Science.gov

Sample records for acid green composites

  1. EVALUATION OF POLY(LACTIC ACID) AND AGRICULTURAL COPRODUCTS AS GREEN COMPOSITE MATERIALS

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Green composite materials of poly(lactic acid)(PLA) and agricultural coproducts such as sugar beet pulp(SBP), cuphea, lesquerella, and milkweed were compounded using a twin-screw extruder, molded by injection molding and evaluated for structural and mechanical properties using acoustic emission and ...

  2. Effects of alginate oligosaccharide mixtures on the growth and fatty acid composition of the green alga Chlamydomonas reinhardtii.

    PubMed

    Yamasaki, Yasuhiro; Yokose, Takeshi; Nishikawa, Toru; Kim, Daekyung; Jiang, Zedong; Yamaguchi, Kenichi; Oda, Tatsuya

    2012-01-01

    Alginate is a natural acidic linear polysaccharide that is produced by brown seaweeds. It is currently used in a broad range of commercial enterprises, such as the food and medical products industries. Recent evidence has demonstrated that alginate oligosaccharides may function as growth promoting agents for certain plant cells, including those of some green algae. Chlamydomonas reinhardtii is a green alga that is used as a model organism in fundamental molecular biology studies; it is also a producer of biohydrogen. In the present study, we examined effects of two types of alginate oligosaccharide mixtures (AOMs), which were prepared by either enzymatic degradation (ED) or acid hydrolysis (AH), on the growth of C. reinhardtii. Growth was significantly promoted by AOM (ED) in a concentration-dependent manner. The maximum effect was observed on day 4 of treatment. The fatty acid composition of C. reinhardtii was also influenced by AOM (ED); the levels of C16:0, C18:2 cis and C18:3 n-3 increased in treated cells. AOM (AH) and the other saccharides that we tested did not affect the growth of C. reinhardtii. The effects that we identified could promote efficient biomass production by reducing culture times and by changing cellular fatty acid levels.

  3. Simultaneous removal of acid green 25 and mercury ions from aqueous solutions using glutamine modified chitosan magnetic composite microspheres.

    PubMed

    Tao, Xue; Li, Kun; Yan, Han; Yang, Hu; Li, Aimin

    2016-02-01

    In this current work, the magnetic composite microsphere containing glutamine modified chitosan and silica coated Fe3O4 nanoparticles (CS-Gln-MCM) has been successfully prepared and extensively characterized, which is a kind of biodegradable materials. CS-Gln-MCM shows enhanced removal efficiency for both acid green 25 (AG25), an amphoteric dye, and mercury ions (Hg(2+)) from water in the respective while measured pH range compared with chitosan magnetic composite microsphere (CS-MCM) without modification. It is due to the fact that the grafted amino acid provides a variety of additional adsorption active sites and diverse adsorption mechanisms are involved. In AG25 and Hg(2+) aqueous mixture, the modified adsorbents bear preferential adsorption for AG25 over Hg(2+) in strong acidic solutions ascribed to multiple interactions between AG25 and CS-Gln-MCM, such as hydrogen bonding and electrostatic interactions. While, in weak acidic conditions, an efficient simultaneous removal is observed for different adsorption effects involved in aforementioned two pollutants. Besides, CS-Gln-MCM illuminates not only short equilibrium time for adsorption of each pollutant less than 20.0 min but also rapid magnetic separation from water and efficient regeneration after saturated adsorption. Therefore, CS-Gln-MCM bears great application potentials in water treatment. PMID:26618263

  4. Simultaneous removal of acid green 25 and mercury ions from aqueous solutions using glutamine modified chitosan magnetic composite microspheres.

    PubMed

    Tao, Xue; Li, Kun; Yan, Han; Yang, Hu; Li, Aimin

    2016-02-01

    In this current work, the magnetic composite microsphere containing glutamine modified chitosan and silica coated Fe3O4 nanoparticles (CS-Gln-MCM) has been successfully prepared and extensively characterized, which is a kind of biodegradable materials. CS-Gln-MCM shows enhanced removal efficiency for both acid green 25 (AG25), an amphoteric dye, and mercury ions (Hg(2+)) from water in the respective while measured pH range compared with chitosan magnetic composite microsphere (CS-MCM) without modification. It is due to the fact that the grafted amino acid provides a variety of additional adsorption active sites and diverse adsorption mechanisms are involved. In AG25 and Hg(2+) aqueous mixture, the modified adsorbents bear preferential adsorption for AG25 over Hg(2+) in strong acidic solutions ascribed to multiple interactions between AG25 and CS-Gln-MCM, such as hydrogen bonding and electrostatic interactions. While, in weak acidic conditions, an efficient simultaneous removal is observed for different adsorption effects involved in aforementioned two pollutants. Besides, CS-Gln-MCM illuminates not only short equilibrium time for adsorption of each pollutant less than 20.0 min but also rapid magnetic separation from water and efficient regeneration after saturated adsorption. Therefore, CS-Gln-MCM bears great application potentials in water treatment.

  5. Mechanical Property Characterization of Plasticized Sugar Beet Pulp and Poly(lactic acid) Green Composites using Acoustic Emission and Confocal Microscopy.

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Sorbitol and glycerol were used to plasticize sugar beet pulp-poly (lactic acid) green composites. The plasticizer was incorporated into sugar beet pulp (SBP)at 0, 10, 20, 30 and 40% w/w at low temperature and shear and then compounded with PLA using twin-screw extrusion and injection molding. The...

  6. Green composites of poly(lactic acid) and sugar beet pulp. II. Structural and mechanical property analysis.

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Poly(lactic acid) and sugar beet pulp were compounded by twin-screw extrusion and injection molded into composite forms. Specific mechanical energy decreased with the addition of SBP during processing. PLA-SBP composites retained more tensile strength than expected based on the Nicolais-Narkis mod...

  7. Solid acids for green chemistry.

    PubMed

    Clark, James H

    2002-09-01

    Solid acids and especially those based on micelle-templated silicas and other mesoporous high surface area support materials are beginning to play a significant role in the greening of fine and specialty chemicals manufacturing processes. A wide range of important organic reactions can be efficiently catalyzed by these materials, which can be designed to provide different types of acidity as well as high degrees of reaction selectivity. The solid acids generally have high turnover numbers and can be easily separated from the organic components. The combination of this chemistry with innovative reaction engineering offers exciting opportunities for innovative green chemical manufacturing in the future. PMID:12234209

  8. Effect of green Spanish-style processing (Manzanilla and Hojiblanca) on the quality parameters and fatty acid and triacylglycerol compositions of olive fat.

    PubMed

    López-López, Antonio; Cortés-Delgado, Amparo; Garrido-Fernández, Antonio

    2015-12-01

    This work studies the effect of processing Manzanilla and Hojiblanca olives as green Spanish-style on the quality parameters and fatty acid and triacylglycerol compositions of their oils. Lye treatment reduced the values of most quality parameters while fermentation/packaging increased acidity, K232 and K270. Processing did not cause any systematic effect on fatty acids (FA), triacylglycerols or nutritional fat subclasses but significant differences between cultivars were observed. Principal component analysis (PCA) confirmed that most of the variation among oil characteristics was due to cultivars and only a limited proportion (∼22% and ∼14% variance for FA and triacylglycerols, respectively) to processing. Furthermore, the levels of the quality parameters and fatty acids with restrictions in the legislation were below the limits established in the Commission Implementing Regulation (EU) 1348/2013 for extra virgin olive oil (EVOO), except for C18:3n-3 in Hojiblanca. Therefore, the fat of processed olives was compatible with EVOO.

  9. Green tea composition, consumption, and polyphenol chemistry.

    PubMed

    Graham, H N

    1992-05-01

    Tea is grown in about 30 countries but is consumed worldwide, although at greatly varying levels. It is the most widely consumed beverage aside from water with a per capita worldwide consumption of approximately 0.12 liter per year. Tea is manufactured in three basic forms. Green tea is prepared in such a way as to preclude the oxidation of green leaf polyphenols. During black tea production oxidation is promoted so that most of these substances are oxidized. Oolong tea is a partially oxidized product. Of the approximately 2.5 million metric tons of dried tea manufactured, only 20% is green tea and less than 2% is oolong tea. Green tea is consumed primarily in China, Japan, and a few countries in North Africa and the Middle East. Fresh tea leaf is unusually rich in the flavanol group of polyphenols known as catechins which may constitute up to 30% of the dry leaf weight. Other polyphenols include flavanols and their glycosides, and depsides such as chlorogenic acid, coumarylquinic acid, and one unique to tea, theogallin (3-galloylquinic acid). Caffeine is present at an average level of 3% along with very small amounts of the other common methylxanthines, theobromine and theophylline. The amino acid theanine (5-N-ethylglutamine) is also unique to tea. Tea accumulates aluminum and manganese. In addition to the normal complement of plant cell enzymes, tea leaf contains an active polyphenol oxidase which catalyzes the aerobic oxidation of the catechins when the leaf cell structure is disrupted during black tea manufacture. The various quinones produced by the enzymatic oxidations undergo condensation reactions which result in a series of compounds, including bisflavanols, theaflavins, epitheaflavic acids, and thearubigens, which impart the characteristic taste and color properties of black tea. Most of these compounds readily form complexes with caffeine. There is no tannic acid in tea. Thearubigens constitute the largest mass of the extractable matter in black tea but

  10. Lipid content and fatty acid composition of green algae Scenedesmus obliquus grown in a constant cell density apparatus

    NASA Technical Reports Server (NTRS)

    Choi, K. J.; Nakhost, Z.; Barzana, E.; Karel, M.

    1987-01-01

    The lipids of alga Scenedesmus obliquus grown under controlled conditions were separated and fractionated by column and thin-layer chromatography, and fatty acid composition of each lipid component was studied by gas-liquid chromatography (GLC). Total lipids were 11.17%, and neutral lipid, glycolipid and phospholipid fractions were 7.24%, 2.45% and 1.48% on a dry weight basis, respectively. The major neutral lipids were diglycerides, triglycerides, free sterols, hydrocarbons and sterol esters. The glycolipids were: monogalactosyl diglyceride, digalactosyl diglyceride, esterified sterol glycoside, and sterol glycoside. The phospholipids included: phosphatidyl choline, phosphatidyl glycerol and phosphatidyl ethanolamine. Fourteen fatty acids were identified in the four lipid fractions by GLC. The main fatty acids were C18:2, C16:0, C18:3(alpha), C18:1, C16:3, C16:1, and C16:4. Total unsaturated fatty acid and essential fatty acid compositions of the total algal lipids were 80% and 38%, respectively.

  11. Effects of different media and nitrogen sources and levels on growth and lipid of green microalga Botryococcus braunii KMITL and its biodiesel properties based on fatty acid composition.

    PubMed

    Ruangsomboon, Suneerat

    2015-09-01

    This work aimed to find an optimum culture medium for green microalga Botryococcus braunii KMITL and investigate its biodiesel properties based on fatty acid composition. Four different media were tested. Chlorella medium was the best medium for lipid yield. Among four nitrogen sources tested, KNO3 produced the highest lipid yield. When varied the nitrogen concentrations, this strain gave the highest lipid yield at the highest nitrogen level. When cultivated in the best medium and nitrogen source and level for 30 days, and then cultivated further for 14 days in the medium with no nitrogen, the highest lipid content and yield were 49.94±0.82% and 2.71±0.02 g L(-1), respectively. C16:0 fatty acid was the major fatty acid found. Fatty acid profiles of B. braunii KMITL cultivated in Chlorella medium with 1.25 g L(-1) KNO3 gave the best biodiesel properties with the lowest iodine value, maximum cetane number, and lowest degree of unsaturation.

  12. Effect of green Spanish-style processing (Manzanilla and Hojiblanca) on the quality parameters and fatty acid and triacylglycerol compositions of olive fat.

    PubMed

    López-López, Antonio; Cortés-Delgado, Amparo; Garrido-Fernández, Antonio

    2015-12-01

    This work studies the effect of processing Manzanilla and Hojiblanca olives as green Spanish-style on the quality parameters and fatty acid and triacylglycerol compositions of their oils. Lye treatment reduced the values of most quality parameters while fermentation/packaging increased acidity, K232 and K270. Processing did not cause any systematic effect on fatty acids (FA), triacylglycerols or nutritional fat subclasses but significant differences between cultivars were observed. Principal component analysis (PCA) confirmed that most of the variation among oil characteristics was due to cultivars and only a limited proportion (∼22% and ∼14% variance for FA and triacylglycerols, respectively) to processing. Furthermore, the levels of the quality parameters and fatty acids with restrictions in the legislation were below the limits established in the Commission Implementing Regulation (EU) 1348/2013 for extra virgin olive oil (EVOO), except for C18:3n-3 in Hojiblanca. Therefore, the fat of processed olives was compatible with EVOO. PMID:26041161

  13. "Green" composites and nanocomposites from soybean oil

    Technology Transfer Automated Retrieval System (TEKTRAN)

    In this study, we report preparation of epoxidized soybean oil (ESO) based "green" composites and nanocomposites. The high strength and stiffness composites and nanocomposites are formed through flax fiber and organoclay reinforcement. The epoxy resin, 1,1,1-tris(p-hydroxyphenyl)ethane triglycidyl...

  14. Phytic acid in green leaves.

    PubMed

    Hadi Alkarawi, H; Zotz, G

    2014-07-01

    Phytic acid or phytate, the free-acid form of myo-inositolhexakiphosphate, is abundant in many seeds and fruits, where it represents the major storage form of phosphorus. Although also known from other plant tissues, available reports on the occurrence of phytic acid, e.g. in leaves, have never been compiled, nor have they been critically reviewed. We found 45 published studies with information on phytic acid content in leaves. Phytic acid was almost always detected when studies specifically tried to detect it, and accounted for up to 98% of total P. However, we argue that such extreme values, which rival findings from storage organs, are dubious and probably result from measurement errors. Excluding these high values from further quantitative analysis, foliar phytic acid-P averaged 2.3 mg·g(-1) , and represented, on average, 7.6% of total P. Remarkably, the ratio of phytic acid-P to total P did not increase with total P, we even detected a negative correlation of the two variables within one species, Manihot esculenta. This enigmatic finding warrants further attention.

  15. Well acidizing compositions and methods

    SciTech Connect

    Swanson, B. L.

    1980-12-23

    Gelled acidic compositions suitable for matrix acidizing or fracture acidizing of subterranean formations are provided comprising water, a water-dispersible polymeric viscosifier such as a polymer of acrylamide, an acid, and a polyphenolic material such as lignite.

  16. Nucleic acid detection compositions

    DOEpatents

    Prudent, James R.; Hall, Jeff G.; Lyamichev, Victor I.; Brow, Mary Ann; Dahlberg, James L.

    2008-08-05

    The present invention relates to means for the detection and characterization of nucleic acid sequences, as well as variations in nucleic acid sequences. The present invention also relates to methods for forming a nucleic acid cleavage structure on a target sequence and cleaving the nucleic acid cleavage structure in a site-specific manner. The structure-specific nuclease activity of a variety of enzymes is used to cleave the target-dependent cleavage structure, thereby indicating the presence of specific nucleic acid sequences or specific variations thereof.

  17. Hyperbranched acidic polysaccharide from green tea.

    PubMed

    Yang, Liqun; Fu, Shanshan; Zhu, Xiane; Zhang, Li-Ming; Yang, Yanrui; Yang, Xiaomin; Liu, Hui

    2010-12-13

    An acidic tea polysaccharide (ALTPS), isolated from green tea ( Camellia sinensis ), was characterized as a hyperbranched glycoprotein containing the acidic heteropolysaccharide chains and the protein residues from the results of UV-vis, FTIR, one- and two-dimensional NMR, GC, GC-MS, and amino acid analyses. Solution properties of ALTPS were investigated by static and dynamic light scattering analyses and viscometry. The results indicated that the viscosity behavior of ALTPS exhibited a typical polyelectrolyte effect in distilled water, which may be avoided by adding salts. The low intrinsic viscosity of ALTPS in the solutions (8-15 mL/g) is attributed to its hyperbranched structure. By application of the polymer solution theory, it was revealed that ALTPS was present in a sphere-like conformation in the solutions as a result of the hyperbranched structure. The TEM image further confirmed that ALTPS existed in a spherical conformation in aqueous NaCl solution. Glucose was absorbed by ALTPS, which may be one of blood glucose lowering mechanisms of tea polysaccharides.

  18. Urban greenness influences airborne bacterial community composition.

    PubMed

    Mhuireach, Gwynne; Johnson, Bart R; Altrichter, Adam E; Ladau, Joshua; Meadow, James F; Pollard, Katherine S; Green, Jessica L

    2016-11-15

    Urban green space provides health benefits for city dwellers, and new evidence suggests that microorganisms associated with soil and vegetation could play a role. While airborne microorganisms are ubiquitous in urban areas, the influence of nearby vegetation on airborne microbial communities remains poorly understood. We examined airborne microbial communities in parks and parking lots in Eugene, Oregon, using high-throughput sequencing of the bacterial 16S rRNA gene on the Illumina MiSeq platform to identify bacterial taxa, and GIS to measure vegetation cover in buffer zones of different diameters. Our goal was to explore variation among highly vegetated (parks) versus non-vegetated (parking lots) urban environments. A secondary objective was to evaluate passive versus active collection methods for outdoor airborne microbial sampling. Airborne bacterial communities from five parks were different from those of five parking lots (p=0.023), although alpha diversity was similar. Direct gradient analysis showed that the proportion of vegetated area within a 50m radius of the sampling station explained 15% of the variation in bacterial community composition. A number of key taxa, including several Acidobacteriaceae were substantially more abundant in parks, while parking lots had higher relative abundance of Acetobacteraceae. Parks had greater beta diversity than parking lots, i.e. individual parks were characterized by unique bacterial signatures, whereas parking lot communities tended to be similar to each other. Although parks and parking lots were selected to form pairs of nearby sites, spatial proximity did not appear to affect compositional similarity. Our results also showed that passive and active collection methods gave comparable results, indicating the "settling dish" method is effective for outdoor airborne sampling. This work sets a foundation for understanding how urban vegetation may impact microbial communities, with potential implications for designing

  19. Urban greenness influences airborne bacterial community composition.

    PubMed

    Mhuireach, Gwynne; Johnson, Bart R; Altrichter, Adam E; Ladau, Joshua; Meadow, James F; Pollard, Katherine S; Green, Jessica L

    2016-11-15

    Urban green space provides health benefits for city dwellers, and new evidence suggests that microorganisms associated with soil and vegetation could play a role. While airborne microorganisms are ubiquitous in urban areas, the influence of nearby vegetation on airborne microbial communities remains poorly understood. We examined airborne microbial communities in parks and parking lots in Eugene, Oregon, using high-throughput sequencing of the bacterial 16S rRNA gene on the Illumina MiSeq platform to identify bacterial taxa, and GIS to measure vegetation cover in buffer zones of different diameters. Our goal was to explore variation among highly vegetated (parks) versus non-vegetated (parking lots) urban environments. A secondary objective was to evaluate passive versus active collection methods for outdoor airborne microbial sampling. Airborne bacterial communities from five parks were different from those of five parking lots (p=0.023), although alpha diversity was similar. Direct gradient analysis showed that the proportion of vegetated area within a 50m radius of the sampling station explained 15% of the variation in bacterial community composition. A number of key taxa, including several Acidobacteriaceae were substantially more abundant in parks, while parking lots had higher relative abundance of Acetobacteraceae. Parks had greater beta diversity than parking lots, i.e. individual parks were characterized by unique bacterial signatures, whereas parking lot communities tended to be similar to each other. Although parks and parking lots were selected to form pairs of nearby sites, spatial proximity did not appear to affect compositional similarity. Our results also showed that passive and active collection methods gave comparable results, indicating the "settling dish" method is effective for outdoor airborne sampling. This work sets a foundation for understanding how urban vegetation may impact microbial communities, with potential implications for designing

  20. Fatty acid amides from freshwater green alga Rhizoclonium hieroglyphicum.

    PubMed

    Dembitsky, V M; Shkrob, I; Rozentsvet, O A

    2000-08-01

    Freshwater green algae Rhizoclonium hieroglyphicum growing in the Ural Mountains were examined for their fatty acid amides using capillary gas chromatography-mass spectrometry (GC-MS). Eight fatty acid amides were identified by GC-MS. (Z)-9-octadecenamide was found to be the major component (2.26%).

  1. Fatty acid amides from freshwater green alga Rhizoclonium hieroglyphicum.

    PubMed

    Dembitsky, V M; Shkrob, I; Rozentsvet, O A

    2000-08-01

    Freshwater green algae Rhizoclonium hieroglyphicum growing in the Ural Mountains were examined for their fatty acid amides using capillary gas chromatography-mass spectrometry (GC-MS). Eight fatty acid amides were identified by GC-MS. (Z)-9-octadecenamide was found to be the major component (2.26%). PMID:11014298

  2. Steam cooking significantly improves in vitro bile acid binding of collard greens, kale, mustard greens, broccoli, green bell pepper, and cabbage.

    PubMed

    Kahlon, Talwinder Singh; Chiu, Mei-Chen M; Chapman, Mary H

    2008-06-01

    Bile acid binding capacity has been related to the cholesterol-lowering potential of foods and food fractions. Lowered recirculation of bile acids results in utilization of cholesterol to synthesize bile acid and reduced fat absorption. Secondary bile acids have been associated with increased risk of cancer. Bile acid binding potential has been related to lowering the risk of heart disease and that of cancer. Previously, we have reported bile acid binding by several uncooked vegetables. However, most vegetables are consumed after cooking. How cooking would influence in vitro bile acid binding of various vegetables was investigated using a mixture of bile acids secreted in human bile under physiological conditions. Eight replicate incubations were conducted for each treatment simulating gastric and intestinal digestion, which included a substrate only, a bile acid mixture only, and 6 with substrate and bile acid mixture. Cholestyramine (a cholesterol-lowering, bile acid binding drug) was the positive control treatment and cellulose was the negative control. Relative to cholestyramine, in vitro bile acid binding on dry matter basis was for the collard greens, kale, and mustard greens, 13%; broccoli, 10%; Brussels sprouts and spinach, 8%; green bell pepper, 7%; and cabbage, 5%. These results point to the significantly different (P < or = .05) health-promoting potential of collard greens = kale = mustard greens > broccoli > Brussels sprouts = spinach = green bell pepper > cabbage as indicated by their bile acid binding on dry matter basis. Steam cooking significantly improved the in vitro bile acid binding of collard greens, kale, mustard greens, broccoli, green bell pepper, and cabbage compared with previously observed bile acid binding values for these vegetables raw (uncooked). Inclusion of steam-cooked collard greens, kale, mustard greens, broccoli, green bell pepper, and cabbage in our daily diet as health-promoting vegetables should be emphasized. These green

  3. Steam cooking significantly improves in vitro bile acid binding of collard greens, kale, mustard greens, broccoli, green bell pepper, and cabbage.

    PubMed

    Kahlon, Talwinder Singh; Chiu, Mei-Chen M; Chapman, Mary H

    2008-06-01

    Bile acid binding capacity has been related to the cholesterol-lowering potential of foods and food fractions. Lowered recirculation of bile acids results in utilization of cholesterol to synthesize bile acid and reduced fat absorption. Secondary bile acids have been associated with increased risk of cancer. Bile acid binding potential has been related to lowering the risk of heart disease and that of cancer. Previously, we have reported bile acid binding by several uncooked vegetables. However, most vegetables are consumed after cooking. How cooking would influence in vitro bile acid binding of various vegetables was investigated using a mixture of bile acids secreted in human bile under physiological conditions. Eight replicate incubations were conducted for each treatment simulating gastric and intestinal digestion, which included a substrate only, a bile acid mixture only, and 6 with substrate and bile acid mixture. Cholestyramine (a cholesterol-lowering, bile acid binding drug) was the positive control treatment and cellulose was the negative control. Relative to cholestyramine, in vitro bile acid binding on dry matter basis was for the collard greens, kale, and mustard greens, 13%; broccoli, 10%; Brussels sprouts and spinach, 8%; green bell pepper, 7%; and cabbage, 5%. These results point to the significantly different (P < or = .05) health-promoting potential of collard greens = kale = mustard greens > broccoli > Brussels sprouts = spinach = green bell pepper > cabbage as indicated by their bile acid binding on dry matter basis. Steam cooking significantly improved the in vitro bile acid binding of collard greens, kale, mustard greens, broccoli, green bell pepper, and cabbage compared with previously observed bile acid binding values for these vegetables raw (uncooked). Inclusion of steam-cooked collard greens, kale, mustard greens, broccoli, green bell pepper, and cabbage in our daily diet as health-promoting vegetables should be emphasized. These green

  4. Diets containing traditional and novel green leafy vegetables improve liver fatty acid profiles of spontaneously hypertensive rats

    PubMed Central

    2013-01-01

    Background The consumption of green leafy vegetables (GLVs) has been demonstrated to reduce the risks associated with cardiovascular and other diseases. However, no literature exists that examines the influence of traditional and novel GLVs on the liver fatty acid profile of an animal model genetically predisposed to developing hypertension. The aim of the present study was to examine the effects of diets containing 4% collard greens, purslane or sweet potato greens on the liver fatty acid profiles of four-week old male spontaneously hypertensive rats (SHRs, N = 44). Following four weeks consumption of the diets, liver fatty acid profiles were determined by gas–liquid chromatography of transesterified fatty acid methyl esters. Results SHRs consuming the control diet had greater percentages of liver saturated fatty acid and less omega-3 fatty acid percentages. SHRs consuming the diets containing vegetables had significantly greater liver concentrations of γ- linolenic, docosahexaenoic and docosahexaenoic acids, as well as lower levels of lauric, palmitic and arachidonic acids. SHRs consuming the control diet had significantly greater percentages (p < 0.05) of oleic; significantly less γ-linolenic and docosahexaenoic acids. Conclusions This study demonstrates the ability of GLVs to modulate liver fatty acid composition, thus providing protection against elevations in atherogenic fatty acids, which may be involved in CVD pathogenesis. Consequently, dietary recommendations for the prevention of CVD should consider the possible cardioprotective benefits and the subsequent alterations in fatty acid profiles afforded by diets containing collard greens, purslane and sweet potato greens. PMID:24192144

  5. Well acidizing compositions and method

    SciTech Connect

    Gardener, T.R.; Dill, W.R.; Ford, W.G.F.; King, K.L.

    1991-07-23

    This patent describes a concentrate which forms an acid internal microemulsion well treatment composition when added to an acid treatment fluid. It comprises in the range of from about 20% to about 98% by weight of a hydrocarbon carrier fluid; in the range of from about 1% to about 50% by weight of an alkyl alcohol having in the range of from about 4 to 18 carbon atoms; and in the range of from about 1% to about 50% by weight of an emulsifying agent comprising at least one compound selected from the group consisting of amine salts having ester or amide linkages and propoxylated alcohols, each of the components being different compounds or different mixtures of compounds.

  6. Green engineering: Green composite material, biodiesel from waste coffee grounds, and polyurethane bio-foam

    NASA Astrophysics Data System (ADS)

    Cheng, Hsiang-Fu

    In this thesis we developed several ways of producing green materials and energy resources. First, we developed a method to fabricate natural fibers composites, with the purpose to develop green textile/woven composites that could potentially serve as an alternative to materials derived from non-renewable sources. Flax and hemp fabrics were chosen because of their lightweight and exceptional mechanical properties. To make these textile/woven composites withstand moist environments, a commercially available marine resin was utilized as a matrix. The tensile, three-point bending, and edgewise compression strengths of these green textile/woven composites were measured using ASTM protocols. Secondly, we developed a chemical procedure to obtain oil from waste coffee grounds; we did leaching and liquid extractions to get liquid oil from the solid coffee. This coffee oil was used to produce bio-diesel that could be used as a substitute for petroleum-based diesel. Finally, polyurethane Bio-foam formation utilized glycerol that is the by-product from the biodiesel synthesis. A chemical synthesis procedure from the literature was used as the reference system: a triol and isocynate are mixed to produce polyurethane foam. Moreover, we use a similar triol, a by-product from bio-diesel synthesis, to reproduce polyurethane foam.

  7. Gelled acidic well treating composition and process

    SciTech Connect

    Swanson, B.L.

    1981-01-13

    Gelled acidic compositions suitable for either matrix-acidizing or fracture-acidizing of subterranean formations comprising water , a water-dispersible polymer selected from cellulose ethers and polymers of acrylamides, an acid, an aldehyde, and a phenolic compound capable of causing gelation of an aqueous dispersion of the polymer, acid, aldehyde, and phenolic compound are provided. In another embodiment, guar gum, polyvinylpyrrolidone and biopolysaccharides can also be used as the polymeric component in said compositions.

  8. Peatlands and green frogs: A relationship regulated by acidity?

    USGS Publications Warehouse

    Mazerolle, M.J.

    2005-01-01

    The effects of site acidification on amphibian populations have been thoroughly addressed in the last decades. However, amphibians in naturally acidic environments, such as peatlands facing pressure from the peat mining industry, have received little attention. Through two field studies and an experiment, I assessed the use of bog habitats by the green frog (Rana clamitans melanota), a species sensitive to various forestry and peat mining disturbances. First, I compared the occurrence and breeding patterns of frogs in bog and upland ponds. I then evaluated frog movements between forest and bog habitats to determine whether they corresponded to breeding or postbreeding movements. Finally, I investigated, through a field experiment, the value of bogs as rehydrating areas for amphibians by offering living Sphagnum moss and two media associated with uplands (i.e., water with pH ca 6.5 and water-saturated soil) to acutely dehydrated frogs. Green frog reproduction at bog ponds was a rare event, and no net movements occurred between forest and bog habitats. However, acutely dehydrated frogs did not avoid Sphagnum. Results show that although green frogs rarely breed in bogs and do not move en masse between forest and bog habitats, they do not avoid bog substrates for rehydrating, despite their acidity. Thus, bogs offer viable summering habitat to amphibians, which highlights the value of these threatened environments in terrestrial amphibian ecology.

  9. Nutritional composition of selected green leafy vegetables, herbs and carrots.

    PubMed

    Singh, G; Kawatra, A; Sehgal, S

    2001-01-01

    Six green leafy vegetables and herbs - spinach, amaranth, bengal gram, cauliflower, mint, coriander and carrots - were analyzed for moisture, protein, ascorbic acid, beta-carotene, total iron, ionizable iron (as % of total iron) in vitro iron (% of total iron), copper, manganese and zinc. Moisture content of the leaves and carrots varied from 75.1 percent (bengal gram) to 95.4 percent (carrot) and protein from 9.83 percent (carrots) to 30.9 (mint) percent. Ascorbic acid, beta-carotene, total iron and ionizable iron contents were at a maximum in case of bengal gram leaves whereas level of ionizable iron and in vitro iron as a percent of total iron was highest in carrots. Copper, manganese and zinc contents were maximum in spinach.

  10. Composition for nucleic acid sequencing

    SciTech Connect

    Korlach, Jonas; Webb, Watt W.; Levene, Michael; Turner, Stephen; Craighead, Harold G.; Foquet, Mathieu

    2008-08-26

    The present invention is directed to a method of sequencing a target nucleic acid molecule having a plurality of bases. In its principle, the temporal order of base additions during the polymerization reaction is measured on a molecule of nucleic acid, i.e. the activity of a nucleic acid polymerizing enzyme on the template nucleic acid molecule to be sequenced is followed in real time. The sequence is deduced by identifying which base is being incorporated into the growing complementary strand of the target nucleic acid by the catalytic activity of the nucleic acid polymerizing enzyme at each step in the sequence of base additions. A polymerase on the target nucleic acid molecule complex is provided in a position suitable to move along the target nucleic acid molecule and extend the oligonucleotide primer at an active site. A plurality of labelled types of nucleotide analogs are provided proximate to the active site, with each distinguishable type of nucleotide analog being complementary to a different nucleotide in the target nucleic acid sequence. The growing nucleic acid strand is extended by using the polymerase to add a nucleotide analog to the nucleic acid strand at the active site, where the nucleotide analog being added is complementary to the nucleotide of the target nucleic acid at the active site. The nucleotide analog added to the oligonucleotide primer as a result of the polymerizing step is identified. The steps of providing labelled nucleotide analogs, polymerizing the growing nucleic acid strand, and identifying the added nucleotide analog are repeated so that the nucleic acid strand is further extended and the sequence of the target nucleic acid is determined.

  11. Interactive suppression of aberrant crypt foci induced by azoxymethane in rat colon by phytic acid and green tea.

    PubMed

    Challa, A; Rao, D R; Reddy, B S

    1997-10-01

    Several epidemiological studies point to a strong correlation between nutrient composition of the diet and cancer of the colon. Phytic acid, present in grains, has been credited with reducing the risk of cancer of the colon. A number of reports are available indicating the benefits of green tea consumption in reducing the risk of stomach, lung and skin cancer, but little data are available on the effect of green tea in reducing the risk of colon cancer. Also, there are no studies on the combined effect of these compounds on colon tumorigenesis. Thus the primary objective of this investigation was to elucidate the combined effects of green tea and phytic acid on colonic preneoplastic lesions and the Phase II enzyme glutathione S-transferase. Fisher 344 male weanling rats were divided into nine groups of 15 rats each and fed the experimental diet for 13 weeks. Rats received two s.c. injections of azoxymethane in saline at 16 mg/kg body wt at 7 and 8 weeks of age. Rats received three levels (0, 1 and 2%) of phytic acid with three levels (0, 1 and 2%) of green tea within each phytic acid level in a 3 x 3 factorial experiment. Results indicate that while green tea had a marginal effect (P < 0.14), phytic acid significantly reduced the incidence of aberrant crypt foci (P < 0.008). The interaction between green tea and phytic acid was significant (P < 0.029 for distal and < 0.0168 for entire colon) and positive, pointing to a synergistic effect of green tea and phytic acid.

  12. Optical properties of (nanometer MCM-41)-(malachite green) composite materials

    NASA Astrophysics Data System (ADS)

    Li, Xiao-Dong; Zhai, Qing-Zhou; Zou, Ming-Qiang

    2010-11-01

    Nanosized materials loaded with organic dyes are of interest with respect to novel optical applications. The optical properties of malachite green (MG) in MCM-41 are considerably influenced by the limited nanoporous channels of nanometer MCM-41. Nanometer MCM-41 was synthesized by tetraethyl orthosilicate (TEOS) as the source of silica and cetyltrimethylammonium bromide (CTMAB) as the template. The liquid-phase grafting method has been employed for incorporation of the malachite green molecules into the channels of nanometer MCM-41. A comparative study has been carried out on the adsorption of the malachite green into modified MCM-41 and unmodified MCM-41. The modified MCM-41 was synthesized using a silylation reagent, trimethychlorosilane (TMSCl), which functionalized the surface of nanometer MCM-41 for proper host-guest interaction. The prepared (nanometer MCM-41)-MG samples have been studied by powder X-ray diffraction (XRD), Fourier transform infrared (FT-IR) spectroscopy, low-temperature nitrogen adsorption-desorption technique at 77 K, Raman spectra and luminescence studies. In the prepared (nanometer MCM-41)-MG composite materials, the frameworks of the host molecular sieve were kept intact and the MG located inside the pores of MCM-41. Compared with the MG, it is found that the prepared composite materials perform a considerable luminescence. The excitation and emission spectra of MG in both modified MCM-41 and unmodified MCM-41 were examined to explore the structural effects on the optical properties of MG. The results of luminescence spectra indicated that the MG molecules existed in monomer form within MCM-41. However, the luminescent intensity of MG incorporated in the modified MCM-41 are higher than that of MG encapsulated in unmodified MCM-41, which may be due to the anchored methyl groups on the channels of the nanometer MCM-41 and the strong host-guest interactions. The steric effect from the pore size of the host materials is significant. Raman

  13. Amino acid composition of some Mexican foods.

    PubMed

    Morales de León, Josefina; Camacho, M Elena; Bourges, Héctor

    2005-06-01

    Knowledge of the amino acid composition of foods is essential to calculate their chemical score, which is used to predict protein quality of foods and diets. Though amino acid composition of many foods is reasonably well established, better knowledge is needed on native foods consumed in different regions and countries. This paper presents the amino acid composition of different presentations of raw and processed foods produced and consumed in Mexico. The amino acid composition was determined using Beckman amino acid analyzers (models 116 and 6300). Tryptophan was determined using the Spies and Chambers method. Of the different foods analyzed, some comments are made on native or basic foods in Mexico: Spirulin, where lysine is the limiting amino acid, with a chemical score of 67%, is a good source of tryptophan (1.16g/16 gN); amaranth contains high levels of sulphur amino acids (4.09 to 5.34 g/16gN), with a protein content of 15 g/100g; and pulque, a Pre-Hispanic beverage that contains high levels of tryptophan (2.58 g/16 gN) and sulphur amino acids (2.72 g/16 gN). Finally, insects are good sources of sulphur amino acids and lysine.

  14. Gibberellic Acid effects on greening in pea seedlings.

    PubMed

    Mathis, J N; Bradburne, J A; Dupree, M A

    1989-09-01

    The effect of gibberellic acid (GA) on light-induced greening of etiolated pea plants (Pisum sativum [L.] cultivars Alaska and Progress) was characterized. Progress, a GA-deficient dwarf of Alaska, was found to accumulate chlorophyll and light harvesting chlorophyll protein associated with photosystem II (LHC-II) more rapidly than Alaska, Alaska treated with GA, or Progress treated with GA. A slightly lower chlorophyll content was noted after 24 hours of light induced greening for Alaska treated with GA relative to untreated Alaska. GA-treated Progress, Alaska, and GA-treated Alaska all gave essentially identical patterns for LHC-II accumulation. Similar patterns of LHC-II mRNA induction were found in all four treatments indicating that differences in mRNA induction did not cause differences in LHC-II accumulation. Chlorophyll and LHC-II accumulation in each treatment followed the same patterns of accumulation and a significant correlation (at the 0.01 level of significance) was found between chlorophyll and LHC-II content. Since Progress treated with GA accumulated LHC-II and chlorophyll in a manner similar to that of Alaska, it is clear that GA alters the process of greening either directly or indirectly. PMID:16666994

  15. Fatty acid profiles of four filamentous green algae under varying culture conditions.

    PubMed

    Liu, Junzhuo; Vanormelingen, Pieter; Vyverman, Wim

    2016-01-01

    Although benthic filamentous algae are interesting targets for wastewater treatment and biotechnology, relatively little is known about their biochemical composition and variation in response to growth conditions. Fatty acid composition of four benthic filamentous green algae was determined in different culture conditions. Although the response was partly species-dependent, increasing culture age, nitrogen deprivation and dark exposure of stationary phase greatly increased both total fatty acid content (TFA) from 12-35 to 40-173mgg(-1) dry weight (DW) and the relative proportion of polyunsaturated fatty acids (PUFAs) from 21-58% to 55-87% of TFA, with dark exposure having the greatest effect. However, the main variation in fatty acid composition was between species, with Uronema being rich in C16:0 (2.3% of DW), Klebsormidium in C18:2ω6 (5.4% of DW) and Stigeoclonium in C18:3ω3 (11.1% of DW). This indicates the potential of the latter two species as potential sources of these PUFAs.

