinapic and ferulic acid were the main phenolic acids. C-glycosides were also found although their structure could not be elucidated. The proposed method can be used as a rapid screening test for flavonoid identification and for routine analysis of plant extracts, such as these derived from cauliflower waste. The study also confirms that agroindustrial wastes, such as cauliflower leaves, could be seen as a valuable source of different bioactive phenolic compounds. PMID:24280615

  10. Mosaic KCNJ2 mutation in Andersen-Tawil syndrome: targeted deep sequencing is useful for the detection of mosaicism.

    PubMed

    Hasegawa, K; Ohno, S; Kimura, H; Itoh, H; Makiyama, T; Yoshida, Y; Horie, M

    2015-03-01

    Andersen-Tawil syndrome (ATS) is an inherited disease characterized by ventricular arrhythmias, periodic paralysis, and dysmorphic features. It results from a heterozygous mutation of KCNJ2, but little is known about mosaicism in ATS. We performed genetic analysis of KCNJ2 in 32 ATS probands and their family members and identified KCNJ2 mutations in 25 probands, 20 families who underwent extensive genetic testing. These tests revealed that seven probands carried de novo mutations while 13 carried inherited mutations from their parents. We then specifically assessed a single proband and the respective family. The proband was a 9 year old girl who fulfilled the ATS triad and carried an insertion mutation (p.75_76insThr). We determined that the proband's mother carried a somatic mosaicism and that the proband's younger brother also carried the ATS phenotype with the same insertion mutation. The mother, who exhibited mosaicism, was asymptomatic, although she exhibited Q(T)U prolongation. Mutant allele frequency was 11% as per TA cloning and 17.3% as per targeted deep sequencing. Our observations suggest that targeted deep sequencing is useful for the detection of mosaicism and that the detection of mosaic mutations in parents of apparently sporadic ATS patients can help in the process of genetic counseling. PMID:24635491

  11. Graph theory approach for match reduction in image mosaicing.

    PubMed

    Elibol, Armagan; Gracias, Nuno; Garcia, Rafael; Kim, Jinwhan

    2014-04-01

    One of the crucial steps in image mosaicing is global alignment, which requires finding the best image registration parameters by employing nonlinear minimization methods over correspondences between overlapping image pairs for a dataset. Based on graph theory, we propose a simple but efficient method to reduce the number of overlapping image pairs without any noticeable effect on the final mosaic quality. This reduction significantly lowers the computational cost of the image mosaicing process. The proposed method can be applied in a topology estimation process to reduce the number of image matching attempts. The method has been validated through experiments on challenging underwater image sequences obtained during sea trials with different unmanned underwater vehicles. PMID:24695139

  12. Somatic Mosaicism: Implications for Disease and Transmission Genetics

    PubMed Central

    Campbell, Ian M.; Shaw, Chad A.; Stankiewicz, Pawel; Lupski, James R.

    2015-01-01

    Nearly all of the genetic material among cells within an organism is identical. However, single nucleotide variants (SNVs), indels, copy number variants (CNVs), and other structural variants (SVs) continually accumulate as cells divide during development. This process results in an organism composed of countless cells, each with its own unique personal genome. Thus, every human is undoubtedly mosaic. Mosaic mutations can go unnoticed, underlie genetic disease or normal human variation, and may be transmitted to the next generation as constitutional variants. Here, we review the influence of the developmental timing of mutations, the mechanisms by which they arise, methods for detecting mosaic variants, and the risk of passing these mutations on to the next generation. PMID:25910407

  13. Image mosaic method based on SIFT features of line segment.

    PubMed

    Zhu, Jun; Ren, Mingwu

    2014-01-01

    This paper proposes a novel image mosaic method based on SIFT (Scale Invariant Feature Transform) feature of line segment, aiming to resolve incident scaling, rotation, changes in lighting condition, and so on between two images in the panoramic image mosaic process. This method firstly uses Harris corner detection operator to detect key points. Secondly, it constructs directed line segments, describes them with SIFT feature, and matches those directed segments to acquire rough point matching. Finally, Ransac method is used to eliminate wrong pairs in order to accomplish image mosaic. The results from experiment based on four pairs of images show that our method has strong robustness for resolution, lighting, rotation, and scaling. PMID:24511326

  14. Cowpea mosaic virus nanoparticles target surface vimentin on cancer cells

    PubMed Central

    Steinmetz, Nicole F; Cho, Choi-Fong; Ablack, Amber; Lewis, John D; Manchester, Marianne

    2011-01-01

    Aims Vimentin, a type III intermediate filament, is upregulated during epithelial–mesenchymal transition and tumor progression. Vimentin is surface-expressed on cells involved in inflammation; the function remains unknown. We investigated the expression of surface vimentin on cancer cells and evaluated targeting nanoparticles to tumors exploiting vimentin. Materials & methods Cowpea mosaic virus nanoparticles that interact with surface vimentin were used as probes. Tumor homing was tested using the chick chorioallantoic membrane model with human tumor xenografts. Results & discussion Surface vimentin levels varied during cell cycle and among the cell lines tested. Surface vimentin expression correlated with cowpea mosaic virus uptake, underscoring the utility of cowpea mosaic virus to detect invasive cancer cells. Targeting to tumor xenografts was observed; homing was based on the enhanced permeability and retention effect. Our data provide novel insights into the role of surface vimentin in cancer and targeting nanoparticles in vivo. PMID:21385137

  15. Phenotypic extremes in liveborn monozygotic twins with mosaic Edwards syndrome.

    PubMed

    Bussmann, Neidin; Cunningham, Katie; Green, Andrew; Ryan, C Anthony

    2015-01-01

    Mosaic trisomy 18 (Edwards syndrome) in monozygotic diamniotic liveborn twins is rare. We describe such a case involving preterm male infants. Although both infants had a low percentage of trisomy 18 cells in peripheral blood leucocytes, their varied phenotypic presentation of mosaic trisomy 18 resulted in one twin surviving, with the other twin's demise at 1 month of age. Despite the presence of trisomy 18 in peripheral leucocytes, further analysis of a buccal smear and skin biopsy of the surviving twin did not show evidence of trisomy 18. Establishing such diagnoses in a timely manner is imperative for the child, parents and clinicians. The clinical course of these twins reflects the unpredictable prognosis associated with the diagnosis of mosaic trisomy 18, and emphasises the challenges that can be encountered when counselling parents. PMID:26561224

  16. Characterization of interfaces in mosaic CVD diamond crystal

    NASA Astrophysics Data System (ADS)

    Muchnikov, Anatoly B.; Radishev, Dmitry B.; Vikharev, Anatoly L.; Gorbachev, Alexei M.; Mitenkin, Anatoly V.; Drozdov, Mikhail N.; Drozdov, Yuri N.; Yunin, Pavel A.

    2016-05-01

    Detailed description of a way to accrete diamond single crystals in one plate using the CVD method is presented. It was found that each region of the mosaic CVD diamond crystal grown over a certain seed substrate "inherits" the crystallographic orientation of its substrate. No correlation was found between the value of misorientation of the accreted crystals and entrance of hydrogen to the boundary. It is shown that successful accretion of single crystal diamond plates in a single mosaic crystal occurs even in the case of great misorientation of crystals. The mechanical stresses appear during the fabrication of the mosaic CVD diamond crystal. Stresses accumulate during accretion of the regions, which grow over substrates with different orientations, in a common structure.

  17. Mosaic acquisition and processing for optical-resolution photoacoustic microscopy

    NASA Astrophysics Data System (ADS)

    Shao, Peng; Shi, Wei; Chee, Ryan K. W.; Zemp, Roger J.

    2012-08-01

    In optical-resolution photo-acoustic microscopy (OR-PAM), data acquisition time is limited by both laser pulse repetition rate (PRR) and scanning speed. Optical-scanning offers high speed, but limited, field of view determined by ultrasound transducer sensitivity. In this paper, we propose a hybrid optical and mechanical-scanning OR-PAM system with mosaic data acquisition and processing. The system employs fast-scanning mirrors and a diode-pumped, nanosecond-pulsed, Ytterbium-doped, 532-nm fiber laser with PRR up to 600 kHz. Data from a sequence of image mosaic patches is acquired systematically, at predetermined mechanical scanning locations, with optical scanning. After all imaging locations are covered, a large panoramic scene is generated by stitching the mosaic patches together. Our proposed system is proven to be at least 20 times faster than previous reported OR-PAM systems.