  16. Wood-plastic composites as promising green-composites for automotive industries!

    PubMed

    Ashori, Alireza

    2008-07-01

    Wood-plastic composite (WPC) is a very promising and sustainable green material to achieve durability without using toxic chemicals. The term WPCs refers to any composites that contain plant fiber and thermosets or thermoplastics. In comparison to other fibrous materials, plant fibers are in general suitable to reinforce plastics due to relative high strength and stiffness, low cost, low density, low CO2 emission, biodegradability and annually renewable. Plant fibers as fillers and reinforcements for polymers are currently the fastest-growing type of polymer additives. Since automakers are aiming to make every part either recyclable or biodegradable, there still seems to be some scope for green-composites based on biodegradable polymers and plant fibers. From a technical point of view, these bio-based composites will enhance mechanical strength and acoustic performance, reduce material weight and fuel consumption, lower production cost, improve passenger safety and shatterproof performance under extreme temperature changes, and improve biodegradability for the auto interior parts. PMID:18068352

  17. In Vitro bile acid binding of kale, mustard greens, broccoli, cabbage and green bell pepper improves with microwave cooking

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Bile acid binding potential of foods and food fractions has been related to lowering the risk of heart disease and that of cancer. Sautéing or steam cooking has been observed to significantly improve bile acid binding of green/leafy vegetables. It was hypothesized that microwave cooking could impr...

  18. Nutrient composition and nutritional importance of green leaves and wild food resources in an agricultural district, Koutiala, in southern Mali.

    PubMed

    Nordeide, M B; Hatløy, A; Følling, M; Lied, E; Oshaug, A

    1996-11-01

    This paper discusses the nutrient composition and the nutritional importance of green leaves and wild gathered foods in an area with surplus food production in Mali. In this West African country, there is little information about the nutrient composition and the nutritional quality of foods in general, and of wild gathered foods in particular. Food frequency was collected in two cross-sectional surveys. Focus group discussions with women in the area were used to collect information about seasonality, availability and preparation of various foods. Selected food samples were collected for chemical analysis of nutrient composition. The food samples of green leaves (Adansonia digitata, Amaranthus viridis, Tamarindus indica, Allium cepa), seeds and flour (Parkia biglobosa) and fruits (Tamarindus indica) were analysed for water, energy, fat, protein, minerals, amino acids and carotenoids. Availability and use of the foods varied with seasons. In the rainy season, wild gathered foods (e.g. A. digitata) were used as much as fresh cultivated foods (e.g., A. viridis and A. cepa). The wild food resources were more frequently used in rural than in urban areas, with A. digitata as the dominating green leaves. Green leaves were rich in energy, protein and minerals (calcium, iron). Leaves of A. viridis were, in particular, rich in beta-carotene (3290 micrograms/100 g). Chemical score in dried green leaves varied from 47 (A. cepa) to 81 (A. digitata), with lysine as the first limiting amino acid. P. biglobosa fermented seeds, with 35% fat and 37% protein were a complementary source of lysine in the diet. Based on the seasonality, the frequency of use and the nutrient contents of selected green leaves and wild gathered foods in Koutiala district, it is concluded that these traditional and locally produced foods are valuable and important nutrient contributors in the diet both in rural and urban areas, but most important in rural areas.

  19. Green chromatography determination of fatty acid methyl esters in biodiesel.

    PubMed

    Mayo, Carlos Molina; Alayón, Andrea Brito; García Rodríguez, María Teresa; Jiménez Abizanda, Ana Isabel; Moreno, Francisco Jiménez

    2015-01-01

    This work proposes a green, simple and rapid chromatographic methodology for separation and determination of a group of 13 fatty acids methyl esters (FAMEs) by using a capillary gas chromatography with a flame ionization detector. The method was successfully applied for the determination of FAMEs in biodiesel samples from commercial and waste cooking oils, synthesized by homogeneous catalysis. Detection and quantification limits were in the μg L(-1) level. Direct injection of sample solution was compared with solid-phase extraction and solid-phase microextraction procedures, giving similar results. The lower analysis time represent considerable improvement compared with other papers. The described methodology is especially suitable for process control applications. The samples analysed showed total contents of FAMEs higher than 96.5%, which verifies the European regulations. PMID:25666201

  20. Starch composites with aconitic acid.

    PubMed

    Gilfillan, William Neil; Doherty, William O S

    2016-05-01

    The aim of this project is to examine the effectiveness of using aconitic acid (AcA), a tricarboxylic acid which contains a carbon/carbon double bond (CC), to enhance the properties of starch-based films. Starch/glycerol cast films were prepared with 0, 2, 5, 10 and 15wt% AcA (starch wt% basis) and the properties analysed. It was shown that AcA acted as both a cross-linking agent and also a strong plasticising agent. The 5wt% AcA derived starch films were the most effectively cross-linked having the lowest solubility (28wt%) and decreased swelling coefficient (35vol.%) by approximately 3 times and 2.4 times respectively compared to the control film submerged in water (23°C). There was also a significant increase in the film elongation at break by approximately 35 times (compared to the control) with the addition of 15wt% AcA, emphasising the plasticising effect of AcA. However, generally there was a reduced tensile strength, softening of the film, and reduced thermal stability with increased amounts of AcA. PMID:26876996

  1. Novel green nano composites films fabricated by indigenously synthesized graphene oxide and chitosan.

    PubMed

    Khan, Younus H; Islam, Atif; Sarwar, Afsheen; Gull, Nafisa; Khan, Shahzad M; Munawar, Muhammad A; Zia, Saba; Sabir, Aneela; Shafiq, Muhammad; Jamil, Tahir

    2016-08-01

    Graphene oxide (GO) was indigenously synthesized from graphite using standard Hummers method. Chitosan-graphene oxide green composite films were fabricated by mixing aqueous solution of chitosan and GO using dilute acetic acid as a solvent for chitosan. Chitosan of different viscosity and calculated molecular weight was used keeping amount of GO constant in each composite film. The structural properties, thermal stability and mechanical properties of the composite films were investigated using Fourier transform infrared (FTIR) spectroscopy, X-ray diffraction (XRD), scanning electron microscopy (SEM), thermogravimetric analysis (TGA) and tensile test. FTIR studies revealed the successful synthesis of GO from graphite powder and it was confirmed that homogenous blending of chitosan and GO was promising due to oxygenated functional groups on the surface of GO. XRD indicated effective conversion of graphite to GO as its strong peak observed at 11.06° as compared to pristine graphite which appeared at 26°. Moreover, mechanical analysis confirmed the effect of molecular weight on the mechanical properties of chitosan-GO composites showing that higher molecular weight chitosan composite (GOCC-1000) showed best strength (higher than 3GPa) compared to other composite films. Thermal stability of GOCC-1000 was enhanced for which residual content increased up to 56% as compared to the thermal stability of GOCC-200 whose residue was restricted to only 24%. The morphological analysis of the composites sheets by SEM was smooth having dense structure and showed excellent interaction, miscibility, compatibility and dispersion of GO with chitosan. The prepared composite films find their applications as biomaterials in different biomedical fields.

  2. Novel green nano composites films fabricated by indigenously synthesized graphene oxide and chitosan.

    PubMed

    Khan, Younus H; Islam, Atif; Sarwar, Afsheen; Gull, Nafisa; Khan, Shahzad M; Munawar, Muhammad A; Zia, Saba; Sabir, Aneela; Shafiq, Muhammad; Jamil, Tahir

    2016-08-01

    Graphene oxide (GO) was indigenously synthesized from graphite using standard Hummers method. Chitosan-graphene oxide green composite films were fabricated by mixing aqueous solution of chitosan and GO using dilute acetic acid as a solvent for chitosan. Chitosan of different viscosity and calculated molecular weight was used keeping amount of GO constant in each composite film. The structural properties, thermal stability and mechanical properties of the composite films were investigated using Fourier transform infrared (FTIR) spectroscopy, X-ray diffraction (XRD), scanning electron microscopy (SEM), thermogravimetric analysis (TGA) and tensile test. FTIR studies revealed the successful synthesis of GO from graphite powder and it was confirmed that homogenous blending of chitosan and GO was promising due to oxygenated functional groups on the surface of GO. XRD indicated effective conversion of graphite to GO as its strong peak observed at 11.06° as compared to pristine graphite which appeared at 26°. Moreover, mechanical analysis confirmed the effect of molecular weight on the mechanical properties of chitosan-GO composites showing that higher molecular weight chitosan composite (GOCC-1000) showed best strength (higher than 3GPa) compared to other composite films. Thermal stability of GOCC-1000 was enhanced for which residual content increased up to 56% as compared to the thermal stability of GOCC-200 whose residue was restricted to only 24%. The morphological analysis of the composites sheets by SEM was smooth having dense structure and showed excellent interaction, miscibility, compatibility and dispersion of GO with chitosan. The prepared composite films find their applications as biomaterials in different biomedical fields. PMID:27112859

  3. An Unlikely Silk: The Composite Material of Green Lacewing Cocoons

    SciTech Connect

    Weisman, Sarah; Trueman, Holly E.; Mudie, Stephen T.; Church, Jeffrey S.; Sutherland, Tara D.; Haritos, Victoria S.

    2009-01-15

    Spiders routinely produce multiple types of silk; however, common wisdom has held that insect species produce one type of silk each. This work reports that the green lacewing (Mallada signata, Neuroptera) produces two distinct classes of silk. We identified and sequenced the gene that encodes the major protein component of the larval lacewing cocoon silk and demonstrated that it is unrelated to the adult lacewing egg-stalk silk. The cocoon silk protein is 49 kDa in size and is alanine rich (>40%), and it contains an {alpha}-helical secondary structure. The final instar lacewing larvae spin protein fibers of {approx}2 {mu}m diameter to construct a loosely woven cocoon. In a second stage of cocoon construction, the insects lay down an inner wall of lipids that uses the fibers as a scaffold. We propose that the silk protein fibers provide the mechanical strength of the composite lacewing cocoon whereas the lipid layer provides a barrier to water loss during pupation.

  4. Proximate composition, amino acid and fatty acid composition of fish maws.

    PubMed

    Wen, Jing; Zeng, Ling; Xu, Youhou; Sun, Yulin; Chen, Ziming; Fan, Sigang

    2016-01-01

    Fish maws are commonly recommended and consumed in Asia over many centuries because it is believed to have some traditional medical properties. This study highlights and provides new information on the proximate composition, amino acid and fatty acid composition of fish maws of Cynoscion acoupa, Congresox talabonoides and Sciades proops. The results indicated that fish maws were excellent protein sources and low in fat content. The proteins in fish maws were rich in functional amino acids (FAAs) and the ratio of FAAs and total amino acids in fish maws ranged from 0.68 to 0.69. Among species, croaker C. acoupa contained the most polyunsaturated fatty acids, arachidonic acid, docosahexaenoic acid and eicosapntemacnioc acid, showing the lowest value of index of atherogenicity and index of thrombogenicity, showing the highest value of hypocholesterolemic/hypercholesterolemic ratio, which is the most desirable.

  5. Comparative fatty acid composition of four Sargassum species (Fucales, Phaeophyta)

    NASA Astrophysics Data System (ADS)

    Wu, Xiang-Chun; Lu, Bao-Ren; Tseng, C. K.

    1995-12-01

    Fatty acid composition of four Sargassum species from Qingdao and Shidao, Shandong Province was investigated. 16:0 (palmitic acid) was the major saturated fatty acid. C18 and C20 were the main polyunsaturated fatty acids (PUFAs). Arachidonic acid and eicosapentaenoic acid predominated among polyenoic acids in all the algal species examined, except for Sargassum sp. which had low concentration of eicosapentaenoic acid.

  6. Use of anaerobic green fluorescent protein versus green fluorescent protein as reporter in lactic acid bacteria.

    PubMed

    Landete, José M; Langa, Susana; Revilla, Concepción; Margolles, Abelardo; Medina, Margarita; Arqués, Juan L

    2015-08-01

    Lactic acid bacteria (LAB) are commonly used in the production of fermented and probiotic foods. Development of molecular tools to discriminate the strains of interest from the endogenous microbiota in complex environments like food or gut is of high interest. Green fluorescent protein (GFP)-like chromophores strictly requires molecular oxygen for maturation of fluorescence, which restrict the study of microorganisms in low-oxygen environments. In this work, we have developed a noninvasive cyan-green fluorescent based reporter system for real-time tracking of LAB that is functional under anoxic conditions. The evoglow-Pp1 was cloned downstream from the promoters D-alanyl-D-alanine carboxypeptidase and elongation factor Tu of Lactobacillus reuteri CECT925 using pNZ8048 and downstream of the lactococcal P1 promoter using pT1NX. The classical gfp was also cloned in pT1NX. These recombinant expression vectors were electroporated into Lactococccus, Lactobacillus, and Enterococcus strains with biotechnological and/or probiotic interests to assess and compare their functionality under different conditions of oxygen and pH. The expression was analyzed by imaging and fluorometric methods as well as by flow cytometry. We demonstrate that reporter systems pNZ:TuR-aFP and pT1-aFP are two versatile molecular markers for monitoring LAB in food and fecal environments without the potential problems caused by oxygen and pH limitations, which could be exploited for in vivo studies. Production of the fluorescent protein did not disturb any important physiological properties of the parental strains, such as growth rate, reuterin, or bacteriocin production.

  7. Leguminose green juice as an efficient nutrient for l(+)-lactic acid production.

    PubMed

    Dietz, Donna; Schneider, Roland; Papendiek, Franka; Venus, Joachim

    2016-10-20

    Lactic acid is one of the most important building blocks for the production of bioplastic. Many investigations have been conducted to reduce the lactic acid production costs. In this work, the focus was put on the application of legume pressed juice or green juice as nutrient source. The pressed juice was utilized directly without prior pre-treatment and sterilization. Using two different alfalfa green juices and a clover green juice from two different harvest years as sole nutrients, non-sterile fermentations were performed at 52°C and pH 6.0 with a thermotolerant strain Bacillus coagulans AT107. The results showed that alfalfa green juices generally were more suitable for high lactic acid production than clover green juices, presumably due to the higher nitrogen content. A final titer of 98.8g/L after 30h with l(+)-lactic acid purity of >99% was obtained. PMID:27422353

  8. Leguminose green juice as an efficient nutrient for l(+)-lactic acid production.

    PubMed

    Dietz, Donna; Schneider, Roland; Papendiek, Franka; Venus, Joachim

    2016-10-20

    Lactic acid is one of the most important building blocks for the production of bioplastic. Many investigations have been conducted to reduce the lactic acid production costs. In this work, the focus was put on the application of legume pressed juice or green juice as nutrient source. The pressed juice was utilized directly without prior pre-treatment and sterilization. Using two different alfalfa green juices and a clover green juice from two different harvest years as sole nutrients, non-sterile fermentations were performed at 52°C and pH 6.0 with a thermotolerant strain Bacillus coagulans AT107. The results showed that alfalfa green juices generally were more suitable for high lactic acid production than clover green juices, presumably due to the higher nitrogen content. A final titer of 98.8g/L after 30h with l(+)-lactic acid purity of >99% was obtained.

  9. Report-The fatty acid composition and physicochemical properties of the underutilised Cassia abbreviata seed oil.

    PubMed

    Dangarembizi, Rachael; Chivandi, Eliton; Dawood, Sumaya; Erlwanger, Kennedy Honey; Gundidza, Mazuru; Magwa, Michael Libala; Muredzi, Perkins; Samie, Amidou

    2015-05-01

    The fatty acid composition of the underutilised Cassia abbreviata seed oil was determined using gas chromatographic methods. C. abbreviata seeds yielded 9.53% of yellowish-green oil consisting mainly of oleic acid (37.8%), palmitic acid (26.5%), linoleic acid (26.7%), stearic acid (4.1%) and elaidic acid (2.1%). The oil was solid at room temperature, had a saponification value of 376.16 mg KOH/g and an iodine value of 26.48 g I2/100g oil. The fatty acid composition and saponification value of the C. abbreviata seed oil suggest that it may find application in both cosmetic and pharmaceutical natural product formulations.

  10. Report-The fatty acid composition and physicochemical properties of the underutilised Cassia abbreviata seed oil.

    PubMed

    Dangarembizi, Rachael; Chivandi, Eliton; Dawood, Sumaya; Erlwanger, Kennedy Honey; Gundidza, Mazuru; Magwa, Michael Libala; Muredzi, Perkins; Samie, Amidou

    2015-05-01

    The fatty acid composition of the underutilised Cassia abbreviata seed oil was determined using gas chromatographic methods. C. abbreviata seeds yielded 9.53% of yellowish-green oil consisting mainly of oleic acid (37.8%), palmitic acid (26.5%), linoleic acid (26.7%), stearic acid (4.1%) and elaidic acid (2.1%). The oil was solid at room temperature, had a saponification value of 376.16 mg KOH/g and an iodine value of 26.48 g I2/100g oil. The fatty acid composition and saponification value of the C. abbreviata seed oil suggest that it may find application in both cosmetic and pharmaceutical natural product formulations. PMID:26004707

  11. Carotenoid and fatty acid metabolism in nitrogen-starved Dunaliella salina, a unicellular green microalga.

    PubMed

    Lamers, Packo P; Janssen, Marcel; De Vos, Ric C H; Bino, Raoul J; Wijffels, René H

    2012-11-30

    Nitrogen availability and light intensity affect β-carotene overproduction in the green alga Dunaliella salina. Following a previous study on high-light stress, we here report on the effect of nitrogen depletion on the growth characteristics and β-carotene as well as fatty acid metabolism of D. salina under a constant light regime in a turbidostat. Upon nitrogen depletion, the biomass yield on absorbed light approximately doubled, due to a transient increase in cell division rate, swelling of the cells and a linear increase of the density of the cells. Simultaneously, β-carotene started to accumulate up to a final intracellular concentration of 14 mg LCV⁻¹ (i.e. 2.7% of AFDW). This β-carotene production accounted for 6% of the increased density of the cells, indicating that other biochemical constituents accumulated as well. Since D. salina accumulates β-carotene in lipid globules, we also determined the fatty acid content and composition of D. salina. The intracellular concentration of the total fatty acid pool did not change significantly during nitrogen starvation, indicating that β-carotene and total fatty acid accumulation were unrelated, similar to what was found previously for high-light treated cells. However, for both high-light and nitrogen stress, β-carotene accumulation negatively correlated with the degree of unsaturation of the total fatty acid pool and, within the individual fatty acids, correlated positively with oleic acid biosynthesis, suggesting that oleic acid may be a key component of the lipid-globule-localized triacylglycerols and thereby in β-carotene accumulation.

  12. Cellular fatty acid composition of Haemophilus equigenitalis.

    PubMed Central

    Sugimoto, C; Miyagawa, E; Mitani, K; Nakazawa, M; Isayama, Y

    1982-01-01

    The cellular fatty acid composition of eight Haemophilus equigenitalis strains was determined by gas-liquid chromatography. All strains showed a grossly similar pattern characterized by large amounts of 18:1 and 16:0. The amounts of 16:1, 18:2, 18:0, 3-OH 14:0, 3-OH 16:0, and 3-OH 18:1 were relatively small. PMID:7096556

  13. A Green Polymerization of Aspartic Acid for the Undergraduate Organic Laboratory

    ERIC Educational Resources Information Center

    Bennett, George D.

    2005-01-01

    The green polymerization of aspartic acid carried out during an organic-inorganic synthesis laboratory course for undergraduate students is described. The procedure is based on work by Donlar Corporation, a Peru, Illinois-based company that won a Green Chemistry Challenge Award in 1996 in the Small Business category for preparing thermal…

  14. Fatty acid composition of water buffalo meat.

    PubMed

    Sharma, N; Gandemer, G; Goutefongea, R; Kowale, B N

    1986-01-01

    The fatty acid composition of intramuscular lipids of Longissimus dorsi (LD), Psoas major (PM), Biceps femoris (BF), Semitendinosus (ST) muscles and liver of water buffalo male calves was determined by capillary gas-liquid chromatography. The content of total lipids in the LD muscle was found to be maximum, followed by PM, BF and ST in decreasing order (1·03, 0·99, 0·66 and 0·55g/100g of fresh muscle). Liver contained 2·65 g of total lipids per 100 g of fresh tissue. Following the anatomical location, intramuscular lipids contained 44-55% of saturated fatty acids, of which the major components were stearic and palmitic acids. Mono-unsaturated fatty acids (31-40%) composed mainly oleic acid (90%). The PUFA contents in PM, LD, ST and BF were, respectively, 11%, 12%, 13% and 16%. The predominant PUFA were linoleic (66%) and arachidonic (25%). The significance of difference of PUFA content between muscles is discussed. Liver contained 48%, 27% and 22% saturated, monosaturated and PUFA, respectively. The PUFA in liver were linoleic (36%), C20 (47%) and C22 (9%).

  15. Calculation of the relative uniformity coefficient on the green composites reinforced with cotton and hemp fabric

    NASA Astrophysics Data System (ADS)

    Baciu, Florin; Hadǎr, Anton; Sava, Mihaela; Marinel, Stǎnescu Marius; Bolcu, Dumitru

    2016-06-01

    In this paper it is studied the influence of discontinuities on elastic and mechanical properties of green composite materials (reinforced with fabric of cotton or hemp). In addition, it is studied the way variations of the volume f the reinforcement influences the elasticity modulus and the tensile strength for the studied composite materials. In order to appreciate the difference in properties between different areas of the composite material, and also the dimensions of the defective areas, we have introduced a relative uniformity coefficient with which the mechanical behavior of the studied composite is compared with a reference composite. To validate the theoretical results we have obtained we made some experiments, using green composites reinforced with fabric, with different imperfection introduced special by cutting the fabric.

  16. Lewis acid catalysis and Green oxidations: sequential tandem oxidation processes induced by Mn-hyperaccumulating plants.

    PubMed

    Escande, Vincent; Renard, Brice-Loïc; Grison, Claude

    2015-04-01

    Among the phytotechnologies used for the reclamation of degraded mining sites, phytoextraction aims to diminish the concentration of polluting elements in contaminated soils. However, the biomass resulting from the phytoextraction processes (highly enriched in polluting elements) is too often considered as a problematic waste. The manganese-enriched biomass derived from native Mn-hyperaccumulating plants of New Caledonia was presented here as a valuable source of metallic elements of high interest in chemical catalysis. The preparation of the catalyst Eco-Mn1 and reagent Eco-Mn2 derived from Grevillea exul exul and Grevillea exul rubiginosa was investigated. Their unusual polymetallic compositions allowed to explore new reactivity of low oxidative state of manganese-Mn(II) for Eco-Mn1 and Mn(IV) for Eco-Mn2. Eco-Mn1 was used as a Lewis acid to catalyze the acetalization/elimination of aldehydes into enol ethers with high yields; a new green and stereoselective synthesis of (-)-isopulegol via the carbonyl-ene cyclization of (+)-citronellal was also performed with Eco-Mn1. Eco-Mn2 was used as a mild oxidative reagent and controlled the oxidation of aliphatic alcohols into aldehydes with quantitative yields. Oxidative cleavage was interestingly noticed when Eco-Mn2 was used in the presence of a polyol. Eco-Mn2 allowed direct oxidative iodination of ketones without using iodine, which is strongly discouraged by new environmental legislations. Finally, the combination of the properties in the Eco-Mn catalysts and reagents gave them an unprecedented potential to perform sequential tandem oxidation processes through new green syntheses of p-cymene from (-)-isopulegol and (+)-citronellal; and a new green synthesis of functionalized pyridines by in situ oxidation of 1,4-dihydropyridines.

  17. Lewis acid catalysis and Green oxidations: sequential tandem oxidation processes induced by Mn-hyperaccumulating plants.

    PubMed

    Escande, Vincent; Renard, Brice-Loïc; Grison, Claude

    2015-04-01

    Among the phytotechnologies used for the reclamation of degraded mining sites, phytoextraction aims to diminish the concentration of polluting elements in contaminated soils. However, the biomass resulting from the phytoextraction processes (highly enriched in polluting elements) is too often considered as a problematic waste. The manganese-enriched biomass derived from native Mn-hyperaccumulating plants of New Caledonia was presented here as a valuable source of metallic elements of high interest in chemical catalysis. The preparation of the catalyst Eco-Mn1 and reagent Eco-Mn2 derived from Grevillea exul exul and Grevillea exul rubiginosa was investigated. Their unusual polymetallic compositions allowed to explore new reactivity of low oxidative state of manganese-Mn(II) for Eco-Mn1 and Mn(IV) for Eco-Mn2. Eco-Mn1 was used as a Lewis acid to catalyze the acetalization/elimination of aldehydes into enol ethers with high yields; a new green and stereoselective synthesis of (-)-isopulegol via the carbonyl-ene cyclization of (+)-citronellal was also performed with Eco-Mn1. Eco-Mn2 was used as a mild oxidative reagent and controlled the oxidation of aliphatic alcohols into aldehydes with quantitative yields. Oxidative cleavage was interestingly noticed when Eco-Mn2 was used in the presence of a polyol. Eco-Mn2 allowed direct oxidative iodination of ketones without using iodine, which is strongly discouraged by new environmental legislations. Finally, the combination of the properties in the Eco-Mn catalysts and reagents gave them an unprecedented potential to perform sequential tandem oxidation processes through new green syntheses of p-cymene from (-)-isopulegol and (+)-citronellal; and a new green synthesis of functionalized pyridines by in situ oxidation of 1,4-dihydropyridines. PMID:25263417

  18. Composition and structure of an iron-bearing, layered double hydroxide (LDH) - Green rust sodium sulphate

    NASA Astrophysics Data System (ADS)

    Christiansen, B. C.; Balic-Zunic, T.; Petit, P.-O.; Frandsen, C.; Mørup, S.; Geckeis, H.; Katerinopoulou, A.; Stipp, S. L. Svane

    2009-06-01

    Mixed-valent Fe(II),Fe(III)-layered hydroxide, known as green rust, was synthesized from slightly basic, sodium sulphate solutions in an oxygen-free glove box. Solution conditions were monitored with pH and Eh electrodes and optimized to ensure a pure sulphate green-rust phase. The solid was characterised using Mössbauer spectroscopy, X-ray diffraction, scanning electron microscopy and atomic force microscopy. The composition of the solution from which the green rust precipitated was established by mass and absorption spectroscopy. The sulphate form of green rust is composed of brucite-like layers with Fe(II) and Fe(III) in an ordered distribution. The interlayers contain sulphate, water and sodium in an arrangement characteristic for the nikischerite group. The crystal structure is highly disordered by stacking faults. The composition, formula and crystallographic parameters are: NaFe(II) 6Fe(III) 3(SO 4) 2(OH) 18·12H 2O, space group P-3, a = 9.528(6) Å, c = 10.968(8) Å and Z = 1. Green rust sodium sulphate, GR, crystallizes in thin, hexagonal plates. Particles range from less than 50 nm to 2 μm in diameter and are 40 nm thick or less. The material is redox active and reaction rates are fast. Extremely small particle size and high surface area contribute to rapid oxidation, transforming green rust to an Fe(III)-phase within minutes.

  19. Composition of pigments and colour changes in green table olives related to processing type.

    PubMed

    Ramírez, Eva; Gandul-Rojas, Beatriz; Romero, Concepción; Brenes, Manuel; Gallardo-Guerrero, Lourdes

    2015-01-01

    Brownish colourations in Natural green table olives (non-treated with alkali) make this product less attractive to consumers than Spanish-style green table olives (treated with alkali), which develop a more appreciated bright golden-yellow colour. These colour differences were studied in relation to changes in the composition of chlorophyll and carotenoid pigments, as well as polyphenolic compounds and polyphenol oxidase enzyme (PPO) activity. Natural green olives showed a different chlorophyll profile than Spanish-style. However, all the chlorophyll pigments formed in both processing types were Mg-free derivatives (mostly pheophytins) with similar colourations, ranging from grey to green brownish. In the carotenoid fraction no appreciable differences were found between both processing types. The fruit's brownish colour was mainly due to polymeric substances with a size of >1000 daltons and polyphenolic nature, resulting from an enzymatic oxidation by PPO of the o-diphenolic compounds present in the fresh fruits.

  20. Thermal properties of epoxy composites filled with boric acid

    NASA Astrophysics Data System (ADS)

    Visakh, P. M.; Nazarenko, O. B.; Amelkovich, Yu A.; Melnikova, T. V.

    2015-04-01

    The thermal properties of epoxy composites filled with boric acid fine powder at different percentage were studied. Epoxy composites were prepared using epoxy resin ED-20, boric acid as flame-retardant filler, hexamethylenediamine as a curing agent. The prepared samples and starting materials were examined using methods of thermal analysis, scanning electron microscopy and infrared spectroscopy. It was found that the incorporation of boric acid fine powder enhances the thermal stability of epoxy composites.

  1. Contents and compositions of policosanols in green tea (Camellia sinensis) leaves.

    PubMed

    Choi, Sol Ji; Park, Su Yeon; Park, Ji Su; Park, Sang-Kyu; Jung, Mun Yhung

    2016-08-01

    Policosanol (PC) is a mixture of health promoting bioactive long-chain aliphatic alcohols. Here, we report that green tea (Camellia sinensis) leaves are the exceptionally rich plant-sources of PC. Young and tender leaves and old and turf leaves of C. sinensis were hand-picked in spring and autumn. The total contents of PC in the leaves were in the range of 726.2-1363.6mg/kg as determined by a GC-MS/MS. The compositions of PC in the leaves were different with harvest season and types. The total contents of PC in commercial green tea leaves were found to be in the range of 856.7-1435.1mg/kg. Interestingly, the infused green tea leaves contained the higher PC than the non-infused green tea product, reaching to 1629.4mg/kg. This represents the first report on the contents and compositions of PC in green tea leaves, showing unambiguous evidence of their potential as rich sources of PC.

  2. Exploring the chemical sensitivity of a carbon nanotube/green tea composite.

    PubMed

    Chen, Yanan; Lee, Yang Doo; Vedala, Harindra; Allen, Brett L; Star, Alexander

    2010-11-23

    Single-walled carbon nanotubes (SWNTs) possess unique electronic and physical properties, which make them very attractive for a wide range of applications. In particular, SWNTs and their composites have shown a great potential for chemical and biological sensing. Green tea, or more specifically its main antioxidant component, epigallocatechin gallate (EGCG), has been found to disperse SWNTs in water. However, the chemical sensitivity of this SWNT/green tea (SWNT/EGCG) composite remained unexplored. With EGCG present, this SWNT composite should have strong antioxidant properties and thus respond to reactive oxygen species (ROS). Here we report on fabrication and characterization of SWNT/EGCG thin films and the measurement of their relative conductance as a function of H(2)O(2) concentrations. We further investigated the sensing mechanism by Fourier transform infrared (FTIR) spectroscopy and field-effect transistor measurements (FET). We propose here that the response to H(2)O(2) arises from the oxidation of EGCG in the composite. These findings suggest that SWNT/green tea composite has a great potential for developing simple resistivity-based sensors. PMID:21043457

  3. Hydrothermal microwave valorization of eucalyptus using acidic ionic liquid as catalyst toward a green biorefinery scenario.

    PubMed

    Xu, Ji-Kun; Chen, Jing-Huan; Sun, Run-Cang

    2015-10-01

    The application of the acidic ionic liquid (IL), 1-butyl-3-methylimidazolium hydrogensulfate ([bmim]HSO4), as a catalyst in the hydrothermal microwave treatment (HMT) and green upgradation of eucalyptus biomass has been investigated. The process was carried out in a microwave reactor system at different temperatures (140-200°C) and evaluated for severities. The xylooligosaccharides (XOS, refers to a DP of 2-6) yield up to 5.04% (w/w) of the initial biomass and 26.72% (w/w) of xylan were achieved. Higher temperature resulted in lower molecular weight product, and enhanced the concentration of monosaccharides and byproducts. The morphology and structure of the solid residues were performed using an array of techniques, such as SEM, XRD, FTIR, BET surface area, and CP/MAS (13)C NMR, by which the increase of crystallinity, the destruction of surface structure, and the changes in functional groups and compositions were studied after the pretreatment, thus significantly enhancing the enzymatic hydrolysis.

  4. Hydrothermal microwave valorization of eucalyptus using acidic ionic liquid as catalyst toward a green biorefinery scenario.

    PubMed

    Xu, Ji-Kun; Chen, Jing-Huan; Sun, Run-Cang

    2015-10-01

    The application of the acidic ionic liquid (IL), 1-butyl-3-methylimidazolium hydrogensulfate ([bmim]HSO4), as a catalyst in the hydrothermal microwave treatment (HMT) and green upgradation of eucalyptus biomass has been investigated. The process was carried out in a microwave reactor system at different temperatures (140-200°C) and evaluated for severities. The xylooligosaccharides (XOS, refers to a DP of 2-6) yield up to 5.04% (w/w) of the initial biomass and 26.72% (w/w) of xylan were achieved. Higher temperature resulted in lower molecular weight product, and enhanced the concentration of monosaccharides and byproducts. The morphology and structure of the solid residues were performed using an array of techniques, such as SEM, XRD, FTIR, BET surface area, and CP/MAS (13)C NMR, by which the increase of crystallinity, the destruction of surface structure, and the changes in functional groups and compositions were studied after the pretreatment, thus significantly enhancing the enzymatic hydrolysis. PMID:26119053

  5. Adaptive amino acid composition in collagens of parasitic nematodes.

    PubMed

    Hughes, Austin L

    2015-04-01

    Amino acid composition was analyzed in the glycine-rich repeat region of 306 collagens belonging to three major families of collagens from both parasitic and free-living nematodes. The collagens of parasitic species showed a tendency toward decreased usage of the hydrophilic residues A, D, and Q and increased usage of the hydrophobic resides I, L, and M; and this trend was seen in parasitic species of both the order Rhabdita and the order Spirurida. The amino acid composition of collagens of parasitic Rhabdita thus tended to resemble those of Spirurida more than that of free-living Rhabdita, suggesting an association between amino acid composition and a parasitic lifestyle. Computer predictions suggested that the more hydrophobic amino acid composition was associated with a reduction of the propensity towards B-cell epitope formation, suggesting that evasion of host immune responses may be a major selective factor responsible for the parasite-specific trend in collagen amino acid composition.

  6. Probing fatty acid metabolism in bacteria, cyanobacteria, green microalgae and diatoms with natural and unnatural fatty acids.

    PubMed

    Beld, Joris; Abbriano, Raffaela; Finzel, Kara; Hildebrand, Mark; Burkart, Michael D

    2016-04-01

    In both eukaryotes and prokaryotes, fatty acid synthases are responsible for the biosynthesis of fatty acids in an iterative process, extending the fatty acid by two carbon units every cycle. Thus, odd numbered fatty acids are rarely found in nature. We tested whether representatives of diverse microbial phyla have the ability to incorporate odd-chain fatty acids as substrates for their fatty acid synthases and their downstream enzymes. We fed various odd and short chain fatty acids to the bacterium Escherichia coli, cyanobacterium Synechocystis sp. PCC 6803, green microalga Chlamydomonas reinhardtii and diatom Thalassiosira pseudonana. Major differences were observed, specifically in the ability among species to incorporate and elongate short chain fatty acids. We demonstrate that E. coli, C. reinhardtii, and T. pseudonana can produce longer fatty acid products from short chain precursors (C3 and C5), while Synechocystis sp. PCC 6803 lacks this ability. However, Synechocystis can incorporate and elongate longer chain fatty acids due to acyl-acyl carrier protein synthetase (AasS) activity, and knockout of this protein eliminates the ability to incorporate these fatty acids. In addition, expression of a characterized AasS from Vibrio harveyii confers a similar capability to E. coli. The ability to desaturate exogenously added fatty acids was only observed in Synechocystis and C. reinhardtii. We further probed fatty acid metabolism of these organisms by feeding desaturase inhibitors to test the specificity of long-chain fatty acid desaturases. In particular, supplementation with thia fatty acids can alter fatty acid profiles based on the location of the sulfur in the chain. We show that coupling sensitive gas chromatography mass spectrometry to supplementation of unnatural fatty acids can reveal major differences between fatty acid metabolism in various organisms. Often unnatural fatty acids have antibacterial or even therapeutic properties. Feeding of short

  7. Probing fatty acid metabolism in bacteria, cyanobacteria, green microalgae and diatoms with natural and unnatural fatty acids.

    PubMed

    Beld, Joris; Abbriano, Raffaela; Finzel, Kara; Hildebrand, Mark; Burkart, Michael D

    2016-04-01

    In both eukaryotes and prokaryotes, fatty acid synthases are responsible for the biosynthesis of fatty acids in an iterative process, extending the fatty acid by two carbon units every cycle. Thus, odd numbered fatty acids are rarely found in nature. We tested whether representatives of diverse microbial phyla have the ability to incorporate odd-chain fatty acids as substrates for their fatty acid synthases and their downstream enzymes. We fed various odd and short chain fatty acids to the bacterium Escherichia coli, cyanobacterium Synechocystis sp. PCC 6803, green microalga Chlamydomonas reinhardtii and diatom Thalassiosira pseudonana. Major differences were observed, specifically in the ability among species to incorporate and elongate short chain fatty acids. We demonstrate that E. coli, C. reinhardtii, and T. pseudonana can produce longer fatty acid products from short chain precursors (C3 and C5), while Synechocystis sp. PCC 6803 lacks this ability. However, Synechocystis can incorporate and elongate longer chain fatty acids due to acyl-acyl carrier protein synthetase (AasS) activity, and knockout of this protein eliminates the ability to incorporate these fatty acids. In addition, expression of a characterized AasS from Vibrio harveyii confers a similar capability to E. coli. The ability to desaturate exogenously added fatty acids was only observed in Synechocystis and C. reinhardtii. We further probed fatty acid metabolism of these organisms by feeding desaturase inhibitors to test the specificity of long-chain fatty acid desaturases. In particular, supplementation with thia fatty acids can alter fatty acid profiles based on the location of the sulfur in the chain. We show that coupling sensitive gas chromatography mass spectrometry to supplementation of unnatural fatty acids can reveal major differences between fatty acid metabolism in various organisms. Often unnatural fatty acids have antibacterial or even therapeutic properties. Feeding of short

  8. Preparation, characterization and catalytic properties of MCM-48 supported tungstophosphoric acid mesoporous materials for green synthesis of benzoic acid

    SciTech Connect

    Wu, Hai-Yan; Zhang, Xiao-Li; Chen, Xi; Chen, Ya; Zheng, Xiu-Cheng

    2014-03-15

    MCM-48 and tungstophosphoric acid (HPW) were prepared and applied for the synthesis of HPW/MCM-48 mesoporous materials. The characterization results showed that HPW/MCM-48 obtained retained the typical mesopore structure of MCM-48, and the textural parameters decreased with the increase loading of HPW. The catalytic oxidation results of benzyl alcohol and benzaldehyde with 30% H{sub 2}O{sub 2} indicated that HPW/MCM-48 was an efficient catalyst for the green synthesis of benzoic acid. Furthermore, 35 wt% HPW/MCM-48 sample showed the highest activity under the reaction conditions. Highlights: • 5–45 wt% HPW/MCM-48 mesoporous catalysts were prepared and characterized. • Their catalytic activities for the green synthesis of benzoic acid were investigated. • HPW/MCM-48 was approved to be an efficient catalyst. • 5 wt% HPW/MCM-48 exhibited the highest catalytic activity.

  9. Sulfated phenolic acids from Dasycladales siphonous green algae.

    PubMed

    Kurth, Caroline; Welling, Matthew; Pohnert, Georg

    2015-09-01

    Sulfated aromatic acids play a central role as mediators of chemical interactions and physiological processes in marine algae and seagrass. Among others, Dasycladus vermicularis (Scopoli) Krasser 1898 uses a sulfated hydroxylated coumarin derivative as storage metabolite for a protein cross linker that can be activated upon mechanical disruption of the alga. We introduce a comprehensive monitoring technique for sulfated metabolites based on fragmentation patterns in liquid chromatography/mass spectrometry and applied it to Dasycladales. This allowed the identification of two new aromatic sulfate esters 4-(sulfooxy)phenylacetic acid and 4-(sulfooxy)benzoic acid. The two metabolites were synthesized to prove the mass spectrometry-based structure elucidation in co-injections. We show that both metabolites are transformed to the corresponding desulfated phenols by sulfatases of bacteria. In biofouling experiments with Escherichia coli and Vibrio natriegens the desulfated forms were more active than the sulfated ones. Sulfatation might thus represent a measure of detoxification that enables the algae to store inactive forms of metabolites that are activated by settling organisms and then act as defense. PMID:26188914

  10. Biochar: a green sorbent to sequester acidic organic contaminants

    NASA Astrophysics Data System (ADS)

    Sigmund, Gabriel; Kah, Melanie; Sun, Huichao; Hofmann, Thilo

    2015-04-01

    Biochar is a carbon rich product of biomass pyrolysis that exhibits a high sorption potential towards a wide variety of inorganic and organic contaminants. Because it is a valuable soil additive and a potential carbon sink that can be produced from renewable resources, biochar has gained growing attention for the development of more sustainable remediation strategies. A lot of research efforts have been dedicated to the sorption of hydrophobic contaminants and metals to biochar. Conversely, the understanding of the sorption of acidic organic contaminants remains limited, and questions remain on the influence of biochar characteristics (e.g. ash content) on the sorption behaviour of acidic organic contaminants. To address this knowledge gap, sorption batch experiments were conducted with a series of structurally similar acidic organic contaminants covering a range of dissociation constant (2,4-D, MCPA, 2,4-DB and triclosan). The sorbents selected for experimentation included a series of 10 biochars covering a range of characteristics, multiwalled carbon nanotubes as model for pure carbonaceous phases, and an activated carbon as benchmark. Overall, sorption coefficient [L/kg] covered six orders of magnitude and generally followed the order 2,4-D < MCPA < 2,4-DB < triclosan. Combining comprehensive characterization of the sorbents with the sorption dataset allowed the discussion of sorption mechanisms and driving factors of sorption. Statistical analysis suggests that (i) partitioning was the main driver for sorption to sorbents with small specific surface area (< 25 m²/g), whereas (ii) specific mechanisms dominated sorption to sorbents with larger specific surface area. Results showed that factors usually not considered for the sorption of neutral contaminants play an important role for the sorption of organic acids. The pH dependent lipophilicity ratio (i.e. D instead of Kow), ash content and ionic strength are key factors influencing the sorption of acidic organic

  11. Studies of the acidic components of the Colorado Green River formation oil shale-Mass spectrometric identification of the methyl esters of extractable acids.

    NASA Technical Reports Server (NTRS)

    Haug, P.; Schnoes, H. K.; Burlingame, A. L.

    1971-01-01

    Study of solvent extractable acidic constituents of oil shale from the Colorado Green River Formation. Identification of individual components is based on gas chromatographic and mass spectrometric data obtained for their respective methyl esters. Normal acids, isoprenoidal acids, alpha, omega-dicarboxylic acids, mono-alpha-methyl dicarboxylic acids and methyl ketoacids were identified. In addition, the presence of monocyclic, benzoic, phenylalkanoic and naphthyl-carboxylic acids, as well as cycloaromatic acids, is demonstrated by partial identification.

  12. Long-chain carboxylic acids in pyrolysates of Green River kerogen

    NASA Technical Reports Server (NTRS)

    Kawamura, K.; Tannenbaum, E.; Huizinga, B. J.; Kaplan, I. R.

    1986-01-01

    Long-chain fatty acids (C10-C32), as well as C14-C21 isoprenoid acids (except for C18), have been identified in anhydrous and hydrous pyrolyses products of Green River kerogen (200-400 degrees C, 2-1000 hr). These kerogen-released fatty acids are characterized by a strong even/odd predominance (CPI: 4.8-10.2) with a maximum at C16 followed by lesser amounts of C18 and C22 acids. This distribution is different from that of unbound and bound geolipids extracted from Green River shale. The unbound fatty acids show a weak even/odd predominance (CPI: 1.64) with a maximum at C14, and bound fatty acids display an even/odd predominance (CPI: 2.8) with maxima at C18 and C30. These results suggest that fatty acids were incorporated into kerogen during sedimentation and early diagenesis and were protected from microbial and chemical changes over geological periods of time. Total quantities of fatty acids produced during heating of the kerogen ranged from 0.71 to 3.2 mg/g kerogen. Highest concentrations were obtained when kerogen was heated with water for 100 hr at 300 degrees C. Generally, their amounts did not decrease under hydrous conditions with increase in temperature or heating time, suggesting that significant decarboxylation did not occur under the pyrolysis conditions used, although hydrocarbons were extensively generated.

  13. Ulvan, a Sulfated Polysaccharide from Green Algae, Activates Plant Immunity through the Jasmonic Acid Signaling Pathway

    PubMed Central

    Jaulneau, Valérie; Lafitte, Claude; Jacquet, Christophe; Fournier, Sylvie; Salamagne, Sylvie; Briand, Xavier; Esquerré-Tugayé, Marie-Thérèse; Dumas, Bernard

    2010-01-01

    The industrial use of elicitors as alternative tools for disease control needs the identification of abundant sources of them. We report on an elicitor obtained from the green algae Ulva spp. A fraction containing most exclusively the sulfated polysaccharide known as ulvan-induced expression of a GUS gene placed under the control of a lipoxygenase gene promoter. Gene expression profiling was performed upon ulvan treatments on Medicago truncatula and compared to phytohormone effects. Ulvan induced a gene expression signature similar to that observed upon methyl jasmonate treatment (MeJA). Involvement of jasmonic acid (JA) in ulvan response was confirmed by detecting induction of protease inhibitory activity and by hormonal profiling of JA, salicylic acid (SA) and abscisic acid (ABA). Ulvan activity on the hormonal pathway was further consolidated by using Arabidopsis hormonal mutants. Altogether, our results demonstrate that green algae are a potential reservoir of ulvan elicitor which acts through the JA pathway. PMID:20445752

  14. Some properties and amino acid sequence of plastocyanin from a green alga, Ulva arasakii.

    PubMed

    Yoshizaki, F; Fukazawa, T; Mishina, Y; Sugimura, Y

    1989-08-01

    Plastocyanin was purified from a multicellular, marine green alga, Ulva arasakii, by conventional methods to homogeneity. The oxidized plastocyanin showed absorption maxima at 252, 276.8, 460, 595.3, and 775 nm, and shoulders at 259, 265, 269, and 282.5 nm; the ratio A276.8/A595.3 was 1.5. The midpoint redox potential was determined to be 0.356 V at pH 7.0 with a ferri- and ferrocyanide system. The molecular weight was estimated to be 10,200 and 11,000 by SDS-PAGE and by gel filtration, respectively. U. arasakii also has a small amount of cytochrome c6, like Enteromorpha prolifera. The amino acid sequence of U. arasakii plastocyanin was determined by Edman degradation and by carboxypeptidase digestion of the plastocyanin, six tryptic peptides, and five staphylococcal protease peptides. The plastocyanin contained 98 amino acid residues, giving a molecular weight of 10,236 including one copper atom. The complete sequence is as follows: AQIVKLGGDDGALAFVPSKISVAAGEAIEFVNNAGFPHNIVFDEDAVPAGVDADAISYDDYLNSKGETV VRKLSTPGVY G VYCEPHAGAGMKMTITVQ. The sequence of U. arasakii plastocyanin is closet to that of the E. prolifera protein (85% homology). A phylogenetic tree of five algal and two higher plant plastocyanins was constructed by comparing the amino acid differences. The branching order is considered to be as follows: a blue-green alga, unicellular green algae, multicellular green algae, and higher plants. PMID:2509442

  15. Preparation and properties of biodegradable films from Sterculia urens short fiber/cellulose green composites.

    PubMed

    Jayaramudu, J; Reddy, G Siva Mohan; Varaprasad, K; Sadiku, E R; Sinha Ray, S; Varada Rajulu, A

    2013-04-01

    The development of commercially viable "green products", based on natural resources for the matrices and reinforcements, in a wide range of applications, is on the rise. The present paper focuses on Sterculia urens short fiber reinforced pure cellulose matrix composite films. The morphologies of the untreated and 5% NaOH (alkali) treated S. urens fibers were observed by SEM. The effect of 5% NaOH treated S. urens fiber (5, 10, 15 and 20% loading) on the mechanical properties and thermal stability of the composites films is discussed. This paper presents the developments made in the area of biodegradable S. urens short fiber/cellulose (SUSF/cellulose) composite films, buried in the soil and later investigated by the (POM), before and after biodegradation has taken place. SUSF/cellulose composite films have great potential in food packaging and for medical applications.

  16. Comparison of fatty acid composition of cell homogenates and isolated chloroplasts in Acetabularia crenulata (Lamouroux).

    PubMed

    Santiago-Vázquez, Lory Z; Jacobs, Robert S

    2005-01-01

    Algal preparations from Acetabularia crenulata were analyzed for their fatty acid composition to establish the suitability of this alga as a model to study fatty acid oxidation and oxylipin biosynthesis. The work was based on two goals. The first goal of this study was to determine the contribution of fatty acids from contaminating bacteria and how this influenced the total fatty acid composition of cell homogenates of A. crenulata collected in the wild as compared to specimens cultured in sterile conditions. The major fatty acids detected for both specimens were palmitic (C16:0), palmitoleic (C16:1n-7), oleic (C18:1n-9), linoleic (C18:2n-6), linolenic (C18:3n-3), and octadecatetraenoic acid (C18:4n-3). Significant amounts of odd-chain fatty acids common to bacteria were not detected in either sample. Furthermore, branched-chain fatty acids, typical bacterial biomarkers, were not detected in either sample. Data suggest that bacteria do not greatly contribute to the total fatty acid pool of A. crenulata. The second goal was to compare the fatty acid composition of cell homogenates with that of isolated chloroplasts. Comparatively speaking palmitoleic and octadecatetraenoic acid were found at significantly lower concentrations in the chloroplast whereas oleic and linolenic acid were found at significantly higher amounts in this organelle. Furthermore, the amount of hexadecatrienoic acid (C16:3), a fatty acid commonly esterified to monogalactosyldiacylglycerol (MGDG; lipid present at high concentrations inside the chloroplasts of algae), was present at very low concentrations in these plastids (0.7%). Typically green algal follow the "prokaryotic pathway" for MGDG biosynthesis where C18:3 is esterified at the sn-1 position of the glycerol backbone and C18:3 or C16:3 at the sn-2 position, making C16:3 a major fatty acid inside chloroplasts. Interestingly, our results suggest that chloroplasts of A. crenulata appear to follow the "eukaryotic pathway" for MGDG

  17. Degradation of ascorbic acid and potassium sorbate by different Lactobacillus species isolated from packed green olives.

    PubMed

    Montaño, Alfredo; Sánchez, Antonio Higinio; Casado, Francisco Javier; Beato, Víctor Manuel; de Castro, Antonio

    2013-05-01

    The aim of this research was to ascertain the lactic acid bacteria responsible for the degradation of ascorbic acid and/or potassium sorbate, isolated from packed green olives where these additives had diminished. A total of 14 isolates were recovered from samples of different green olive containers. According to partial sequencing of the 16S rRNA coding gene, Lactobacillus parafarraginis, Lactobacillus rapi, Lactobacillus pentosus, Lactobacillus paracollinoides, and Pediococcus ethanolidurans were identified. With the exception of L. pentosus and L. paracollinoides, the other species had not been mentioned in table olives before this study. Only three of the 14 isolates metabolized ascorbic acid in MRS broth, and the products from ascorbic acid in modified MRS broth without carbon sources were acetic and lactic acids. Except for the two L. rapi and the two P. ethanolidurans strains, the remaining 10 isolates depleted potassium sorbate added into MRS broth to some extent. The product generated by three of these strains was confirmed to be trans-4-hexenoic acid. The degradation of ascorbate or sorbate by lactic acid bacteria should be taken into account when these additives are used in food products where this group of bacteria may be present. PMID:23498172

  18. Preparation, characterization and catalytic properties of MCM-48 supported tungstophosphoric acid mesoporous materials for green synthesis of benzoic acid

    NASA Astrophysics Data System (ADS)

    Wu, Hai-Yan; Zhang, Xiao-Li; Chen, Xi; Chen, Ya; Zheng, Xiu-Cheng

    2014-03-01

    MCM-48 and tungstophosphoric acid (HPW) were prepared and applied for the synthesis of HPW/MCM-48 mesoporous materials. The characterization results showed that HPW/MCM-48 obtained retained the typical mesopore structure of MCM-48, and the textural parameters decreased with the increase loading of HPW. The catalytic oxidation results of benzyl alcohol and benzaldehyde with 30% H2O2 indicated that HPW/MCM-48 was an efficient catalyst for the green synthesis of benzoic acid. Furthermore, 35 wt% HPW/MCM-48 sample showed the highest activity under the reaction conditions.

  19. Advances in Food Composition Tables of Japan--Amino Acid, Fatty Acid and Available Carbohydrate Tables.

    PubMed

    Yasui, Takeshi

    2015-01-01

    The new revised version of the Standard Tables of Food Composition in Japan (STFCJ 2015) will be published in 2015. The aim of the present paper is to share information on issues we have encountered during the revision. New analytical data on amino acid composition will be provided for approximately 230 foods, fatty acid composition for approximately 140 foods, and available carbohydrate (starch, glucose, fructose, sucrose, maltose, and lactose) composition for approximately 340 foods. These data will be published separately as three supplements to the STFCJ 2015: amino acid tables, fatty acid tables, and available carbohydrate tables. Available carbohydrate tables will also provide polyol (sorbitol and mannitol) and organic acid (acetic acid, lactic acid, citric acid, etc.) data. In the supplements, amino acid content will be adjusted for protein content calculated as reference nitrogen multiplied by a nitrogen to protein conversion factor, and fatty acid content adjusted for extractable lipid content, as in previous revisions. Available carbohydrate content, however, will be adjusted for water content. Values of protein content calculated as the sum of amino acid residues , lipid content expressed as triacylglycerol equivalents of fatty acids , and available carbohydrate content will appear in the main tables of the STFCJ 2015. Protein, fat and available carbohydrate contents were significantly decreased when the preferred analytical methods of FAO were applied instead of the acceptable methods. Online publication of Japanese and English versions of these tables, reference materials, and a retrievable food composition database is planned. PMID:26598876

  20. Composition of acid tars from sulfuric acid treatment of petroleum oils

    SciTech Connect

    Frolov, A.F.; Denisova, T.L.; Karpova, I.V.; Titova, T.S.

    1986-01-01

    This paper examines the composition of freshly produced acid tars and pond tars, gives an analysis of the acid part of the tars, and obtains data on the change in composition of the acid tar in the course of storage--data that are needed in developing methods for utilizing the tar. The acid-pond tars consist of a mixture of hydrocarbons with a very low content of acids, whereas the freshly produced acid tars consist mainly of sulfuric acid, sulfonic acids, and carboxylic acids. In the course of storage, hardening of acid tars in the volume proceeds through reactions of polymerization, condensation, and oxidation of the surface layer that is in contact with air.

  1. [Influence of the substrate composition in extensive green roof on the effluent quality].

    PubMed

    Chen, Yu-Lin; Li, Tian; Gu, Jun-Qing

    2014-11-01

    By monitoring the effluent quality from different green roof assemblies during several artificial rain events, the main pollutant characteristics and the influence of substrate composition in extensive green roof on the effluent quality were studied. Results showed that the main pollutants in the effluent were N, P and COD; with the increase of cumulative rain, the concentrations of pollutants in the effluent decreased, which had obvious leaching effect; The average concentrations of heavy metals in the early effluent from all assemblies reached drinking water standard, including the assemblies using crushed bricks; When garden soil and compost were used as organic matter, the assemblies had serious leaching of nutrient substance. After the accumulated rainfall reached 150 mm, the TN, TP and COD concentrations of effluent were 2.93, 0.73 and 78 mg x L(-1), respectively, which exceeded the Surface water V class limit. By means of application of the Water Treatment Residual, the leaching of TP from green planting soil was decreased by about 60%. The inorganic compound soil had better effluent quality, however we also need to judge whether the substrate could be applied in extensive green roof or not, by analyzing its ability of water quantity reduction and the plant growth situation.

  2. [Influence of the substrate composition in extensive green roof on the effluent quality].

    PubMed

    Chen, Yu-Lin; Li, Tian; Gu, Jun-Qing

    2014-11-01

    By monitoring the effluent quality from different green roof assemblies during several artificial rain events, the main pollutant characteristics and the influence of substrate composition in extensive green roof on the effluent quality were studied. Results showed that the main pollutants in the effluent were N, P and COD; with the increase of cumulative rain, the concentrations of pollutants in the effluent decreased, which had obvious leaching effect; The average concentrations of heavy metals in the early effluent from all assemblies reached drinking water standard, including the assemblies using crushed bricks; When garden soil and compost were used as organic matter, the assemblies had serious leaching of nutrient substance. After the accumulated rainfall reached 150 mm, the TN, TP and COD concentrations of effluent were 2.93, 0.73 and 78 mg x L(-1), respectively, which exceeded the Surface water V class limit. By means of application of the Water Treatment Residual, the leaching of TP from green planting soil was decreased by about 60%. The inorganic compound soil had better effluent quality, however we also need to judge whether the substrate could be applied in extensive green roof or not, by analyzing its ability of water quantity reduction and the plant growth situation. PMID:25639089

  3. [(-)-Epigallocatechin gallate, the main constituent of Japanese green tea, inhibits tumor promotion of okadaic acid].

    PubMed

    Yoshizawa, S

    1996-10-01

    (-)-Epigallocatechin gallate (EGCG), the main constituent of green tea, inhibited a tumor promoting activity of okadaic acid in a two-stage carcinogenesis experiment on mouse skin. The group treated with a single application of 100 micrograms 7, 12-dimethylbenz (a) anthracene followed by repeated applications of 1 microgram okadaic acid resulted in 80% of tumor-bearing mice and 4.7 of average numbers of tumors per mouse in week 20. Repeated applications of 5 mg EGCG, prior to okadaic acid, completely inhibited the tumor formation in mice up to week 20. The inhibitory effects of EGCG with two different doses of each application, 1 mg and 5 mg, were dose-dependent. A topical application of 5 mg EGCG immediately reduced the specific binding of [3H]okadaic acid to a particulate fraction of mouse skin to as low as 30% of control. According to the Scatchard analysis, the reduction of specific [3H]okadaic acid binding was mainly due to the reduction of the binding sites, not due to the change of the affinity. The reduction of the specific binding was closely related to the inhibitory effct of EGCG on tumor promotion of okadaic acid. Since EGCG is a non-toxic compound, ingested in green tea in daily life in Japan, EGCG is one of the candidates for practical cancer chemopreventive agents.

  4. [Chemical composition and seasonal fluctuations of the edible green seaweed, Monostroma undulatum, Wittrock, from the Southern Argentina coast].

    PubMed

    Risso, Susana; Escudero, Carlos; Estevao Belchior, Silvia; de Portela, María Luz; Fajardo, María Angélica

    2003-09-01

    The chemical composition of green seaweed, Monostroma undulatum, Wittrock, growing in the Southern Argentina coast, was studied. Samples were collected in Puerto Deseado, province of Santa Cruz (47 degrees 45'L.S., 65 degrees 55'L.W.), from October to December 1999 and 2000. It has been analyzed six sample during this period. Algae were washed with sea water and dried at room temperature for 24 hs. Moisture, nitrogen, lipids and ashes were determined according to AOAC; fiber (total, soluble and insoluble), according to Lahaye. After mineralization with nitric acid, sodium and potassium were determined by flame photometry, calcium by complexometric method, and phosphorus by Gomori's method. The ranges expressed per 100 g dry algae were: protein (Nx6.25): 12.89-21.85; ashes (g): 33.92-40.05; lipid (g): 0.32-1.47; total fiber (g): 14.36-19.6; digestible carbohydrates (calculated by difference) (g): 20.86-32.48; sodium (g): 7.39-13.11; potassium (g): 1.38-3.18; calcium (mg): 149-226; phosphorus (mg): 190-447; Vitamin C (mg): 159-455. These results show that this green seaweed is an important source for protein, fiber, macronutrients minerals and vitamin C, during the macroscopic period. There was an important fluctuation that must be taken into account to consider the commercial collection to use it in human nutrition. PMID:14694816

  5. Effect of rosemary, echinacea, green tea extracts and ascorbic acid on broiler meat quality.

    PubMed

    Mirshekar, R; Dastar, B; Shabanpour, B

    2009-08-01

    This study evaluated the effect of addition some plant extracts and ascorbic acid in presence of distilled water as the control on the broiler thigh meat color, subsequent lipid oxidation (TBARS) and rancidity development during frozen storage of chicken thigh meat. All the extracts were used in the density of 1000 ppm. The results showed that all the antioxidants had significant effect on lipid oxidation as measured by TBARS value during frozen storage at -20 degrees C for 120 days. However, lipid oxidation only occurred to a limited extent and was insufficient to cause rancid flavor development. The results also demonstrated that rosemary and green tea were the most effective antioxidants in stabilization of a* value. Echinacea, green tea and rosemary extracts were effective antioxidants and strongly inhibited oxidation. Present findings show that these plants extracts exhibit greater antioxidant efficiency compared to ascorbic acid.

  6. Synthesis, structure and antimicrobial property of green composites from cellulose, wool, hair and chicken feather.

    PubMed

    Tran, Chieu D; Prosencyes, Franja; Franko, Mladen; Benzi, Gerald

    2016-10-20

    Novel composites between cellulose (CEL) and keratin (KER) from three different sources (wool, hair and chicken feather) were successfully synthesized in a simple one-step process in which butylmethylimidazolium chloride (BMIm(+)Cl(-)), an ionic liquid, was used as the sole solvent. The method is green and recyclable because [BMIm(+)Cl(-)] used was recovered for reuse. Spectroscopy (FTIR, XRD) and imaging (SEM) results confirm that CEL and KER remain chemically intact and homogeneously distributed in the composites. KER retains some of its secondary structure in the composites. Interestingly, the minor differences in the structure of KER in wool, hair and feather produced pronounced differences in the conformation of their corresponding composites with wool has the highest α-helix content and feather has the lowest content. These results correlate well with mechanical and antimicrobial properties of the composites. Specifically, adding CEL into KER substantially improves mechanical strength of [CEL+KER] composites made from all three different sources, wool, hair and chicken feathers i.e., [CEL+wool], [CEL+hair] and [CEL+feather]. Since mechanical strength is due to CEL, and CEL has only random structure, [CEL+feather] has, expectedly, the strongest mechanical property because feather has the lowest content of α-helix. Conversely, [CEL+wool] composite has the weakest mechanical strength because wool has the highest α-helix content. All three composites exhibit antibacterial activity against methicillin resistant Staphylococcus aureus (MRSA). The antibacterial property is due not to CEL but to the protein and strongly depends on the type of the keratin, namely, the bactericidal effect is strongest for feather and weakest for wool. These results together with our previous finding that [CEL+KER] composites can control release of drug such as ciprofloxacin clearly indicate that these composites can potentially be used as wound dressing.

  7. Synthesis, structure and antimicrobial property of green composites from cellulose, wool, hair and chicken feather.

    PubMed

    Tran, Chieu D; Prosencyes, Franja; Franko, Mladen; Benzi, Gerald

    2016-10-20

    Novel composites between cellulose (CEL) and keratin (KER) from three different sources (wool, hair and chicken feather) were successfully synthesized in a simple one-step process in which butylmethylimidazolium chloride (BMIm(+)Cl(-)), an ionic liquid, was used as the sole solvent. The method is green and recyclable because [BMIm(+)Cl(-)] used was recovered for reuse. Spectroscopy (FTIR, XRD) and imaging (SEM) results confirm that CEL and KER remain chemically intact and homogeneously distributed in the composites. KER retains some of its secondary structure in the composites. Interestingly, the minor differences in the structure of KER in wool, hair and feather produced pronounced differences in the conformation of their corresponding composites with wool has the highest α-helix content and feather has the lowest content. These results correlate well with mechanical and antimicrobial properties of the composites. Specifically, adding CEL into KER substantially improves mechanical strength of [CEL+KER] composites made from all three different sources, wool, hair and chicken feathers i.e., [CEL+wool], [CEL+hair] and [CEL+feather]. Since mechanical strength is due to CEL, and CEL has only random structure, [CEL+feather] has, expectedly, the strongest mechanical property because feather has the lowest content of α-helix. Conversely, [CEL+wool] composite has the weakest mechanical strength because wool has the highest α-helix content. All three composites exhibit antibacterial activity against methicillin resistant Staphylococcus aureus (MRSA). The antibacterial property is due not to CEL but to the protein and strongly depends on the type of the keratin, namely, the bactericidal effect is strongest for feather and weakest for wool. These results together with our previous finding that [CEL+KER] composites can control release of drug such as ciprofloxacin clearly indicate that these composites can potentially be used as wound dressing. PMID:27474680

  8. Compositions and method for controlling precipitation when acidizing sour wells

    SciTech Connect

    Dill, W.R.; Walker, M.L.

    1989-12-19

    This patent describes an acidizing composition for treating a sour well. It comprises: a base acid solution having an initial ph below 1.9; an iron sequestering agent to combine with iron present in the solution comprising at least one compound selected from the group consisting of aminopolycarboxylic acids, hydroxycarboxylic acids, cyclic polyethers and derivatives of the acids and ethers present in an amount of from about 0.25 to about 5 percent by weight of the acid solution; and a sulfide modifier to combine with sulfides present in the solution comprising at least one member selected from the group consisting of an aldehyde, acetal, hemiacetal and any other compound capable of forming an aldehyde in solution, present in an amount of from about 1 to about 4 percent by weight of the acid solution, whereby precipitation of ferric hydroxide, ferrous sulfide and elemental sulfur is inhibited as acid spending occurs.

  9. Two-Flux Green's Function Analysis for Transient Spectral Radiation in a Composite

    NASA Technical Reports Server (NTRS)

    Siegel, Robert

    1996-01-01

    An analysis is developed for obtaining transient temperatures in a two-layer semitransparent composite with spectrally dependent properties. Each external boundary of the composite is subjected to radiation and convection. The two-flux radiative transfer equations are solved by deriving a Green's function. This yields the local radiative heat source needed to numerically solve the transient energy equation. An advantage of the two-flux method is that isotropic scattering is included without added complexity. The layer refractive indices are larger than one. This produces internal reflections at the boundaries and the internal interface; the reflections are assumed diffuse. Spectral results using the Green's function method are verified by comparing with numerical solutions using the exact radiative transfer equations. Transient temperature distributions are given to illustrate the effect of radiative heating on one side of a composite with external convective cooling. The protection of a material from incident radiation is illustrated by adding scattering to the layer adjacent to the radiative source.

  10. Green glass vitrophyre 78526 - An impact of very low-Ti mare basalt composition

    NASA Technical Reports Server (NTRS)

    Warner, R. D.; Taylor, G. J.; Kiel, K.; Planner, H. H.; Nehru, C. E.; Ma, M.-S.; Schmitt, R. A.

    1978-01-01

    Rake sample 78526 is an 8.77 g rock consisting primarily of vitrophyric pale green glass with subordinate mineral and lithic relics. Petrographic and compositional evidence leads to the following conclusions: (1) the bulk composition represents that of a mixture formed by impact melting of at least two different textural and compositional varieties of VLT mare basalt that are now present in the rock as lithic relics and a poorly defined low-Ti mare basalt component observed in thin section only in the form of isolated mineral relics; (2) the admixed VLT mare basalts had REE abundances lower than those found in other mare basalts (but probably higher than emerald green glass) and REE patterns showing significant enrichment of the heavy relative to light REE's, suggesting that they were derived by comparatively high degrees of partial melting of a clinopyroxene-rich source region; and (3) the impact melt supercooled to produce the vitrophyre, with rather sharply contrasting textural domains present in the vitrophyre resulting from differences in nucleation kinetics and degrees of supercooling in various portions of the sample.

  11. Experimental Evolution of a Green Fluorescent Protein Composed of 19 Unique Amino Acids without Tryptophan

    NASA Astrophysics Data System (ADS)

    Kawahara-Kobayashi, Akio; Hitotsuyanagi, Mitsuhiro; Amikura, Kazuaki; Kiga, Daisuke

    2014-04-01

    At some stage of evolution, genes of organisms may have encoded proteins that were synthesized using fewer than 20 unique amino acids. Similar to evolution of the natural 19-amino-acid proteins GroEL/ES, proteins composed of 19 unique amino acids would have been able to evolve by accumulating beneficial mutations within the 19-amino-acid repertoire encoded in an ancestral genetic code. Because Trp is thought to be the last amino acid included in the canonical 20-amino-acid repertoire, this late stage of protein evolution could be mimicked by experimental evolution of 19-amino-acid proteins without tryptophan (Trp). To further understand the evolution of proteins, we tried to mimic the evolution of a 19-amino-acid protein involving the accumulation of beneficial mutations using directed evolution by random mutagenesis on the whole targeted gene sequence. We created active 19-amino-acid green fluorescent proteins (GFPs) without Trp from a poorly fluorescent 19-amino-acid mutant, S1-W57F, by using directed evolution with two rounds of mutagenesis and selection. The N105I and S205T mutations showed beneficial effects on the S1-W57F mutant. When these two mutations were combined on S1-W57F, we observed an additive effect on the fluorescence intensity. In contrast, these mutations showed no clear improvement individually or in combination on GFPS1, which is the parental GFP mutant composed of 20 amino acids. Our results provide an additional example for the experimental evolution of 19-amino-acid proteins without Trp, and would help understand the mechanisms underlying the evolution of 19-amino-acid proteins. (236 words)

  12. Biochemical composition and bioactivity screening of various extracts from Dunaliella salina, a green microalga.

    PubMed

    Cakmak, Yavuz Selim; Kaya, Murat; Asan-Ozusaglam, Meltem

    2014-01-01

    The current study examines the antimicrobial and antioxidant properties of different extracts of the microalga Dunaliella salina Teodoresco (Dunaliellaceae), their fatty acid composition and the antimicrobial activity of the oil. Antimicrobial and antioxidant activities were evaluated by obtaining extracts of D. salina in n-hexane, dichloromethane, ethanol, and methanol. To evaluate the antimicrobial activity, the extracts, and fatty acids from D. salina were assessed by the disc diffusion and microdilution techniques against pathogenic microorganisms including fish and clinical/food-borne. The MBC or MFC values of the extracts and fatty acids ranged from 0.63 to 10.00 mg/ml. The antioxidant activity was studied by phosphomolybdenum and DPPH assays and ß-carotene/linoleic acid tests. In addition, the total phenolic and flavonoid contents were evaluated and the fatty acid composition was determined using gas chromatography. Palmitic, alpha-linolenic, and oleic acids were discovered to be the major components of the fatty acids. These findings have demonstrated that the extracts and oil from D. salina could be used as natural antimicrobials and antioxidants in the food/feed and pharmaceutical industry and as a biodiesel because of its high unsaturated fatty acid content.

  13. Apple juice composition: sugar, nonvolatile acid, and phenolic profiles.

    PubMed

    Lee, H S; Wrolstad, R E

    1988-01-01

    Apples from Michigan, Washington, Argentina, Mexico, and New Zealand were processed into juice; the 8 samples included Golden Delicious, Jonathan, Granny Smith, and McIntosh varieties. Liquid chromatography was used for quantitation of sugars (glucose, fructose, sucrose, and sorbitol), nonvolatile acids (malic, quinic, citric, shikimic, and fumaric), and phenolics (chlorogenic acid and hydroxymethylfurfural [HMF]). Other determinations included pH, 0Brix, and L-malic acid. A number of compositional indices for these authentic juices, e.g., chlorogenic acid content, total malic - L-malic difference, and the HMF:chlorogenic ratio, were at variance with recommended standards. The phenolic profile was shown to be particularly influenced by gelatin fining, with peak areas decreasing by as much as 50%. The L-malic:total malic ratio serves as a better index for presence of synthetic malic acid than does the difference between the 2 determinations. No apparent differences in chemical composition could be attributed to geographic origin.

  14. Analysis of fatty acid content and composition in microalgae.

    PubMed

    Breuer, Guido; Evers, Wendy A C; de Vree, Jeroen H; Kleinegris, Dorinde M M; Martens, Dirk E; Wijffels, René H; Lamers, Packo P

    2013-01-01

    A method to determine the content and composition of total fatty acids present in microalgae is described. Fatty acids are a major constituent of microalgal biomass. These fatty acids can be present in different acyl-lipid classes. Especially the fatty acids present in triacylglycerol (TAG) are of commercial interest, because they can be used for production of transportation fuels, bulk chemicals, nutraceuticals (ω-3 fatty acids), and food commodities. To develop commercial applications, reliable analytical methods for quantification of fatty acid content and composition are needed. Microalgae are single cells surrounded by a rigid cell wall. A fatty acid analysis method should provide sufficient cell disruption to liberate all acyl lipids and the extraction procedure used should be able to extract all acyl lipid classes. With the method presented here all fatty acids present in microalgae can be accurately and reproducibly identified and quantified using small amounts of sample (5 mg) independent of their chain length, degree of unsaturation, or the lipid class they are part of. This method does not provide information about the relative abundance of different lipid classes, but can be extended to separate lipid classes from each other. The method is based on a sequence of mechanical cell disruption, solvent based lipid extraction, transesterification of fatty acids to fatty acid methyl esters (FAMEs), and quantification and identification of FAMEs using gas chromatography (GC-FID). A TAG internal standard (tripentadecanoin) is added prior to the analytical procedure to correct for losses during extraction and incomplete transesterification. PMID:24121679

  15. Fatty Acid Composition and Volatile Constituents of Protaetia brevitarsis Larvae

    PubMed Central

    Yeo, Hyelim; Youn, Kumju; Kim, Minji; Yun, Eun-Young; Hwang, Jae-Sam; Jeong, Woo-Sik; Jun, Mira

    2013-01-01

    A total of 48 different volatile oils were identified form P. brevitarsis larvae by gas chromatography/mass spectrometry (GC/MS). Acids (48.67%) were detected as the major group in P. brevitarsis larvae comprising the largest proportion of the volatile compounds, followed by esters (19.84%), hydrocarbons (18.90%), alcohols (8.37%), miscellaneous (1.71%), aldehydes (1.35%) and terpenes (1.16%). The major volatile constituents were 9-hexadecenoic acid (16.75%), 6-octadecenoic acid (14.88%) and n-hexadecanoic acid (11.06%). The composition of fatty acid was also determined by GC analysis and 16 fatty acids were identified. The predominant fatty acids were oleic acid (C18:1, 64.24%) followed by palmitic acid (C16:0, 15.89%), palmitoleic acid (C16:1, 10.43%) and linoleic acid (C18:2, 4.69%) constituting more than 95% of total fatty acids. The distinguished characteristic of the fatty acid profile of P. brevitarsis larvae was the high proportion of unsaturated fatty acid (80.54% of total fatty acids) versus saturated fatty acids (19.46% of total fatty acids). Furthermore, small but significant amounts of linoleic, linolenic and γ-linolenic acids bestow P. brevitarsis larvae with considerable nutritional value. The novel findings of the present study provide a scientific basis for the comprehensive utilization of the insect as a nutritionally promising food source and a possibility for more effective utilization. PMID:24471125

  16. Green Chemistry in the Organic Teaching Laboratory: An Environmentally Benign Synthesis of Adipic Acid

    NASA Astrophysics Data System (ADS)

    Reed, Scott M.; Hutchison, James E.

    2000-12-01

    Environmentally benign ("green") chemical techniques are growing in importance in academic and industrial research laboratories. Such chemistry has been slow to appear in teaching laboratories, owing in part to a lack of published material on this subject. Recent developments in green synthesis provide opportunities to introduce this material in teaching laboratories. We present a synthesis of adipic acid that utilizes green reagents (hydrogen peroxide as the oxidant), solvents (water), and methods (phase-transfer catalysis, catalyst recycling). The synthesis works well and provides an excellent forum for emphasizing green chemical concepts while teaching laboratory skills. It demonstrates reuse of a product, synthesis using a nonhazardous solvent, elimination of deleterious by-products, and use of a recyclable catalyst. It can be carried out on either the macroscale or microscale and generates little waste if the catalyst solution is recycled. This experiment fits well in a sophomore organic sequence; it covers the topics of oxidation, phase-transfer catalysis, and the technique of recrystallization, reinforces lecture topics such as alkene synthesis and reactivity, and provides an opportunity to introduce polymer chemistry.

  17. Nucleic acids, compositions and uses thereof

    DOEpatents

    Preston, III, James F.; Chow, Virginia; Nong, Guang; Rice, John D.; St. John, Franz J.

    2012-02-21

    The subject invention provides at least one nucleic acid sequence encoding an aldouronate-utilization regulon isolated from Paenibacillus sp. strain JDR-2, a bacterium which efficiently utilizes xylan and metabolizes aldouronates (methylglucuronoxylosaccharides). The subject invention also provides a means for providing a coordinately regulated process in which xylan depolymerization and product assimilation are coupled in Paenibacillus sp. strain JDR-2 to provide a favorable system for the conversion of lignocellulosic biomass to biobased products. Additionally, the nucleic acid sequences encoding the aldouronate-utilization regulon can be used to transform other bacteria to form organisms capable of producing a desired product (e.g., ethanol, 1-butanol, acetoin, 2,3-butanediol, 1,3-propanediol, succinate, lactate, acetate, malate or alanine) from lignocellulosic biomass.

  18. Nucleic acid compositions and the encoding proteins

    SciTech Connect

    Preston, III, James F.; Chow, Virginia; Nong, Guang; Rice, John D.; St. John, Franz J.

    2014-09-02

    The subject invention provides at least one nucleic acid sequence encoding an aldouronate-utilization regulon isolated from Paenibacillus sp. strain JDR-2, a bacterium which efficiently utilizes xylan and metabolizes aldouronates (methylglucuronoxylosaccharides). The subject invention also provides a means for providing a coordinately regulated process in which xylan depolymerization and product assimilation are coupled in Paenibacillus sp. strain JDR-2 to provide a favorable system for the conversion of lignocellulosic biomass to biobased products. Additionally, the nucleic acid sequences encoding the aldouronate-utilization regulon can be used to transform other bacteria to form organisms capable of producing a desired product (e.g., ethanol, 1-butanol, acetoin, 2,3-butanediol, 1,3-propanediol, succinate, lactate, acetate, malate or alanine) from lignocellulosic biomass.

  19. Oxidation of indole-3-acetic acid to oxindole-3-acetic acid by etiolated and green corn tissues

    SciTech Connect

    Reinecke, D. )

    1989-04-01

    Etiolated corn tissues oxidase indole-3-acetic acid (IAA) to oxindole-3-acetic acid (OxIAA). This oxidation results in loss of auxin activity and may plant a role in regulating IAA-stimulated growth. The enzyme has been partially purified and characterized and shown to require O{sub 2}, and a heat-stable lipid-soluble corn factor which can be replaced by linolenic or linoleic acids in the oxidation of IAA. Corn oil was tested as a cofactor in the IAA oxidation reaction. Corn oil stimulated enzyme activity by 30% while trilinolein was inactive. The capacity of green tissue to oxidize IAA was examined by incubating leaf sections from 2 week old light-grown corn seedlings with {sup 14}C-IAA. OxIAA and IAA were separated from other IAA metabolites on a 3 ml anion exchange column. Of the IAA taken up by the sections, 13% was oxidized to OxIAA. This is the first evidence that green tissue of corn may also regulate IAA levels by oxidizing IAA to OxIAA.