  18. Constitutional partial 1q trisomy mosaicism and Wilms tumor.

    PubMed

    Mark, Hon Fong L; Wyandt, Herman; Pan, Agen; Milunsky, Jeff M

    2005-10-15

    We report on a female patient with severe-profound mental retardation, multiple congenital anomalies, as well as a history of mosaicism for partial 1q trisomy in the amniotic fluid and a previous Wilms tumor specimen. Peripheral blood and fibroblasts were studied and did not demonstrate the mosaicism initially detected for 1q. Array comparative genomic hybridization yielded negative results. Additional cytogenetic studies helped clarify the previous findings and revealed evidence of partial 1q trisomy mosaicism in normal kidney tissue and in a kidney lesion. GTG-banded results showing low-percentage mosaicism for the structural rearrangement der(1)t(1;1)(p36.1;q23) in both tissues were corroborated by fluorescence in situ hybridization studies. We hypothesize that the partial 1q trisomy predisposed the target tissue (in this case kidney) to neoplasia. This study provides further support for the hypothesis that certain constitutional chromosomal abnormalities can predispose to cancer. As detection of a low-percentage mosaicism may be hampered by the limits imposed by currently available technology and the constraint of a finite sample size, extra vigilance in monitoring other somatic tissues will be needed throughout the patient's lifetime. Anticipatory clinical guidance and prognostication are meaningful only if given accurate cytogenetic diagnoses. To the best of our knowledge, this is the first reported case of Wilms tumor associated with constitutional partial 1q trisomy, either in pure or mosaic form, with the particular 1q23 breakpoint in conjunction with a break on 1p36.1. PMID:16213366

  19. Characterisation and diagnosis of frangipani mosaic virus from India.

    PubMed

    Kumar, Alok; Solanki, Vikas; Verma, H N; Mandal, Bikash

    2015-10-01

    Frangipani mosaic virus (FrMV) is known to infect frangipani tree (Plumeria rubra f. acutifolia) in India but the virus has not been characterized at genomic level and diagnosis is not available. In the present study, an isolate of FrMV (FrMV-Ind-1) showing greenish mosaic and vein-banding symptoms in P. rubra f. acutifolia in New Delhi was characterized based on host reactions, serology and genome sequence. The virus isolate induced local symptoms on several new experimental host species: Capsicum annuum (chilli), Nicotiana benthamiana, Solanum lycopersicum and S. melongena. N. benthamiana could be used as an efficient propagation host as it developed systemic mottle mosaic symptoms all round the year. The genome of FrMV-Ind-1 was 6643 (JN555602) nucleotides long with genome organization similar to tobamoviruses. The Indian isolate of FrMV shared a very close genome sequence identity (98.3 %) with the lone isolate of FrMV-P from Australia. FrMV-Ind-1 together with FrMV-P formed a new phylogenetic group i.e. Apocynaceae-infecting tobamovirus. The polyclonal antiserum generated through the purified virus preparation was successfully utilized to detect the virus in field samples of frangipani by ELISA. Of the eight different tobamoviruses tested, FrMV-Ind-1 shared distant serological relationships with only cucumber green mottle mosaic virus, tobacco mosaic virus, bell pepper mottle virus and kyuri green mottle mosaic virus. RT-PCR based on coat protein gene primer successfully detected the virus in frangipani plants. This study is the first comprehensive description of FrMV occurring in India. PMID:26239043

  20. Clinical features of 58 Japanese patients with mosaic neurofibromatosis 1.

    PubMed

    Tanito, Katsumi; Ota, Arihito; Kamide, Ryoichi; Nakagawa, Hidemi; Niimura, Michihito

    2014-08-01

    Neurofibromatosis type 1 (NF1) is an autosomal dominant disorder caused by mutation in the NF1 tumor-suppressor gene, and may sometimes manifest in a mosaic form. "Segmental NF1" is generally assumed to be the result of somatic mosaicism for a NF1 mutation, and patients with mosaic NF1 have typical features of NF1 limited to specific body segments. The clinical features of 58 patients (42 females and 16 males; aged 1-69 years; mean age, 23.4 years) with mosaic NF1 seen at the Jikei University Hospital during 2004-2007 and at the Jikei University Daisan Hospital during 2007-2011, were retrospectively studied. Somatic or gonosomal mosaicism was not investigated. Patients were classified into four groups: (i) pigmentary changes (café-au-lait spots and freckling) only (n = 32); (ii) neurofibromas only (n = 5); (iii) neurofibromas and pigmentary changes (n = 13); and (iv) solitary plexiform neurofibromas (n = 8). The area of involvement was variable. The majority of patients were asymptomatic, except patients with plexiform neurofibromas who presented most commonly with pain or tenderness. Lisch nodules were rarely seen. Only four of our 58 patients (6.9%) had specific NF1 complications, including language delay (n = 1) and bone deformity (n = 3). Two patients were ascertained through their children with generalized NF1. Patients with mosaic NF1 are at low risk of developing disease-associated complications, except patients with plexiform neurofibromas. However, they need to be aware of the small risk of having a child with generalized NF1. PMID:25041723

  1. Model for Simulating Aerosol Interactions and Chemistry (MOSAIC)

    SciTech Connect

    Zaveri, Rahul A.; Easter, Richard C.; Fast, Jerome D.; Peters, Len K.

    2008-07-03

    This paper describes the development and evaluation of a new Model for Simulating Aerosol Interactions and Chemistry (MOSAIC), with a special focus on addressing the long-standing issues associated with solving the dynamic partitioning of semi-volatile inorganic gases (HNO3, HCl, and NH3) to size-distributed atmospheric aerosol particles. The coupled ordinary differential equations (ODE) for dynamic gas-particle mass transfer are extremely stiff, and the available numerical techniques are either too expensive or produce oscillatory and/or inaccurate steady-state solutions. These limitations are overcome in MOSAIC, which couples an accurate and computationally efficient thermodynamic module [Zaveri et al., 2005a,b] with a new dynamic gas-particle partitioning module described here. The algorithm involves time-split integrations of non-volatile and semi-volatile species, and a new concept of “dynamic pH” and an adaptive time-stepping scheme hold the key to smooth, accurate, and efficient solutions over the entire relative humidity range. MOSAIC is found to be in excellent agreement with a benchmark version of the model that uses LSODES (a Gear solver) for rigorously integrating the stiff ODEs. The steady-state MOSAIC results for monodisperse aerosol test cases are also in excellent agreement with those obtained with the benchmark equilibrium model AIM. MOSAIC is also evaluated within a 3-D model, and the average CPU speed is estimated to be over 100 times faster than the dynamic aerosol model MADM [Pilinis et al., 2000]. These results suggest that MOSAIC is highly attractive for use in 3-D aerosol and air quality models in which both accuracy and efficiency are critically important.

  2. Mosaic structural variation in children with developmental disorders

    PubMed Central

    King, Daniel A.; Jones, Wendy D.; Crow, Yanick J.; Dominiczak, Anna F.; Foster, Nicola A.; Gaunt, Tom R.; Harris, Jade; Hellens, Stephen W.; Homfray, Tessa; Innes, Josie; Jones, Elizabeth A.; Joss, Shelagh; Kulkarni, Abhijit; Mansour, Sahar; Morris, Andrew D.; Parker, Michael J.; Porteous, David J.; Shihab, Hashem A.; Smith, Blair H.; Tatton-Brown, Katrina; Tolmie, John L.; Trzaskowski, Maciej; Vasudevan, Pradeep C.; Wakeling, Emma; Wright, Michael; Plomin, Robert; Timpson, Nicholas J.; Hurles, Matthew E.

    2015-01-01

    Delineating the genetic causes of developmental disorders is an area of active investigation. Mosaic structural abnormalities, defined as copy number or loss of heterozygosity events that are large and present in only a subset of cells, have been detected in 0.2–1.0% of children ascertained for clinical genetic testing. However, the frequency among healthy children in the community is not well characterized, which, if known, could inform better interpretation of the pathogenic burden of this mutational category in children with developmental disorders. In a case–control analysis, we compared the rate of large-scale mosaicism between 1303 children with developmental disorders and 5094 children lacking developmental disorders, using an analytical pipeline we developed, and identified a substantial enrichment in cases (odds ratio = 39.4, P-value 1.073e − 6). A meta-analysis that included frequency estimates among an additional 7000 children with congenital diseases yielded an even stronger statistical enrichment (P-value 1.784e − 11). In addition, to maximize the detection of low-clonality events in probands, we applied a trio-based mosaic detection algorithm, which detected two additional events in probands, including an individual with genome-wide suspected chimerism. In total, we detected 12 structural mosaic abnormalities among 1303 children (0.9%). Given the burden of mosaicism detected in cases, we suspected that many of the events detected in probands were pathogenic. Scrutiny of the genotypic–phenotypic relationship of each detected variant assessed that the majority of events are very likely pathogenic. This work quantifies the burden of structural mosaicism as a cause of developmental disorders. PMID:25634561

  3. Wheat streak mosaic virus-Structural parameters for a Potyvirus

    SciTech Connect

    Parker, Lauren; Kendall, Amy; Berger, P.H.; Shiel, P.J.; Stubbs, Gerald . E-mail: gerald.stubbs@vanderbilt.edu

    2005-09-15

    Wheat streak mosaic virus is a Tritimovirus, a member of the Potyviridae family, which includes the very large Potyvirus genus. We have examined wheat streak mosaic virus by electron microscopy and fiber diffraction from partially oriented sols, and analyzed the results to estimate the symmetry and structural parameters of the viral helix. The virions have an apparent radius of 63 {+-} 5 A. The viral helix has a pitch of 33.4 A {+-} 0.6 A. There appear to be 6.9 subunits per turn of the helix, although we cannot completely eliminate values of 5.9 or 7.9 for this parameter.