  20. Polyunsaturated fatty acid saturation by gut lactic acid bacteria affecting host lipid composition

    PubMed Central

    Kishino, Shigenobu; Takeuchi, Michiki; Park, Si-Bum; Hirata, Akiko; Kitamura, Nahoko; Kunisawa, Jun; Kiyono, Hiroshi; Iwamoto, Ryo; Isobe, Yosuke; Arita, Makoto; Arai, Hiroyuki; Ueda, Kazumitsu; Shima, Jun; Takahashi, Satomi; Yokozeki, Kenzo; Shimizu, Sakayu; Ogawa, Jun

    2013-01-01

    In the representative gut bacterium Lactobacillus plantarum, we identified genes encoding the enzymes involved in a saturation metabolism of polyunsaturated fatty acids and revealed in detail the metabolic pathway that generates hydroxy fatty acids, oxo fatty acids, conjugated fatty acids, and partially saturated trans-fatty acids as intermediates. Furthermore, we observed these intermediates, especially hydroxy fatty acids, in host organs. Levels of hydroxy fatty acids were much higher in specific pathogen-free mice than in germ-free mice, indicating that these fatty acids are generated through polyunsaturated fatty acids metabolism of gastrointestinal microorganisms. These findings suggested that lipid metabolism by gastrointestinal microbes affects the health of the host by modifying fatty acid composition. PMID:24127592

  1. Green and biodegradable composite films with novel antimicrobial performance based on cellulose.

    PubMed

    Wu, Yuehan; Luo, Xiaogang; Li, Wei; Song, Rong; Li, Jing; Li, Yan; Li, Bin; Liu, Shilin

    2016-04-15

    In order to obtain a safe and biodegradable material with antimicrobial properties from cellulose for food packaging, we presented a facile way to graft chitosan onto the oxidized cellulose films. The obtained films had a high transparent property of above 80% transmittance, excellent barrier properties against oxygen and antimicrobial properties against Escherichia coli and Staphylococcus aureus. The antimicrobial properties, mechanical properties, and water vapor permeability of composites are essential characteristics in determining their applicability as food-packaging materials. Moreover, using a sausage model, it was shown that the composites exhibited better performance than traditional polyethylene packaging material and demonstrated good potential as food packaging materials. The results presented a new insight into the development of green materials for food packaging.

  2. Green and biodegradable composite films with novel antimicrobial performance based on cellulose.

    PubMed

    Wu, Yuehan; Luo, Xiaogang; Li, Wei; Song, Rong; Li, Jing; Li, Yan; Li, Bin; Liu, Shilin

    2016-04-15

    In order to obtain a safe and biodegradable material with antimicrobial properties from cellulose for food packaging, we presented a facile way to graft chitosan onto the oxidized cellulose films. The obtained films had a high transparent property of above 80% transmittance, excellent barrier properties against oxygen and antimicrobial properties against Escherichia coli and Staphylococcus aureus. The antimicrobial properties, mechanical properties, and water vapor permeability of composites are essential characteristics in determining their applicability as food-packaging materials. Moreover, using a sausage model, it was shown that the composites exhibited better performance than traditional polyethylene packaging material and demonstrated good potential as food packaging materials. The results presented a new insight into the development of green materials for food packaging. PMID:26616947

  3. Amino acid composition in parenteral nutrition: what is the evidence?

    PubMed Central

    Yarandi, Shadi S.; Zhao, Vivian M.; Hebbar, Gautam; Ziegler, Thomas R.

    2011-01-01

    Purpose of review Complete parenteral nutrition solutions contain mixed amino acid products providing all nine essential amino acids and a varying composition of nonessential amino acids. Relatively little rigorous comparative efficacy research on altered parenteral nutrition amino acid composition has been published in recent years. Recent findings Limited data from randomized, double-blind, adequately powered clinical trials to define optimal doses of total or individual amino acids in parenteral nutrition are available. An exception is the growing number of studies on the efficacy of glutamine supplementation of parenteral nutrition or given as a single parenteral agent. Parenteral glutamine appears to confer benefit in selected patients; however, additional data to define optimal glutamine dosing and the patient subgroups who may most benefit from this amino acid are needed. Although some promising studies have been published, little data are available in the current era of nutrition support on the clinical efficacy of altered doses of arginine, branched chain amino acids, cysteine, or taurine supplementation of parenteral nutrition. Summary Despite routine use of parenteral nutrition, surprisingly little clinical efficacy data are available to guide total or specific amino acid dosing in adult and pediatric patients requiring this therapy. This warrants increased attention by the research community and funding agencies to better define optimal amino acid administration strategies in patient subgroups requiring parenteral nutrition. PMID:21076291

  4. Purification, properties and complete amino acid sequence of the ferredoxin from a green alga, Chlamydomonas reinhardtii.

    PubMed

    Schmitter, J M; Jacquot, J P; de Lamotte-Guéry, F; Beauvallet, C; Dutka, S; Gadal, P; Decottignies, P

    1988-03-01

    The ferredoxin was purified from the green alga, Chlamydomonas reinhardtii. The protein showed typical absorption and circular dichroism spectra of a [2Fe-2S] ferredoxin. When compared with spinach ferredoxin, the C. reinhardtii protein was less effective in the catalysis of NADP+ photoreduction, but its activity was higher in the light activation of C. reinhardtii malate dehydrogenase (NADP). The complete amino acid sequence was determined by automated Edman degradation of the whole protein and of peptides obtained by trypsin and chymotrypsin digestions and by CNBr cleavage. The protein consists of 94 residues, with Tyr at both NH2 and COOH termini. The positions of the four cysteines binding the two iron atoms are similar to those found in other [2Fe-2S] ferredoxins. The primary structure of C. reinhardtii ferredoxin showed a great homology (about 80%) with ferredoxins from two other green algae.

  5. Infant cerebral cortex phospholipid fatty-acid composition and diet.

    PubMed

    Farquharson, J; Cockburn, F; Patrick, W A; Jamieson, E C; Logan, R W

    1992-10-01

    It has not been established whether nutrition in early infancy affects subsequent neurodevelopment and function. If there is an effect, it seems probable that the essential fatty acids and their metabolites, the major constituents of brain structure, will be the most susceptible to dietary influence. We determined the phospholipid fatty-acid composition of cerebral cortex grey matter obtained from 20 term and 2 preterm infants who had died of "cot deaths" and related results to the milk diet the infants had received. Tissues were analysed by gas chromatography. The mean weight percentage of docosahexaenoic acid was significantly greater (p less than 0.02) in 5 breast-milk-fed infants (9.7%) than in 5 age-comparable formula-milk-fed infants (7.6%). In these formula-fed babies, the overall percentage of long-chain polyunsaturated fatty acids was maintained by increased incorporation of the major n-6 series fatty acids. In 1 formula-fed preterm infant, in whom the lowest concentration of cortical docosahexaenoic acid was found, the compensatory effect was only partial with both n-9 series eicosatrienoic acid or Mead acid and docosatrienoic acid also detected in the phospholipid. Supplementation of formula milks for term infants with docosahexaenoic acid and those for preterm infants with both docosahexaenoic and arachidonic acid could prove beneficial to subsequent neurodevelopment.

  6. Deoxyribonucleic acid base compositions of dermatophytes.

    PubMed

    Davison, F D; Mackenzie, D W; Owen, R J

    1980-06-01

    DNA was extracted and purified from 55 dermatophyte isolates representing 34 species of Trichophyton, Microsporum and Epidermophyton. The base compositions of the chromosomal DNA were determined by CsCl density gradient centrifugation and were found to be in the narrow range of 48.7 to 50.3 mol % G + C. A satellite DNA component assumed to be of mitochondrial origin was present in most strains, with a G + C content ranging from 14.7 to 30.8 mol % G + C. Heterogeneity in microscopic and colonial characteristics was not reflected in differences in the mean G + C content of the chromosomal DNAs. Strains varied in the G + C contents of satelite DNA, but these did not correlate with traditional species concepts.

  7. Oleic acid-grafted chitosan/graphene oxide composite coating for corrosion protection of carbon steel.

    PubMed

    Fayyad, Eman M; Sadasivuni, Kishor Kumar; Ponnamma, Deepalekshmi; Al-Maadeed, Mariam Al Ali

    2016-10-20

    An anticorrosion coating film based on the formation of nanocomposite coating is reported in this study. The composite consisted of chitosan (green matrix), oleic acid, and graphene oxide (nano filler). The nanocomposite coating was arranged on the surface of carbon steel, and the corrosion resistance was monitored using electrochemical impedance spectroscopy (EIS) and potentiodynamic polarization (PP). Compared to the pure chitosan (CS) coating, the corrosion resistance of oleic acid-modified chitosan/graphene oxide film (CS/GO-OA) is increased by 100 folds. Since the well-dispersed smart grafted nanolayers delayed the penetration rate of corrosive species and thus maintained long term anticorrosive stability which is correlated with hydrophobicity and permeability.

  8. Oleic acid-grafted chitosan/graphene oxide composite coating for corrosion protection of carbon steel.

    PubMed

    Fayyad, Eman M; Sadasivuni, Kishor Kumar; Ponnamma, Deepalekshmi; Al-Maadeed, Mariam Al Ali

    2016-10-20

    An anticorrosion coating film based on the formation of nanocomposite coating is reported in this study. The composite consisted of chitosan (green matrix), oleic acid, and graphene oxide (nano filler). The nanocomposite coating was arranged on the surface of carbon steel, and the corrosion resistance was monitored using electrochemical impedance spectroscopy (EIS) and potentiodynamic polarization (PP). Compared to the pure chitosan (CS) coating, the corrosion resistance of oleic acid-modified chitosan/graphene oxide film (CS/GO-OA) is increased by 100 folds. Since the well-dispersed smart grafted nanolayers delayed the penetration rate of corrosive species and thus maintained long term anticorrosive stability which is correlated with hydrophobicity and permeability. PMID:27474635

  9. Green synthesis of graphene nanosheets/ZnO composites and electrochemical properties

    SciTech Connect

    Wang Jun; Gao Zan; Li Zhanshuang; Wang Bin; Yan Yanxia; Liu Qi; Mann, Tom; Zhang Milin; Jiang Zhaohua

    2011-06-15

    A green and facile approach was demonstrated to prepare graphene nanosheets/ZnO (GNS/ZnO) composites for supercapacitor materials. Glucose, as a reducing agent, and exfoliated graphite oxide (GO), as precursor, were used to synthesize GNS, then ZnO directly grew onto conducting graphene nanosheets as electrode materials. The small ZnO particles successfully anchored onto graphene sheets as spacers to keep the neighboring sheets separate. The electrochemical performances of these electrodes were analyzed by cyclic voltammetry, electrochemical impedance spectrometry and chronopotentiometry. Results showed that the GNS/ZnO composites displayed superior capacitive performance with large capacitance (62.2 F/g), excellent cyclic performance, and maximum power density (8.1 kW/kg) as compared with pure graphene electrodes. Our investigation highlight the importance of anchoring of small ZnO particles on graphene sheets for maximum utilization of electrochemically active ZnO and graphene for energy storage application in supercapacitors. - Graphical abstract: Glucose was used to synthesize GNS, then ZnO directly grew onto conducting graphene nanosheets as electrode materials for supercapacitor. Results showed that the composites have superior capacitive performance. Highlights: > Graphene nanosheets were synthesized via using glucose as a reducing agent. > The reductant and the oxidized product are environmentally friendly. > ZnO grew onto conducting graphene sheets keeping neighboring sheets separate. > The structure improves the contact between the electrode and the electrolyte. > Results showed that these composites have good electrochemical property.

  10. Ultrasound versus microwave as green processes for extraction of rosmarinic, carnosic and ursolic acids from rosemary.

    PubMed

    Jacotet-Navarro, M; Rombaut, N; Fabiano-Tixier, A-S; Danguien, M; Bily, A; Chemat, F

    2015-11-01

    Ultrasound and microwave as green processes are investigated in this study, focusing on the extraction selectivity towards antioxidant extraction from rosemary leaves. Due to its richness in valuable compounds such as rosmarinic, carnosic and ursolic acids, rosemary is a reference matrix for extraction study. In this work, six alternative processes are compared: ultrasound (bath, reactor and probe), microwave (reflux under microwave, microwave under nitrogen pressure and microwave under vapor pressure). The main result of this study is that selective extraction can be achieved according to extraction techniques and therefore to the extraction process.

  11. Methods and compositions for efficient nucleic acid sequencing

    DOEpatents

    Drmanac, Radoje

    2002-01-01

    Disclosed are novel methods and compositions for rapid and highly efficient nucleic acid sequencing based upon hybridization with two sets of small oligonucleotide probes of known sequences. Extremely large nucleic acid molecules, including chromosomes and non-amplified RNA, may be sequenced without prior cloning or subcloning steps. The methods of the invention also solve various current problems associated with sequencing technology such as, for example, high noise to signal ratios and difficult discrimination, attaching many nucleic acid fragments to a surface, preparing many, longer or more complex probes and labelling more species.

  12. Methods and compositions for efficient nucleic acid sequencing

    DOEpatents

    Drmanac, Radoje

    2006-07-04

    Disclosed are novel methods and compositions for rapid and highly efficient nucleic acid sequencing based upon hybridization with two sets of small oligonucleotide probes of known sequences. Extremely large nucleic acid molecules, including chromosomes and non-amplified RNA, may be sequenced without prior cloning or subcloning steps. The methods of the invention also solve various current problems associated with sequencing technology such as, for example, high noise to signal ratios and difficult discrimination, attaching many nucleic acid fragments to a surface, preparing many, longer or more complex probes and labelling more species.

  13. Steam Cooking Significantly Improves in Vitro Bile Acid Binding of Beets, Eggplant, Asparagus, Carrots, Green Beans and Cauliflower

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The relative healthful potential of cooked beets, okra, eggplant, asparagus, carrots, green beans, cauliflower and turnips was evaluated by determining their in vitro bile acid binding using a mixture of bile acids secreted in human bile at a duodenal physiological pH of 6.3. Six treatments and two...

  14. Seed oil and fatty acid composition in Capsicum spp

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The oil content and fatty acid composition of seed of 233 genebank accessions (total) of nine Capsicum species, and a single accession of Tubocapsicum anomalum, were determined. The physicochemical characteristics of oil extracted from seed of C. annuum and C. baccatum were also examined. Significan...

  15. Effects of Biomass in Polyethylene or Polylactic Acid Composites

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Previous studies have shown that compounding Polyethylene (PE) or Polylactic acid (PLA) with a dairy-based bioplastic resulted in composites with good mechanical properties. In this study, mass ratios of a dairy-protein-based material (DBP) ranging from 0, 5, 10 and 20 wt% replaced equivalent masse...

  16. Corrosion of graphite composites in phosphoric acid fuel cells

    NASA Technical Reports Server (NTRS)

    Christner, L. G.; Dhar, H. P.; Farooque, M.; Kush, A. K.

    1986-01-01

    Polymers, polymer-graphite composites and different carbon materials are being considered for many of the fuel cell stack components. Exposure to concentrated phosphoric acid in the fuel cell environment and to high anodic potential results in corrosion. Relative corrosion rates of these materials, failure modes, plausible mechanisms of corrosion and methods for improvement of these materials are investigated.

  17. Perfluoroalkyl acid contamination and polyunsaturated fatty acid composition of French freshwater and marine fishes.

    PubMed

    Yamada, Ami; Bemrah, Nawel; Veyrand, Bruno; Pollono, Charles; Merlo, Mathilde; Desvignes, Virginie; Sirot, Véronique; Oseredczuk, Marine; Marchand, Philippe; Cariou, Ronan; Antignac, Jean-Phillippe; Le Bizec, Bruno; Leblanc, Jean-Charles

    2014-07-30

    In this study, French marine and freshwater fish perfluoroalkyl acid (PFAA) contamination are presented along with their fatty acid (FA) composition to provide further elements for a risk/benefit balance of fish consumption to be assessed. The 29 most consumed marine fish species were collected in four metropolitan French coastal areas in 2004 to constitute composite samples. Geographical differences in terms of consumed species and contamination level were taken into account. Three hundred and eighty-seven composite samples corresponding to 16 freshwater fish species collected between 2008 and 2010 in the six major French rivers or their tributaries were selected among the French national agency for water and aquatic environments freshwater fish sample library. The raw edible parts were analyzed for FA composition and PFAA contamination. Results show that freshwater fishes are more contaminated by PFAAs than marine fishes and do not share the same contamination profile. Freshwater fish contamination is mostly driven by perfluorooctane sulfonate (PFOS) (75%), whereas marine fish contamination is split between perfluorooctanoic acid (PFOA) (24%), PFOS (20%), perfluorohexanoic acid (PFHxA) (15%), perfluoropentanoic acid (PFHpA) (11%), and perfluorobutanoic acid (PFBA) (11%). Common carp, pike-perch, European perch, thicklip grey mullet, and common roach presented the most unfavorable balance profile due to their high level of PFAAs and low level of n-3 long-chain polyunsaturated fatty acids (LC-PUFAs). These data could be used, if needed, in an updated opinion on fish consumption that takes into account PFAA contamination.

  18. Osmium Isotope and Highly Siderophile Element Compositions of Lunar Orange and Green Glasses

    NASA Technical Reports Server (NTRS)

    Walker, R. J.; Horan, M. F.; Shearer, C. K.; Papike, J. J.

    2003-01-01

    The absolute and relative abundances of the highly siderophile elements (HSE) present in planetary mantles are primarily controlled by: 1) silicate-metal partitioning during core-mantle differentiation, 2) the subsequent addition of HSE to mantles via continued planetary accretion. Consequently, constraints on the absolute and relative abundances of the HSE in the lunar mantle will provide unique insights to the formation and late accretionary history of not only the Moon, but also Earth. Determining the HSE content of the lunar mantle, however, has proven difficult, because no bona fide mantle rocks have been collected from the moon. The only materials presently available for constraining mantle abundances are lunar volcanic rocks. Lunar basalts typically have very low concentrations of HSE and highly fractionated HSE patterns. Because of our extremely limited understanding of mantle melt partitioning of the HSE, even for terrestrial systems, extrapolations to mantle compositions from basaltic compositions are difficult, except possibly for the less compatible HSE Pt and Pd. Primitive, presumably less fractionated materials, such as picritic glasses are potentially more diagnostic of the lunar interior. Here we report Os isotopic composition data and Re, Os, Ir, Ru, Pt and Pd concentration data for green glass (15426,164) and orange glass (74001,1217). As with previous studies utilizing neutron activation analysis, we are examining different size fractions of the spherules to assess the role of surface condensation in the generation of the HSE abundances.

  19. Creating ω-3 Fatty-Acid-Enriched Chicken Using Defatted Green Microalgal Biomass.

    PubMed

    Gatrell, Stephanie K; Kim, JongGun; Derksen, Theodore J; O'Neil, Eleanore V; Lei, Xin Gen

    2015-10-28

    This study was to create an ω-3 (n-3) fatty-acid-enriched chicken product using defatted green microalgae (DGA, Nannochloropsis oceanica) biomass out of biofuel research. Hatching Ross broiler chicks were fed a corn-soybean meal diet containing 0 (control), 2, 4, 8, or 16% DGA for 6 weeks (n = 6 cages/diet). The DGA inclusion resulted in a linear (p < 0.001) increase in total n-3 fatty acids, eicosapentaenoic acid (EPA), and docosahexaenoic acid (DHA) in plasma, liver, breast, and thigh at weeks 3 and 6. The increase in the breast EPA + DHA by the 16% DGA diet reached 60-fold (p < 0.0001) over the control. The 8 and 4% DGA diets elevated (p < 0.05) liver mRNA levels of Δ-9 (88%) and Δ-6 (96) desaturases. In conclusion, 8-16% of the DGA can be added in diets for broilers to produce a n-3 fatty-acid-enriched chicken meat. PMID:26395320

  20. Evidence for transport intermediates in aromatic amino acid synthesis of non-green tissues

    SciTech Connect

    Leuschner, C.; Schultz, G. )

    1990-05-01

    Quinate (QA) is the predominant pre-aromatic compound formed at high rates in leaves of many plants at the early vegetation stage and transported through the phloem. The transfer of 3-dehydroquinate, 3-dehydroshikimate and (SkA) across the plastidial membranes has been evidenced. The question was whether the rate of QA uptake is comparable to that of the 3 SkA-pathway intermediates. To demonstrate this, /U-{sup 14}C/QA and /U-{sup 14}C/SkA were applied to Brassica rapa roots. Both compounds were uptaken at considerable rates and incorporated into aromatic amino acids (Phe + Tyr + Trp formation, in nmol/g fresh wt x h: applying 145 {mu}mol QA: 21.2; applying 156 {mu}mol Ska: 31.8). Thus, QA is a possible candidate for transport into non-green tissues for aromatic amino acid synthesis.

  1. Polyacrylamide gel analysis of high molecular weight ribonucleic Acid from etiolated and green cucumber cotyledons.

    PubMed

    Vedel, F; D'Aoust, M J

    1970-07-01

    Cucumis sativus L. seeds and 5-day-old dark-grown cotyledons contain 25 and 18 S cytoplasmic ribosomal RNAs as main components. The major increase in nucleic acid content in both green and etiolated cotyledons occurs between days 5 and 7 of germination. This increase is characterized by an important synthesis of 23 and 16 S plastid (chloroplast and proplastid) ribosomal RNAs. Proplastid RNA synthesis appears to continue for a longer period in the dark-grown cotyledons, despite a total RNA content considerably less than in the light-grown cotyledons.The nonribosomal distribution of the chloroplast and proplastid ribosomal RNAs observed in all cases (after extraction and fractionation) results from the lability of the 23 S component. This degradation increases if the chloroplasts and proplastids are isolated prior to extraction of their nucleic acid.

  2. Saccharides and fructooligosaccharides composition of green and ripe Averrhoa carambola, Blighia sapida and Spondias dulcis fruits.

    PubMed

    Benkeblia, Noureddine; Lopez, Mercedes G

    2015-06-01

    The maturation of fruits is characterized by numerous compositional changes during ripening and these changes contribute in their quality attributes. This study aimed to assess the contents of saccharides and potential fructooligosaccharides (FOS) of ackee (Blighia sapida Köenig), carambola (Averrhoa carambola) and June plum (Spondias dulcis), at green and ripe stages. Beside glucose and fructose and lower sucrose content, three short chain fructooligosaccharides were identified in ackee fruit, namely 1-kestose (1(F)-β-d-fructofuranosyl sucrose), nystose (1(F)(1-β-d-fructofuranosyl)2 sucrose) and DP5 (1(F)(1-β-d-fructofuranosyl)3 sucrose), while in carambola and June plum DP5 (1(F)(1-β-d-fructofuranosyl)3 sucrose) was not detected. Ripening stage also affected significantly the contents of these saccharides and sFOS.

  3. Method of preparing and using and composition for acidizing subterranean formations

    SciTech Connect

    Dill, W.R.

    1984-08-21

    A composition and method of acidizing or fracturing a subterranean formation comprises contacting the formation with a composition comprising an acid, urea, and a selected gelling agent. The urea is present in an amount sufficient to extend the viscous stability of the gelled acid composition in comparison to the acid and gelling agent alone.

  4. Synergistic De-colorization of CanLan-Green Solution with Attapulgite-Ferrous Sulfate Composite Coagulator

    NASA Astrophysics Data System (ADS)

    Han, Hong; Gu, Xu; Li, Dong; Zhou, Sumin; Jiang, Saibo; Lu, Humei

    2010-11-01

    Attapulgite clay has strong adsorptive ability, excellent chemical stability and biological safety, thus has attracted more and more attention in application for environmental field recently. In this study, 0.01 g/L Canlan-Green solution was prepared as treatment target, and the optimal preparation conditions of attapulgite-ferrous sulfate composite coagulator were obtained by methods of heat pretreatment, high temperature calcination and orthogonal experiments; Then the best dosage of composite coagulator for de-colorization of CanLan-Green solution was determined via inspecting factors as pH, reaction temperature, settlement time, reaction time, agitation rate etc. Compared with conventional coagulator ferrous sulfate, composite coagulator possesses advantages of less dosage, excellent decolorization performance, speediness, better settlement ability, cheaper and safer and so on. It proves to be an ideal inorganic composite coagulator choice.

  5. Meteoritic Amino Acids: Diversity in Compositions Reflects Parent Body Histories

    PubMed Central

    2016-01-01

    The analysis of amino acids in meteorites dates back over 50 years; however, it is only in recent years that research has expanded beyond investigations of a narrow set of meteorite groups (exemplified by the Murchison meteorite) into meteorites of other types and classes. These new studies have shown a wide diversity in the abundance and distribution of amino acids across carbonaceous chondrite groups, highlighting the role of parent body processes and composition in the creation, preservation, or alteration of amino acids. Although most chiral amino acids are racemic in meteorites, the enantiomeric distribution of some amino acids, particularly of the nonprotein amino acid isovaline, has also been shown to vary both within certain meteorites and across carbonaceous meteorite groups. Large l-enantiomeric excesses of some extraterrestrial protein amino acids (up to ∼60%) have also been observed in rare cases and point to nonbiological enantiomeric enrichment processes prior to the emergence of life. In this Outlook, we review these recent meteoritic analyses, focusing on variations in abundance, structural distributions, and enantiomeric distributions of amino acids and discussing possible explanations for these observations and the potential for future work. PMID:27413780

  6. Meteoritic Amino Acids: Diversity in Compositions Reflects Parent Body Histories.

    PubMed

    Elsila, Jamie E; Aponte, José C; Blackmond, Donna G; Burton, Aaron S; Dworkin, Jason P; Glavin, Daniel P

    2016-06-22

    The analysis of amino acids in meteorites dates back over 50 years; however, it is only in recent years that research has expanded beyond investigations of a narrow set of meteorite groups (exemplified by the Murchison meteorite) into meteorites of other types and classes. These new studies have shown a wide diversity in the abundance and distribution of amino acids across carbonaceous chondrite groups, highlighting the role of parent body processes and composition in the creation, preservation, or alteration of amino acids. Although most chiral amino acids are racemic in meteorites, the enantiomeric distribution of some amino acids, particularly of the nonprotein amino acid isovaline, has also been shown to vary both within certain meteorites and across carbonaceous meteorite groups. Large l-enantiomeric excesses of some extraterrestrial protein amino acids (up to ∼60%) have also been observed in rare cases and point to nonbiological enantiomeric enrichment processes prior to the emergence of life. In this Outlook, we review these recent meteoritic analyses, focusing on variations in abundance, structural distributions, and enantiomeric distributions of amino acids and discussing possible explanations for these observations and the potential for future work. PMID:27413780

  7. Meteoritic Amino Acids: Diversity in Compositions Reflects Parent Body Histories.

    PubMed

    Elsila, Jamie E; Aponte, José C; Blackmond, Donna G; Burton, Aaron S; Dworkin, Jason P; Glavin, Daniel P

    2016-06-22

    The analysis of amino acids in meteorites dates back over 50 years; however, it is only in recent years that research has expanded beyond investigations of a narrow set of meteorite groups (exemplified by the Murchison meteorite) into meteorites of other types and classes. These new studies have shown a wide diversity in the abundance and distribution of amino acids across carbonaceous chondrite groups, highlighting the role of parent body processes and composition in the creation, preservation, or alteration of amino acids. Although most chiral amino acids are racemic in meteorites, the enantiomeric distribution of some amino acids, particularly of the nonprotein amino acid isovaline, has also been shown to vary both within certain meteorites and across carbonaceous meteorite groups. Large l-enantiomeric excesses of some extraterrestrial protein amino acids (up to ∼60%) have also been observed in rare cases and point to nonbiological enantiomeric enrichment processes prior to the emergence of life. In this Outlook, we review these recent meteoritic analyses, focusing on variations in abundance, structural distributions, and enantiomeric distributions of amino acids and discussing possible explanations for these observations and the potential for future work.

  8. Caffeic acid and glycerol are constituents of the suberin layers in green cotton fibres.

    PubMed

    Schmutz, A; Jenny, T; Amrhein, N; Ryser, U

    1993-03-01

    The fibres of the green-lint mutant (Lg) of cotton (Gossypium hirsutum L.) are suberized and contain a large proportion of wax. The unidentified components of the wax were separated into a colourless fluorescent fraction and a yellow pigmented fraction. Using ultraviolet spectroscopy and nuclear-magneticresonance ((1)H-NMR) spectroscopy, esterified trans-caffeic acid was identified as the only phenolic component in the colourless fraction. This fraction was further purified and was shown to contain caffeic acid esterified to fatty acids (mainly ω-hydroxy fatty acids), and glycerol in molar ratios of 4∶5∶5. When 2-aminoindan-2-phosphonic acid (AIP), an inhibitor of phenylalanine ammonia-lyase (EC 4. 3. 1. 5.) was added to ovules cultured in vitro, at the beginning of secondary wall formation, the fibres remained white and the colourless caffeic-acid derivative and the yellow compounds could no longer be detected by ultraviolet spectroscopy. Fibres grown in the presence of AIP were also examined in the electron microscope. Secondary cell walls were present in the treated fibres, but the electron-opaque suberin layers were replaced by apparently empty spaces. This result indicates that cinnamic-acid derivatives are covalently linked to suberin and have a structural role within the polymer or are involved in anchoring the polymer to the cellulosic secondary wall. Purified cell walls of green cotton fibres contained about 1% (of the dry weight) of bound glycerol, 0.9% of the glycerol being extractable with the wax fraction and 0.1% remaining in the cell-wall residue. The corresponding values for white fibres were 0.03% (total), 0.02% (wax), and 0.01% (cell-wall residue). Fibres synthesizing their secondary walls in the presence of AIP contained about normal amounts of bound glycerol in the wax fraction, but glycerol accumulation in the cell-wall residue was inhibited by about 95%. These observations indicate that glycerol is an important constituent of cotton

  9. Fatty acid composition of fat depots in wintering Canada geese

    USGS Publications Warehouse

    Austin, J.E.

    1993-01-01

    I determined the fatty acid composition of subcutaneous, abdominal, visceral, and leg saddle depots in adult female Canada Geese (Branta canadensis) wintering in north-central Missouri during October 1984-March 1985. Mean levels of C14:0, C16:0, C16:1, C18:0, C18:1, C18:2, and C18:3 generally were highest in the subcutaneous and abdominal depots. The ratio of saturated to unsaturated fats was highest in the leg saddle depot and lowest in the abdominal depot. I also assessed the differences among sexes, seasons, and years in fatty acid composition of abdominal fat depots in adult geese collected during October-March, 1985-1987. Adult females had consistently higher levels of C14:0 in abdominal depots than males. Fatty acid composition of the abdominal depot differed among years but not by season. In the abdominal depot, C14:0, C16:0, C16:1, and C18:1 were higher in 1986-1987 compared with the previous two years, whereas C18:3 was highest in 1984-1985. Differences among years reflected changes in winter diet. Fatty acids of wintering geese were similar to those previously found in breeding Canada Geese.

  10. Theoretical study of inhibition efficiencies of some amino acids on corrosion of carbon steel in acidic media: green corrosion inhibitors.

    PubMed

    Dehdab, Maryam; Shahraki, Mehdi; Habibi-Khorassani, Sayyed Mostafa

    2016-01-01

    Inhibition efficiencies of three amino acids [tryptophan (B), tyrosine (c), and serine (A)] have been studied as green corrosion inhibitors on corrosion of carbon steel using density functional theory (DFT) method in gas and aqueous phases. Quantum chemical parameters such as EH OMO (highest occupied molecular orbital energy), E LUMO (lowest unoccupied molecular orbital energy), hardness (η), polarizability ([Formula: see text]), total negative charges on atoms (TNC), molecular volume (MV) and total energy (TE) have been calculated at the B3LYP level of theory with 6-311++G** basis set. Consistent with experimental data, theoretical results showed that the order of inhibition efficiency is tryptophan (B) > tyrosine (C) > serine (A). In order to determine the possible sites of nucleophilic and electrophilic attacks, local reactivity has been evaluated through Fukui indices.

  11. Prebiotically plausible mechanisms increase compositional diversity of nucleic acid sequences

    PubMed Central

    Derr, Julien; Manapat, Michael L.; Rajamani, Sudha; Leu, Kevin; Xulvi-Brunet, Ramon; Joseph, Isaac; Nowak, Martin A.; Chen, Irene A.

    2012-01-01

    During the origin of life, the biological information of nucleic acid polymers must have increased to encode functional molecules (the RNA world). Ribozymes tend to be compositionally unbiased, as is the vast majority of possible sequence space. However, ribonucleotides vary greatly in synthetic yield, reactivity and degradation rate, and their non-enzymatic polymerization results in compositionally biased sequences. While natural selection could lead to complex sequences, molecules with some activity are required to begin this process. Was the emergence of compositionally diverse sequences a matter of chance, or could prebiotically plausible reactions counter chemical biases to increase the probability of finding a ribozyme? Our in silico simulations using a two-letter alphabet show that template-directed ligation and high concatenation rates counter compositional bias and shift the pool toward longer sequences, permitting greater exploration of sequence space and stable folding. We verified experimentally that unbiased DNA sequences are more efficient templates for ligation, thus increasing the compositional diversity of the pool. Our work suggests that prebiotically plausible chemical mechanisms of nucleic acid polymerization and ligation could predispose toward a diverse pool of longer, potentially structured molecules. Such mechanisms could have set the stage for the appearance of functional activity very early in the emergence of life. PMID:22319215

  12. Reduction of ferrylmyoglobin by theanine and green tea catechins. Importance of specific Acid catalysis.

    PubMed

    Yin, Jie; Andersen, Mogens L; Skibsted, Leif H

    2013-03-27

    Reduction of the hypervalent heme pigment ferrylmyoglobin by green tea catechins in aqueous solution of pH = 7.5 was investigated by stopped-flow spectroscopy. Reduction by the gallic acid esters epigallocatechin gallate (EGCG, k2 = 1460 L mol(-1) s(-1), 25.0 °C, 0.16 ionic strength) and epicatechin gallate (ECG, 1410 L mol(-1) s(-1)) was found faster than for epicatechin (EC, 300 L mol(-1) s(-1)) and epigallocatechin (EGC, 200 L mol(-1) s(-1)), even though the gallate ion (G, 330 L mol(-1) s(-1)) is similar in rate to EC. The rate for reduction by EC, EGC, ECG, EGCG, and G shows no correlation with their oxidation potentials or phenolic hydrogen-oxygen bond dissociation energy, but with the pKa of the most acidic phenol group. Theanine, with an acidity similar to that of EC, reduces ferrylmyoglobin with a similar rate (200 L mol(-1) s(-1)), in support of general acid catalysis with an initial proton transfer prior to electron transfer.

  13. Inhibitors of lactic acid fermentation in Spanish-style green olive brines of the Manzanilla variety.

    PubMed

    Medina, Eduardo; Romero, Concepción; de Castro, Antonio; Brenes, Manuel; García, Aranzazu

    2008-10-15

    Frequently, a delay or lack of lactic acid fermentation occurs during the processing of Spanish-style green olives, in particular of the Manzanilla variety. Many variables can affect the progress of fermentation such as temperature, nutrients, salt concentration, antimicrobials in brines, and others. In this study, it was demonstrated that an inappropriate alkaline treatment (low NaOH strength and insufficient alkali penetration) allowed for the presence of several antimicrobial compounds in brines, which inhibited the growth of Lactobacillus pentosus. These substances were the dialdehydic form of decarboxymethyl elenolic acid either free or linked to hydroxytyrosol and an isomer of oleoside 11-methyl ester. Olive brines, from olives treated with a NaOH solution of low concentration up to 1/2 the distance to the pit, contained these antimicrobials, and no lactic acid fermentation took place in them. By contrast, a more intense alkaline treatment (2/3 lye depth penetration) gave rise to an abundant growth of lactic acid bacteria without any antimicrobial in brines. Therefore, the precise cause of stuck fermentation in Manzanilla olive brines was demonstrated for the first time and this finding will contribute to better understand the table olive fermentation process. PMID:26047282

  14. Chemical and isotopic compositions in acid residues from various meteorites

    NASA Technical Reports Server (NTRS)

    Kano, N.; Yamakoshi, K.; Matsuzaki, H.; Nogami, K.

    1993-01-01

    We are planning to carry out systematic isotopic investigations of Ru, Mg, etc., in primordial samples. The investigations will be pursued in the context of a study of the pre-history of the solar system. It is hoped that the study will yield direct evidence for processes of nucleosynthesis in the pre-solar stage and detection of extinct radioactive nuclides. In this paper, we present the results of chemical compositions of acid residues obtained from three types of meteorites: Canyon Diablo (IA), Allende (CV3), and Nuevo Mercuro (H5); and the preliminary results of Ru isotopic compositions.

  15. Cultural characteristics and fatty acid composition of Corynebacterium acnes.

    PubMed

    Moss, C W; Dowell, V R; Lewis, V J; Schekter, M A

    1967-11-01

    A detailed study of the cultural characteristics and cellular fatty acid composition of 27 isolates of Corynebacterium acnes was performed to establish the properties by which this organism may be identified and characterized. The fatty acids were extracted directly from whole cells and examined as methyl esters by gas-liquid chromatography. Each strain possessed a similar fatty acid profile which was characterized by a large percentage of C15 branched-chain acid. Uniformity in certain biochemical reactions and cultural characteristics was also observed. All strains were catalase-positive, nonmotile, and urease-negative, reduced nitrate, liquefied gelatin, failed to hydrolyze esculin and starch, and gave a positive methyl red test. Glucose, fructose, and glycerol were fermented, but not lactose, salicin, sucrose, maltose, xylose, or arabinose. Production of hydrogen sulfide and indole, fermentation of mannitol, and hemolytic activity were variable characteristics. Two species of the genus Propionibacterium were also tested and found to be similar to C. acnes both in cultural characteristics and fatty acid composition. The results strengthen previous suggestions that C. acnes should be classified in the genus Propionibacterium.

  16. Fatty acid composition and possible health effects of coconut constituents.

    PubMed

    Pehowich, D J; Gomes, A V; Barnes, J A

    2000-06-01

    The link between excessive consumption of dietary saturated fats and coronary heart disease (CHD) is now well established. Because of its high content of saturated fatty acids, the consumption of foods containing coconut oil may therefore be a risk factor for CHD. While the fatty acid composition of coconut oil is well established, relatively little is known about the other constituents of coconut: the milk, water, cream and meat fractions. In this study, we show that while the water fraction is low in lipid content, the milk contains about 24% of the fat content of oil and the cream and meat fractions about 34%. The other coconut constituents contain significant amounts of medium-chain triglycerides that are formed from fatty acids of chain length 8:0 to 14:0. It is these fatty acids, primarily 14:0, that are thought to be atherogenic. On the other hand, medium-chain triglycerides may be advantageous under some circumstances in that they are absorbed intact and do not undergo degradation and re-esterification processes. As a result, medium-chain triglycerides provide a ready source of energy and may be useful in baby foods or in diet therapy. Nevertheless, the possible negative effects of the saturated fatty acids and the absence of the essential fatty acid linolenic acid from all coconut constituents suggest that the coconut milk, oil and cream should not be used on a regular basis in adults. PMID:10948851

  17. Fatty acid composition and possible health effects of coconut constituents.

    PubMed

    Pehowich, D J; Gomes, A V; Barnes, J A

    2000-06-01

    The link between excessive consumption of dietary saturated fats and coronary heart disease (CHD) is now well established. Because of its high content of saturated fatty acids, the consumption of foods containing coconut oil may therefore be a risk factor for CHD. While the fatty acid composition of coconut oil is well established, relatively little is known about the other constituents of coconut: the milk, water, cream and meat fractions. In this study, we show that while the water fraction is low in lipid content, the milk contains about 24% of the fat content of oil and the cream and meat fractions about 34%. The other coconut constituents contain significant amounts of medium-chain triglycerides that are formed from fatty acids of chain length 8:0 to 14:0. It is these fatty acids, primarily 14:0, that are thought to be atherogenic. On the other hand, medium-chain triglycerides may be advantageous under some circumstances in that they are absorbed intact and do not undergo degradation and re-esterification processes. As a result, medium-chain triglycerides provide a ready source of energy and may be useful in baby foods or in diet therapy. Nevertheless, the possible negative effects of the saturated fatty acids and the absence of the essential fatty acid linolenic acid from all coconut constituents suggest that the coconut milk, oil and cream should not be used on a regular basis in adults.

  18. Green synthesis of high conductivity silver nanoparticle-reduced graphene oxide composite films

    NASA Astrophysics Data System (ADS)

    Dinh, D. A.; Hui, K. S.; Hui, K. N.; Cho, Y. R.; Zhou, Wei; Hong, Xiaoting; Chun, Ho-Hwan

    2014-04-01

    A green facile chemical approach to control the dimensions of Ag nanoparticles-graphene oxide (AgNPs/GO) composites was performed by the in situ ultrasonication of a mixture of AgNO3 and graphene oxide solutions with the assistance of vitamin C acting as an environmentally friendly reducing agent at room temperature. With decreasing ultrasonication time, the size of the Ag nanoparticles decreased and became uniformly distributed over the surface of the GO nanosheets. The as-prepared AgNPs/rGO composite films were then formed using a spin coating method and reduced at 500 °C under N2/H2 gas flow for 1 h. Four-point probe measurements showed that the sheet resistance of the AgNPs/rGO films decreased with decreasing AgNPs size. The lowest sheet resistance of 270 Ω/sq was obtained in the film corresponding to 1 min of ultrasonication, which showed a 40 times lower resistivity than the rGO film (10.93 kΩ/sq). The formation mechanisms of the as-prepared AgNPs/rGO films are proposed. This study provides a guide to controlling the dimensions of AgNPs/rGO films, which might hold promise as advanced materials for a range of analytical applications, such as catalysis, sensors and microchips.

  19. Green Fabrication of Ag Coated Polyacrylonitrile Nanofibrous Composite Membrane with High Catalytic Efficiency.

    PubMed

    Shen, Lingdi; Yu, Lina; Wang, Min; Wang, Xuefen; Zhu, Meifang; Hsiao, Benjamin S

    2015-07-01

    Ag-coated polyacrylonitrile (PAN) nanofibers have been prepared by a novel, facile and green way that combined electrospinning technique and poly(dopamine)-assisted electroless plating method. Poly(dopamine) (PDOP) was formed by oxidation polymerization of dopamine on the surface of PAN nanofibers to promote the electroless plating of silver. Scanning electron microscopy (SEM), X-ray photoelectron spectroscopy (XPS), X-ray diffraction (XRD), attenuated total reflectance Fourier transform infrared (ATR FT-IR) spectroscopy and energy dispersive X-ray spectroscopy (EDS) were used to characterize the morphology and structure of Ag/PDOP/PAN nanofibrous composite mem- brane and Ultraviolet-visible (UV-vis) Spectroscopy was used to investigate its catalytic performance. The results indicated that silver clusters composed of face-centred cubic crystal Ag with average crystallite size of about 18 nm were well distributed on the surface of dopamine-modified electrospun PAN nanofibers (PDOP/PAN). The prepared silver coated PDOP/PAN (Ag/PDOP/PAN) nanofibrous composite membrane exhibited an outstanding catalytic performance, and showed good reusabil- ity for completely degradating methylene blue (MB) dyes and reducing o-nitroaniline very quickly, respectively. PMID:26373068

  20. Determination of antioxidant capacity, phenolic acids, and fatty acid composition of rapeseed varieties.

    PubMed

    Szydłowska-Czerniak, Aleksandra; Trokowski, Konrad; Karlovits, György; Szłyk, Edward

    2010-07-14

    Three different analytical methods: ferric-reducing antioxidant power (FRAP), 2,2'-diphenyl-1-picrylhydrazyl (DPPH), and oxygen radical absorbance capacity (ORAC) were used for determination of antioxidant capacity of seven rapeseed varieties. Antioxidant capacity and levels of the total phenolic content, individual phenolic acids, fatty acid composition, and the selected physicochemical properties of the studied rapeseed cultivars were determined. Mean ORAC values for methanolic extracts of rapeseeds (4092-12989 mmol of Trolox/100 g) were significantly higher than FRAP and DPPH values (6218-7641 and 6238-7645 mumol of Trolox/100 g, respectively). Although FRAP and DPPH results were lower than ORAC values for all studied rapeseed varieties, there are linear and significant correlations between these three analytical methods (correlation coefficients ranged between 0.9124 and 0.9930, p < 0.005). Also, total phenolic compounds in rapeseeds correlated with antioxidant capacity (correlation coefficients ranged between 0.8708 and 0.9516, p < 0.01). Total phenolic acids determined by HPLC varied from 20.3 mg to 40.7 mg per 100 g of rapeseed flour, and the main phenolic acid is sinapic acid (17.4-36.4 mg/100 g). Fatty acid composition (SAFA = 7.2-8.6%, MUFA = 58.5-68.0%, PUFA = 24.7-33.9%) and the absence of trans-fatty acids indicate that the studied rapeseed varieties can be a source of unsaturated fatty acids and have a positive impact on human health.

  1. DEOXYRIBONUCLEIC ACID BASE COMPOSITION OF PROTEUS AND PROVIDENCE ORGANISMS

    PubMed Central

    Falkow, Stanley; Ryman, I. R.; Washington, O.

    1962-01-01

    Falkow, Stanley (Walter Reed Army Institute of Research, Washington D.C.), I. R. Ryman, and O. Washington. Deoxyribonucleic acid base composition of Proteus and Providence organisms. J. Bacteriol. 83:1318–1321. 1962.—Deoxyribonucleic acids (DNA) from various species of Proteus and of Providence bacteria have been examined for their guanine + cytosine (GC) content. P. vulgaris, P. mirabilis, and P. rettgeri possess essentially identical mean GC contents of 39%, and Providence DNA has a GC content of 41.5%. In marked contrast, P. morganii DNA was found to contain 50% GC. The base composition of P. morganii is only slightly lower than those observed for representatives of the Escherichia, Shigella, and Salmonella groups. Aerobacter and Serratia differ significantly from the other members of the family by their relatively high GC content. Since a minimal requirement for genetic compatibility among different species appears to be similarity of their DNA base composition, it is suggested that P. morganii is distinct genetically from the other species of Proteus as well as Providence strains. The determination of the DNA base composition of microorganisms is important for its predictive information. This information should prove of considerable value in investigating genetic and taxonomic relationships among bacteria. PMID:13891463

  2. Composition and Diversity of Avian Communities Using a New Urban Habitat: Green Roofs

    NASA Astrophysics Data System (ADS)

    Washburn, Brian E.; Swearingin, Ryan M.; Pullins, Craig K.; Rice, Matthew E.

    2016-06-01

    Green roofs on buildings are becoming popular and represent a new component of the urban landscape. Public benefits of green roof projects include reduced stormwater runoff, improved air quality, reduced urban heat island effects, and aesthetic values. As part of a city-wide plan, several green roofs have been constructed at Chicago's O'Hare International Airport (ORD). Like some other landscaping features, green roofs on or near an airport might attract wildlife and thus increase the risk of bird-aircraft collisions. During 2007-2011, we conducted a series of studies to evaluate wildlife use of newly constructed green roofs and traditional (gravel) roofs on buildings at ORD. These green roofs were 0.04-1.62 ha in area and consisted of primarily stonecrop species for vegetation. A total of 188 birds were observed using roofs during this research. Of the birds using green roofs, 66, 23, and 4 % were Killdeer, European Starlings, and Mourning Doves, respectively. Killdeer nested on green roofs, whereas the other species perched, foraged, or loafed. Birds used green roofs almost exclusively between May and October. Overall, avian use of the green roofs was minimal and similar to that of buildings with traditional roofs. Although green roofs with other vegetation types might offer forage or cover to birds and thus attract potentially hazardous wildlife, the stonecrop-vegetated green roofs in this study did not increase the risk of bird-aircraft collisions.

  3. Composition and Diversity of Avian Communities Using a New Urban Habitat: Green Roofs.

    PubMed

    Washburn, Brian E; Swearingin, Ryan M; Pullins, Craig K; Rice, Matthew E

    2016-06-01

    Green roofs on buildings are becoming popular and represent a new component of the urban landscape. Public benefits of green roof projects include reduced stormwater runoff, improved air quality, reduced urban heat island effects, and aesthetic values. As part of a city-wide plan, several green roofs have been constructed at Chicago's O'Hare International Airport (ORD). Like some other landscaping features, green roofs on or near an airport might attract wildlife and thus increase the risk of bird-aircraft collisions. During 2007-2011, we conducted a series of studies to evaluate wildlife use of newly constructed green roofs and traditional (gravel) roofs on buildings at ORD. These green roofs were 0.04-1.62 ha in area and consisted of primarily stonecrop species for vegetation. A total of 188 birds were observed using roofs during this research. Of the birds using green roofs, 66, 23, and 4 % were Killdeer, European Starlings, and Mourning Doves, respectively. Killdeer nested on green roofs, whereas the other species perched, foraged, or loafed. Birds used green roofs almost exclusively between May and October. Overall, avian use of the green roofs was minimal and similar to that of buildings with traditional roofs. Although green roofs with other vegetation types might offer forage or cover to birds and thus attract potentially hazardous wildlife, the stonecrop-vegetated green roofs in this study did not increase the risk of bird-aircraft collisions.

  4. Green biodiesel production from waste cooking oil using an environmentally benign acid catalyst.

    PubMed

    Tran, Thi Tuong Vi; Kaiprommarat, Sunanta; Kongparakul, Suwadee; Reubroycharoen, Prasert; Guan, Guoqing; Nguyen, Manh Huan; Samart, Chanatip

    2016-06-01

    The application of an environmentally benign sulfonated carbon microsphere catalyst for biodiesel production from waste cooking oil was investigated. This catalyst was prepared by the sequential hydrothermal carbonization and sulfonation of xylose. The morphology, surface area, and acid properties were analyzed. The surface area and acidity of the catalyst were 86m(2)/g and 1.38mmol/g, respectively. In addition, the presence of sulfonic acid on the carbon surface was confirmed by Fourier transform infrared spectroscopy and X-ray photoelectron spectroscopy. The catalytic activity was tested for biodiesel production from waste cooking oil via a two-step reaction to overcome reaction equilibrium. The highest biodiesel yield (89.6%) was obtained at a reaction temperature of 110°C, duration time of 4h, and catalyst loading of 10wt% under elevated pressure 2.3bar and 1.4bar for first and second step, respectively. The reusability of the catalyst was investigated and showed that the biodiesel yield decreased by 9% with each cycle; however, this catalyst is still of interest because it is an example of green chemistry, is nontoxic, and makes use of xylose waste. PMID:27053375

  5. Green biodiesel production from waste cooking oil using an environmentally benign acid catalyst.

    PubMed

    Tran, Thi Tuong Vi; Kaiprommarat, Sunanta; Kongparakul, Suwadee; Reubroycharoen, Prasert; Guan, Guoqing; Nguyen, Manh Huan; Samart, Chanatip

    2016-06-01

    The application of an environmentally benign sulfonated carbon microsphere catalyst for biodiesel production from waste cooking oil was investigated. This catalyst was prepared by the sequential hydrothermal carbonization and sulfonation of xylose. The morphology, surface area, and acid properties were analyzed. The surface area and acidity of the catalyst were 86m(2)/g and 1.38mmol/g, respectively. In addition, the presence of sulfonic acid on the carbon surface was confirmed by Fourier transform infrared spectroscopy and X-ray photoelectron spectroscopy. The catalytic activity was tested for biodiesel production from waste cooking oil via a two-step reaction to overcome reaction equilibrium. The highest biodiesel yield (89.6%) was obtained at a reaction temperature of 110°C, duration time of 4h, and catalyst loading of 10wt% under elevated pressure 2.3bar and 1.4bar for first and second step, respectively. The reusability of the catalyst was investigated and showed that the biodiesel yield decreased by 9% with each cycle; however, this catalyst is still of interest because it is an example of green chemistry, is nontoxic, and makes use of xylose waste.

  6. Rapid microplate, green method for high-throughput evaluation of vinegar acidity using thermal infrared enthalpimetry.

    PubMed

    Tischer, Bruna; Oliveira, Alessandra Stangherlin; Ferreira, Daniele de Freitas; Menezes, Cristiano Ragagnin; Duarte, Fábio Andrei; Wagner, Roger; Barin, Juliano Smanioto

    2017-01-15

    Infrared thermal imaging was combined with disposable microplates to perform enthalpimetric analysis using an infrared camera to monitor temperature without contact. The proposed thermal infrared enthalpimetry (TIE) method was used to determine the total, fixed and volatile acidities of vinegars. Sample preparation and analysis were performed in the same vessel, avoiding excessive sample handling and reducing energy expenditure by more than ten times. The results agreed with those of the conventional method for different kinds of vinegars, with values of 1.7%, and 2.3% for repeatability and intermediate precision, respectively. A linear calibration curve was obtained from 0.040 to 1.30molL(-1). The proposed method provided rapid results (within 10s) for four samples simultaneously, a sample throughput of up to 480 samples per hour. In addition, the method complies with at least eight of twelve recommendations for green analytical chemistry, making TIE a promising tool for routine vinegar analysis.

  7. Rapid microplate, green method for high-throughput evaluation of vinegar acidity using thermal infrared enthalpimetry.

    PubMed

    Tischer, Bruna; Oliveira, Alessandra Stangherlin; Ferreira, Daniele de Freitas; Menezes, Cristiano Ragagnin; Duarte, Fábio Andrei; Wagner, Roger; Barin, Juliano Smanioto

    2017-01-15

    Infrared thermal imaging was combined with disposable microplates to perform enthalpimetric analysis using an infrared camera to monitor temperature without contact. The proposed thermal infrared enthalpimetry (TIE) method was used to determine the total, fixed and volatile acidities of vinegars. Sample preparation and analysis were performed in the same vessel, avoiding excessive sample handling and reducing energy expenditure by more than ten times. The results agreed with those of the conventional method for different kinds of vinegars, with values of 1.7%, and 2.3% for repeatability and intermediate precision, respectively. A linear calibration curve was obtained from 0.040 to 1.30molL(-1). The proposed method provided rapid results (within 10s) for four samples simultaneously, a sample throughput of up to 480 samples per hour. In addition, the method complies with at least eight of twelve recommendations for green analytical chemistry, making TIE a promising tool for routine vinegar analysis. PMID:27542445

  8. Weight gain and psychiatric treatment: Is there a role for green tea and conjugated linoleic acid?

    PubMed

    Katzman, Martin A; Jacobs, Leslie; Marcus, Madalyn; Vermani, Monica; Logan, Alan C

    2007-01-01

    Dietary supplement use is widespread in developed nations. In particular, patients who utilize mental health services also report frequent consumption of dietary supplements, often in relation to management of adverse events and specifically weight gain. Weight gain induced by psychotropic medications can further compound psychological distress and negatively influence compliance. Here we report on four cases of social anxiety disorder treated with the atypical antipsychotic quetiapine. Self-administration of conjugated linoleic acid and green tea extract may have influenced objective anthropomorphic measurements; each patient had an unexpected decrease in total body fat mass, a decrease in body fat percentage and an increase in lean body mass. Since weight gain is a common and undesirable side-effect with psychiatric medications, our observation strongly suggests the need for controlled clinical trials using these agents. PMID:17477874

  9. Quest for the binding mode of malachite green with humic acid

    NASA Astrophysics Data System (ADS)

    Zhang, Hongmei; Yin, Mingxing; Shi, Jinghua; Wang, Yanqing

    2015-02-01

    The association of malachite green (MG) with humic acid (HA) was investigated by using fluorescence, UV-vis spectroscopy and molecular Modelling method. The fluorescence spectral results indicated that the binding between MG and HA occurred by mainly hydrophobic and electrostatic forces with association constants of KA (298 K) = 6.24 × 105 L/mol and KA (310 K) = 10.20 × 105 L/mol. There were more than one binding sites on HA to bind with MG. The binding sites of MG with HA primarily located at the aromatic rings of HA. MG could enter into the hydrophobic cavities of HA to quench the fluorescence of HA. On the contrary, HA binding caused MG to a coplanar conformation with more extended π bond distribution by π-π stacking interactions. The experiment and calculation data both showed that the hydrophobic binding cavities in HA played a key role in its binding with MG.

  10. Fiberglass goes green: Developing phosphate glass for use in biodegradable composites

    NASA Astrophysics Data System (ADS)

    Arendt, Christina Lee

    Composite materials, such as the glass fiber reinforced polyester thermosets known as "fiberglass," are used in many applications. However, recycling processes for these materials are inefficient and not widely available. Specially engineered degradable polymers offer an opportunity to redesign these composites. Additionally, the composite could be tailored to be multi-use, such that upon degradation, the resulting products could be used as part of a zeoponic substrate (artificial soil) for growing plants. Such a material would be beneficial for long-duration space missions, terraforming, or in other agricultural applications. The research presented in this dissertation focuses on developing phosphate glass for use as the fiber reinforcement for such a composite. Due to the under-utilization of phosphate systems, there is a lack of thermodynamic data on these systems. The modified associate species method of phase diagram calculation was used in an attempt to gain more information about the desired system, as it is a good predictor of the phase relations in oxide melts, slags, and glasses and requires less data than other methods. Further research into the thermodynamic properties of phosphates is still needed to develop accurate phase diagrams and melting temperatures for this system. Seventeen glass formulations were developed and melted. Six of these formulations were chosen for dissolution testing. Of these six, Glass 17 was chosen for intensive testing and characterization. This glass was tested in water, hydrochloric acid solutions, and citric acid solutions. The weight loss was measured and ICP-OES was performed on the leachate solution. Scanning electron microscopy (SEM) and X-ray diffraction were performed on the tested specimens. Shrinking-core models were fit to the dissolution data. Fibers were drawn from the glass and characterized using SEM. The data shows that this glass is not dissolving congruently, as is expected of phosphate glasses. Instead

  11. Polylactic acid composites incorporating casein functionalized cellulose nanowhiskers

    PubMed Central

    2013-01-01

    Background Polylactic acid (PLA) is considered to be a sustainable alternative to petroleum-based polymers for many applications. Using cellulose fiber to reinforce PLA is of great interest recently due to its complete biodegradability and potential improvement of the mechanical performance. However, the dispersion of hydrophilic cellulose fibers in the hydrophobic polymer matrix is usually poor without using hazardous surfactants. The goal of this study was to develop homogenously dispersed cellulose nanowhisker (CNW) reinforced PLA composites using whole milk casein protein, which is an environmentally compatible dispersant. Results In this study, whole milk casein was chosen as a dispersant in the PLA-CNW system because of its potential to interact with the PLA matrix and cellulose. The affinity of casein to PLA was studied by surface plasmon resonance (SPR) imaging. CNWs were functionalized with casein and used as reinforcements to make PLA composites. Fluorescent staining of CNWs in the PLA matrix was implemented as a novel and simple way to analyze the dispersion of the reinforcements. The dispersion of CNWs in PLA was improved when casein was present. The mechanical properties of the composites were studied experimentally. Compared to pure PLA, the PLA composites had higher Young’s modulus. Casein (CS) functionalized CNW reinforced PLA (PLA-CS-CNW) at 2 wt% filler content maintained higher strain at break compared to normal CNW reinforced PLA (PLA-CNW). The Young’s modulus of PLA-CS-CNW composites was also higher than that of PLA-CNW composites at higher filler content. However, all composites exhibited lower strain at break and tensile strength at high filler content. Conclusions The presence of whole milk casein improved the dispersion of CNWs in the PLA matrix. The improved dispersion of CNWs provided higher modulus of the PLA composites at higher reinforcement loading and maintained the strain and stress at break of the composites at relatively low

  12. Comparative Study of Chemical Composition and Biological Activity of Yellow, Green, Brown, and Red Brazilian Propolis.

    PubMed

    Machado, Christiane Schineider; Mokochinski, João Benhur; de Lira, Tatiana Onofre; de Oliveira, Fátima de Cassia Evangelista; Cardoso, Magda Vieira; Ferreira, Roseane Guimarães; Sawaya, Alexandra Christine Helena Frankland; Ferreira, Antonio Gilberto; Pessoa, Cláudia; Cuesta-Rubio, Osmany; Monteiro, Marta Chagas; de Campos, Mônica Soares; Torres, Yohandra Reyes

    2016-01-01

    The chemical composition and biological activity of a sample of yellow propolis from Mato Grosso do Sul, Brazil (EEP-Y MS), were investigated for the first time and compared with green, brown, and red types of Brazilian propolis and with a sample of yellow propolis from Cuba. Overall, EEP-Y MS had different qualitative chemical profiles, as well as different cytotoxic and antimicrobial activities when compared to the other types of propolis assessed in this study and it is a different chemotype of Brazilian propolis. Absence of phenolic compounds and the presence of mixtures of aliphatic compounds in yellow propolis were determined by analysing (1)H-NMR spectra and fifteen terpenes were identified by GC-MS. EEP-Y MS showed cytotoxic activity against human tumour strain OVCAR-8 but was not active against Gram-negative or Gram-positive bacteria. Our results confirm the difficulty of establishing a uniform quality standard for propolis from diverse geographical origins. The most appropriate pharmacological applications of yellow types of propolis must be further investigated.

  13. Comparative Study of Chemical Composition and Biological Activity of Yellow, Green, Brown, and Red Brazilian Propolis

    PubMed Central

    Machado, Christiane Schineider; Mokochinski, João Benhur; de Lira, Tatiana Onofre; de Oliveira, Fátima de Cassia Evangelista; Cardoso, Magda Vieira; Ferreira, Roseane Guimarães; Sawaya, Alexandra Christine Helena Frankland; Ferreira, Antonio Gilberto; Pessoa, Cláudia; Cuesta-Rubio, Osmany; Monteiro, Marta Chagas; de Campos, Mônica Soares

    2016-01-01

    The chemical composition and biological activity of a sample of yellow propolis from Mato Grosso do Sul, Brazil (EEP-Y MS), were investigated for the first time and compared with green, brown, and red types of Brazilian propolis and with a sample of yellow propolis from Cuba. Overall, EEP-Y MS had different qualitative chemical profiles, as well as different cytotoxic and antimicrobial activities when compared to the other types of propolis assessed in this study and it is a different chemotype of Brazilian propolis. Absence of phenolic compounds and the presence of mixtures of aliphatic compounds in yellow propolis were determined by analysing 1H-NMR spectra and fifteen terpenes were identified by GC-MS. EEP-Y MS showed cytotoxic activity against human tumour strain OVCAR-8 but was not active against Gram-negative or Gram-positive bacteria. Our results confirm the difficulty of establishing a uniform quality standard for propolis from diverse geographical origins. The most appropriate pharmacological applications of yellow types of propolis must be further investigated. PMID:27525023

  14. A study of material composition disclosure practices in green footwear products.

    PubMed

    Jacques, Jocelise J; Guimarães, Lia B M

    2012-01-01

    This work is based on the study of pioneering sustainable product development initiatives, and the analysis was guided by the cradle-to-cradle concept, which sees the waste of a given process as raw material for another, just like it happens in nature. Several studies on human factors have focused on factory conditions and workers dealing with product assembly. This research, however, relates more to consumer behavior, product use and end-of-life. The purchase of more environmentally- friendly products, in particular, is heavily influenced by the information made available by the companies. In this scenario, this article discusses three early but notable efforts on green product development, focusing on the disclosure practices adopted by the companies regarding the composition of their products. Research and data collection has focused on the footwear industry, whose products satisfy a basic human need and are ubiquitous worldwide. The use of hazardous materials and chemicals in shoe manufacturing, particularly the use of chromium - a highly toxic element - in addition to toxic solvents and adhesives and non-recyclable synthetic materials can pose serious risks to human health and the environment, even though the consumer usually is not aware of all the relevant characteristics of this kind of product.

  15. Environmental modification of yield and nutrient composition of 'Waldmann's Green' leaf lettuce

    NASA Technical Reports Server (NTRS)

    Mitchell, C. A.; Chun, C.; Brandt, W. E.; Nielsen, S. S.

    1997-01-01

    Leaf number, dry weight, and nutrient composition of Lactuca sativa L. cv. Waldmann's Green leaves were compared following 9 days of treatment in a controlled environment room under various combinations of photosynthetic photon flux (PPF:350 vs 800 micromoles m-2 s-1), atmospheric CO2 level (ambient vs 1500 micromoles mol-1), and single-strength (1X:15 mM) vs double-strength (2X:30 mM) nitrogen (N) as NO3- alone or as NH4(+) + NO3- (1:5 molar ratio). CO2 enrichment greatly enhanced leaf number under all PPF and N conditions, but increased leaf dry weight only at high PPF. Conditions favoring high photosynthesis enhanced leaf starch content 3-fold, and protein content increased as much as 64% with 2X NH4(+)+NO3-. Free sugar content was 6 to 9% of leaf dry weight for all treatment combinations, while fat was 1.5 to 3.5%. Ash content varied from 15 to 20% of leaf dry weight. Modified controlled environments can be used to enhance the nutritional content as well as the yield of crops to be used for life support in space-deployed, self-sustaining human habitats. Leaf lettuce is a useful model crop for demonstrating the potential of nutritional value added by environmental manipulation.

  16. Comparative Study of Chemical Composition and Biological Activity of Yellow, Green, Brown, and Red Brazilian Propolis.

    PubMed

    Machado, Christiane Schineider; Mokochinski, João Benhur; de Lira, Tatiana Onofre; de Oliveira, Fátima de Cassia Evangelista; Cardoso, Magda Vieira; Ferreira, Roseane Guimarães; Sawaya, Alexandra Christine Helena Frankland; Ferreira, Antonio Gilberto; Pessoa, Cláudia; Cuesta-Rubio, Osmany; Monteiro, Marta Chagas; de Campos, Mônica Soares; Torres, Yohandra Reyes

    2016-01-01

    The chemical composition and biological activity of a sample of yellow propolis from Mato Grosso do Sul, Brazil (EEP-Y MS), were investigated for the first time and compared with green, brown, and red types of Brazilian propolis and with a sample of yellow propolis from Cuba. Overall, EEP-Y MS had different qualitative chemical profiles, as well as different cytotoxic and antimicrobial activities when compared to the other types of propolis assessed in this study and it is a different chemotype of Brazilian propolis. Absence of phenolic compounds and the presence of mixtures of aliphatic compounds in yellow propolis were determined by analysing (1)H-NMR spectra and fifteen terpenes were identified by GC-MS. EEP-Y MS showed cytotoxic activity against human tumour strain OVCAR-8 but was not active against Gram-negative or Gram-positive bacteria. Our results confirm the difficulty of establishing a uniform quality standard for propolis from diverse geographical origins. The most appropriate pharmacological applications of yellow types of propolis must be further investigated. PMID:27525023

  17. RNAi knockdown of fatty acid elongase1 alters fatty acid composition in Brassica napus.

    PubMed

    Shi, Jianghua; Lang, Chunxiu; Wu, Xuelong; Liu, Renhu; Zheng, Tao; Zhang, Dongqing; Chen, Jinqing; Wu, Guanting

    2015-10-23

    The quality and end-use of oil from oilseed crops is determined by its fatty acid composition. In particular, the relative proportions of erucic and oleic acids are key selection traits for breeders. The goal of our research is to genetically improve the nutritional quality of Brassica napus cultivar CY2, the oil of which is high in erucic acid (about 40%) and low in oleic acid (about 20%). Here, we report the use of a seed-specific napin A promoter to drive the knockdown of BnFAE1 in transgenic CY2. Southern blotting results confirmed the presence of the transgene. RT-PCR analysis showed that the levels of BnFAE1 were greatly decreased in BnFAE1-Ri lines compared with the CY2 cultivar. Knockdown of BnFAE1 sharply decreased the levels of erucic acid (less than 3%), largely increased the contents of oleic acid (more than 60%) and slightly increased the polyunsaturated chain fatty acids. Compared with high erucic acid parents, expression of BnFAE1 was dramatically decreased in developing F1 seeds derived from reciprocally crossed BnFAE1-Ri lines and high erucic acid cultivars. In addition, F1 seeds derived from reciprocal crosses between BnFAE1-Ri lines and high erucic acid cultivars showed significantly increased oleic acid (more than 52%) and sharply decreased erucic acid (less than 4%), demonstrating that the RNAi construct of BnFAE1 can effectively interfere with the target gene in F1 seeds. Taken together, our results demonstrate that BnFAE1 is a reliable target for genetic improvement of rapeseed in seed oil quality promotion.

  18. Amino Acid Composition of Breast Milk from Urban Chinese Mothers

    PubMed Central

    Garcia-Rodenas, Clara L.; Affolter, Michael; Vinyes-Pares, Gerard; De Castro, Carlos A.; Karagounis, Leonidas G.; Zhang, Yumei; Wang, Peiyu; Thakkar, Sagar K.

    2016-01-01

    Human breast milk (BM) amino acid (AA) composition may be impacted by lactation stage or factors related to geographical location. The present cross-sectional study is aimed at assessing the temporal changes of BMAA over lactation stages in a large cohort of urban mothers in China. Four hundred fifty BM samples, collected in three Chinese cities covering eight months of lactation were analyzed for free (FAA) and total (TAA) AA by o-phthalaldehyde/ fluorenylmethylchloroformate (OPA/FMOC) derivatization. Concentrations and changes over lactation were aligned with previous reports. Both the sum and the individual TAA values significantly decreased during the first periods of lactation and then generally leveled off. Leucine and methionine were respectively the most and the least abundant indispensable amino acids across all the lactation stages, whereas glutamic acid + glutamine (Glx) was the most and cystine the least abundant dispensable AA. The contribution of FAA to TAA levels was less than 2%, except for free Glx, which was the most abundant FAA. In conclusion, the AA composition of the milk from our cohort of urban Chinese mothers was comparable to previous studies conducted in other parts of the world, suggesting that this is an evolutionary conserved trait largely independent of geographical, ethnic, or dietary factors. PMID:27690094

  19. Lipid content and fatty acid composition in foods commonly consumed by nursing Congolese women: incidences on their essential fatty acid intakes and breast milk fatty acids.

    PubMed

    Rocquelin, G; Tapsoba, S; Mbemba, F; Gallon, G; Picq, C

    1998-09-01

    The fat content and fatty acid (FA) composition of nearly 40 foods, currently consumed by 102 nursing Congolese mothers living in Brazzaville, were determined to assess their impact on mothers' essential fatty acid (EFA) intakes and breast milk FA. Data on mothers' milk FA and dietary habits which allowed food selection were recently published (Rocquelin et al., 1998). Most foods were locally produced. Food samples were collected at local markets, bleached if necessary to avoid microbial degradation, and stored at +4 degrees C or -20 degrees C. They were lyophilized upon their arrival in the laboratory before lipid analyses. FA composition of food lipids was determined by capillary gas chromatography. Staple diets included low-fat, high-carbohydrate foods (processed cassava roots, wheat bread) and high-polyunsaturated fatty acid (PUFA) foods: soybean oil (high in 18 : 2 n-6 and alpha-18 : 3 n-3), bushbutter (dacryodes edulis), peanuts, avocado (high in fat and 18 : 2 n-6), freshwater and salt-water fish (high in LC n-3 and/or n-6 PUFA), and leafy green vegetables (low in fat but very high in alpha-18 : 3 n-3). Their frequent consumption by nursing mothers provided enough EFA to meet requirements due to lactation. It also explains why mothers' breast milk was rich in C8-C14 saturated FA (26% of total FA) and in n-6, n-3 PUFA (respectively 15.0% and 2.4% of total FA) highly profitable for breastfed infants' development. From this point of view, dietary habits of Congolese mothers have to be sustained for they are more adequate than most Western-type diets.

  20. Effects of Tannic Acid, Green Tea and Red Wine on hERG Channels Expressed in HEK293 Cells

    PubMed Central

    Xu, Bingyuan; Li, Wenya; Lin, Yue; Sun, Xiaorun; Ding, Chunhua; Zhang, Xuan

    2015-01-01

    Tannic acid presents in varying concentrations in plant foods, and in relatively high concentrations in green teas and red wines. Human ether-à-go-go-related gene (hERG) channels expressed in multiple tissues (e.g. heart, neurons, smooth muscle and cancer cells), and play important roles in modulating cardiac action potential repolarization and tumor cell biology. The present study investigated the effects of tannic acid, green teas and red wines on hERG currents. The effects of tannic acid, teas and red wines on hERG currents stably transfected in HEK293 cells were studied with a perforated patch clamp technique. In this study, we demonstrated that tannic acid inhibited hERG currents with an IC50 of 3.4 μM and ~100% inhibition at higher concentrations, and significantly shifted the voltage dependent activation to more positive potentials (Δ23.2 mV). Remarkably, a 100-fold dilution of multiple types of tea (green tea, oolong tea and black tea) or red wine inhibited hERG currents by ~90%, and significantly shifted the voltage dependent activation to more positive potentials (Δ30.8 mV and Δ26.0 mV, respectively). Green tea Lung Ching and red wine inhibited hERG currents, with IC50 of 0.04% and 0.19%, respectively. The effects of tannic acid, teas and red wine on hERG currents were irreversible. These results suggest tannic acid is a novel hERG channel blocker and consequently provide a new mechanistic evidence for understanding the effects of tannic acid. They also revealed the potential pharmacological basis of tea- and red wine-induced biology activities. PMID:26625122

  1. Composition of Humic Acids of the Lake Baikal Sediments

    NASA Astrophysics Data System (ADS)

    Vishnyakova, O.; Chimitdorzhieva, G.; Andreeva, D.

    2012-04-01

    Humic substances are the final stage of the biogeochemical transformation of organic matter in the biosphere. Its natural compounds are found not only in soil, peat, coal, and sediments of basins. Chemical composition and properties of humic substances are determined by the functioning of the ecosystem as a whole. Therefore the study of the unique Lake Baikal sediments can provide information about their genesis, as well as the processes of organic matter transformation. For this purpose, preparations of humic acids (HA) were isolated by alkaline extraction method. The composition of HA was investigated by the elemental analyzer CHNS/O PerkinElmer Series II. Various located sediments of the Lake Baikal were the objects of the study: 1 - Chivyrkuisky Bay, 2 - Kotovo Bay, 3 - Selenga river delta near Dubinino village, 4 - Selenga river delta near Murzino village. Data on the elemental composition of HA in terms of ash-free portion show that the carbon content (CC) is of 50-53% with a maximum value in a sample 3, and minimum - in a sample 2. Such values are characteristic also for the soils with low biochemical activity. The hydrogen content is of 4,2-5,3%, a maximum value is in a sample 1. Data recalculation to the atomic percentages identified following regularities. The CC of HA is of 35-39 at. %. Hydrogen content is of 37-43 at. %. According to the content of these elements investigated substances are clearly divided into two groups: HA of the sediments of the Lake Baikal and river Selenga delta. The magnitude of the atomic ratio H/C can be seen varying degrees of condensation of the molecules of humic acids. The high atomic ratio H/C in HA of the former group indicates the predominance of aliphatic structures in the molecules. Humic acids of the later group are characterized by a low value H/C (<1), suggesting a large proportion of aromatic components in HA composition. In sediments of the Selenga river delta there is an addition of organic matter of terrigenous

  2. Comparative evaluation of essential fatty acid composition of mothers' milk of some urban and suburban regions of West Bengal, India.

    PubMed

    Roy, Susmita; Dhar, Pubali; Ghosh, Santinath

    2012-12-01

    This study investigated the fatty acid composition of lipid present in breast milk of mothers residing in urban and suburban regions of West Bengal with special emphasis on n-6 and n-3 polyunsaturated fatty acids, which played a crucial role in the growth and development of neonates. Milk samples collected from 135 mothers of middle income group (average monthly income around 'Rs 10,000/-') were analysed by gas liquid chromatography after extraction and transmethylation to determine fatty acid composition. Information about the dietary intake of individual mothers was obtained through food frequency questionnaire. The fractions of n-6 and n-3 polyunsaturated fatty acids available in milk of urban mothers were 13.59 ± 0.94 and 3.65 ± 0.49, respectively, and in suburban mothers 12.74 ± 0.89 and 4.36 ± 0.39, respectively. The green leafy vegetables, fishes and vegetable oils were the major sources of essential fatty acids in the diet of the experimental groups of Bengali mothers. This study revealed a relationship between the alimentary habits of mothers and the concentration of essential fatty acids in breast milk of Bengali mothers.

  3. Green synthesis and characterization of Au@Pt core-shell bimetallic nanoparticles using gallic acid

    NASA Astrophysics Data System (ADS)

    Zhang, Guojun; Zheng, Hongmei; Shen, Ming; Wang, Lei; Wang, Xiaosan

    2015-06-01

    In this study, we developed a facile and benign green synthesis approach for the successful fabrication of well-dispersed urchin-like Au@Pt core-shell nanoparticles (NPs) using gallic acid (GA) as both a reducing and protecting agent. The proposed one-step synthesis exploits the differences in the reduction potentials of AuCl4- and PtCl62-, where the AuCl4- ions are preferentially reduced to Au cores and the PtCl62- ions are then deposited continuously onto the Au core surface as a Pt shell. The as-prepared Au@Pt NPs were characterized by transmission electron microscope (TEM); high-resolution transmission electron microscope (HR-TEM); scanning electron microscope (SEM); UV-vis absorption spectra (UV-vis); X-ray diffraction (XRD); Fourier transmission infrared spectra (FT-IR). We systematically investigated the effects of some experimental parameters on the formation of the Au@Pt NPs, i.e., the reaction temperature, the molar ratios of HAuCl4/H2PtCl6, and the amount of GA. When polyvinylpyrrolidone K-30 (PVP) was used as a protecting agent, the Au@Pt core-shell NPs obtained using this green synthesis method were better dispersed and smaller in size. The as-prepared Au@Pt NPs exhibited better catalytic activity in the reaction where NaBH4 reduced p-nitrophenol to p-aminophenol. However, the results showed that the Au@Pt bimetallic NPs had a lower catalytic activity than the pure Au NPs obtained by the same method, which confirmed the formation of Au@Pt core-shell nanostructures because the active sites on the surfaces of the Au NPs were covered with a Pt shell.

  4. Acid gas scrubbing by composite solvent-swollen membranes

    DOEpatents

    Matson, Stephen L.; Lee, Eric K. L.; Friesen, Dwayne T.; Kelly, Donald J.