  4. A new ophiovirus is associated with blueberry mosaic disease.

    PubMed

    Thekke-Veetil, Thanuja; Ho, Thien; Keller, Karen E; Martin, Robert R; Tzanetakis, Ioannis E

    2014-08-30

    Blueberry mosaic disease (BMD) was first described more than 60 years ago and is caused by a yet unidentified graft transmissible agent. A combination of traditional methods and next generation sequencing disclosed the presence of a new ophiovirus in symptomatic plants. The virus was detected in all BMD samples collected from several production areas of North America and was thus named blueberry mosaic associated virus. Phylogenetic analysis, supported by high bootstrap values, places the virus within the family Ophioviridae. The genome organization resembles that of citrus psorosis virus, the type member of the genus Ophiovirus. The implications of this discovery in BMD control and blueberry virus certification schemes are also discussed. PMID:24874194

  5. Acne in Klinefelter Syndrome-46XY/47XXY Mosaicism?

    PubMed

    Lakshmi, Chembolli; Swarnalakshimi, Selvaraj

    2015-01-01

    Klinefelter syndrome (KFS) is the most common non-heritable sex chromosome anomaly caused by nondisjunction during cell division and contains two or more X chromosomes. More than two third of all cases are homogenous (47XXY) and the remaining are mosaic (46XY/47XXY). Lower limb ulcers are frequently observed and attributed to impaired fibrinolysis. A case of KFS with post acne scars and leg ulcers is presented. The rarity of acne in this syndrome is explained by the phenomenon of mosaicism. PMID:26538700

  6. Digital Mammography with a Mosaic of CCD Arrays

    NASA Technical Reports Server (NTRS)

    Jalink, Antony, Jr. (Inventor); McAdoo, James A. (Inventor)

    1998-01-01

    A digital mammography device uses a mosaic of electronic digital imaging arrays to scan an x-ray image is discussed. The mosaic of arrays is repositioned several times to expose different portions of the image, until the entire image is scanned. The data generated by the arrays during each exposure is stored in a computer. After the final exposure, the computer combines data of the several partial images to produce a composite of the original x-ray image. An aperture plate is used to reduce scatter and the overall exposure of the patient to x-rays.

  7. Role of wheat streak mosaic virus-encoded proteins in disease development

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Eriophyid mite-transmitted wheat streak mosaic virus (WSMV) and Triticum mosaic virus (TriMV) are the type species of Tritimovirus and Poacevirus genera, respectively, in the family Potyviridae. TriMV and WSMV exhibit differential symptom phenotypes on wheat: TriMV elicits mild mosaic and mottling ...

  8. First report of Sugarcane mosaic virus infecting Columbus Grass (Sorghum almum) in the United States

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Mosaic symptoms in sorghum can be caused by several potyviruses [family Potyviridae], including Sorghum mosaic virus (SrMV) and Sugarcane mosaic virus (SCMV). SrMV and SCMV are responsible for global economic losses in sorghum, maize, and sugarcane. Ten plants of Columbus grass (Sorghum almum) exhib...

  9. HEXAGON MOSAIC MAPS FOR DISPLAY OF UNIVARIATE AND BIVARIATE GEOGRAPHICAL DATA

    EPA Science Inventory

    Hexagon mosaic maps and hexagon-based ray glyph maps are presented. he phrase "hexagon mosaic map" refers to maps that use hexagons to tessellate major areas of a map such as land masses. exagon mosaic maps are similar to color-contour (isarithm) maps and show broad regional patt...

  10. False Color Mosaic Great Red Spot

    NASA Technical Reports Server (NTRS)

    1996-01-01

    False color representation of Jupiter's Great Red Spot (GRS) taken through three different near-infrared filters of the Galileo imaging system and processed to reveal cloud top height. Images taken through Galileo's near-infrared filters record sunlight beyond the visible range that penetrates to different depths in Jupiter's atmosphere before being reflected by clouds. The Great Red Spot appears pink and the surrounding region blue because of the particular color coding used in this representation. Light reflected by Jupiter at a wavelength (886 nm) where methane strongly absorbs is shown in red. Due to this absorption, only high clouds can reflect sunlight in this wavelength. Reflected light at a wavelength (732 nm) where methane absorbs less strongly is shown in green. Lower clouds can reflect sunlight in this wavelength. Reflected light at a wavelength (757 nm) where there are essentially no absorbers in the Jovian atmosphere is shown in blue: This light is reflected from the deepest clouds. Thus, the color of a cloud in this image indicates its height. Blue or black areas are deep clouds; pink areas are high, thin hazes; white areas are high, thick clouds. This image shows the Great Red Spot to be relatively high, as are some smaller clouds to the northeast and northwest that are surprisingly like towering thunderstorms found on Earth. The deepest clouds are in the collar surrounding the Great Red Spot, and also just to the northwest of the high (bright) cloud in the northwest corner of the image. Preliminary modeling shows these cloud heights vary over 30 km in altitude. This mosaic, of eighteen images (6 in each filter) taken over a 6 minute interval during the second GRS observing sequence on June 26, 1996, has been map-projected to a uniform grid of latitude and longitude. North is at the top.

    Launched in October 1989, Galileo entered orbit around Jupiter on December 7, 1995. The spacecraft's mission is to conduct detailed studies of the giant planet

  11. Development of a multiplexed PCR detection method for Barley and Cereal Yellow Dwarf Viruses, Wheat Spindle Streak Virus, Wheat Streak Mosaic Virus and Soil-Borne Wheat Mosaic Virus

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Barley and Cereal Yellow Dwarf Viruses (B/CYDVs), Wheat Spindle Streak Mosaic (WSSMV), Soil-Borne Wheat Mosaic (SBWMV) Mosaic Virus and Wheat Streak Mosaic Virus (WSMV) constitute the most economically important group of wheat viruses. In this paper, a multiplex reverse transcription polymerase chai...

  12. The mosaics of Mars: As seen by the Viking Lander cameras

    NASA Technical Reports Server (NTRS)

    Levinthal, E. C.; Jones, K. L.

    1980-01-01

    The mosaics and derivative products produced from many individual high resolution images acquired by the Viking Lander Camera Systems are described: A morning and afternoon mosaic for both cameras at the Lander 1 Chryse Planitia site, and a morning, noon, and afternoon camera pair at Utopia Planitia, the Lander 11 site. The derived products include special geometric projections of the mosaic data sets, polar stereographic (donut), stereoscopic, and orthographic. Contour maps and vertical profiles of the topography were overlaid on the mosaics from which they were derived. Sets of stereo pairs were extracted and enlarged from stereoscopic projections of the mosaics.

  13. EXPRESSION OF THE MAIZE MOSAIC VIRUS GLYCOPROTEIN IN INSECT CELLS

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Maize mosaic virus (genus Nucleorhabdovirus, family Rhabdoviridae) is transmitted in a persistent-propagative manner by Peregrinus maidis, the corn planthopper. Like other rhabdoviruses, the MMV genome encodes a surface glycoprotein that is likely involved in virus attachment and entry into host ce...