    1988-01-01

    A composite immobilized liquid membrane suitable for acid gas scrubbing is disclosed. The membrane is a solvent-swollen polymer and a microporous polymeric support, the solvent being selected from a class of highly polar solvents containing at least one atom selected from nitrogen, oxygen, phosphorous and sulfur, and having a boiling point of at least 100.degree. C. and a solubility parameter of from about 7.5 to about 13.5 (cal/cm.sup.3 -atm).sup.1/2. Such solvents are homogeneously distributed through the solvent-swollen polymer from 20% to 95% by weight. Also disclosed are methods of acid gas scrubbing of high- and low-Btu gas effluents with such solvent-swollen membranes.

  5. Acid gas scrubbing by composite solvent-swollen membranes

    DOEpatents

    Matson, S.L.; Lee, E.K.L.; Friesen, D.T.; Kelly, D.J.

    1988-04-12

    A composite immobilized liquid membrane suitable for acid gas scrubbing is disclosed. The membrane is a solvent-swollen polymer and a microporous polymeric support, the solvent being selected from a class of highly polar solvents containing at least one atom selected from nitrogen, oxygen, phosphorus and sulfur, and having a boiling point of at least 100 C and a solubility parameter of from about 7.5 to about 13.5 (cal/cm[sup 3]-atm)[sup 1/2]. Such solvents are homogeneously distributed through the solvent-swollen polymer from 20% to 95% by weight. Also disclosed are methods of acid gas scrubbing of high- and low-Btu gas effluents with such solvent-swollen membranes. 3 figs.

  6. Conjugated Linoleic Acid Production by Bifidobacteria: Screening, Kinetic, and Composition

    PubMed Central

    Amaretti, Alberto; Leonardi, Alan; Quartieri, Andrea; Gozzoli, Caterina; Rossi, Maddalena

    2016-01-01

    Conjugated linoleic acids (CLA) are positional and geometric isomers of linoleic acid involved in a number of health aspects. In humans, CLA production is performed by gut microbiota, including some species of potential probiotic bifidobacteria. 128 strains of 31 Bifidobacterium species were screened with a spectrophotometric assay to identify novel CLA producers. Most species were nonproducers, while producers belonged to B. breve and B. pseudocatenulatum. GC-MS revealed that CLA producer strains yielded 9cis,11trans-CLA and 9trans,11trans-CLA, without any production of other isomers. Hydroxylated forms of LA were absent in producer strains, suggesting that the myosin-cross-reactive antigen (MCRA) protein that exerts hydratase activity is not involved in LA isomerization. Moreover, both CLA producer and nonproducer species bear a MCRA homologue. The strain B. breve WC 0421 was the best CLA producer, converting LA into 68.8% 9cis,11trans-CLA and 25.1% 9trans,11trans-CLA. Production occurred mostly during the lag and the exponential phase. For the first time, production and incorporation of CLA in biomass were assessed. B. breve WC 0421 stored CLA in the form of free fatty acids, without changing the composition of the esterified fatty acids, which mainly occurred in the plasmatic membrane. PMID:27429985

  7. Evaluation of fatty acid and amino acid compositions in okra (Abelmoschus esculentus) grown in different geographical locations.

    PubMed

    Sami, Rokayya; Lianzhou, Jiang; Yang, Li; Ma, Ying; Jing, Jing

    2013-01-01

    Okra has different uses as a food and a remedy in traditional medicine. Since it produces many seeds, distribution of the plant is also quite easy. Although seed oil yield is low (4.7%), since the linoleic acid composition of the seed oil is quiet high (67.5%), it can still be used as a source of (UNSAT) unsaturated fatty acids. In this study, samples of okra grown in four different locations were analyzed to measure fatty acid and amino acid compositions. The content of the lipid extraction ranged from 4.34% to 4.52% on a dry weight basis. Quantitatively, the main okra fatty acids were palmitic acid (29.18-43.26%), linoleic acid (32.22-43.07%), linolenic acid (6.79-12.34%), stearic acid (6.36-7.73%), oleic acid (4.31-6.98%), arachidic acid (ND-3.48%), margaric acid (1.44-2.16%), pentadecylic acid (0.63-0.92%), and myristic acid (0.21-0.49%). Aspartic acid, proline, and glutamic acids were the main amino acids in okra pods, while cysteine and tyrosine were the minor amino acids. Statistical methods revealed how the fatty acid and amino acid contents in okra may be affected by the sampling location.

  8. Evaluation of fatty acid and amino acid compositions in okra (Abelmoschus esculentus) grown in different geographical locations.

    PubMed

    Sami, Rokayya; Lianzhou, Jiang; Yang, Li; Ma, Ying; Jing, Jing

    2013-01-01

    Okra has different uses as a food and a remedy in traditional medicine. Since it produces many seeds, distribution of the plant is also quite easy. Although seed oil yield is low (4.7%), since the linoleic acid composition of the seed oil is quiet high (67.5%), it can still be used as a source of (UNSAT) unsaturated fatty acids. In this study, samples of okra grown in four different locations were analyzed to measure fatty acid and amino acid compositions. The content of the lipid extraction ranged from 4.34% to 4.52% on a dry weight basis. Quantitatively, the main okra fatty acids were palmitic acid (29.18-43.26%), linoleic acid (32.22-43.07%), linolenic acid (6.79-12.34%), stearic acid (6.36-7.73%), oleic acid (4.31-6.98%), arachidic acid (ND-3.48%), margaric acid (1.44-2.16%), pentadecylic acid (0.63-0.92%), and myristic acid (0.21-0.49%). Aspartic acid, proline, and glutamic acids were the main amino acids in okra pods, while cysteine and tyrosine were the minor amino acids. Statistical methods revealed how the fatty acid and amino acid contents in okra may be affected by the sampling location. PMID:24171167

  9. [EFFECT OF MYCOPLASMA INFECTION TO FATTY ACID COMPOSITION OF CALLUS CULTURE SUGAR BEET].

    PubMed

    Panchenko, L P; Korobkova, K S; Ostapchuk, A N

    2015-01-01

    It was studied the effect of Acholeplasma laidlawii var. granulum str. 118 to fatty acid composition of sugar beet calluses. It was established that acting of acholeplasma results to changes in the quantitative content of the individual fatty acids and in the qualitative composition of fatty acids in the lipids of calluses. The changing of the fatty acid composition of calluses lipids of sugar beet infected by A. laidlawii vargranulum str. 118 is observed as nonspecific response to biotic stress. PMID:26829840

  10. Effects of alternative steeping methods on composition, antioxidant property and colour of green, black and oolong tea infusions.

    PubMed

    Lantano, Claudia; Rinaldi, Massimiliano; Cavazza, Antonella; Barbanti, Davide; Corradini, Claudio

    2015-12-01

    Cold water steeping is reported to maximise tea health benefits, but requires long infusion time. In this work, the employment of a brief hot infusion step followed by ice addition was evaluated. The comparison of this innovative method with hot and cold steeping was investigated on green, black and oolong teas. Catechins, xanthines and gallic acid content, antioxidant power, total phenolics and colour analysis were evaluated. Hot infusion shown rapid extractive power, but relevant compound degradation. On the contrary, cold infusion extracted higher level of healthy molecules with slow kinetic. The innovative method achieved in short time similar properties of cold infusion in terms of antioxidant power. As for bioactive compounds, such as gallic acid and epigallocatechin gallate, highest values, about double than in hot infusion, were recorded for green and black teas. This steeping method may represent an alternative approach for industrial beverage preparation. PMID:26604404

  11. Changes in fatty acid composition of Chlorella vulgaris by hypochlorous acid.

    PubMed

    Park, Ji-Yeon; Choi, Sun-A; Jeong, Min-Ji; Nam, Bora; Oh, You-Kwan; Lee, Jin-Suk

    2014-06-01

    Hypochlorous acid treatment of a microalga, Chlorella vulgaris, was investigated to improve the quality of microalgal lipid and to obtain high biodiesel-conversion yield. Because chlorophyll deactivates the catalyst for biodiesel conversion, its removal in the lipid-extraction step enhances biodiesel productivity. When microalgae contacted the hypochlorous acid, chlorophyll was removed, and resultant changes in fatty acid composition of microalgal lipid were observed. The lipid-extraction yield after activated clay treatment was 32.7 mg lipid/g cell; after NaClO treatment at 0.8% available chlorine concentration, it was 95.2 mg lipid/g cell; and after NaCl electrolysis treatment at the 1 g/L cell concentration, it was 102.4 mg lipid/g cell. While the contents of all of the unsaturated fatty acids except oleic acid, in the microalgal lipid, decreased as the result of NaClO treatment, the contents of all of the unsaturated fatty acids including oleic acid decreased as the result of NaCl electrolysis treatment. PMID:24785789

  12. Renewable resource-based green composites from recycled cellulose fiber and poly(3-hydroxybutyrate-co-3-hydroxyvalerate) bioplastic.

    PubMed

    Bhardwaj, Rahul; Mohanty, Amar K; Drzal, L T; Pourboghrat, F; Misra, M

    2006-06-01

    Novel "green" composites were successfully fabricated from recycled cellulose fibers (RCF) and a bacterial polyester, poly(3-hydroxybutyrate-co-3-hydroxyvalerate) (PHBV) by melt mixing technique. Various weight contents (15%, 30%, and 40%) of the fibers were incorporated in the PHBV matrix. The effect of the fiber weight contents on the thermal, mechanical, and dynamic-mechanical thermal properties of PHBV was investigated and a comparative property analysis was performed with RCF-reinforced polypropylene (PP) composites. The tensile and storage moduli of the PHBV-based composites were improved by 220% and 190%, respectively, by reinforcement with 40 wt % RCF. Halpin-Tsai and Tsai-Pagano's equations were applied for the theoretical modeling of the tensile modulus of PHBV-based composites. The heat deflection temperature (HDT) of the PHBV-based composites was increased from 105 to 131 degrees C, while the coefficient of linear thermal expansion (CLTE) value was reduced by 70% upon reinforcement with 40 wt % RCF. The PHBV-based composites had also shown better tensile and storage moduli and lower CLTE values than PP-based composites. Differential scanning calorimetry (DSC), thermogravimetric analysis (TGA), and scanning electron microscopy (SEM) were used to study the melting behavior, thermal stability, and morphology of the composite systems, respectively.

  13. Polylactide/Poly(ω-hydroxytetradecanoic acid) Reactive Blending: A Green Renewable Approach to Improving Polylactide Properties.

    PubMed

    Spinella, Stephen; Cai, Jiali; Samuel, Cedric; Zhu, Jianhui; McCallum, Scott A; Habibi, Youssef; Raquez, Jean-Marie; Dubois, Philippe; Gross, Richard A

    2015-06-01

    A green manufacturing technique, reactive extrusion (REx), was employed to improve the mechanical properties of polylactide (PLA). To achieve this goal, a fully biosourced PLA based polymer blend was conceived by incorporating small quantities of poly(ω-hydroxytetradecanoic acid) (PC14). PLA/PC14 blends were compatibilized by transesterification reactions promoted by 200 ppm titanium tetrabutoxide (Ti(OBu)4) during REx. REx for 15 min at 150 rpm and 200 °C resulted in enhanced blend mechanical properties while minimizing losses in PLA molecular weight. SEM analysis of the resulting compatibilized phase-separated blends showed good adhesion between dispersed PC14 phases within the continuous PLA phase. Direct evidence for in situ synthesis of PLA-b-PC14 copolymers was obtained by HMBC and HSQC NMR experiments. The size of the dispersed phase was tuned by the screw speed to "tailor" the blend morphology. In the presence of 200 ppm Ti(OBu)4, inclusion of only 5% PC14 increased the elongation at break of PLA from 3 to 140% with only a slight decrease in the tensile modulus (3200 to 2900 MPa). Furthermore, PLA's impact strength was increased by 2.4× that of neat PLA for 20% PC14 blends prepared by REx. Blends of PLA and PC14 are expected to expand the potential uses of PLA-based materials. PMID:25848833

  14. Copper-promoted cementation of antimony in hydrochloric acid system: A green protocol.

    PubMed

    Wu, Lian-Kui; Li, Ying-Ying; Cao, Hua-Zhen; Zheng, Guo-Qu

    2015-12-15

    A new method of recovering antimony in hydrochloric acid system by cementation with copper powder was proposed and carried out at laboratory scale. Thermodynamic analysis and cyclic voltammetry test were conducted to study the cementation process. This is a novel antimony removal technology and quite meets the requirements of green chemistry. The main cement product Cu2Sb is a promising anodic material for lithium and sodium ion battery. And nearly all consumed copper powder are transformed into CuCl which is an important industrial material. The effect of reaction temperature, stoichiometric ratio of Cu to Sb(III), stirring rate and concentration of HCl on the cementation efficiency of antimony were investigated in detail. Optimized cementation condition is obtained at 60 °C for 120 min and stirring rate of 600 rpm with Cu/Sb(III) stoichiometric ratio of 6 in 3 mol L(-1) HCl. At this time, nearly all antimony can be removed by copper powder and the cementation efficiency is over 99%. The structure and morphologies of the cement products were characterized by X-ray diffraction and scanning electron microscopy, respectively. Results show that the reaction temperature has little influence on the morphology of the cement products which consist of particles with various sizes. The activation energy of the cementation antimony on copper is 37.75 kJ mol(-1), indicating a chemically controlled step. Inductively coupled plasma mass spectrometry results show that no stibine generates during the cementation process.

  15. Effect of penicillic acid on biliary excretion of indocyanine green in the mouse and rat.

    PubMed

    Chan, P K; Hayes, A W

    1981-02-01

    Penicillic acid (PA), a mycotoxin, is hepatotoxic. A study was undertaken to investigate its effects on hepatobiliary excretory function, using the anionic compounds indocyanine green (ICG), in mice and rats. Pretreatment with a single dose of PA (90 mg/kg, ip, an LD50 dose in both species) resulted in depression of ICG excretion in both species. This depression was dose- and time-dependent. Decreases of 42 and 57% in biliary excretion of ICG were observed in rats and mice 48 and 72 h after PA pretreatment, respectively. Although bile flow was depressed significantly when expressed in terms of body weight, it was not altered in mice when expressed in terms of liver weight. Bile flow was not affected in rats. While the serum ICG concentration was increased after PA treatment in both species, the liver ICG concentration was not affected. The liver-to-serum, bile-to-serum, and bile-to-liver ICG concentration ratios decreased in PA-treated animals. These data suggest that the PA-induced hepatobiliary excretory dysfunction may result from depression of both uptake of ICG into the liver and bile canlicular transport of ICG.

  16. Fatty acid composition of seeds of some species of Nepeta L.

    PubMed

    Kiliç, Turgut; Dirmenci, Tuncay; Gören, Ahmet C

    2007-05-01

    The fatty acid compositions of Nepeta viscida, N. cilicica, N. crinita, N. nuda ssp. glandulifera and N. aristata were analyzed by GC/MS. The main free fatty acids were found as linolenic acid (49.8-58.5%), linoleic acid (10.9-23.5%), oleic acid (11.5-19.2%), palmitic acid (5.2-6.8%) and stearic acid (2.0-3.7%) and, total fatty acid compositions of species were analyzed and results were found as 36.2-49.8%, 17.1-25.8%, 15.4-25.8%, 6.4-7.8%, and 2.7-4.1%, respectively.

  17. Removal of Salmonella enterica Enteritidis and Escherichia coli from green peppers and melons by ultrasound and organic acids.

    PubMed

    José, Jackline Freitas Brilhante de São; de Medeiros, Hiasmyne Silva; Bernardes, Patrícia Campos; de Andrade, Nélio José

    2014-11-01

    The aim of this study was to evaluate the effectiveness of ultrasound treatment combined with organic acids in the decontamination step for green peppers and melons. The influence of the surface roughness of the peppers and melons on bacterial adhesion was evaluated, as measured using a profilometer. The adhesion of Salmonella enterica serovar Enteritidis and Escherichia coli to the green pepper and melon surfaces was also evaluated by measuring the hydrophobicity of the microorganisms and the surfaces. The bacteria that adhered to the surface of green peppers and melons was quantified by plate count and visualized by scanning electron microscopy. In addition, the efficiency of ultrasound and organic acids to remove bacteria from the pepper and melon surfaces was examined. The average roughness (Ra) of the green peppers (13.0±2.7 nm) was significantly different (p>0.05) from the melons (33.5±7.9 nm). Adherence of S. Enteritidis and E. coli are thermodynamically unfavorable for both surfaces studied (∆G(adhesion)>0). Despite these data, good adhesion occurred on both surfaces. The number of bacteria on green pepper slices was 7.3 and 7.0 log CFU/cm(2) for E. coli and S. enterica Enteritidis, respectively. For melon surfaces, the number of bacteria was 7.0 and 6.9 log CFU/cm(2) for E. coli and S. Enteritidis, respectively. The greater adherence of both bacteria on the green peppers can be explained by its hydrophobic surface; the hydrophilic surfaces of melons resulted in lower adherence. These results suggest that the adhesion observed in this experiment is a multifactorial process. Among the treatments evaluated for green peppers, a higher removal of pathogens was observed after use of a combination of ultrasound and 1% lactic acid; this treatment reduced E. coli and Salmonella by 2.9 and 2.8 log CFU/cm(2), respectively. For melons, the combination of ultrasound and lactic acid showed a reduction of 2.5 and 3.1 log CFU/cm(2) for E. coli and S. Enteritidis

  18. Effects of feeding bile acids and a bile acid sequestrant on hepatic bile acid composition in mice.

    PubMed

    Zhang, Youcai; Klaassen, Curtis D

    2010-11-01

    An improved ultra performance liquid chromatography-tandem mass spectrometry (UPLC/MS/MS) method was established for the simultaneous analysis of various bile acids (BA) and applied to investigate liver BA content in C57BL/6 mice fed 1% cholic acid (CA), 0.3% deoxycholic acid (DCA), 0.3% chenodeoxycholic acid (CDCA), 0.3% lithocholic acid (LCA), 3% ursodeoxycholic acid (UDCA), or 2% cholestyramine (resin). Results indicate that mice have a remarkable ability to maintain liver BA concentrations. The BA profiles in mouse livers were similar between CA and DCA feedings, as well as between CDCA and LCA feedings. The mRNA expression of Cytochrome P450 7a1 (Cyp7a1) was suppressed by all BA feedings, whereas Cyp7b1 was suppressed only by CA and UDCA feedings. Gender differences in liver BA composition were observed after feeding CA, DCA, CDCA, and LCA, but they were not prominent after feeding UDCA. Sulfation of CA and CDCA was found at the 7-OH position, and it was increased by feeding CA or CDCA more in male than female mice. In contrast, sulfation of LCA and taurolithocholic acid (TLCA) was female-predominant, and it was increased by feeding UDCA and LCA. In summary, the present systematic study on BA metabolism in mice will aid in interpreting BA-mediated gene regulation and hepatotoxicity.

  19. Chemical Composition and Biological Activity of Extracts Obtained by Supercritical Extraction and Ethanolic Extraction of Brown, Green and Red Propolis Derived from Different Geographic Regions in Brazil.

    PubMed

    Machado, Bruna Aparecida Souza; Silva, Rejane Pina Dantas; Barreto, Gabriele de Abreu; Costa, Samantha Serra; Silva, Danielle Figuerêdo da; Brandão, Hugo Neves; Rocha, José Luiz Carneiro da; Dellagostin, Odir Antônio; Henriques, João Antônio Pegas; Umsza-Guez, Marcelo Andres; Padilha, Francine Ferreira

    2016-01-01

    The variations in the chemical composition, and consequently, on the biological activity of the propolis, are associated with its type and geographic origin. Considering this fact, this study evaluated propolis extracts obtained by supercritical extraction (SCO2) and ethanolic extraction (EtOH), in eight samples of different types of propolis (red, green and brown), collected from different regions in Brazil. The content of phenolic compounds, flavonoids, in vitro antioxidant activity (DPPH and ABTS), Artepillin C, p-coumaric acid and antimicrobial activity against two bacteria were determined for all extracts. For the EtOH extracts, the anti-proliferative activity regarding the cell lines of B16F10, were also evaluated. Amongst the samples evaluated, the red propolis from the Brazilian Northeast (states of Sergipe and Alagoas) showed the higher biological potential, as well as the larger content of antioxidant compounds. The best results were shown for the extracts obtained through the conventional extraction method (EtOH). However, the highest concentrations of Artepillin C and p-coumaric acid were identified in the extracts from SCO2, indicating a higher selectivity for the extraction of these compounds. It was verified that the composition and biological activity of the Brazilian propolis vary significantly, depending on the type of sample and geographical area of collection.

  20. Chemical Composition and Biological Activity of Extracts Obtained by Supercritical Extraction and Ethanolic Extraction of Brown, Green and Red Propolis Derived from Different Geographic Regions in Brazil

    PubMed Central

    Machado, Bruna Aparecida Souza; Silva, Rejane Pina Dantas; Barreto, Gabriele de Abreu; Costa, Samantha Serra; da Silva, Danielle Figuerêdo; Brandão, Hugo Neves; da Rocha, José Luiz Carneiro; Dellagostin, Odir Antônio; Henriques, João Antônio Pegas; Umsza-Guez, Marcelo Andres; Padilha, Francine Ferreira

    2016-01-01

    The variations in the chemical composition, and consequently, on the biological activity of the propolis, are associated with its type and geographic origin. Considering this fact, this study evaluated propolis extracts obtained by supercritical extraction (SCO2) and ethanolic extraction (EtOH), in eight samples of different types of propolis (red, green and brown), collected from different regions in Brazil. The content of phenolic compounds, flavonoids, in vitro antioxidant activity (DPPH and ABTS), Artepillin C, p-coumaric acid and antimicrobial activity against two bacteria were determined for all extracts. For the EtOH extracts, the anti-proliferative activity regarding the cell lines of B16F10, were also evaluated. Amongst the samples evaluated, the red propolis from the Brazilian Northeast (states of Sergipe and Alagoas) showed the higher biological potential, as well as the larger content of antioxidant compounds. The best results were shown for the extracts obtained through the conventional extraction method (EtOH). However, the highest concentrations of Artepillin C and p-coumaric acid were identified in the extracts from SCO2, indicating a higher selectivity for the extraction of these compounds. It was verified that the composition and biological activity of the Brazilian propolis vary significantly, depending on the type of sample and geographical area of collection. PMID:26745799

  1. Comparison of high performance TLC and HPLC for separation and quantification of chlorogenic acid in green coffee bean extracts.

    PubMed

    Urakova, Irina N; Pozharitskaya, Olga N; Shikov, Alexander N; Kosman, Vera M; Makarov, Valery G

    2008-02-01

    Two chromatographic methods, high-performance TLC (HPTLC) and HPLC, were developed and used for separation and quantitative determination of chlorogenic acid in green coffee bean extracts. For HPTLC silica gel Kieselgel 60 F 254 plates with ethyl acetate/dichlormethane/formic acid/acetic acid/water (100:25:10:10:11, v/v/v/v/v) as mobile phase were used. Densitometric determination of chlorogenic acid by HPTLC was performed at 330 nm. A gradient RP HPLC method was carried out at 330 nm. All necessary validation tests for both methods were developed for their comparison. There were no statistically significant differences between HPLC and HPTLC for quantitative determination of chlorogenic acid according to the test of equality of the means.

  2. Fermented green tea extract alleviates obesity and related complications and alters gut microbiota composition in diet-induced obese mice.

    PubMed

    Seo, Dae-Bang; Jeong, Hyun Woo; Cho, Donghyun; Lee, Bum Jin; Lee, Ji Hae; Choi, Jae Young; Bae, Il-Hong; Lee, Sung-Joon

    2015-05-01

    Obesity is caused by an imbalance between caloric intake and energy expenditure and accumulation of excess lipids in adipose tissues. Recent studies have demonstrated that green tea and its processed products (e.g., oolong and black tea) are introduced to exert beneficial effects on lipid metabolism. Here, we propose that fermented green tea (FGT) extract, as a novel processed green tea, exhibits antiobesity effects. FGT reduced body weight gain and fat mass without modifying food intake. mRNA expression levels of lipogenic and inflammatory genes were downregulated in white adipose tissue of FGT-administered mice. FGT treatment alleviated glucose intolerance and fatty liver symptoms, common complications of obesity. Notably, FGT restored the changes in gut microbiota composition (e.g., the Firmicutes/Bacteroidetes and Bacteroides/Prevotella ratios), which is reported to be closely related with the development of obesity and insulin resistance, induced by high-fat diets. Collectively, FGT improves obesity and its associated symptoms and modulates composition of gut microbiota; thus, it could be used as a novel dietary component to control obesity and related symptoms.

  3. Comparison of bamboo green, timber and yellow in sulfite, sulfuric acid and sodium hydroxide pretreatments for enzymatic saccharification.

    PubMed

    Li, Zhiqiang; Jiang, Zehui; Fei, Benhua; Cai, Zhiyong; Pan, Xuejun

    2014-01-01

    The response and behavior of bamboo green, timber, and yellow of moso bamboo (Phyllostachys heterocycla) to three pretreatments, sulfite (SPORL), dilute acid (DA), and alkali (NaOH), were investigated and compared with varied chemical loadings at 180°C for 30 min with a 6.25:1 (v/w) liquor-to-bamboo ratio. All the pretreatments improved the enzymatic digestibility of bamboo substrates. Under the investigated conditions, the DA pretreatment achieved better enzymatic digestibility, but had lower sugar recovery yield, and formed more fermentation inhibitors. The results suggested that the SPORL pretreatment be able to generate more readily digestible bamboo substrate with higher sugar yield and fewer fermentation inhibitors than the corresponding DA pretreatment if hemicelluloses are sufficiently removed by adding more acid to bring down the pretreatment pH. Bamboo timber had higher sugar content and better enzymatic digestibility and therefore was a better feedstock for bioconversion than bamboo green and yellow.

  4. Chemical characteristics, fatty acid composition and conjugated linoleic acid (CLA) content of traditional Greek yogurts.

    PubMed

    Serafeimidou, Amalia; Zlatanos, Spiros; Laskaridis, Kostas; Sagredos, Angelos

    2012-10-15

    Many studies with conjugated linoleic acid (CLA) indicate that it has a protective effect against mammary cancer. Because dairy products are the most important dietary sources of CLA, we have investigated the CLA concentrations and additionally the fatty acid profiles and chemical composition of several commercial, traditional, Greek yogurts from different geographical origin. The fat content of yogurts was in the order of goatacids (SFA) were found in low-fat yogurts, of monounsaturated fatty acids (MUFA) in sheep milk yogurts and of polyunsaturated fatty acid (PUFA) in low-fat cow milk yogurts. PMID:23442628

  5. Chemical characteristics, fatty acid composition and conjugated linoleic acid (CLA) content of traditional Greek yogurts.

    PubMed

    Serafeimidou, Amalia; Zlatanos, Spiros; Laskaridis, Kostas; Sagredos, Angelos

    2012-10-15

    Many studies with conjugated linoleic acid (CLA) indicate that it has a protective effect against mammary cancer. Because dairy products are the most important dietary sources of CLA, we have investigated the CLA concentrations and additionally the fatty acid profiles and chemical composition of several commercial, traditional, Greek yogurts from different geographical origin. The fat content of yogurts was in the order of goatacids (SFA) were found in low-fat yogurts, of monounsaturated fatty acids (MUFA) in sheep milk yogurts and of polyunsaturated fatty acid (PUFA) in low-fat cow milk yogurts.

  6. Supramolecular structure of 5-aminosalycilic acid/halloysite composites.

    PubMed

    Viseras, Maria-Teresa; Aguzzi, Carola; Cerezo, Pilar; Cultrone, Giuseppe; Viseras, Cesar

    2009-05-01

    This paper assesses the supramolecular structure of nanocomposites prepared by including the anti-inflammatory drug 5-aminosalycilic acid in halloysite nanotubes. Halloysite tubes have sub-micron individual lengths with outer diameters ∼0.1 µm, as observed by FESEM. The mercury intrusion plots showed bimodal profiles with pore dimensions ∼10 and 0.06 µm. X-ray diffraction and thermogravimetric results revealed changes in the hydration form of the clay after the interaction. The groups associated to the interaction were studied by FTIR. The location of the drug in the composites was determined after uranium staining of its amino groups by X-EDS microanalysis coupled with HREM. The drug was located both inside and on the surface of the halloysite nanotubes. These results confirm the occurrence of two concomitant interaction mechanisms: rapid adsorption of 5-ASA at the external halloysite surface followed by slow adsorption of the drug inside the tubes.

  7. Adansonian Analysis and Deoxyribonucleic Acid Base Composition of Serratia marcescens

    PubMed Central

    Colwell, R. R.; Mandel, M.

    1965-01-01

    Colwell, R. R. (Georgetown University, Washington, D.C.), and M. Mandel. Adansonian analysis and deoxyribonucleic acid base composition of Serratia marcescens. J. Bacteriol. 89:454–461. 1965.—A total of 33 strains of Serratia marcescens were subjected to Adansonian analysis for which more than 200 coded features for each of the organisms were included. In addition, the base composition [expressed as moles per cent guanine + cytosine (G + C)] of the deoxyribonucleic acid (DNA) prepared from each of the strains was determined. Except for four strains which were intermediate between Serratia and the Hafnia and Aerobacter group C of Edwards and Ewing, the S. marcescens species group proved to be extremely homogeneous, and the different strains showed high affinities for each other (mean similarity, ¯S = 77%). The G + C ratio of the DNA from the Serratia strains ranged from 56.2 to 58.4% G + C. Many species names have been listed for the genus, but only a single clustering of the strains was obtained at the species level, for which the species name S. marcescens was retained. S. kiliensis, S. indica, S. plymuthica, and S. marinorubra could not be distinguished from S. marcescens; it was concluded, therefore, that there is only a single species in the genus. The variety designation kiliensis does not appear to be valid, since no subspecies clustering of strains with negative Voges-Proskauer reactions could be detected. The characteristics of the species are listed, and a description of S. marcescens is presented. PMID:14255714

  8. Mineral composition of two populations of leaves - green and iron chlorotic - of the same age all from the same tree

    SciTech Connect

    Procopiou, J.; Wallace, A.

    1981-01-01

    Since carefully washed Fe chlorotic leaves often contain more total Fe on the dry weight basis than do green leaves, a population of leaves of the same age representing chlorotic leaves from each of two lemon trees and green leaves also of the same age and from the same two trees were analyzed individually for mineral elements to determine, especially, the frequency distribution of Fe in the various groups of leaves (n = 47, 48, 71, 48). The chlorotic leaves from one tree had mineral composition typical of lime-induced chlorosis. The chlorotic leaves for this tree were, on the average, higher in P, K, and Fe and lower in Ca than the green leaves. For the other tree the chlorotic leaves appeared to be truly Fe deficient; P was not higher in these leaves but the mean K and Ca showed the same pattern as in the first tree. Zinc was higher in the deficient leaves than in the green ones on this tree which can be expected for true Fe deficiency. Mean zinc levels were below the critical levels. Mean manganese was below the critical level for all groups. The coefficient of variation for each element in each group was usually around 30%. Maximum-minimum data indicated that many individual leaves did not fit the patterns just described. Correlation coefficients indicated that most major patterns were consistent in spite of the variability, although there were some differences. The frequency distribution for each of most elements was much like a normal curve with usually a three-fold range for each of the elements. Many of the Fe-deficient leaves had more Fe than some of the green leaves. Analysis of an individual leaf, therefore, cannot result in accurate description of lime-induced chlorosis.

  9. Influences of acidic reaction and hydrolytic conditions on monosaccharide composition analysis of acidic, neutral and basic polysaccharides.

    PubMed

    Wang, Qing-Chi; Zhao, Xia; Pu, Jiang-Hua; Luan, Xiao-Hong

    2016-06-01

    Monosaccharide composition analysis is important for structural characterization of polysaccharides. To investigate the influences of acidic reaction and hydrolytic conditions on monosaccharide composition analysis of polysaccharides, we chose alginate, starch, chitosan and chondroitin sulfate as representative of acidic, neutral, basic and complex polysaccharides to compare the release degree of monosaccharides under different hydrolytic conditions. The hydrolysis stability of 10 monosaccharide standards was also explored. Results showed that the basic sugars were hard to release but stable, the acidic sugars (uronic acids) were easy to release but unstable, and the release and stability of neutral sugars were in between acidic and basic sugars. In addition, the hydrolysis process was applied to monosaccharide composition analysis of Hippocampus trimaculatus polysaccharide and the appropriate hydrolytic condition was accorded with that of the above four polysaccharides. Thus, different hydrolytic conditions should be used for the monosaccharide composition analysis of polysaccharides based on their structural characteristics. PMID:27083372

  10. Electrophoretic deposition of tannic acid-polypyrrolidone films and composites.

    PubMed

    Luo, Dan; Zhang, Tianshi; Zhitomirsky, Igor

    2016-05-01

    Thin films of polyvinylpyrrolidone (PVP)-tannic acid (TA) complexes were prepared by a conceptually new strategy, based on electrophoretic deposition (EPD). Proof of concept investigations involved the analysis of the deposition yield, FTIR and UV-vis spectroscopy of the deposited material, and electron microscopy studies. The analysis of the deposition mechanism indicated that the limitations of the EPD in the deposition of small phenolic molecules, such as TA, and electrically neutral polymers, similar to PVP, containing hydrogen-accepting carbonyl groups, can be avoided. The remarkable adsorption properties of TA and film forming properties of the PVP-TA complexes allowed for the EPD of materials of different types, such as huntite mineral platelets and hydrotalcite clay particles, TiO2 and MnO2 oxide nanoparticles, multiwalled carbon nanotubes, TiN and Pd nanoparticles. Moreover, PVP-TA complexes were used for the co-deposition of different materials and formation of composite films. In another approach, TA was used as a capping agent for the hydrothermal synthesis of ZnO nanorods, which were then deposited by EPD using PVP-TA complexes. The fundamental adsorption and interaction mechanisms of TA involved chelation of metal atoms on particle surfaces with galloyl groups, π-π interactions and hydrogen bonding. The films prepared by EPD can be used for various applications, utilizing functional properties of TA, PVP, inorganic and organic materials of different types and their composites.

  11. Electrophoretic deposition of tannic acid-polypyrrolidone films and composites.

    PubMed

    Luo, Dan; Zhang, Tianshi; Zhitomirsky, Igor

    2016-05-01

    Thin films of polyvinylpyrrolidone (PVP)-tannic acid (TA) complexes were prepared by a conceptually new strategy, based on electrophoretic deposition (EPD). Proof of concept investigations involved the analysis of the deposition yield, FTIR and UV-vis spectroscopy of the deposited material, and electron microscopy studies. The analysis of the deposition mechanism indicated that the limitations of the EPD in the deposition of small phenolic molecules, such as TA, and electrically neutral polymers, similar to PVP, containing hydrogen-accepting carbonyl groups, can be avoided. The remarkable adsorption properties of TA and film forming properties of the PVP-TA complexes allowed for the EPD of materials of different types, such as huntite mineral platelets and hydrotalcite clay particles, TiO2 and MnO2 oxide nanoparticles, multiwalled carbon nanotubes, TiN and Pd nanoparticles. Moreover, PVP-TA complexes were used for the co-deposition of different materials and formation of composite films. In another approach, TA was used as a capping agent for the hydrothermal synthesis of ZnO nanorods, which were then deposited by EPD using PVP-TA complexes. The fundamental adsorption and interaction mechanisms of TA involved chelation of metal atoms on particle surfaces with galloyl groups, π-π interactions and hydrogen bonding. The films prepared by EPD can be used for various applications, utilizing functional properties of TA, PVP, inorganic and organic materials of different types and their composites. PMID:26878711

  12. Effect of Gallic acid on mechanical and water barrier properties of zein-oleic acid composite films.

    PubMed

    Masamba, Kingsley; Li, Yue; Hategekimana, Joseph; Liu, Fei; Ma, Jianguo; Zhong, Fang

    2016-05-01

    In this study, the effect of gallic acid on mechanical and water barrier properties of zein-oleic acid 0-4 % composite films was investigated. Molecular weight distribution analysis was carried out to confirm gallic acid induced cross linking through change in molecular weight in fraction containing zein proteins. Results revealed that gallic acid treatment increased tensile strength from 17.9 MPa to 26.0 MPa, decreased water vapour permeability from 0.60 (g mm m(-2) h(-1) kPa(-1)) to 0.41 (g mm m(-2) h(-1) kPa(-1)), increased solubility from 6.3 % to 10.2 % and marginally increased elongation at break from 3.7 % to 4.2 % in zein films only. However, gallic acid treatment in zein-oleic composite films did not significantly influence mechanical and water barrier properties and in most instances irrespective of oleic acid concentration, the properties were negatively affected. Results from scanning electron microscopy showed that both gallic acid treated and untreated zein films and composite films containing 3 % oleic acid had a compact and homogeneous structure while those containing 4 % oleic acid had inhomogeneous structure. The findings have demonstrated that gallic acid treatment can significantly improve mechanical and water barrier properties especially in zein films only as opposed to when used in composite films using zein and oleic acid. PMID:27407188

  13. Effect of Gallic acid on mechanical and water barrier properties of zein-oleic acid composite films.

    PubMed

    Masamba, Kingsley; Li, Yue; Hategekimana, Joseph; Liu, Fei; Ma, Jianguo; Zhong, Fang

    2016-05-01

    In this study, the effect of gallic acid on mechanical and water barrier properties of zein-oleic acid 0-4 % composite films was investigated. Molecular weight distribution analysis was carried out to confirm gallic acid induced cross linking through change in molecular weight in fraction containing zein proteins. Results revealed that gallic acid treatment increased tensile strength from 17.9 MPa to 26.0 MPa, decreased water vapour permeability from 0.60 (g mm m(-2) h(-1) kPa(-1)) to 0.41 (g mm m(-2) h(-1) kPa(-1)), increased solubility from 6.3 % to 10.2 % and marginally increased elongation at break from 3.7 % to 4.2 % in zein films only. However, gallic acid treatment in zein-oleic composite films did not significantly influence mechanical and water barrier properties and in most instances irrespective of oleic acid concentration, the properties were negatively affected. Results from scanning electron microscopy showed that both gallic acid treated and untreated zein films and composite films containing 3 % oleic acid had a compact and homogeneous structure while those containing 4 % oleic acid had inhomogeneous structure. The findings have demonstrated that gallic acid treatment can significantly improve mechanical and water barrier properties especially in zein films only as opposed to when used in composite films using zein and oleic acid.

  14. Highly sensitive fluorescence quantitative detection of specific DNA sequences with molecular beacons and nucleic acid dye SYBR Green I.

    PubMed

    Xiang, Dongshan; Zhai, Kun; Xiang, Wenjun; Wang, Lianzhi

    2014-11-01

    A highly sensitive fluorescence method of quantitative detection for specific DNA sequence is developed based on molecular beacon (MB) and nucleic acid dye SYBR Green I by synchronous fluorescence analysis. It is demonstrated by an oligonucleotide sequence of wild-type HBV (target DNA) as a model system. In this strategy, the fluorophore of MB is designed to be 6-carboxyfluorescein group (FAM), and the maximum excitation wavelength and maximum emission wavelength are both very close to that of SYBR Green I. In the presence of targets DNA, the MBs hybridize with the targets DNA and form double-strand DNA (dsDNA), the fluorophore FAM is separated from the quencher BHQ-1, thus the fluorophore emit fluorescence. At the same time, SYBR Green I binds to dsDNA, the fluorescence intensity of SYBR Green I is significantly enhanced. When targets DNA are detected by synchronous fluorescence analysis, the fluorescence peaks of FAM and SYBR Green I overlap completely, so the fluorescence signal of system will be significantly enhanced. Thus, highly sensitive fluorescence quantitative detection for DNA can be realized. Under the optimum conditions, the total fluorescence intensity of FAM and SYBR Green I exhibits good linear dependence on concentration of targets DNA in the range from 2×10(-11) to 2.5×10(-9)M. The detection limit of target DNA is estimated to be 9×10(-12)M (3σ). Compared with previously reported methods of detection DNA with MB, the proposed method can significantly enhance the detection sensitivity.