  14. Asymmetry and skin pigmentary anomalies in chromosome mosaicism.

    PubMed Central

    Woods, C G; Bankier, A; Curry, J; Sheffield, L J; Slaney, S F; Smith, K; Voullaire, L; Wellesley, D

    1994-01-01

    We report six persons mosaic for a chromosome anomaly. All were mentally retarded and dysmorphic. Unilateral or asymmetrical features were found in all cases, in one an unusual transverse terminal limb anomaly, and in the others various degrees of hemiatrophy of the left side of the body. Five of the subjects had skin pigmentary anomalies which were distributed in the lines of Blaschko. The abnormal cell lines found were ring chromosome 22, trisomy 22, a large acrocentric marker, a deletion of 18q, a deletion of 8q, and triploidy. In four cases the clinical diagnosis was only confirmed by skin biopsy. In one case low level mosaicism in blood was fortuitously detected because of cytogenetic fragile X screening and confirmed in a skin biopsy. The sixth case was of dynamic mosaicism of a non-mosaic deletion 18q with a chromosome 18 derived marker present in a proportion of cells. Chromosome mosaicisn may cause subtle and asymmetrical clinical features and can require repeated cytogenetic investigations. The diagnosis should be actively sought as it enables accurate genetic counselling to be given. Images PMID:7815438

  15. A nearly real-time UAV video flow mosaic method

    NASA Astrophysics Data System (ADS)

    Zheng, H.; Jiang, C.; Sun, M.; Li, X. D.; Xiang, R.; Liu, Lei

    2014-12-01

    In order to solve the problem of low accuracy and high computation cost of current video mosaic methods, and also to acquire large field of view images by the unmanned aerial vehicles (UAV), which have high accuracy and high resolution, this paper propose a method for near real-time mosaic of video flow, so that we can provide essential reference data for the earthquake relief, as well as post-disaster reconstruction and recovery, in time. In this method, we obtain the flight area scope in the route planning process, and calculate the sizes of each frame with sensor sizes and altitudes. Given an overlap degree, time intervals are calculated, and key frames are extracted. After that, feature points are detected in each frame, and they are matched using Hamming distance. The RANSAC algorithm is then applied to remove error matching and calculate parameters of the transformation model. In one-strip case, the newly extracted frame is taken as the reference image in the first half, while after the middle frame is extracted, it is the reference one until the end. Experimental results show that our method can reduce the cascading error, and improve the accuracy and quality of the mosaic images, near real-time mosaic of aerial video flow is feasible.

  16. RNAi mediated, stable resistance to Triticum mosaic virus in wheat

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Triticum mosaic virus (TriMV), discovered in 2006, affects wheat production systems in the Great Plains of the United States. There are no available TriMV resistant commercial varieties. RNA interference (RNAi) was evaluated as an alternative strategy to generate resistance to TriMV. An RNAi pANDA...

  17. 42. PRESSING A SLAB OF CLAY ONTO A MOSAIC MOLD. ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    42. PRESSING A SLAB OF CLAY ONTO A MOSAIC MOLD. THE MOLD, WHICH HAS A RAISED DESIGN, LEAVES AND OUTLINE IN THE SLAB, THE PIECES THUS DEFINED, ARE THEN CUT APART TO BE FIRED SEPARATELY AND REASSEMBLED. - Moravian Pottery & Tile Works, Southwest side of State Route 313 (Swamp Road), Northwest of East Court Street, Doylestown, Bucks County, PA

  18. First report of apple mosaic virus in Alaska

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Apple mosaic virus (ApMV, family Bromoviridae, genus Ilarvirus) is one of the oldest and most economically important viruses of apples (Malus x domestica Borkh.). Yield losses may vary from negligible to as high as fifty percent, depending on the affected cultivar. Although ApMV is found worldwide...

  19. Mosaic. Hispanic Sub-Cultural Values: Similarities and Differences.

    ERIC Educational Resources Information Center

    Rutgers, The State Univ., New Brunswick, NJ. Inst. for Intercultural Relations and Ethnic Studies.

    This issue of Mosaic magazine contains several articles focusing on the similarities and differences between different Hispanic groups. Each article examines a specific Hispanic culture in order to improve existing and future intercultural education and to foster cultural awareness. The following topics are addressed: (1) values involved in…

  20. Research of x-ray automatic image mosaic method

    NASA Astrophysics Data System (ADS)

    Liu, Bin; Chen, Shunan; Guo, Lianpeng; Xu, Wanpeng

    2013-10-01

    Image mosaic has widely applications value in the fields of medical image analysis, and it is a technology that carries on the spatial matching to a series of image which are overlapped with each other, and finally builds a seamless and high quality image which has high resolution and big eyeshot. In this paper, the method of grayscale cutting pseudo-color enhancement was firstly used to complete the mapping transformation from gray to the pseudo-color, and to extract SIFT features from the images. And then by making use of a similar measure of NCC (normalized cross correlation - Normalized cross-correlation), the method of RANSAC (Random Sample Consensus) was used to exclude the pseudofeature points right in order to complete the exact match of feature points. Finally, seamless mosaic and color fusion were completed by using wavelet multi-decomposition. The experiment shows that the method we used can effectively improve the precision and automation of the medical image mosaic, and provide an effective technical approach for automatic medical image mosaic.

  1. 9. 451 MADISON AVENUE, MAIN HALL, SOUTH WALL, MOSAIC TYMPANUM ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    9. 451 MADISON AVENUE, MAIN HALL, SOUTH WALL, MOSAIC TYMPANUM WITH SHELL AND URN MOTIF ENTITLED 'PAX' BY AUGUSTUS SAINT-GAUDENS TO WEST OF FIREPLACE - Villard Houses, 451-457 Madison Avenue & 24 East Fifty-first Street, New York County, NY

  2. A Personal Journey through the "Mosaic of Thought."

    ERIC Educational Resources Information Center

    Penticoff, Judith

    2002-01-01

    Describes how the book "Mosaic of Thought: Teaching Comprehension in a Reader's Workshop" by Ellin Oliver Keene and Susan Zimmerman requires teachers to examine their reading strategies. Examines essential strategies for students to become engaged and independent readers. Considers strategies such as: metacognition; activating prior knowledge;…

  3. Mosaic protein and nucleic acid vaccines against hepatitis C virus

    DOEpatents

    Yusim, Karina; Korber, Bette T. M.; Kuiken, Carla L.; Fischer, William M.

    2013-06-11

    The invention relates to immunogenic compositions useful as HCV vaccines. Provided are HCV mosaic polypeptide and nucleic acid compositions which provide higher levels of T-cell epitope coverage while minimizing the occurrence of unnatural and rare epitopes compared to natural HCV polypeptides and consensus HCV sequences.

  4. Introduction to the World Wide Web and Mosaic

    NASA Technical Reports Server (NTRS)

    Youngblood, Jim

    1994-01-01

    This tutorial provides an introduction to some of the terminology related to the use of the World Wide Web and Mosaic. It is assumed that the user has some prior computer experience. References are included to other sources of additional information.

  5. Familial recurrences of FOXG1-related disorder: Evidence for mosaicism.

    PubMed

    McMahon, Kelly Q; Papandreou, Apostolos; Ma, Mandy; Barry, Brenda J; Mirzaa, Ghayda M; Dobyns, William B; Scott, Richard H; Trump, Natalie; Kurian, Manju A; Paciorkowski, Alex R

    2015-12-01

    FOXG1-related disorders are caused by heterozygous mutations in FOXG1 and result in a spectrum of neurodevelopmental phenotypes including postnatal microcephaly, intellectual disability with absent speech, epilepsy, chorea, and corpus callosum abnormalities. The recurrence risk for de novo mutations in FOXG1-related disorders is assumed to be low. Here, we describe three unrelated sets of full siblings with mutations in FOXG1 (c.515_577del63, c.460dupG, and c.572T > G), representing familial recurrence of the disorder. In one family, we have documented maternal somatic mosaicism for the FOXG1 mutation, and all of the families presumably represent parental gonadal (or germline) mosaicism. To our knowledge, mosaicism has not been previously reported in FOXG1-related disorders. Therefore, this report provides evidence that germline mosaicism for FOXG1 mutations is a likely explanation for familial recurrence and should be considered during recurrence risk counseling for families of children with FOXG1-related disorders. PMID:26364767

  6. Somatic mosaicism in a patient with neurofibromatosis type 1.

    PubMed Central

    Colman, S. D.; Rasmussen, S. A.; Ho, V. T.; Abernathy, C. R.; Wallace, M. R.

    1996-01-01

    Using loss of heterozygosity analysis, a method designed to detect moderate to large gene deletions, we have identified a new-mutation neurofibromatosis type 1 (NF1) patient who is somatically mosaic for a large maternally derived deletion in the NF1 gene region. The deletion extends at least from exon 4 near the 5' end of the gene to intron 39 near the 3' end. The gene-coding region is, therefore, mostly or entirely deleted, encompassing a loss of > or = 100 kb. We hypothesize that the deletion occurred at a relatively early developmental timepoint, since signs of NF1 in this patient are not confined to a specific body region, as seen in "segmental" NF, and since both mesodermally and ectodermally derived cells are affected. This report provides the first molecular evidence of somatic mosaicism in NF1 and, taken together with a recent report of germ-line mosaicism in NF1, adds credence to the concept that mosaicism plays an important role in phenotypic and genetic aspects of NF1 and may even be a relatively common phenomenon. Images Figure 1 Figure 2 Figure 3 Figure 4 PMID:8644707

  7. Zucchini tigre mosaic virus infection of cucurbits in Florida

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Zucchini tigre mosaic virus (ZTMV) was identified infecting cucurbits in Florida in 2002 and again in 2015. This is the first report of ZTMV in the U.S. This report provides an overview of this emerging virus for growers, extension workers, crop consultants, and research and regulatory scientists....