  15. Nanotubes-Embedded Indocyanine Green-Hyaluronic Acid Nanoparticles for Photoacoustic-Imaging-Guided Phototherapy.

    PubMed

    Wang, Guohao; Zhang, Fan; Tian, Rui; Zhang, Liwen; Fu, Guifeng; Yang, Lily; Zhu, Lei

    2016-03-01

    Phototherapy is a light-triggered treatment for tumor ablation and growth inhibition via photodynamic therapy (PDT) and photothermal therapy (PTT). Despite extensive studies in this area, a major challenge is the lack of selective and effective phototherapy agents that can specifically accumulate in tumors to reach a therapeutic concentration. Although recent attempts have produced photosensitizers complexed with photothermal nanomaterials, the tedious preparation steps and poor tumor efficiency of therapy still hampers the broad utilization of these nanocarriers. Herein, we developed a CD44 targeted photoacoustic (PA) nanophototherapy agent by conjugating Indocyanine Green (ICG) to hyaluronic acid nanoparticles (HANPs) encapsulated with single-walled carbon nanotubes (SWCNTs), resulting in a theranostic nanocomplex of ICG-HANP/SWCNTs (IHANPT). We fully characterized its physical features as well as PA imaging and photothermal and photodynamic therapy properties in vitro and in vivo. Systemic delivery of IHANPT theranostic nanoparticles led to the accumulation of the targeted nanoparticles in tumors in a human cancer xenograft model in nude mice. PA imaging confirmed targeted delivery of the IHANPT nanoparticles into tumors (T/M ratio = 5.19 ± 0.3). The effect of phototherapy was demonstrated by low-power laser irradiation (808 nm, 0.8 W/cm(2)) to induce efficient photodynamic effect from ICG dye. The photothermal effect from the ICG and SWCNTs rapidly raised the tumor temperature to 55.4 ± 1.8 °C. As the result, significant tumor growth inhibition and marked induction of tumor cell death and necrosis were observed in the tumors in the tumors. There were no apparent systemic and local toxic effects found in the mice. The dynamic thermal stability of IHANPT was studied to ensure that PTT does not affect ICG-dependent PDT in phototherapy. Therefore, our results highlight imaging property and therapeutic effect of the novel IHANPT theranostic nanoparticle for CD44

  16. Chemical modification of jute fibers for the production of green-composites.

    PubMed

    Corrales, F; Vilaseca, F; Llop, M; Gironès, J; Méndez, J A; Mutjè, P

    2007-06-18

    Natural fiber reinforced composites is an emerging area in polymer science. Fibers derived from annual plants are considered a potential substitute for non-renewable synthetic fibers like glass and carbon fibers. The hydrophilic nature of natural fibers affects negatively its adhesion to hydrophobic polymeric matrices. To improve the compatibility between both components a surface modification has been proposed. The aim of the study is the chemical modification of jute fibers using a fatty acid derivate (oleoyl chloride) to confer hydrophobicity and resistance to biofibers. This reaction was applied in swelling and non-swelling solvents, pyridine and dichloromethane, respectively. The formation of ester groups, resulting from the reaction of oleoyl chloride with hydroxyl group of cellulose were studied by elemental analysis (EA) and Fourier Transform infrared spectroscopy (FTIR). The characterization methods applied has proved the chemical interaction between the cellulosic material and the coupling agent. The extent of the reactions evaluated by elemental analysis was calculated using two ratios. Finally electron microscopy was applied to evaluate the surface changes of cellulose fibers after modification process.

  17. Improving fatty acid composition in peanuts (Arachis hypogaea) by SNP genotyping and traditional breeding.

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Fatty acid composition is an important seed quality trait in cultivated peanuts (Arachis hypogaea L.). Monounsaturated fats, such as oleic acid (C18:1), an omega-9 fatty acid, has been shown to have beneficial effects on human health. In addition, peanuts bred to produce high levels of oleic acid ...

  18. Morphology and Composition of Structured, Phase-Separated Behenic Acid-Perfluorotetradecanoic Acid Monolayer Films.

    PubMed

    Rehman, Jeveria; Araghi, Hessamaddin Younesi; He, Anqiang; Paige, Matthew F

    2016-05-31

    The phase separation of immiscible surfactants in mixed monolayer films provides an approach to physically manipulate important properties of thin films, including surface morphology, microscale composition, and mechanical properties. In this work, we predict, based upon existing miscibility studies and their thermodynamic underpinnings described in the literature, the miscibility and film morphology of mixed monolayers comprised of behenic acid (C21H43COOH) and perfluorotetradecanoic acid (C13F27COOH) in various molar ratios. Predictions are tested using a combination of experimental surface characterization methods for probing miscibility and film morphology at the solid/air and air/water interfaces. Film components were immiscible and phase-separated into chemically well-defined domains under a variety of experimental conditions, with monolayer morphology consistent with initial predictions. The extensibility of these basic predictions to other systems is discussed in the context of using these works for different perfluorinated surfactant molecules. PMID:27163482

  19. Essential fatty acid intake and serum fatty acid composition among adolescent girls in central Mozambique.

    PubMed

    Freese, Riitta; Korkalo, Liisa; Vessby, Bengt; Tengblad, Siv; Vaara, Elina M; Hauta-alus, Helena; Selvester, Kerry; Mutanen, Marja

    2015-04-14

    Many African diets are low in fat but are currently changing because of nutrition transition. We studied fat and fatty acid (FA) intake and the essential fatty acid (EFA) status of adolescent girls (aged 14-19 years, n 262) in Zambezia Province, central Mozambique. A cross-sectional study was carried out in a city as well as in the towns and rural villages of a coastal and an inland district. Dietary intake and FA sources were studied in a 24 h dietary recall. FA compositions of cholesteryl esters and phospholipids of non-fasting serum samples were analysed by GLC. Fat intake was low (13-18 % of energy) in all areas. Coconut and palm oil were the main sources of fat, and soyabean oil and maize were the main sources of PUFA. Compared to Food and Agriculture Organization/WHO 2010 recommendations, intake of linoleic acid (LA, 18 : 2n-6) was inadequate in the coastal district, and intakes of n-3 PUFA were inadequate in all areas. FA compositions of serum lipids differed between areas. The proportions of LA tended to be highest in the city and lowest in the rural areas. The phospholipid mead (20 : 3n-9):arachidonic acid (20 : 4n-6) ratio did not indicate EFA insufficiency. LA proportions in phospholipids were low, but those of long-chain n-6 and n-3 PUFA were high in comparison with Western adolescents. To conclude, fat sources, FA intake and EFA status differed between adolescent girls living in different types of communities. Fat intake was low, but EFA insufficiency was not indicated.

  20. Essential fatty acid intake and serum fatty acid composition among adolescent girls in central Mozambique.

    PubMed

    Freese, Riitta; Korkalo, Liisa; Vessby, Bengt; Tengblad, Siv; Vaara, Elina M; Hauta-alus, Helena; Selvester, Kerry; Mutanen, Marja

    2015-04-14

    Many African diets are low in fat but are currently changing because of nutrition transition. We studied fat and fatty acid (FA) intake and the essential fatty acid (EFA) status of adolescent girls (aged 14-19 years, n 262) in Zambezia Province, central Mozambique. A cross-sectional study was carried out in a city as well as in the towns and rural villages of a coastal and an inland district. Dietary intake and FA sources were studied in a 24 h dietary recall. FA compositions of cholesteryl esters and phospholipids of non-fasting serum samples were analysed by GLC. Fat intake was low (13-18 % of energy) in all areas. Coconut and palm oil were the main sources of fat, and soyabean oil and maize were the main sources of PUFA. Compared to Food and Agriculture Organization/WHO 2010 recommendations, intake of linoleic acid (LA, 18 : 2n-6) was inadequate in the coastal district, and intakes of n-3 PUFA were inadequate in all areas. FA compositions of serum lipids differed between areas. The proportions of LA tended to be highest in the city and lowest in the rural areas. The phospholipid mead (20 : 3n-9):arachidonic acid (20 : 4n-6) ratio did not indicate EFA insufficiency. LA proportions in phospholipids were low, but those of long-chain n-6 and n-3 PUFA were high in comparison with Western adolescents. To conclude, fat sources, FA intake and EFA status differed between adolescent girls living in different types of communities. Fat intake was low, but EFA insufficiency was not indicated. PMID:25772191

  1. Carbohydrate, Organic Acid, and Amino Acid Composition of Bacteroids and Cytosol from Soybean Nodules 1

    PubMed Central

    Streeter, John G.

    1987-01-01

    Metabolites in Bradyrhizobium japonicum bacteroids and in Glycine max (L.) Merr. cytosol from root nodules were analyzed using an isolation technique which makes it possible to estimate and correct for changes in concentration which may occur during bacteroid isolation. Bacteroid and cytosol extracts were fractionated on ion-exchange columns and were analyzed for carbohydrate composition using gas-liquid chromatography and for organic acid and amino acid composition using high performance liquid chromatography. Analysis of organic acids in plant tissues as the phenacyl derivatives is reported for the first time and this approach revealed the presence of several unknown organic acids in nodules. The time required for separation of bacteroids and cytosol was varied, and significant change in concentration of individual compounds during the separation of the two fractions was estimated by calculating the regression of concentration on time. When a statistically significant slope was found, the true concentration was estimated by extrapolating the regression line to time zero. Of 78 concentration estimates made, there was a statistically significant (5% level) change in concentration during sample preparation for only five metabolites: glucose, sucrose, and succinate in the cytosol and d-pinitol and serine in bacteroids. On a mass basis, the major compounds in bacteroids were (descending order of concentration): myo-inositol, d-chiro-inositol, α,α-trehalose, sucrose, aspartate, glutamate, d-pinitol, arginine, malonate, and glucose. On a proportional basis (concentration in bacteroid as percent of concentration in bacteroid + cytosol fractions), the major compounds were: α-aminoadipate (94), trehalose (66), lysine (58), and arginine (46). The results indicate that metabolite concentrations in bacteroids can be reliably determined. PMID:16665774

  2. Continuous microcellular foaming of polylactic acid/natural fiber composites

    NASA Astrophysics Data System (ADS)

    Diaz-Acosta, Carlos A.

    Poly(lactic acid) (PLA), a biodegradable thermoplastic derived from renewable resources, stands out as a substitute to petroleum-based plastics. In spite of its excellent properties, commercial applications are limited because PLA is more expensive and more brittle than traditional petroleum-based resins. PLA can be blended with cellulosic fibers to reduce material cost. However, the lowered cost comes at the expense of flexibility and impact strength, which can be enhanced through the production of microcellular structures in the composite. Microcellular foaming uses inert gases (e.g., carbon dioxide) as physical blowing agents to make cellular structures with bubble sizes of less than 10 microm and cell-population densities (number of bubbles per unit volume) greater than 109 cells/cm³. These unique characteristics result in a significant increase in toughness and elongation at break (ductility) compared with unfoamed parts because the presence of small bubbles can blunt the crack-tips increasing the energy needed to propagate the crack. Microcellular foams have been produced through a two step batch process. First, large amounts of gas are dissolved in the solid plastic under high pressure (sorption process) to form a single-phase solution. Second, a thermodynamic instability (sudden drop in solubility) triggers cell nucleation and growth as the gas diffuses out of the plastic. Batch production of microcellular PLA has addressed some of the drawbacks of PLA. Unfortunately, the batch foaming process is not likely to be implemented in the industrial production of foams because it is not cost-effective. This study investigated the continuous microcellular foaming process of PLA and PLA/wood-fiber composites. The effects of the processing temperature and material compositions on the melt viscosity, pressure drop rate, and cell-population density were examined in order to understand the nucleation mechanisms in neat and filled PLA foams. The results indicated that

  3. Threonine 286 of fatty acid desaturase 7 is essential for ω-3 fatty acid desaturation in the green microalga Chlamydomonas reinhardtii.

    PubMed

    Lim, Jong-Min; Vikramathithan, Jayaraman; Hwangbo, Kwon; Ahn, Joon-Woo; Park, Youn-Il; Choi, Dong-Woog; Jeong, Won-Joong

    2015-01-01

    Omega-3 fatty acid desaturases catalyze the conversion of dienoic fatty acids (C18:2 and C16:2) into trienoic fatty acids (C18:3 and C16:3), accounting for more than 50% of the total fatty acids in higher plants and the green microalga Chlamydomonas reinhardtii. Here, we describe a Thr residue located in the fourth transmembrane domain of fatty acid desaturase 7 (FAD7) that is essential for the biosynthesis of ω-3 fatty acids in C. reinhardtii. The ω-3 fatty acid deficiency in strain CC-620, which contains a putative missense mutation at Thr286 of CrFAD7, was recovered by the overexpression of CC-125 CrFAD7. A Ser substitution in position 286 was able to partially complement the phenotype of the ω-3 fatty acid deficiency, but other substitution variants, such as Tyr, His, Cys, and Gly, failed to do so. Prediction of the phosphorylation target site revealed that Thr286 may be phosphorylated. Analysis of the structural conformation of CC-620 CrFAD7 via topology prediction (and bends in the helix) shows that this missense mutation may collapse the catalytic structure of CrFAD7. Taken together, this study suggests that Thr286 is essential for the maintaining the catalytic structure of CrFAD7.

  4. Threonine 286 of fatty acid desaturase 7 is essential for ω-3 fatty acid desaturation in the green microalga Chlamydomonas reinhardtii

    PubMed Central

    Lim, Jong-Min; Vikramathithan, Jayaraman; Hwangbo, Kwon; Ahn, Joon-Woo; Park, Youn-Il; Choi, Dong-Woog; Jeong, Won-Joong

    2015-01-01

    Omega-3 fatty acid desaturases catalyze the conversion of dienoic fatty acids (C18:2 and C16:2) into trienoic fatty acids (C18:3 and C16:3), accounting for more than 50% of the total fatty acids in higher plants and the green microalga Chlamydomonas reinhardtii. Here, we describe a Thr residue located in the fourth transmembrane domain of fatty acid desaturase 7 (FAD7) that is essential for the biosynthesis of ω-3 fatty acids in C. reinhardtii. The ω-3 fatty acid deficiency in strain CC-620, which contains a putative missense mutation at Thr286 of CrFAD7, was recovered by the overexpression of CC-125 CrFAD7. A Ser substitution in position 286 was able to partially complement the phenotype of the ω-3 fatty acid deficiency, but other substitution variants, such as Tyr, His, Cys, and Gly, failed to do so. Prediction of the phosphorylation target site revealed that Thr286 may be phosphorylated. Analysis of the structural conformation of CC-620 CrFAD7 via topology prediction (and bends in the helix) shows that this missense mutation may collapse the catalytic structure of CrFAD7. Taken together, this study suggests that Thr286 is essential for the maintaining the catalytic structure of CrFAD7. PMID:25699037

  5. Influence of fatty acid profile of total parenteral nutrition emulsions on the fatty acid composition of different tissues of piglets.

    PubMed

    Amusquivar, E; Sánchez, M; Hyde, M J; Laws, J; Clarke, L; Herrera, E

    2008-08-01

    Total parenteral nutrition (TPN) studies in human babies of very-low-birth-weight suggest that the lipid emulsions currently available are not optimum for neonatal nutrition. Since fatty acid metabolism in human and pigs is very similar, the present study examines how lipid emulsions used in clinical TPN (i.e. ClinOleic, Intralipid, Lipofundin or Omegaven), with different fatty acid compositions, administered to neonatal piglets for 7 days, influenced their tissue fatty acid composition as compared to those enterally fed with a sow milk replacer. A positive linear relationship was found between the proportion of all individual fatty acids in the lipid emulsions or in the milk replacer versus those in plasma, skeletal muscle, subcutaneous fat, liver, heart, pancreas, stomach or intestine total lipids or in brain phospholipids, the latter showing the lowest correlation coefficient. With the exception of brain, the proportion of either oleic acid or alpha-linolenic acid in the individual tissues was correlated with those present in the corresponding lipid emulsion or milk replacer, whereas the proportion of linoleic acid correlated significantly with all the tissues studied. With the exception of brain phospholipids, both eicosapentaenoic and docosahexaenoic acids were higher in the tissues of piglets receiving Omegaven than in all other groups. In conclusion, with the exception of the brain, fatty acid composition of plasma and different tissues in piglets are strongly influenced by the fatty acid profile of TPN emulsions. Fatty acid composition of brain phospholipids are, however, much less influenced by dietary composition, indicating an active and efficient metabolism that ensures its appropriate composition at this key stage of development.

  6. Effect of the chemical composition of green manure crops on humus formation in a Soddy-Podzolic soil

    NASA Astrophysics Data System (ADS)

    Tripolskaja, L.; Romanovskaja, D.; Slepetiene, A.; Razukas, A.; Sidlauskas, G.

    2014-04-01

    The effects of different types of green manure ( Trifolium pratense L., Dactylis glomerata L., and Secale cereale L.) and the time of its input into the soil (autumn and spring) on the contents of humus and labile humus substances in a soddy-podzolic soil and the relationship between the formation of humus and the chemical composition of the applied biomass were studied. Green manure had a positive effect on the accumulation of humus in the soil. When the plants were plowed into the soil in the fall, the amount of humus formed in the soil in the first year was 0.1% higher in comparison with the spring application of green manure. The most active synthesis of new humus substances took place upon the following properties of the plant biomass: C: N = 15-25, the cellulose content of 20-28%, and the lignin content of 14-17%. The highest amount of labile humus substances was formed during the decomposition of the biomass with the C: N ratio above 20, the cellulose content of 19-20%, and the lignin content of 14-16%.

  7. Mechanical Properties of Green Composites with Poly(caprolactone) and Wheat Gluten

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Wheat gluten (WG) was incorporated into poly(caprolactone) (PCL) up to 50% w/w as a filler to form a biodegradable polymer composite. Microscopic examination showed a well-dispersed particle-matrix system. The composite was evaluated for tensile properties. The tensile strength of the composite d...

  8. Elemental composition of green coffee and its contribution to dietary intake.

    PubMed

    Şemen, Sevcan; Mercan, Selda; Yayla, Murat; Açıkkol, Münevver

    2017-01-15

    The concentration of twenty-seven elements (Li, Be, B, Mg, Al, P, K, Ca, Cr, Mn, Co, Ni, Cu, Zn, As, Se, Sr, Mo, Cd, Sn, Sb, Ba, Hg, Pb, Bi, Th, and U) in green coffee samples and their infusions were determined by using inductively coupled plasma-mass spectrometry (ICP-MS). Prior to analysis, green coffee samples were prepared by microwave digestion, while infusions were analyzed without any pre-treatment. The accuracy and precision of the proposed methods were verified by recovery experiments. Considering samples; K, Cu, and Al had the highest mean concentrations with 6714.5μgg(-1), 12.1μgg(-1), and 25.9μgg(-1) among major, trace and toxic elements, respectively. The impact of brewing type on leachability of elements was also studied and the results outlined that mean leachability of elements to Turkish coffee were greater than to mud coffee. Furthermore, dietary element intakes through green coffee consumption were also estimated. This is the first study presenting wide range of elements in green coffee brews and calculating dietary intakes. PMID:27542454

  9. Obesogenic diets enriched in oleic acid vs saturated fatty acids differentially modify polyunsaturated fatty acid composition in liver and visceral adipose

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Emerging evidence indicates that the fatty acid composition of obesogenic diets impacts physiologic outcomes. Much attention is focused on the biologic effects of consuming monounsaturated fatty acids (MUFA) vs saturated fatty acids (SFA). We investigated the extent to which an obesogenic diet high ...

  10. Nutritional quality and amino acid composition of diets consumed by scavenging hens and cocks across seasons.

    PubMed

    Ncobela, Cyprial Ndumiso; Chimonyo, Michael

    2016-04-01

    The objective of the study was to determine the effect of season on nutritional quality and amino acid composition of diets that scavenging hens and cocks consume. Thirty hens and 30 cocks were purchased and slaughtered during each of the rainy, post rainy, cool dry and hot dry seasons. A total of 240 birds were used in the study. Fresh crop content weights were high (P < 0.05) during the cool dry season. Cereal grains, kitchen wastes, green materials, animal protein sources and inorganic materials were the main components of the crop contents. Crop contents varied with season and sex of bird (P < 0.05). The cereal grain weights were high during cool dry and hot dry seasons. Weights of animal protein sources (insects, locusts and termites) were higher (P < 0.05) during the rainy and post rainy seasons. Hens contained more animal protein sources (P < 0.05) than cocks. Hens had a higher (P < 0.05) lysine content during the rainy season than cocks. Histidine, serine, arginine, threonine, cysteine and lysine contents varied with seasons (P < 0.05). Methionine did not vary with season and sex of the bird. Nutritional supplementation of village chickens should, therefore, vary with seasons.

  11. Nutritional quality and amino acid composition of diets consumed by scavenging hens and cocks across seasons.

    PubMed

    Ncobela, Cyprial Ndumiso; Chimonyo, Michael

    2016-04-01

    The objective of the study was to determine the effect of season on nutritional quality and amino acid composition of diets that scavenging hens and cocks consume. Thirty hens and 30 cocks were purchased and slaughtered during each of the rainy, post rainy, cool dry and hot dry seasons. A total of 240 birds were used in the study. Fresh crop content weights were high (P < 0.05) during the cool dry season. Cereal grains, kitchen wastes, green materials, animal protein sources and inorganic materials were the main components of the crop contents. Crop contents varied with season and sex of bird (P < 0.05). The cereal grain weights were high during cool dry and hot dry seasons. Weights of animal protein sources (insects, locusts and termites) were higher (P < 0.05) during the rainy and post rainy seasons. Hens contained more animal protein sources (P < 0.05) than cocks. Hens had a higher (P < 0.05) lysine content during the rainy season than cocks. Histidine, serine, arginine, threonine, cysteine and lysine contents varied with seasons (P < 0.05). Methionine did not vary with season and sex of the bird. Nutritional supplementation of village chickens should, therefore, vary with seasons. PMID:26936274

  12. Amino acid nitrogen isotopic composition patterns in lacustrine sedimenting matter

    NASA Astrophysics Data System (ADS)

    Carstens, Dörte; Lehmann, Moritz F.; Hofstetter, Thomas B.; Schubert, Carsten J.

    2013-11-01

    Amino acids (AAs) comprise a large fraction of organic nitrogen (N) in plankton and sedimenting matter. Aquatic studies of organic N compounds in general and of AAs in particular, mostly concentrate on marine environments. In order to study the cycling and fate of organic N and AAs in lakes, we measured the N isotopic composition (δ15N) of bulk organic matter (OM) and of single hydrolysable AAs in sediment trap and sediment samples from two Swiss lakes with contrasting trophic state: Lake Brienz, an oligotrophic lake with an oxic water column, and Lake Zug a eutrophic, meromictic lake. We also measured the N isotopic composition of water column nitrate, the likely inorganic N source during biosynthesis in both lakes. The δ15N-AA patterns found for the sediment trap material were consistent with published δ15N-AA data for marine plankton. The AA composition and primary δ15N-AA signatures are preserved until burial in the sediments. During early sedimentary diagenesis, the δ15N values of single AAs appear to increase, exceeding those of the bulk OM. This increase in δ15N-AA is paralleled by a decreased contribution of AAs to the total OM pool with progressed degradation, suggesting preferential AA degradation associated with a significant N isotope fractionation. Indicators for trophic level based on δ15N-AAs were determined, for the first time in lacustrine systems. In our samples, the trophic AAs were generally enriched in 15N compared to source AAs and higher trophic δ15N-AA values in Lake Zug were consistent with a higher trophic level of the bulk biomass compared to Lake Brienz. Especially the difference between average trophic δ15N-AAs and average source δ15N-AAs was sensitive to the trophic states of the two lakes. A proxy for total heterotrophic AA re-synthesis (ΣV), which is strongly associated with heterotrophic microbial reworking of the OM, was calculated based on δ15N values of trophic AAs. Higher ΣV in Lake Brienz indicate enhanced

  13. Distribution and enantiomeric composition of amino acids in the Murchison meteorite

    NASA Technical Reports Server (NTRS)

    Engel, M. H.; Nagy, B.

    1982-01-01

    Studies of the amino acid contents and enantiomeric compositions of a single stone from the Murchison meteorite are reported. Water-extracted and 6M HCl-extracted samples from the meteorite interior of meteorite fragments were analyzed by gas chromatography and combined gas chromatography-chemical ionization mass spectrometry. Examination of the D/L ratios of glutamic acid, aspartic acid, proline, leucine and alanine reveals those amino acids extractable by water to be partially racemized, whereas the acid-extracted amino acids were less racemized. The amino acid composition of the stone is similar to those previously reported, including the absence of serine, threonine, tyrosine phenylalanine and methionine and the presence of unusual amino acids including such as isovaline, alpha-aminoisobutyric acid and pseudoleucine. It is concluded that the most likely mechanism accounting for the occurrence of nonracemic amino acid mixtures in the Murchison meteorite is by extraterrestrial stereoselective synthesis or decomposition reactions.

  14. Hierarchical scheme for liquid chromatography/multi-stage spectrometric identification of 3,4,5-triacyl chlorogenic acids in green Robusta coffee beans.

    PubMed

    Jaiswal, Rakesh; Kuhnert, Nikolai

    2010-08-15

    Liquid chromatography/multi-stage spectrometry (LC/MS(n)) (n = 2-4) has been used to detect and characterize in green Robusta coffee beans eight quantitatively minor triacyl chlorogenic acids with seven of them not previously reported in nature. These comprise 3,4,5-tricaffeoylquinic acid (Mr 678); 3,5-dicaffeoyl-4-feruloylquinic acid, 3-feruloyl-4,5-dicaffeoylquinic acid and 3,4-dicaffeoyl-5-feruloylquinic acid (Mr 692); 3-caffeoyl-4,5-diferuloylquinic acid and 3,4-diferuloyl-5-caffeoylquinic acid (Mr 706); and 3,4-dicaffeoyl-5-sinapoylquinic acid and 3-sinapoyl-4,5-dicaffeoylquinic acid (Mr 722). Structures have been assigned on the basis of LC/MS(n) patterns of fragmentation. A new hierarchical key for the identification of triacyl quinic acids is presented, based on previously established rules of fragmentation. Fifty-two chlorogenic acids have now been characterized in green Robusta coffee beans. In this study five samples of green Robusta coffee beans and fifteen samples of Arabica coffee beans were analyzed with triacyl chlorogenic acids only found in Robusta coffee bean extracts. These triacyl chlorogenic acids could be considered as useful phytochemical markers for the identification of Robusta coffee beans.

  15. Selection of acid compositions in well construction in difficult geological conditions

    NASA Astrophysics Data System (ADS)

    Mishchenko, M. V.; Kamartdinov, M. R.

    2016-03-01

    Within the scope of the current work we have presented an approach towards selecting and substantiation of acid composition in accordance with petrophysical characteristics of formations for acid treatment of bottom-hole formation zones. Article presents the results of lab tests of selected acid compositions, in conditions, which model thermobaric conditions of a payzone, combined with an evaluation of hydraulic permeability change, and this, in its turn, should allow us to evaluate the quality of impact of the acid composition recipe on the reservoir formation.

  16. Ontogenetic trends in aspartic acid racemization and amino acid composition within modern and fossil shells of the bivalve Arctica

    NASA Astrophysics Data System (ADS)

    Goodfriend, Glenn A.; Weidman, Christopher R.

    2001-06-01

    Ontogenetic trends (umbo to growth edge of shell) in aspartic acid (Asp) racemization and amino acid composition and their evolution over time are examined in serial samples of annual growth bands from a time-series of three live-collected and two fossil (ca. 500 and 1000 y BP) shells of the long-lived bivalve Arctica islandica. The rate of Asp racemization is shown to be higher in the umbonal portion of the shells (laid down when the clams are young) but constant from a biological age of 10 to 20 y to more than 100 y. Corresponding changes are also seen in amino acid composition and concentration: with increasing biological age of the clam: total amino acid concentration increases substantially, the acidic amino acids Asp, glutamic acid, and alanine decrease in relative concentration (mole-percent) and more basic amino acids including tyrosine, phenylalanine, and lysine increase in relative concentration. These ontogenetic trends are generally retained in the fossil shells. These trends may reflect changing protein composition related to changes in growth rate. Clams grow considerably faster in their youth than when they are older, as indicated by changes in the annual growth increments. Production of more acidic proteins, which play a role in crystal growth, may be favored during the phase of faster growth, whereas more structural proteins, perhaps enhancing structural strength of the shell, may be favored during later growth. These ontogenetic differences in protein composition affect the observed rates of racemization of the protein pool. Some weak diagenetic trends in amino acid composition and abundance may be represented in the time series of shells. These results emphasize the importance of standardization of the location from which samples are taken from shells for dating by amino acid racemization analysis.

  17. Variability in fatty acid and triacylglycerol composition of the oil of coconut (Cocos nucifera L.) hybrids and their parentals.

    PubMed

    Laureles, Lucita R; Rodriguez, Felicito M; Reaño, Consorcia E; Santos, Gerardo A; Laurena, Antonio C; Mendoza, Evelyn Mae Tecson

    2002-03-13

    The fatty acid profiles and triacylglycerol (TAG) compositions of oils from the solid endosperm of different Philippine coconut hybrids and their parentals were determined by using gas chromatography (GC) and high-performance liquid chromatography (HPLC). In general, varietal differences in fatty acid composition were observed. Lauric acid (C12) content was significantly higher in the hybrids PCA 15-8 (50.45%) and PCA 15-9 (50.26%) by about 3.16% points as compared to other hybrids, and higher in Tacunan Green Dwarf (50.50%) among the parentals. Among the fatty acids, lauric acid exhibited the least variation. In general, none of the hybrids had higher fatty acid content than their parentals. The HPLC chromatogram of triacylglycerols (TAG) showed 8 major peaks which differ in carbon number (CN) by two: identified as TAG CN 30, 32, 34, 36, 38, 40, 42, and 44. TAGs CN 30 (4.08%) and CN 34 (19.20%) were found to be significantly higher in PCA 15-9 than in the other hybrids. CN 36 was highest (21.94-23.66%) in all hybrids and parentals. The TAG CNs varied significantly among hybrids and parents, i.e., in CN 30, 32, and 34, which are high in medium chain triacylglycerols (MCTs), and in CN 30 (for parentals only), 40, 42, and 44 (the latter two for parentals only), and none in CN 36. MCTs calculated for two hybrids and their parents ranged from 13.81% to 20.55%.

  18. Elemental and fatty acid composition of snow algae in Arctic habitats

    PubMed Central

    Spijkerman, Elly; Wacker, Alexander; Weithoff, Guntram; Leya, Thomas

    2012-01-01

    Red, orange or green snow is the macroscopic phenomenon comprising different eukaryotic algae. Little is known about the ecology and nutrient regimes in these algal communities. Therefore, eight snow algal communities from five intensively tinted snow fields in western Spitsbergen were analysed for nutrient concentrations and fatty acid (FA) composition. To evaluate the importance of a shift from green to red forms on the FA-variability of the field samples, four snow algal strains were grown under nitrogen replete and moderate light (+N+ML) or N-limited and high light (−N+HL) conditions. All eight field algal communities were dominated by red and orange cysts. Dissolved nutrient concentration of the snow revealed a broad range of NH+4 (<0.005–1.2 mg N l−1) and only low PO3−4 (<18 μg P l−1) levels. The external nutrient concentration did not reflect cellular nutrient ratios as C:N and C:P ratios of the communities were highest at locations containing relatively high concentrations of NH+4 and PO3−4. Molar N:P ratios ranged from 11 to 21 and did not suggest clear limitation of a single nutrient. On a per carbon basis, we found a 6-fold difference in total FA content between the eight snow algal communities, ranging from 50 to 300 mg FA g C−1. In multivariate analyses total FA content opposed the cellular N:C quota and a large part of the FA variability among field locations originated from the abundant FAs C18:1n-9, C18:2n-6, and C18:3n-3. Both field samples and snow algal strains grown under −N+HL conditions had high concentrations of C18:1n-9. FAs possibly accumulated due to the cessation of growth. Differences in color and nutritional composition between patches of snow algal communities within one snow field were not directly related to nutrient conditions. We propose that the highly patchy distribution of snow algae within and between snow fields may also result from differences in topographical and geological parameters such as slope, melting

  19. Growth hormone reverses excitotoxic damage induced by kainic acid in the green iguana neuroretina.

    PubMed

    Ávila-Mendoza, José; Mora, Janeth; Carranza, Martha; Luna, Maricela; Arámburo, Carlos

    2016-08-01

    It is known that growth hormone (GH) is expressed in extrapituitary tissues, including the nervous system and ocular tissues, where it is involved in autocrine/paracrine actions related to cell survival and anti-apoptosis in several vertebrates. Little is known, however, in reptiles, so we analyzed the expression and distribution of GH in the eye of green iguana and its potential neuroprotective role in retinas that were damaged by the intraocular administration of kainic acid (KA). It was found, by Western blotting, that GH-immunoreactivity (GH-IR) was expressed as two isoforms (15 and 26kDa, under reducing conditions) in cornea, vitreous, retina, crystalline, iris and sclera, in varying proportions. Also, two bands for the growth hormone receptor (GHR)-IR were observed (70 and 44kDa, respectively) in the same tissues. By immunofluorescence, GH-IR was found in neurons present in several layers of the neuroretina (inner nuclear [INL], outer nuclear [ONL] and ganglion cell [GCL] layers) as determined by its co-existence with NeuN, but not in glial cells. In addition, GH and GHR co-expression was found in the same cells, suggesting paracrine/autocrine interactions. KA administration induced retinal excitotoxic damage, as determined by a significant reduction of the cell density and an increase in the appearance of apoptotic cells in the INL and GCL. In response to KA injury, both endogenous GH and Insulin-like Growth Factor I (IGF-I) expression were increased by 70±1.8% and 33.3±16%, respectively. The addition of exogenous GH significantly prevented the retinal damage produced by the loss of cytoarchitecture and cell density in the GCL (from 4.9±0.79 in the control, to 1.45±0.2 with KA, to 6.35±0.49cell/mm(2) with KA+GH) and in the INL (19.12±1.6, 10.05±1.9, 21.0±0.8cell/mm(2), respectively) generated by the long-term effect of 1mM KA intraocular administration. The co-incubation with a specific anti-GH antibody, however, blocked the protective effect of GH

  20. The bile acid composition of crane gallbladder bile

    USGS Publications Warehouse

    Serafin, J.A.

    1983-01-01

    1. 1. The biliary bile acids of the whooping crane (Grus americana) and the Florida sandhill crane (G. canadensis pratensis) have been examined. 2. 2. Cholic acid (CA), chenodeoxycholic acid (CDOCA) and lithocholic acid were found in bile from both species of these North American cranes. 3. 3. CDOCA and CA were the primary bile acids in both species, together constituting 70% or more of the bile acids by weight. 4. 4. The primary bile acids of cranes appear to be the same as those that have been identified in other avian species.

  1. Accumulation and depuration of okadaic acid esters in the European green crab (Carcinus maenas) during a feeding study.

    PubMed

    Jørgensen, Kevin; Cold, Ulrik; Fischer, Knud

    2008-03-01

    Soft shell crab is a seafood delicacy in many parts of the world. In Denmark, it has been investigated whether a commercial production of soft shell European green crabs (Carcinus maenas) would be feasible. In relation to this, a feeding study was performed to examine if occurrence of DSP toxins in the product could be a food safety problem. The crabs were fed with mussels containing DSP toxins (2500 microg total okadaic acid equivalents/kg) for 17 days and then fasted for 19 days. The content of total okadaic acid equivalents in the digestive organs was on average 27 times higher than the corresponding content in the body meat. The highest level of total okadaic acid equivalents measured was 12 microg/kg in body meat and 503 microg/kg in digestive organs. The results show that the content of DSP toxins in a commercial product of soft shell European green crab (without digestive organs) could be regarded as negligible. PMID:17983637

  2. Hydrofluoric acid-resistant composite window and method for its fabrication

    DOEpatents

    Ostenak, C.A.; Mackay, H.A.

    1985-07-18

    A hydrofluoric acid-resistant composite window and method for its fabrication are disclosed. The composite window comprises a window having first and second sides. The first side is oriented towards an environment containing hydrofluoric acid. An adhesive is applied to the first side. A layer of transparent hydrofluoric acid-resistant material, such as Mylar, is applied to the adhesive and completely covers the first side. The adhesive is then cured.

  3. Hydrofluoric acid-resistant composite window and method for its fabrication

    DOEpatents

    Ostenak, Carl A.; Mackay, Harold A.

    1987-01-01

    A hydrofluoric acid-resistant composite window and method for its fabrication are disclosed. The composite window comprises a window having first and second sides. The first side is oriented towards an environment containing hydrofluoric acid. An adhesive is applied to the first side. A layer of transparent hydrofluoric acid-resistant material, such as Mylar, is applied to the adhesive and completely covers the first side. The adhesive is then cured.

  4. One-pot, green, rapid synthesis of flowerlike gold nanoparticles/reduced graphene oxide composite with regenerated silk fibroin as efficient oxygen reduction electrocatalysts.

    PubMed

    Xu, Shengjie; Yong, Liu; Wu, Peiyi

    2013-02-01

    Flowerlike gold nanoparticles (Au NPs)/reduced graphene oxide (RGO) composites were fabricated by a facile, one-pot, environmentally friendly method in the presence of regenerated silk fibroin (RSF). The influences of reaction time, temperature, and HAuCl(4): RGO ratio on the morphology of Au NPs loaded on RGO sheets were discussed and a tentative mechanism for the formation of flowerlike Au NPs/RGO composite was proposed. In addition, the flowerlike Au NPs/RGO composite showed superior catalytic performance for oxygen reduction reaction (ORR) to Au/RGO composites with other morphologies. Our work provides an alternative facile and green approach to synthesize functional metal/RGO composites.

  5. White biotechnology for green chemistry: fermentative 2-oxocarboxylic acids as novel building blocks for subsequent chemical syntheses.