  8. Real-time mosaicing of fetoscopic videos using SIFT

    NASA Astrophysics Data System (ADS)

    Daga, Pankaj; Chadebecq, François; Shakir, Dzhoshkun I.; Herrera, Luis Carlos G.; Tella, Marcel; Dwyer, George; David, Anna L.; Deprest, Jan; Stoyanov, Danail; Vercauteren, Tom; Ourselin, Sebastien

    2016-03-01

    Fetoscopic laser photo-coagulation of the placental vascular anastomoses remains the most effective therapy for twin-to-twin transfusion syndrome (TTTS) in monochorionic twin pregnancies. However, to ensure the success of the intervention, complete photo-coagulation of all anastomoses is needed. This is made difficult by the limited field of view of the fetoscopic video guidance, which hinders the surgeon's ability to locate all the anastomoses. A potential solution to this problem is to expand the field of view of the placental surface by creating a mosaic from overlapping fetoscopic images. This mosaic can then be used for anastomoses localization and spatial orientation during surgery. However, this requires accurate and fast algorithms that can operate within the real-time constraints of fetal surgery. In this work, we present an image mosaicing framework that leverages the parallelism of modern GPUs and can process clinical fetoscopic images in real-time. Initial qualitative results on ex-vivo placental images indicate that the proposed framework can generate clinically useful mosaics from fetoscopic videos in real-time.

  9. Identifying a new causal agent of mosaic in Louisiana sugarcane

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Sugarcane mosaic virus (SCMV) is a pathogen of economic concern that infects maize, sorghum, and sugarcane worldwide. It is a member of the genus Potyvirus in the family Potyviridae and contains a linear, positive sense ssRNA genome 10 kb long. It is transmitted non-persistently via aphids and ...

  10. Detail view looking down at mosaics of everyday objects next ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    Detail view looking down at mosaics of everyday objects next to Living Trailer. Bottle Village is spelled out in shell casings, there are also keys, tiles, watch faces, and plastic parts. View looking north. - Grandma Prisbrey's Bottle Village, 4595 Cochran Street, Simi Valley, Ventura County, CA

  11. PDS Archive of Dawn Framing Camera Vesta Global Mosaics

    NASA Astrophysics Data System (ADS)

    Roatsch, Th.; Kersten, E.; Matz, K.-D.; Preusker, F.; Scholten, F.; Elgner, S.; Schroeder, S. E.; Jaumann, R.; Raymond, C. A.; Russell, C. T.

    2015-06-01

    The Dawn mission mapped the surface of the asteroid 4 Vesta over a period of nearly ten months at altitudes below ~700 km. Global mosaics created from the High and Low Altitude Mapping Orbit (HAMO and LAMO) have been generated and archived with PDS.

  12. New Viruses Found in Fig Exhibiting Mosaic Symptoms

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Mosaic is the most widespread viral disease of fig, affecting the crop wherever it is grown. The causal agent of the disease was poorly characterized, and until recently it was considered a virus-like agent with double membrane bound semispherical bodies transmitted by eriophyid mites. During the mo...

  13. A new Ophiovirus is associated with blueberry mosaic disease

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Blueberry mosaic disease (BMD) was first described more than 60 years ago and is caused by a yet unidentified graft transmissible agent. A combination of traditional methods and next generation sequencing disclosed the presence of a new negative-strand RNA virus in symptomatic plants. The virus was ...

  14. Transmission of Switchgrass mosaic virus by Graminella aureovitatta

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Switchgrass mosaic virus (SwMV) was identified in switchgrass (Panicum virgatum) and was proposed as a new marafivirus based on its genome sequence and comparison with its closest relative, Maize rayado fino virus (MRFV), a type member of the genus, Marafivirus. MRFV only infects maize (Zea mays) an...

  15. Variability in alternanthera mosaic virus isolates from different hosts

    Technology Transfer Automated Retrieval System (TEKTRAN)

    We have determined the complete genome sequences of Alternanthera mosaic virus phlox isolate PA (AltMV-PA) and four infectious clone variants derived from AltMV-SP, as well as partial sequences of other isolates from various types of phlox, and from portulaca, nandina, and cineraria. Phylogenetic co...

  16. Hispanic Women's Health Issues: Understanding A Mosaic Population.

    ERIC Educational Resources Information Center

    Ramirez, Amelie G.; Cousins, Jennifer C.

    According to recent research, Hispanic women are a "mosaic" population, being characterized not only according to subethnic group (Mexican Americans, Puerto Ricans, Cubans, Spanish speakers from other countries) and social dimension (educational attainment, linguistic facilities, cultural and ethnic self-identification), but also according to…

  17. Bemisia tabaci (Homoptera: Aleyrodidae) and Indian cassava mosaic virus transmission

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Bemisia tabaci (Gennadius) adults from colonies reared on cassava or sweet potato plants were studied to determine their ability to transmit Indian cassava mosaic virus (ICMV) (Geminiviridae: Begomovirus) from cassava to cassava. Virus acquisition access (feeding) periods (AAP) of 48 h on ICMV-infec...

  18. Variants of Triticum mosaic virus isolated from wheat in Colorado

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Triticum mosaic virus (TriMV) is a recently discovered virus infecting wheat. We compared the Colorado isolates C10-492 and C11-775 with the 06-123 isolate of TriMV from Kansas (TriMV-K). Comparisons were made using enzyme-linked immunosorbent assay (ELISA), infectivity assay, host range, dry weig...

  19. Fluid Mosaic Membranes and the Light Reactions of Photosynthesis.

    ERIC Educational Resources Information Center

    Hannay, Jack

    1985-01-01

    Discusses: (1) the fluid mosaic membrane structure and light reactions of photosynthesis as exemplified by the Hill and Bendall "Z-scheme"; (2) the arrangement of light-harvesting pigments, electron transport components, and ATP synthesis on chloroplast membranes; and (3) how these topics are treated in A-level textbooks. (JN)

  20. False Color Mosaic of Jupiter's Belt-Zone Boundary

    NASA Technical Reports Server (NTRS)

    1997-01-01

    This false color mosaic shows a belt-zone boundary near Jupiter's equator. The images that make up the four quadrants of this mosaic were taken within a few minutes of each other. Light at each of Galileo's three near-infrared wavelengths is displayed here in the visible colors red, green and blue. Light at 886 nanometers, strongly absorbed by atmospheric methane and scattered from clouds high in the atmosphere, is shown in red. Light at 732 nanometers, moderately absorbed by atmospheric methane, is shown in green. Light at 757 nanometers, scattered mostly from Jupiter's lower visible cloud deck, is shown in blue. The lower cloud deck appears bluish white, while the higher layer appears pinkish. The holes in the upper layer and their relationships to features in the lower cloud deck can be studied in the lower half of the mosaic. Galileo is the first spacecraft to image different layers in Jupiter's atmosphere.

    The edge of the planet runs along the right side of the mosaic. North is at the top. The mosaic covers latitudes -13 to +3 degrees and is centered at longitude 280 degrees west. The smallest resolved features are tens of kilometers in size. These images were taken on Nov. 5, 1996, at a range of 1.2 million kilometers by the solid state imaging (CCD) system aboard NASA's Galileo spacecraft.

    Launched in October 1989, Galileo entered orbit around Jupiter on Dec. 7, 1995. The spacecraft's mission is to conduct detailed studies of the giant planet, its largest moons and the Jovian magnetic environment. The Jet Propulsion Laboratory, Pasadena, CA, manages the mission for NASA's Office of Space Science, Washington, DC.

    This image and other images and data received from Galileo are posted on the World Wide Web Galileo mission home page at http://galileo.jpl.nasa.gov. Background information and educational context for the images can be found at http://www.jpl.nasa.gov/galileo/sepo.

  1. Characterization of Large Structural Genetic Mosaicism in Human Autosomes

    PubMed Central

    Machiela, Mitchell J.; Zhou, Weiyin; Sampson, Joshua N.; Dean, Michael C.; Jacobs, Kevin B.; Black, Amanda; Brinton, Louise A.; Chang, I-Shou; Chen, Chu; Chen, Constance; Chen, Kexin; Cook, Linda S.; Crous Bou, Marta; De Vivo, Immaculata; Doherty, Jennifer; Friedenreich, Christine M.; Gaudet, Mia M.; Haiman, Christopher A.; Hankinson, Susan E.; Hartge, Patricia; Henderson, Brian E.; Hong, Yun-Chul; Hosgood, H. Dean; Hsiung, Chao A.; Hu, Wei; Hunter, David J.; Jessop, Lea; Kim, Hee Nam; Kim, Yeul Hong; Kim, Young Tae; Klein, Robert; Kraft, Peter; Lan, Qing; Lin, Dongxin; Liu, Jianjun; Le Marchand, Loic; Liang, Xiaolin; Lissowska, Jolanta; Lu, Lingeng; Magliocco, Anthony M.; Matsuo, Keitaro; Olson, Sara H.; Orlow, Irene; Park, Jae Yong; Pooler, Loreall; Prescott, Jennifer; Rastogi, Radhai; Risch, Harvey A.; Schumacher, Fredrick; Seow, Adeline; Setiawan, Veronica Wendy; Shen, Hongbing; Sheng, Xin; Shin, Min-Ho; Shu, Xiao-Ou; VanDen Berg, David; Wang, Jiu-Cun; Wentzensen, Nicolas; Wong, Maria Pik; Wu, Chen; Wu, Tangchun; Wu, Yi-Long; Xia, Lucy; Yang, Hannah P.; Yang, Pan-Chyr; Zheng, Wei; Zhou, Baosen; Abnet, Christian C.; Albanes, Demetrius; Aldrich, Melinda C.; Amos, Christopher; Amundadottir, Laufey T.; Berndt, Sonja I.; Blot, William J.; Bock, Cathryn H.; Bracci, Paige M.; Burdett, Laurie; Buring, Julie E.; Butler, Mary A.; Carreón, Tania; Chatterjee, Nilanjan; Chung, Charles C.; Cook, Michael B.; Cullen, Michael; Davis, Faith G.; Ding, Ti; Duell, Eric J.; Epstein, Caroline G.; Fan, Jin-Hu; Figueroa, Jonine D.; Fraumeni, Joseph F.; Freedman, Neal D.; Fuchs, Charles S.; Gao, Yu-Tang; Gapstur, Susan M.; Patiño-Garcia, Ana; Garcia-Closas, Montserrat; Gaziano, J. Michael; Giles, Graham G.; Gillanders, Elizabeth M.; Giovannucci, Edward L.; Goldin, Lynn; Goldstein, Alisa M.; Greene, Mark H.; Hallmans, Goran; Harris, Curtis C.; Henriksson, Roger; Holly, Elizabeth A.; Hoover, Robert N.; Hu, Nan; Hutchinson, Amy; Jenab, Mazda; Johansen, Christoffer; Khaw, Kay-Tee; Koh, Woon-Puay; Kolonel, Laurence N.; Kooperberg, Charles; Krogh, Vittorio; Kurtz, Robert C.; LaCroix, Andrea; Landgren, Annelie; Landi, Maria Teresa; Li, Donghui; Liao, Linda M.; Malats, Nuria; McGlynn, Katherine A.; McNeill, Lorna H.; McWilliams, Robert R.; Melin, Beatrice S.; Mirabello, Lisa; Peplonska, Beata; Peters, Ulrike; Petersen, Gloria M.; Prokunina-Olsson, Ludmila; Purdue, Mark; Qiao, You-Lin; Rabe, Kari G.; Rajaraman, Preetha; Real, Francisco X.; Riboli, Elio; Rodríguez-Santiago, Benjamín; Rothman, Nathaniel; Ruder, Avima M.; Savage, Sharon A.; Schwartz, Ann G.; Schwartz, Kendra L.; Sesso, Howard D.; Severi, Gianluca; Silverman, Debra T.; Spitz, Margaret R.; Stevens, Victoria L.; Stolzenberg-Solomon, Rachael; Stram, Daniel; Tang, Ze-Zhong; Taylor, Philip R.; Teras, Lauren R.; Tobias, Geoffrey S.; Viswanathan, Kala; Wacholder, Sholom; Wang, Zhaoming; Weinstein, Stephanie J.; Wheeler, William; White, Emily; Wiencke, John K.; Wolpin, Brian M.; Wu, Xifeng; Wunder, Jay S.; Yu, Kai; Zanetti, Krista A.; Zeleniuch-Jacquotte, Anne; Ziegler, Regina G.; de Andrade, Mariza; Barnes, Kathleen C.; Beaty, Terri H.; Bierut, Laura J.; Desch, Karl C.; Doheny, Kimberly F.; Feenstra, Bjarke; Ginsburg, David; Heit, John A.; Kang, Jae H.; Laurie, Cecilia A.; Li, Jun Z.; Lowe, William L.; Marazita, Mary L.; Melbye, Mads; Mirel, Daniel B.; Murray, Jeffrey C.; Nelson, Sarah C.; Pasquale, Louis R.; Rice, Kenneth; Wiggs, Janey L.; Wise, Anastasia; Tucker, Margaret; Pérez-Jurado, Luis A.; Laurie, Cathy C.; Caporaso, Neil E.; Yeager, Meredith; Chanock, Stephen J.

    2015-01-01

    Analyses of genome-wide association study (GWAS) data have revealed that detectable genetic mosaicism involving large (>2 Mb) structural autosomal alterations occurs in a fraction of individuals. We present results for a set of 24,849 genotyped individuals (total GWAS set II [TGSII]) in whom 341 large autosomal abnormalities were observed in 168 (0.68%) individuals. Merging data from the new TGSII set with data from two prior reports (the Gene-Environment Association Studies and the total GWAS set I) generated a large dataset of 127,179 individuals; we then conducted a meta-analysis to investigate the patterns of detectable autosomal mosaicism (n = 1,315 events in 925 [0.73%] individuals). Restricting to events >2 Mb in size, we observed an increase in event frequency as event size decreased. The combined results underscore that the rate of detectable mosaicism increases with age (p value = 5.5 × 10−31) and is higher in men (p value = 0.002) but lower in participants of African ancestry (p value = 0.003). In a subset of 47 individuals from whom serial samples were collected up to 6 years apart, complex changes were noted over time and showed an overall increase in the proportion of mosaic cells as age increased. Our large combined sample allowed for a unique ability to characterize detectable genetic mosaicism involving large structural events and strengthens the emerging evidence of non-random erosion of the genome in the aging population. PMID:25748358

  2. A new mosaic method for three-dimensional surface

    NASA Astrophysics Data System (ADS)

    Yuan, Yun; Zhu, Zhaokun; Ding, Yongjun

    2011-08-01

    Three-dimensional (3-D) data mosaic is a indispensable link in surface measurement and digital terrain map generation. With respect to the mosaic problem of the local unorganized cloud points with rude registration and mass mismatched points, a new mosaic method for 3-D surface based on RANSAC is proposed. Every circular of this method is processed sequentially by random sample with additional shape constraint, data normalization of cloud points, absolute orientation, data denormalization of cloud points, inlier number statistic, etc. After N random sample trials the largest consensus set is selected, and at last the model is re-estimated using all the points in the selected subset. The minimal subset is composed of three non-colinear points which form a triangle. The shape of triangle is considered in random sample selection in order to make the sample selection reasonable. A new coordinate system transformation algorithm presented in this paper is used to avoid the singularity. The whole rotation transformation between the two coordinate systems can be solved by twice rotations expressed by Euler angle vector, each rotation has explicit physical means. Both simulation and real data are used to prove the correctness and validity of this mosaic method. This method has better noise immunity due to its robust estimation property, and has high accuracy as the shape constraint is added to random sample and the data normalization added to the absolute orientation. This method is applicable for high precision measurement of three-dimensional surface and also for the 3-D terrain mosaic.

  3. Improved expression of recombinant GFP using a replicating vector based on Beet curly top virus in leaf-disks and infiltrated Nicotiana benthamiana leaves.

    PubMed

    Kim, Kyung Il; Sunter, Garry; Bisaro, David M; Chung, In Sik

    2007-05-01

    Recombinant green fluorescent protein (GFP) with a molecular mass of 29 kDa was transiently expressed in Agrobacterium-inoculated leaf-disks prepared from Nicotiana benthamiana plants. Expression of GFP from the Cauliflower mosaic virus (CaMV) 35 S promoter within a replicating vector based on the geminivirus Beet curly top virus (BCTV) was more than 3 times higher than from a control, non-replicating vector. Use of the Cassava vein mosaic virus (CsVMV) promoter in the BCTV replicating vector increased the expression of recombinant GFP 320% at the transcript level, compared to use of the control CaMV 35 S promoter. Expression of recombinant GFP from Agrobacterium-inoculated leaf-disks of N. benthamiana was further enhanced up to 240% in the presence of post-transcriptional gene silencing suppressor p19. PMID:17294255

  4. A compensating wheat-Thinopyrum intermedium Robertsonian translocation conferring resistance to wheat streak mosaic virus and Triticum mosaic virus

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Wheat streak mosaic virus (WSMV), is a potentially devastating disease of common wheat in the Great Plains of North America. So far, two genes conferring resistance to WSMV have been named and used in cultivar improvement. Here we report a new source of resistance that was derived from a wheat-Th. i...

  5. Occurrance in Korea of three major soybean viruses, Soybean mosaic virus (SMV), Soybean yellow mottle mosaic virus (SYCMV), and Soybean yellow common mosaic virus (SYCMV) revealed by a nationwide survey of soybean fields

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Soybean yellow mottle mosaic virus (SYMMV) and soybean yellow common mosaic virus (SYCMV) were recently isolated in Korea, and it hasn’t been reported how these two viruses were dispersed in Korea. In 2012, we performed a nationwide survey of subsistence soybean farms in Korea. Leaves that appeared ...

  6. Sex Difference in κ-Opioid Receptor (KOPR)-Mediated Behaviors, Brain Region KOPR Level and KOPR-Mediated Guanosine 5′-O-(3-[35S]Thiotriphosphate) Binding in the Guinea Pig

    PubMed Central

    Wang, Yu-Jun; Rasakham, Khampaseuth; Huang, Peng; Chudnovskaya, Darina; Cowan, Alan

    2011-01-01

    We examined whether sex differences in κ-opioid receptor (KOPR) pharmacology exist in guinea pigs, which are more similar to humans in the expression level and distribution of KOPR in the brain than rats and mice. The KOPR agonist trans-(±)-3,4-dichloro-N-methyl-N-(2-[1-pyrrolidinyl]-cyclohexyl)benzeneacetamide methanesulfonate (U50,488H) produced a dose-dependent increase in abnormal postures and immobility with more effects in males than females. Males also showed more U50,488H-induced antinociception in the paw pressure test than females. Pretreatment with the KOPR antagonist norbinaltorphimine blocked U50,488H-induced abnormal body postures and antinociception. In contrast, inhibition of cocaine-induced hyperambulation by U50,488H was more effective in females than males. Thus, sex differences in the effects of U50,488H are endpoint-dependent. We then examined whether sex differences in KOPR levels and KOPR-mediated G protein activation in brain regions may contribute to the observed differences using quantitative in vitro autoradiography of [3H](5a,7a,8b)-(−)-N-methyl-N-(7-(1-pyrrolidinyl)1-oxaspiro(4,5)dec-8-yl)benzeacetamide ([3H]U69,593) binding to the KOPR and U50,488H-stimulated guanosine 5′-O-(3-[35S]thiotriphosphate ([35S]GTPγS) binding. Compared with females, males exhibited more [3H]U69,593 binding in the deep layers of somatosensory and insular cortices, claustrum, endopiriform nucleus, periaqueductal gray, and substantial nigra. Concomitantly, U50,488H-stimulated [35S]GTPγS binding was greater in males than females in the superficial and deep layers of somatosensory and insular cortices, caudate putamen, claustrum, medial geniculate nucleus, and cerebellum. In contrast, compared with males, females showed more U50,488H-stimulated [35S]GTPγS binding in the dentate gyrus and a trend of higher [35S]GTPγS binding in the hypothalamus. These data demonstrate that males and females differ in KOPR expression and KOPR-mediated G protein activation

  7. Application of non-destructive techniques to assess the state of Hagia Sophia's mosaics

    NASA Astrophysics Data System (ADS)

    Moropoulou, Antonia; Karoglou, Maria; Labropoulos, Kyriakos C.; Delegou, Ekaterini T.; Katsiotis, Nikolaos K.; Karagiannis-Bakolas, Asterios

    2012-04-01

    The church of Hagia Sophia in Istanbul is a world heritage monument that epitomizes the byzantine ecclesiastic architecture. The church is decorated with mosaics from various historic periods. The preservation state of the mosaics is of high importance. In this study, non-destructive techniques (ground penetrating radar, infra-red thermography, fibreoptics microscopy) were employed on south upper gallery mosaic areas. The main aim of this on-site investigation was the evaluation of the preservation state of the mosaics and the previous interventions (materials characterization and decay diagnosis) in order to assess the performance of previous conservation/restoration interventions, as well as to verify the presence of mosaics in layers below the external plaster surfaces. Results indicated that is indeed possible to locate the grid of rendered mosaics. Regarding the preservation state of the mosaics, it was indicated that the main environmental decay factors were the high relative humidity levels with co-action of salt damp as well as the air pollutants. Moreover, it was revealed that previous incompatible restoration/conservation interventions have often accelerated the mosaics' degradation processes. Using non-destructive techniques it was possible to identify areas where the mosaic materials (tesserae and mortars) presented decay problems and in addition identify sub-layers that pose risk of detachment or decay intensification. In this way, NDT can contribute to the development of a strategic planning for mosaics conservation, protection and revealing.

  8. Development of a reverse transcription loop-mediated isothermal amplification (RT-LAMP) assay for the detection of Sugarcane mosaic virus and Sorghum mosaic virus in sugarcane

    Technology Transfer Automated Retrieval System (TEKTRAN)

    A reverse transcription loop-mediated isothermal amplification (RT-LAMP) assay was developed for detecting Sugarcane mosaic virus (SCMV) and Sorghum mosaic virus (SrMV) in sugarcane. Six sets of four primers corresponding to the conserved coat protein gene were designed for each virus and their succ...

  9. Cucurbits depicted in Byzantine mosaics from Israel, 350–600 ce

    PubMed Central

    Avital, Anat; Paris, Harry S.

    2014-01-01

    Background and Aims Thousands of floor mosaics were produced in lands across the Roman and Byzantine empires. Some mosaics contain depictions of agricultural produce, potentially providing useful information concerning the contemporary presence and popularity of crop plants in a particular geographical region. Hundreds of floor mosaics produced in Israel during the Byzantine period have survived. The objective of the present work was to search these mosaics for Cucurbitaceae in order to obtain a more complete picture of cucurbit crop history in the eastern Mediterranean region. Results and Conclusions Twenty-three mosaics dating from 350–600 ce were found that had images positively identifiable as cucurbits. The morphological diversity of the cucurbit fruits in the mosaics of Israel is greater than that appearing in mosaics from any other Roman or Byzantine provincial area. The depicted fruits vary in shape from oblate to extremely long, and some are furrowed, others are striped and others lack definite markings. The cucurbit taxa depicted in the mosaics are Cucumis melo (melon), Citrullus lanatus (watermelon), Luffa aegyptiaca (sponge gourd) and Lagenaria siceraria (bottle gourd). Cucumis melo is the most frequently found taxon in the mosaics and is represented by round dessert melons and long snake melons. Fruits of at least two cultivars of snake melons and of watermelons are represented. To our knowledge, images of sponge gourds have not been found in Roman and Byzantine mosaics elsewhere. Indeed, the mosaics of Israel contain what are probably the oldest depictions of Luffa aegyptiaca in Mediterranean lands. Sponge gourds are depicted often, in 11 of the mosaics at eight localities, and the images include both mature fruits, which are useful for cleaning and washing, and immature fruits, which are edible. Only one mosaic has images positively identifiable as of bottle gourds, and these were round–pyriform and probably used as vessels. PMID:24948671

  10. Interactive Visualization of Computational Fluid Dynamics using Mosaic

    NASA Technical Reports Server (NTRS)

    Clucas, Jean; Watson, Velvin; Chancellor, Marisa K. (Technical Monitor)

    1994-01-01

    The Web provides new Methods for accessing Information world-wide, but the current text-and-pictures approach neither utilizes all the Web's possibilities not provides for its limitations. While the inclusion of pictures and animations in a paper communicates more effectively than text alone, It Is essentially an extension of the concept of "publication." Also, as use of the Web increases putting images and animations online will quickly load even the "Information Superhighway." We need to find forms of communication that take advantage of the special nature of the Web. This paper presents one approach: the use of the Internet and the Mosaic interface for data sharing and collaborative analysis. We will describe (and In the presentation, demonstrate) our approach: using FAST (Flow Analysis Software Toolkit), a scientific visualization package, as a data viewer and interactive tool called from MOSAIC. Our intent is to stimulate the development of other tools that utilize the unique nature of electronic communication.

  11. 45,X/47,XXX Mosaicism and Short Stature

    PubMed Central

    Everest, Erica; Tsilianidis, Laurie A.; Haider, Anzar; Rogers, Douglas G.; Raissouni, Nouhad; Schweiger, Bahareh

    2015-01-01

    We describe the case of a ten-year-old girl with short stature and 45,X/47,XXX genotype. She also suffered from vesicoureteric reflux and kidney dysfunction prior to having surgery on her ureters. Otherwise, she does not have any of the characteristics of Turner nor Triple X syndrome. It has been shown that this mosaic condition as well as other varieties creates a milder phenotype than typical Turner syndrome, which is what we mostly see in our patient. However, this patient is a special case, because she is exceptionally short. Overall, one cannot predict the resultant phenotype in these mosaic conditions. This creates difficulty in counseling parents whose children or fetuses have these karyotypes. PMID:26137340

  12. Shaded Relief Mosaic of Umnak Island, Aleutian Islands, Alaska

    NASA Technical Reports Server (NTRS)

    2001-01-01

    This image is a shaded relief mosaic of Umnak Island in Alaska's Aleutian Islands.

    It was created with Airsar data that was geocoded and combined into this mosaic as part of a NASA-funded Alaska Digital Elevation Model Project at the Alaska Synthetic Aperture Radar Facility (ASF) at the University of Alaska Geophysical Institute in Fairbanks, Alaska.

    Airsar collected the Alaska data as part of its PacRim 2000 Mission, which took the instrument to French Polynesia, American and Western Samoa, Fiji, New Zealand, Australia, New Guinea, Indonesia, Malaysia, Cambodia, Philippines, Taiwan, South Korea, Japan, Northern Marianas, Guam, Palau, Hawaii and Alaska. Airsar, part of NASA's Airborne Science Program, is managed for NASA's Earth Science Enterprise by JPL. JPL is a division of the California Institute of Technology in Pasadena.

  13. Visualization and interaction tools for aerial photograph mosaics

    NASA Astrophysics Data System (ADS)

    Fernandes, João Pedro; Fonseca, Alexandra; Pereira, Luís; Faria, Adriano; Figueira, Helder; Henriques, Inês; Garção, Rita; Câmara, António

    1997-05-01

    This paper describes the development of a digital spatial library based on mosaics of digital orthophotos, called Interactive Portugal, that will enable users both to retrieve geospatial information existing in the Portuguese National System for Geographic Information World Wide Web server, and to develop local databases connected to the main system. A set of navigation, interaction, and visualization tools are proposed and discussed. They include sketching, dynamic sketching, and navigation capabilities over the digital orthophotos mosaics. Main applications of this digital spatial library are pointed out and discussed, namely for education, professional, and tourism markets. Future developments are considered. These developments are related to user reactions, technological advancements, and projects that also aim at delivering and exploring digital imagery on the World Wide Web. Future capabilities for site selection and change detection are also considered.

  14. 45,X/47,XXX Mosaicism and Short Stature.

    PubMed

    Everest, Erica; Tsilianidis, Laurie A; Haider, Anzar; Rogers, Douglas G; Raissouni, Nouhad; Schweiger, Bahareh

    2015-01-01

    We describe the case of a ten-year-old girl with short stature and 45,X/47,XXX genotype. She also suffered from vesicoureteric reflux and kidney dysfunction prior to having surgery on her ureters. Otherwise, she does not have any of the characteristics of Turner nor Triple X syndrome. It has been shown that this mosaic condition as well as other varieties creates a milder phenotype than typical Turner syndrome, which is what we mostly see in our patient. However, this patient is a special case, because she is exceptionally short. Overall, one cannot predict the resultant phenotype in these mosaic conditions. This creates difficulty in counseling parents whose children or fetuses have these karyotypes. PMID:26137340

  15. Linear magnetoresistance in mosaic-like bilayer graphene

    NASA Astrophysics Data System (ADS)

    Kisslinger, Ferdinand; Ott, Christian; Heide, Christian; Kampert, Erik; Butz, Benjamin; Spiecker, Erdmann; Shallcross, Sam; Weber, Heiko B.

    2015-08-01

    The magnetoresistance of conductors usually has a quadratic dependence on magnetic field, however, examples exist of non-saturating linear behaviour in diverse materials. Assigning a specific microscopic mechanism to this unusual phenomenon is obscured by the co-occurrence and interplay of doping, mobility fluctuations and a polycrystalline structure. Bilayer graphene has virtually no doping fluctuations, yet provides a built-in mosaic tiling due to the dense network of partial dislocations. We present magnetotransport measurements of epitaxial bilayer graphene that exhibits a strong and reproducible linear magnetoresistance that persists to B = 62 T at and above room temperature, decorated by quantum interference effects at low temperatures. Partial dislocations thus have a profound impact on the transport properties in bilayer graphene, a system that is frequently assumed to be dislocation-free. It further provides a clear and tractable model system for studying the unusual properties of mosaic conductors.

  16. RNA based viral silencing suppression in plant pararetroviruses

    PubMed Central

    Hohn, Thomas

    2015-01-01

    The 35S promoter of cauliflower mosaic virus and that of other plant pararetroviruses gives rise to an RNA, which is both a pre-genome and a polycistronic mRNA. The 600 nucleotide long very structured leader of this RNA is also transcribed separately. The resulting 8S RNA is then converted to a double strand giving rise to a huge set of siRNAs, which suppress silencing. In this Mini-Review I discuss how this versatile stretch of 600 nts constitutes a masterpiece of evolution. PMID:26113850

  17. Development of Cotton leaf curl virus resistant transgenic cotton using antisense ßC1 gene

    PubMed Central

    Sohrab, Sayed Sartaj; Kamal, Mohammad A.; Ilah, Abdul; Husen, Azamal; Bhattacharya, P.S.; Rana, D.

    2014-01-01

    Cotton leaf curl virus (CLCuV) is a serious pathogen causing leaf curl disease and affecting the cotton production in major growing areas. The transgenic cotton (Gossypium hirsutum cv. Coker 310) plants were developed by using βC1 gene in antisense orientation gene driven by Cauliflower mosaic virus-35S promoter and nos (nopaline synthase) terminator and mediated by Agrobacterium tumefaciens transformation and somatic embryogenesis system. Molecular confirmation of the transformants was carried out by polymerase chain reaction (PCR) and Southern blot hybridization. The developed transgenic and inoculated plants remained symptomless till their growth period. In conclusion, the plants were observed as resistant to CLCuV. PMID:27081361

  18. Development of Cotton leaf curl virus resistant transgenic cotton using antisense ßC1 gene.

    PubMed

    Sohrab, Sayed Sartaj; Kamal, Mohammad A; Ilah, Abdul; Husen, Azamal; Bhattacharya, P S; Rana, D

    2016-05-01

    Cotton leaf curl virus (CLCuV) is a serious pathogen causing leaf curl disease and affecting the cotton production in major growing areas. The transgenic cotton (Gossypium hirsutum cv. Coker 310) plants were developed by using βC1 gene in antisense orientation gene driven by Cauliflower mosaic virus-35S promoter and nos (nopaline synthase) terminator and mediated by Agrobacterium tumefaciens transformation and somatic embryogenesis system. Molecular confirmation of the transformants was carried out by polymerase chain reaction (PCR) and Southern blot hybridization. The developed transgenic and inoculated plants remained symptomless till their growth period. In conclusion, the plants were observed as resistant to CLCuV. PMID:27081361

  19. Capsicum annum, a new host of watermelon mosaic virus.

    PubMed

    Hajizadeh, Mohammad; Mohammadi, Kazhal

    2016-03-01

    The occurrence of Watermelon mosaic virus (WMV) in sweet pepper (Capsicum annuum L.) in Kurdistan province, Iran was confirmed by reverse transcriptase-polymerase chain reaction (RT-PCR) and partial characterization of coat protein. To the best of our knowledge, this is the first report of WMV infecting C. annuum, adding a new host to list of more than 170 species infected by this virus. PMID:26925452

  20. Fixation of Emerging Interviral Recombinants in Cucumber Mosaic Virus Populations

    PubMed Central

    Pita, Justin S.

    2013-01-01

    Interstrain recombinants were observed in the progenies of the Cucumber mosaic virus (CMV) reassortant L1L2F3 containing RNAs 1 and 2 from LS-CMV and RNA 3 from Fny-CMV. We characterized these recombinants, and we found that their fixation was controlled by the nature of the replicating RNAs 1 and 2. We demonstrate that the 2b gene partially affects this fixation process, but only in the context of homologous RNAs 1 and 2. PMID:23115282