    PubMed

    Stottmeister, U; Aurich, A; Wilde, H; Andersch, J; Schmidt, S; Sicker, D

    2005-12-01

    Functionalized compounds, which are difficult to produce by classical chemical synthesis, are of special interest as biotechnologically available targets. They represent useful building blocks for subsequent organic syntheses, wherein they can undergo stereoselective or regioselective reactions. "White Biotechnology" (as defined by the European Chemical Industry [ http://www.europabio.org/white_biotech.htm ], as part of a sustainable "Green Chemistry,") supports new applications of chemicals produced via biotechnology. Environmental aspects of this interdisciplinary combination include: Use of renewable feedstock Optimization of biotechnological processes by means of: New "high performance" microorganisms On-line measurement of substrates and products in bioreactors Alternative product isolation, resulting in higher yields, and lower energy demand In this overview we describe biotechnologically produced pyruvic, 2-oxopentaric and 2-oxohexaric acids as promising new building blocks for synthetic chemistry. In the first part, the microbial formation of 2-oxocarboxylic acids (2-OCAs) in general, and optimization of the fermentation steps required to form pyruvic acid, 2-oxoglutaric acid, and 2-oxo-D-gluconic acid are described, highlighting the fundamental advantages in comparison to chemical syntheses. In the second part, a set of chemical formula schemes demonstrate that 2-OCAs are applicable as building blocks in the chemical synthesis of, e.g., hydrophilic triazines, spiro-connected heterocycles, benzotriazines, and pyranoic amino acids. Finally, some perspectives are discussed. PMID:15995855

  6. Fatty acids composition of Spanish black (Morus nigra L.) and white (Morus alba L.) mulberries.

    PubMed

    Sánchez-Salcedo, Eva M; Sendra, Esther; Carbonell-Barrachina, Ángel A; Martínez, Juan José; Hernández, Francisca

    2016-01-01

    This research has determined qualitatively and quantitatively the fatty acids composition of white (Morus alba) and black (Morus nigra) fruits grown in Spain, in 2013 and 2014. Four clones of each species were studied. Fourteen fatty acids were identified and quantified in mulberry fruits. The most abundant fatty acids were linoleic (C18:2), palmitic (C16:0), oleic (C18:1), and stearic (C18:0) acids in both species. The main fatty acid in all clones was linoleic (C18:2), that ranged from 69.66% (MN2) to 78.02% (MA1) of the total fatty acid content; consequently Spanish mulberry fruits were found to be rich in linoleic acid, which is an essential fatty acid. The fatty acid composition of mulberries highlights the nutritional and health benefits of their consumption.

  7. Fatty acids composition of Spanish black (Morus nigra L.) and white (Morus alba L.) mulberries.

    PubMed

    Sánchez-Salcedo, Eva M; Sendra, Esther; Carbonell-Barrachina, Ángel A; Martínez, Juan José; Hernández, Francisca

    2016-01-01

    This research has determined qualitatively and quantitatively the fatty acids composition of white (Morus alba) and black (Morus nigra) fruits grown in Spain, in 2013 and 2014. Four clones of each species were studied. Fourteen fatty acids were identified and quantified in mulberry fruits. The most abundant fatty acids were linoleic (C18:2), palmitic (C16:0), oleic (C18:1), and stearic (C18:0) acids in both species. The main fatty acid in all clones was linoleic (C18:2), that ranged from 69.66% (MN2) to 78.02% (MA1) of the total fatty acid content; consequently Spanish mulberry fruits were found to be rich in linoleic acid, which is an essential fatty acid. The fatty acid composition of mulberries highlights the nutritional and health benefits of their consumption. PMID:26213011

  8. GLC analysis of Indian rapeseed-mustard to study the variability of fatty acid composition.

    PubMed

    Kaushik, N; Agnihotri, A

    2000-12-01

    Rapeseed-mustard is one of the most economically important oilseed crops in India. Speciality oils having high amounts of a specific fatty acid are of immense importance for both nutritional and industrial purposes. Oil high in oleic acid has demand in commercial food-service applications due to a long shelf-life and cholesterol-reducing properties. Both linoleic and linolenic acids are essential fatty acids; however, less than 3% linolenic acid is preferred for oil stability. High erucic acid content is beneficial for the polymer industry, whereas low erucic acid is recommended for food purposes. Therefore, it is important to undertake systematic characterization of the available gene pool for its variable fatty acid profile to be utilized for specific purposes. In the present study the Indian rapeseed-mustard germplasm and some newly developed low-erucic-acid strains were analysed by GLC to study the fatty acid composition in these lines. The GLC analysis revealed that the rapeseed-mustard varieties being commonly grown in India are characterized by high erucic acid content (30-51%) in the oil with low levels of oleic acid (13-23%). However, from among the recently developed low-erucic-acid strains, several lines were identified with comparatively high oleic acid (60-70%), moderate to high linoleic acid (13-40%) and low linolenic acid (< 10%) contents. Work is in progress at TERI (New Delhi, India) to utilize these lines for development of strains with particular fatty acid compositions for specific purposes.

  9. Neutrophil fatty acid composition: effect of a single session of exercise and glutamine supplementation.

    PubMed

    Lagranha, C J; Alba-Loureiro, T C; Martins, E F; Pithon-Curi, T C; Curi, R

    2008-06-01

    The fatty acid composition of immune cells appears to contribute to variations of cell function. The independent and combined effects of a single session of exercise (SSE) and glutamine supplementation (GS) on neutrophil fatty acid composition were investigated. Compared to control (no treatment given--i.e. neither SSE or GS), single session of exercise decreased myristic, palmitic and eicosapentaenoic (EPA) acids, and increased lauric, oleic, linoleic, arachidonic (AA) and docosahexaenoic (DHA) acids whereas glutamine supplementation combined with SSE (GS+SSE) increased oleic acid. Polyunsaturated/saturated fatty acid ratio and Unsaturation index were higher in neutrophils from the SSE and GS groups as compared with control. These findings support the proposition that SSE and GS may modulate neutrophil function through alterations in fatty acid composition. PMID:17721676

  10. Gender Differences in Rat Erythrocyte and Brain Docosahexaenoic Acid Composition: Role of Ovarian Hormones and Dietary Omega-3 Fatty Acid Composition

    PubMed Central

    McNamara, Robert K.; Able, Jessica; Jandacek, Ronald; Rider, Therese; Tso, Patrick

    2009-01-01

    The two-fold higher prevalence rate of major depression in females may involve vulnerability to omega-3 fatty acid deficiency secondary to a dysregulation in ovarian hormones. However, the role of ovarian hormones in the regulation of brain omega-3 fatty acid composition has not been directly evaluated. Here we determined erythrocyte and regional brain docosahexaenoic acid (DHA, 22:6n-3) composition in intact male and female rats, and in chronically ovariectomized (OVX) rats with or without cyclic estradiol treatment (2 μg/4 d). All groups were maintained on diets with or without the DHA precursor alpha-linolenic acid (ALA, 18:3n-3). We report that both male (−21%) and OVX (−19%) rats on ALA+ diet exhibited significantly lower erythrocyte DHA composition relative to female controls. Females on ALA+ diet exhibited lower DHA composition in the prefrontal cortex (PFC) relative males (−5%). OVX rats on ALA+ diet exhibited significantly lower DHA composition in the hippocampus (−6%), but not in the PFC, hypothalamus, or midbrain. Lower erythrocyte and hippocampus DHA composition in OVX rats was not prevented by estrogen replacement. All groups maintained on ALA− diet exhibited significantly lower erythrocyte and regional brain DHA composition relative to groups on ALA+ diet, and these reductions were greater in males but not in OVX rats. These preclinical data corroborate clinical evidence for gender differences in peripheral DHA composition (female>male), demonstrate gender differences in PFC DHA composition (male>female), and support a link between ovarian hormones and erythrocyte and region-specific brain DHA composition. PMID:19046819

  11. Fatty acid composition including cis-9, trans-11 CLA of cooked ground lamb

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Little information is available on effect of cooking on beneficial fatty acids such as conjugated linoleic acid (CLA) and n-3 polyunsaturated fatty acids (PUFA). The objective of this study was to examine impact of cooking on the FA composition of ground lamb of two different muscles. Samples were p...

  12. Effect of lactic acid fermentation on antioxidant, texture, color and sensory properties of red and green smoothies.

    PubMed

    Di Cagno, Raffaella; Minervini, Giovanna; Rizzello, Carlo G; De Angelis, Maria; Gobbetti, Marco

    2011-08-01

    Weissella cibaria, Lactobacillus plantarum, Lactobacillus sp. and Lactobacillus pentosus were variously identified from blackberries, prunes, kiwifruits, papaya and fennels by partial 16S rRNA gene sequence. Representative isolates from each plant species were screened based on the kinetics of growth on fruit juices. A protocol for processing and storage of red and green smoothies (RS and GS) was set up, which included fermentation by selected lactic acid bacteria starters and exo-polysaccharide producing strains. Starters grew and remained viable at ca. 9.0 log cfu g(-1) during 30 days of storage at 4 °C. No contaminating Enterobacteriaceae and yeast were found throughout storage. Values of soluble solids, total titratable acidity and viscosity distinguished started RS and GS compared to spontaneously (unstarted) fermented smoothies. Color difference dE∗(ab) and browning index were positively affected by lactic acid fermentation. Consumption of carbohydrates by lactic acid bacteria was limited as well as it was the lactic fermentation. Consumption of malic acid was evident throughout storage. Polyphenolic compounds and, especially, ascorbic acid were better preserved in started RS and GS compared to unstarted samples. This reflected on the free radical scavenging activity. A statistical correlation was only found between the level of ascorbic acid and free radical scavenging activity. As shown by a first-order equation, the rate of degradation of ascorbic acid through storage were found to be higher in the unstarted compared to started RS and GS. Fermentation by lactic acid bacteria clearly improved the sensory attributes of RS and GS.

  13. Composition of amino acids in feed ingredients for animal diets.

    PubMed

    Li, Xilong; Rezaei, Reza; Li, Peng; Wu, Guoyao

    2011-04-01

    Dietary amino acids (AA) are crucial for animal growth, development, reproduction, lactation, and health. However, there is a scarcity of information regarding complete composition of "nutritionally nonessential AA" (NEAA; those AA which can be synthesized by animals) in diets. To provide a much-needed database, we quantified NEAA (including glutamate, glutamine, aspartate, and asparagine) in feed ingredients for comparison with "nutritionally essential AA" (EAA; those AA whose carbon skeletons cannot be formed by animals). Except for gelatin and feather meal, animal and plant ingredients contained high percentages of glutamate plus glutamine, branched-chain AA, and aspartate plus asparagine, which were 10-32, 15-25, and 8-14% of total protein, respectively. In particular, leucine and glutamine were most abundant in blood meal and casein (13% of total protein), respectively. Notably, gelatin, feather meal, fish meal, meat and bone meal, and poultry byproduct had high percentages of glycine, proline plus hydroxyproline, and arginine, which were 10-35, 9.6-35, and 7.2-7.9% of total protein, respectively. Among plant products, arginine was most abundant in peanut meal and cottonseed meal (14-16% of total protein), whereas corn and sorghum had low percentages of cysteine, lysine, methionine, and tryptophan (0.9-3% of total protein). Overall, feed ingredients of animal origin (except for gelatin) are excellent sources of NEAA and EAA for livestock, avian, and aquatic species, whereas gelatin provides highest amounts of arginine, glycine, and proline plus hydroxyproline. Because casein, corn, soybean, peanut, fish, and gelatin are consumed by children and adults, our findings also have important implications for human nutrition.

  14. Green diesel production via catalytic hydrogenation/decarboxylation of triglycerides and fatty acids of vegetable oil and brown grease

    NASA Astrophysics Data System (ADS)

    Sari, Elvan

    Increase in the petroleum prices, projected increases in the world's energy demand and environmental awareness have shifted the research interest to the alternative fuel technologies. In particular, green diesel, vegetable oil/animal fat/waste oil and grease derived hydrocarbons in diesel boiling range, has become an attractive alternative to biodiesel---a mixture of fatty acid methyl esters, particularly due to its superior fuel properties that are similar to petroleum diesel. Hence, green diesel can be used as a drop-in fuel in the current diesel engines. The current technology for production of green diesel-hydrodeoxygenation of triglycerides and fatty acids over conventional hydrotreating catalysts suffers from fast catalyst deactivation in the absence of hydrogen combined with high temperatures and high fatty acid content in the feedstock. Additionally, excess hydrogen requirement for hydrodeoxygenation technique leads to high production costs. This thesis proposes a new technology-selective decarboxylation of brown grease, which is a mixture of fats and oils collected from waste water trap and rich in fatty acids, over a supported noble metal catalyst that overcomes the green diesel production challenges. In contrast to other feedstocks used for liquid biofuel production, brown grease is inexpensive and non-food competing feedstock, therefore the process finds solution to waste management issues, reduces the renewable fuel production cost and does not add to the global food shortage problems. Special catalyst formulations were developed to have a high activity and stability in the absence of hydrogen in the fatty acid decarboxylation process. The study shows how catalyst innovations can lead to a new technology that overcomes the process challenges. First, the effect of reaction parameters on the activity and the selectivity of brown grease decarboxylation with minimum hydrogen consumption over an activated carbon supported palladium catalyst were

  15. Cellular fatty acid composition of Actinobacillus actinomycetemcomitans and Haemophilus aphrophilus.

    PubMed

    Braunthal, S D; Holt, S C; Tanner, A C; Socransky, S S

    1980-06-01

    Strains of Actinobacillus actinomycetemcomitans isolated from deep pockets of patients with juvenile periodontitis were analyzed for their content of cellular fatty acids. Oral Haemophilus strains, morphologically and biochemically similar to Haemophilus aphrophilus, were also examined for their content of cellular fatty acids. The extractable lipids of the actinobacilli represented approximately 10% of the cell dry weight, with the bound lipids representing 2 to 5%. The major fatty acids consisted of myristic (C14:0) and palmitic (C16:0) acids and a C16:1 acid, possibly palmitoleic acid, accounting for 21, 35, and 31% of the total extractable fatty acids, respectively. Haemophilus strains had a similar cellular fatty acid content. PMID:7430333

  16. Cellular fatty acid composition of Actinobacillus actinomycetemcomitans and Haemophilus aphrophilus.

    PubMed Central

    Braunthal, S D; Holt, S C; Tanner, A C; Socransky, S S

    1980-01-01

    Strains of Actinobacillus actinomycetemcomitans isolated from deep pockets of patients with juvenile periodontitis were analyzed for their content of cellular fatty acids. Oral Haemophilus strains, morphologically and biochemically similar to Haemophilus aphrophilus, were also examined for their content of cellular fatty acids. The extractable lipids of the actinobacilli represented approximately 10% of the cell dry weight, with the bound lipids representing 2 to 5%. The major fatty acids consisted of myristic (C14:0) and palmitic (C16:0) acids and a C16:1 acid, possibly palmitoleic acid, accounting for 21, 35, and 31% of the total extractable fatty acids, respectively. Haemophilus strains had a similar cellular fatty acid content. PMID:7430333

  17. The geochemistry and petrogenesis of the Paleoproterozoic Green Mountain arc: A composite(?), bimodal, oceanic, fringing arc

    USGS Publications Warehouse

    Jones, D.S.; Barnes, C.G.; Premo, W.R.; Snoke, A.W.

    2011-01-01

    The inferred subduction affinity of the ~1780-Ma Green Mountain arc, a dominantly bimodal igneous terrane (together with immature marine and volcaniclastic sedimentary rocks) accreted to the southern margin of the Wyoming province, is integral to arc-accretion models of the Paleoproterozoic growth of southern Laurentia. Conversely, the dominantly bimodal nature of many putative arc-related igneous suites throughout southern Laurentia, including the Green Mountain arc, has also been used to support models of growth by extension of pre-existing crust. We report new geochemical and isotopic data from ~1780-Ma gabbroic and granodioritic to tonalitic rocks of the Big Creek Gneiss, interpreted as consanguineous with previously studied metavolcanic rocks of the Green Mountain Formation.The ~1780-Ma Big Creek Gneiss mafic rocks show clear geochemical signatures of a subduction origin and provide no supporting evidence for extensional tectonism. The ~1780-Ma Big Creek Gneiss felsic rocks are attributed to partial melting of mafic and/or mixed lower-crustal material. The bimodal nature of the suite results from the combination of arc basalts and felsic crustal melts. The lack of andesite is consistent with the observed tholeiitic differentiation trend of the mafic magmas. The lower e{open}Nd(1780Ma) values for the felsic rocks vs. the mafic rocks suggest that the unexposed lower crust of the arc may be older than the arc and that Trans-Hudson- or Penokean-aged rocks possibly form the substratum of the arc. Our results reinforce previous interpretations that arc-related magmatism played a key role in the Paleoproterozoic crustal growth of southern Laurentia, but also support the possibility of unexposed older crust as basement to the arcs. ?? 2011 Elsevier B.V.

  18. Lipids in grain tissues of oat (Avena sativa): differences in content, time of deposition, and fatty acid composition.

    PubMed

    Banas, Antoni; Debski, Henryk; Banas, Walentyna; Heneen, Waheeb K; Dahlqvist, Anders; Bafor, Maureen; Gummeson, Per-Olov; Marttila, Salla; Ekman, Asa; Carlsson, Anders S; Stymne, Sten

    2007-01-01

    Oat (Avena sativa) is unusual in comparison with other cereals since there are varieties with up to 18% oil content. The lipid content and fatty acid composition in different parts of the grain during seed development were characterized in cultivars Freja (6% oil) and Matilda (10% oil), using thin-layer and gas chromatography, and light and electron microscopy. The majority of lipids (86-90%) were found in the endosperm. Ninety-five per cent of the higher oil content of cv. Matilda compared with cv. Freja was due to increased oil content of the endosperm. Up to 84% of the lipids were deposited during the first half of seed development, when seeds where still green with a milky endosperm. Microscopy studies revealed that whereas oil bodies of the embryo and scutellum still contained a discrete shape upon grain maturation, oil bodies of the endosperms fused upon maturation and formed smears of oil.

  19. Interconnection between the protein solubility and amino acid and dipeptide compositions.

    PubMed

    Niu, Xiaohui; Li, Nana; Chen, Dinyan; Wang, Zengzhen

    2013-01-01

    Obtaining soluble proteins in sufficient concentrations helps increase the overall success rate in various experimental studies. Protein solubility is an individual trait ultimately determined by its primary protein sequence. Exploring the interconnection between the protein solubility and the compositions of protein sequence is instrumental for setting priorities on targets in large scale proteomics projects. In this paper, amino acid composition (20 dimensions) and the dipeptide composition (400 dimensions) were extracted to form the total candidate feature pool (420 dimensions), and each feature was selected into the feature vectors one by one, which were sorted by the absolute value of the correlation coefficient. Finally, we evaluated and recorded the 420 results of Support Vector Machine (SVM) as the prediction engine. According to the results of SVM, the first 208 features were chosen from the 420 dimensions, which were considered as the efficient ones. By analyzing the composition of the former 208 features, we found that the protein solubility was significantly influenced by the occurrence frequencies of the acidic amino acids, basic amino acids, non-polar hydrophobic amino acids and the two polar neutral amino acids(C, Q) in the protein sequences. Additionally, we detected that the dipeptides composed by the acidic amino acids (D, E) and basic amino acids (K, R and H), especially the dipeptide composed by the acidic amino acids (D, E), had strong interconnection with the protein solubility.

  20. Structural and dynamic changes associated with beneficial engineered single-amino-acid deletion mutations in enhanced green fluorescent protein

    SciTech Connect

    Arpino, James A. J.; Rizkallah, Pierre J.; Jones, D. Dafydd

    2014-08-01

    The beneficial engineered single-amino-acid deletion variants EGFP{sup D190Δ} and EGFP{sup A227Δ} have been studied. Single-amino-acid deletions are a common part of the natural evolutionary landscape but are rarely sampled during protein engineering owing to limited and prejudiced molecular understanding of mutations that shorten the protein backbone. Single-amino-acid deletion variants of enhanced green fluorescent protein (EGFP) have been identified by directed evolution with the beneficial effect of imparting increased cellular fluorescence. Biophysical characterization revealed that increased functional protein production and not changes to the fluorescence parameters was the mechanism that was likely to be responsible. The structure EGFP{sup D190Δ} containing a deletion within a loop revealed propagated changes only after the deleted residue. The structure of EGFP{sup A227Δ} revealed that a ‘flipping’ mechanism was used to adjust for residue deletion at the end of a β-strand, with amino acids C-terminal to the deletion site repositioning to take the place of the deleted amino acid. In both variants new networks of short-range and long-range interactions are generated while maintaining the integrity of the hydrophobic core. Both deletion variants also displayed significant local and long-range changes in dynamics, as evident by changes in B factors compared with EGFP. Rather than being detrimental, deletion mutations can introduce beneficial structural effects through altering core protein properties, folding and dynamics, as well as function.

  1. Thermal and Mechanical Characteristics of Polymer Composites Based on Epoxy Resin, Aluminium Nanopowders and Boric Acid

    NASA Astrophysics Data System (ADS)

    Nazarenko, O. B.; Melnikova, T. V.; Visakh, P. M.

    2016-01-01

    The epoxy polymers are characterized by low thermal stability and high flammability. Nanoparticles are considered to be effective fillers of polymer composites for improving their thermal and functional properties. In this work, the epoxy composites were prepared using epoxy resin ED-20, polyethylene polyamine as a hardener, aluminum nanopowder and boric acid fine powder as flame-retardant filler. The thermal characteristics of the obtained samples were studied using thermogravimetric analysis and differential scanning calorimetry. The mechanical characteristics of epoxy composites were also studied. It was found that an addition of all fillers enhances the thermal stability and mechanical characteristics of the epoxy composites. The best thermal stability showed the epoxy composite filled with boric acid. The highest flexural properties showed the epoxy composite based on the combination of boric acid and aluminum nanopowder.

  2. Proximate composition, fatty acid analysis and protein digestibility-corrected amino acid score of three Mediterranean cephalopods.

    PubMed

    Zlatanos, Spiros; Laskaridis, Kostas; Feist, Christian; Sagredos, Angelos

    2006-10-01

    Proximate composition, fatty acid analysis and protein digestibility-corrected amino acid score (PDCAAS) in three commercially important cephalopods of the Mediterranean sea (cuttlefish, octopus and squid) were determined. The results of the proximate analysis showed that these species had very high protein:fat ratios similar to lean beef. Docosahexaenoic, palmitic and eicosipentaenoic acid were the most abundant fatty acids among analyzed species. The amount of n-3 fatty acids was higher than that of saturated, monounsaturated and n-6 fatty acids. Despite the fact that cephalopods contain small amounts of fat they were found quite rich in n-3 fatty acids. Finally, PDCAAS indicated that these organisms had a very good protein quality.

  3. Effect of acute nitrogen dioxide exposure on the composition of fatty acid associated with phospholipids in alveolar lavage

    SciTech Connect

    Kobayashi, T.; Noguchi, T.; Kikuno, M.; Kubota, K.

    1984-01-01

    In vivo exposure of rats to 10 ppm nitrogen dioxide (NO/sub 2/) for 12 h caused changes in fatty acids composition of alveolar lavage phospholipids. Among the fatty acid species, the relative ratio of palmitic acid, myristic acid and palmitoleic acid increased significantly. While the relative ratio of stearic acid, oleic acid, linoleic acid and arachidonic acid decreased significantly. Both the increase in the incorporation of palmitic acid in phosphatidylcholine which would be released into the alveoli and the increase in the release of phosphatidylcholine into the alveoli may account for the changes in the fatty acid composition of the present findings.

  4. Multilevel Green's function interpolation method for scattering from composite metallic and dielectric objects.

    PubMed

    Shi, Yan; Wang, Hao Gang; Li, Long; Chan, Chi Hou

    2008-10-01

    A multilevel Green's function interpolation method based on two kinds of multilevel partitioning schemes--the quasi-2D and the hybrid partitioning scheme--is proposed for analyzing electromagnetic scattering from objects comprising both conducting and dielectric parts. The problem is formulated using the surface integral equation for homogeneous dielectric and conducting bodies. A quasi-2D multilevel partitioning scheme is devised to improve the efficiency of the Green's function interpolation. In contrast to previous multilevel partitioning schemes, noncubic groups are introduced to discretize the whole EM structure in this quasi-2D multilevel partitioning scheme. Based on the detailed analysis of the dimension of the group in this partitioning scheme, a hybrid quasi-2D/3D multilevel partitioning scheme is proposed to effectively handle objects with fine local structures. Selection criteria for some key parameters relating to the interpolation technique are given. The proposed algorithm is ideal for the solution of problems involving objects such as missiles, microstrip antenna arrays, photonic bandgap structures, etc. Numerical examples are presented to show that CPU time is between O(N) and O(N log N) while the computer memory requirement is O(N). PMID:18830332

  5. A comparative study of the fatty acid composition of prochloron lipids

    NASA Technical Reports Server (NTRS)

    Kenrick, J. R.; Deane, E. M.; Bishop, D. G.

    1983-01-01

    The chemical analysis of lipids of Prochloron isolated from several hosts is discussed. The object was to determine whether differences in lipid composition could be used to characterize organisms from different sources. Major lipid components are given. An analysis of fatty acid composition of individual lipids slowed a distinctive disstribution of fatty acids. While present results do not justify the use of fatty acid content in the taxonomy of Prochlon, the variations found in the lipids of cells from the same host harvested from different areas, or at different times in the same area, suggest that a study of the effects of temperature and light intensity on lipid composition would be rewarding.

  6. Compositions and method for controlling precipitation when acidizing sour wells

    SciTech Connect

    Dill, W.R.; Walker, M.L.

    1990-08-21

    This patent describes a method of treating a sour well penetrating a subterranean formation. It comprises: introducing into the well a treating fluid comprising an acid solution having a pH below 1.9, an iron sequestering agent comprising at least one compound selected from the group consisting of aminopolycarboxylic acids, hydroxycarboxylic acids, cyclic polyethers and derivatives of the acids and ethers, present in an amount of from about 0.25 to about 5 percent by weight of the acid solution, and a sulfide modifier comprising at least one compound selected from the group consisting of an aldehyde, acetal, hemiacetal and any other compound capable of forming aldehydes in the acid solution, present in an amount of from about 0.25 to about 5 percent of the acid solution; and treating the subterranean formation with the treating fluid.

  7. Green diesel production via catalytic hydrogenation/decarboxylation of triglycerides and fatty acids of vegetable oil and brown grease

    NASA Astrophysics Data System (ADS)

    Sari, Elvan

    Increase in the petroleum prices, projected increases in the world's energy demand and environmental awareness have shifted the research interest to the alternative fuel technologies. In particular, green diesel, vegetable oil/animal fat/waste oil and grease derived hydrocarbons in diesel boiling range, has become an attractive alternative to biodiesel---a mixture of fatty acid methyl esters, particularly due to its superior fuel properties that are similar to petroleum diesel. Hence, green diesel can be used as a drop-in fuel in the current diesel engines. The current technology for production of green diesel-hydrodeoxygenation of triglycerides and fatty acids over conventional hydrotreating catalysts suffers from fast catalyst deactivation in the absence of hydrogen combined with high temperatures and high fatty acid content in the feedstock. Additionally, excess hydrogen requirement for hydrodeoxygenation technique leads to high production costs. This thesis proposes a new technology-selective decarboxylation of brown grease, which is a mixture of fats and oils collected from waste water trap and rich in fatty acids, over a supported noble metal catalyst that overcomes the green diesel production challenges. In contrast to other feedstocks used for liquid biofuel production, brown grease is inexpensive and non-food competing feedstock, therefore the process finds solution to waste management issues, reduces the renewable fuel production cost and does not add to the global food shortage problems. Special catalyst formulations were developed to have a high activity and stability in the absence of hydrogen in the fatty acid decarboxylation process. The study shows how catalyst innovations can lead to a new technology that overcomes the process challenges. First, the effect of reaction parameters on the activity and the selectivity of brown grease decarboxylation with minimum hydrogen consumption over an activated carbon supported palladium catalyst were

  8. Inhibitory activity of chlorogenic acids in decaffeinated green coffee beans against porcine pancreas lipase and effect of a decaffeinated green coffee bean extract on an emulsion of olive oil.

    PubMed

    Narita, Yusaku; Iwai, Kazuya; Fukunaga, Taiji; Nakagiri, Osamu

    2012-01-01

    A decaffeinated green coffee bean extract (DGCBE) inhibited porcine pancreas lipase (PPL) activity with an IC50 value of 1.98 mg/mL. Six different chlorogenic acids in DGCBE contributed to this PPL inhibition, accounting for 91.8% of the inhibitory activity. DGCBE increased the droplet size and decreased the specific surface area of an olive oil emulsion.

  9. Inhibitory activity of chlorogenic acids in decaffeinated green coffee beans against porcine pancreas lipase and effect of a decaffeinated green coffee bean extract on an emulsion of olive oil.

    PubMed

    Narita, Yusaku; Iwai, Kazuya; Fukunaga, Taiji; Nakagiri, Osamu

    2012-01-01

    A decaffeinated green coffee bean extract (DGCBE) inhibited porcine pancreas lipase (PPL) activity with an IC50 value of 1.98 mg/mL. Six different chlorogenic acids in DGCBE contributed to this PPL inhibition, accounting for 91.8% of the inhibitory activity. DGCBE increased the droplet size and decreased the specific surface area of an olive oil emulsion. PMID:23221697

  10. Near-Infrared Spectroscopy Calibrations Performed on Oven-Dried Green Forages for the Prediction of Chemical Composition and Nutritive Value of Preserved Forage for Ruminants.

    PubMed

    Andueza, Donato; Picard, Fabienne; Martin-Rosset, William; Aufrère, Jocelyne

    2016-08-01

    Predicting forage feed value is a vital part of estimating ruminant performances. Most near-infrared (NIR) reflectance calibration models have been developed on oven-dried green forages, but preserved forages such as hays or silages are a significant part of real-world farm practice. Fresh and preserved forages give largely similar fodder, but drying or ensiling processes could modify preserved forage spectra which would make the oven-dried green forage model unsuitable to use on preserved forage samples. The aim of this study was to monitor the performance of oven-dried green forage calibration models on a set of hay and silage to predict their nutritive value. Local and global approaches were tested and 1025 green permanent grassland forages, 46 types of hay, and 27 types of silage were used. The samples were scanned by NIR spectroscopy and analyzed for nitrogen, neutral detergent fiber, acid detergent fiber, and pepsin-cellulase dry matter digestibility (PCDMD). Local and global calibrations were developed on 975 oven-dried green forage spectra and tested on 50 samples of oven-dried green forages, 46 samples of hay, and 27 samples of silage. For oven-dried green forage and hay validation sets, Mahalanobis distance (H) between these samples and the calibration population center was lower than 3. No significant standard error of prediction differences was obtained when calibration models were applied to oven-dried green forage and hay validation sets. For silage, the H-distance was higher than 3, meaning that calibration models built from oven-dried green forages cannot be applied to silage samples. We conclude that local calibration outperforms global strategy on predicting the PCDMD of oven-dried green forages and hay. PMID:27324421

  11. Single-Point-of-Failure Mitigation: Prove-Out of a Green Light-Emitting Illuminant Composition in the Handheld Signal Cluster and 40-mm Parachute Configurations

    NASA Astrophysics Data System (ADS)

    Moretti, Jared D.; Harbol, Seth M.; Riegner, Dawn E.; Carlucci, Nicholas; Sabatini, Jesse J.; Poret, Jay C.

    2014-10-01

    The development of handheld signal cluster and 40-mm parachute green light-emitting pyrotechnic compositions is described. Of the new compositions evaluated, one was found to exceed the military requirements in burn time, luminous intensity, dominant wavelength, and spectral purity in both the cluster and parachute configurations. The new illuminant composition is not plagued by single-point-of-failure concerns, as the Laminac 4116/Lupersol binder system has been replaced by the widely available Epon 813/Versamid 140 binder system. In addition, the new illuminant composition was found to be insensitive toward impact, friction, and electrostatic discharge and had a high thermal onset temperature.

  12. Sulfonated mesoporous silica-carbon composites and their use as solid acid catalysts

    NASA Astrophysics Data System (ADS)

    Valle-Vigón, Patricia; Sevilla, Marta; Fuertes, Antonio B.

    2012-11-01

    The synthesis of highly functionalized porous silica-carbon composites made up of sulfonic groups attached to a carbon layer coating the pores of three types of mesostructured silica (i.e. SBA-15, KIT-6 and mesocellular silica) is presented. The synthesis procedure involves the following steps: (a) removal of the surfactant, (b) impregnation of the silica pores with a carbon precursor, (c) carbonization and (d) sulfonation. The resulting silica-carbon composites contain ˜30 wt % of carbonaceous matter with a high density of acidic groups attached to the deposited carbon (i.e.sbnd SO3H, sbnd COOH and sbnd OH). The structural characteristics of the parent silica are retained in the composite materials, which exhibit a high surface area, a large pore volume and a well-ordered porosity made up uniform mesopores. The high density of the sulfonic groups in combination with the mesoporous structure of the composites ensures that a large number of active sites are easily accessible to reactants. These sulfonated silica-carbon composites behave as eco-friendly, active, selective, water tolerant and recyclable solid acids. In this study we demonstrate the usefulness of these composites as solid acid catalysts for the esterification of maleic anhydride, succinic acid and oleic acid with ethanol. These composites exhibit a superior intrinsic catalytic activity to other commercial solid acids such as Amberlyst-15.

  13. Fatty acid composition of erythrocyte membrane lipid obtained from children suffering from kwashiorkor and marasmus.

    PubMed

    Vajreswari, A; Narayanareddy, K; Rao, P S

    1990-08-01

    The fatty acid composition of erythrocyte membrane (EM) lipids obtained from normal, kwashiorkor, and marasmic children was analyzed by gas chromatography. The proportion of palmitic acid (16:0) was lower and of oleic acid (18:1) higher in the kwashiorkor group than in the control group. The marasmic group showed lower proportions of eicosatrienoic acid (20:3) and arachidonic acid (20:4) and a higher proportion of oleic acid (18:1) than the control group. A significant difference was found between the marasmic and kwashiorkor groups with respect to arachidonic acid (20:4), which showed a lower proportion in the former group than the latter. The ratio of arachidonic acid to linoleic acid (20:4/18:2) was markedly lower in the marasmic group than the control group, suggesting a possible impairment in the conversion of linoleic acid to arachidonic acid in marasmic children. The ratio of unsaturated fatty acids to saturated fatty acids was markedly elevated in the kwashiorkor group over that of control group, indicating increased fluidity of EM in kwashiorkor. It is suggested that the altered membrane fatty acid composition reflects deranged lipid metabolism and affects the physical and physiological properties of EM and could contribute to changes in the activities of several red blood cell membrane-bound enzymes reported earlier in kwashiorkor children.

  14. Formation of lipid bodies and changes in fatty acid composition upon pre-akinete formation in Arctic and Antarctic Zygnema (Zygnematophyceae, Streptophyta) strains.

    PubMed

    Pichrtová, Martina; Arc, Erwann; Stöggl, Wolfgang; Kranner, Ilse; Hájek, Tomáš; Hackl, Hubert; Holzinger, Andreas

    2016-07-01

    Filamentous green algae of the genus Zygnema (Zygnematophyceae, Streptophyta) are key components of polar hydro-terrestrial mats where they face various stressors including UV irradiation, freezing, desiccation and osmotic stress. Their vegetative cells can develop into pre-akinetes, i.e. reserve-rich, mature cells. We investigated lipid accumulation and fatty acid (FA) composition upon pre-akinete formation in an Arctic and an Antarctic Zygnema strain using transmission electron microscopy and gas chromatography coupled with mass spectrometry. Pre-akinetes formed after 9 weeks of cultivation in nitrogen-free medium, which was accompanied by massive accumulation of lipid bodies. The composition of FAs was similar in both strains, and α-linolenic acid (C18:3) dominated in young vegetative cells. Pre-akinete formation coincided with a significant change in FA composition. Oleic (C18:1) and linoleic (C18:2) acid increased the most (up to 17- and 8-fold, respectively). Small amounts of long-chain polyunsaturated FAs were also detected, e.g. arachidonic (C20:4) and eicosapentaenoic (C20:5) acid. Pre-akinetes exposed to desiccation at 86% relative humidity were able to recover maximum quantum yield of photosystem II, but desiccation had no major effect on FA composition. The results are discussed with regard to the capability of Zygnema spp. to thrive in extreme conditions. PMID:27170362

  15. Formation of lipid bodies and changes in fatty acid composition upon pre-akinete formation in Arctic and Antarctic Zygnema (Zygnematophyceae, Streptophyta) strains

    PubMed Central

    Pichrtová, Martina; Arc, Erwann; Stöggl, Wolfgang; Kranner, Ilse; Hájek, Tomáš; Hackl, Hubert; Holzinger, Andreas

    2016-01-01

    Filamentous green algae of the genus Zygnema (Zygnematophyceae, Streptophyta) are key components of polar hydro-terrestrial mats where they face various stressors including UV irradiation, freezing, desiccation and osmotic stress. Their vegetative cells can develop into pre-akinetes, i.e. reserve-rich, mature cells. We investigated lipid accumulation and fatty acid (FA) composition upon pre-akinete formation in an Arctic and an Antarctic Zygnema strain using transmission electron microscopy and gas chromatography coupled with mass spectrometry. Pre-akinetes formed after 9 weeks of cultivation in nitrogen-free medium, which was accompanied by massive accumulation of lipid bodies. The composition of FAs was similar in both strains, and α-linolenic acid (C18:3) dominated in young vegetative cells. Pre-akinete formation coincided with a significant change in FA composition. Oleic (C18:1) and linoleic (C18:2) acid increased the most (up to 17- and 8-fold, respectively). Small amounts of long-chain polyunsaturated FAs were also detected, e.g. arachidonic (C20:4) and eicosapentaenoic (C20:5) acid. Pre-akinetes exposed to desiccation at 86% relative humidity were able to recover maximum quantum yield of photosystem II, but desiccation had no major effect on FA composition. The results are discussed with regard to the capability of Zygnema spp. to thrive in extreme conditions. PMID:27170362

  16. Erythrocyte Membrane Fatty Acid Composition in Premenopausal Patients with Iron Deficiency Anemia.

    PubMed

    Aktas, Mehmet; Elmastas, Mahfuz; Ozcicek, Fatih; Yilmaz, Necmettin

    2016-01-01

    Iron deficiency anemia (IDA) is one of the most common nutritional disorders in the world. In the present study, we evaluated erythrocyte membrane fatty acid composition in premenopausal patients with IDA. Blood samples of 102 premenopausal women and 88 healthy control subjects were collected. After the erythrocytes were separated from the blood samples, the membrane lipids were carefully extracted, and the various membrane fatty acids were measured by gas chromatography (GC). Statistical analyses were performed with the SPSS software program. We used blood ferritin concentration <15 ng/mL as cut-off for the diagnosis of IDA. The five most abundant individual fatty acids obtained were palmitic acid (16:0), oleic acid (18:1, n-9c), linoleic acid (18:2, n-6c), stearic acid (18:0), and erucic acid (C22:1, n-9c). These compounds constituted about 87% of the total membrane fatty acids in patients with IDA, and 79% of the total membrane fatty acids in the control group. Compared with control subjects, case patients had higher percentages of palmitic acid (29.9% case versus 25.3% control), oleic acid (16.8% case versus 15.1% control), and stearic acid (13.5% case versus 10.5% control), and lower percentages of erucic acid (11.5% case versus 13.6% control) and linoleic acid (15.2% case versus 15.4% control) in their erythrocyte membranes. In conclusion, the total-erythrocyte-membrane saturated fatty acid (SFA) composition in premenopausal women with IDA was found to be higher than that in the control group; however, the total-erythrocyte-membrane unsaturated fatty acid (UFA) composition in premenopausal women with IDA was found to be lower than that in the control group. The differences in these values were statistically significant.

  17. Fatty acid composition of spermatozoa is associated with BMI and with semen quality.

    PubMed

    Andersen, J M; Rønning, P O; Herning, H; Bekken, S D; Haugen, T B; Witczak, O

    2016-09-01

    High body mass index (BMI) is negatively associated with semen quality. In addition, the composition of fatty acids of spermatozoa has been shown to be important for their function. The aim of the study was to examine the association between BMI and the composition of spermatozoa fatty acids in men spanning a broad BMI range. We also analysed the relation between fatty acid composition of spermatozoa and semen characteristics, and the relationship between serum fatty acids and spermatozoa fatty acids. One hundred forty-four men with unknown fertility status were recruited from the general population, from couples with identified female infertility and from morbid obesity centres. Standard semen analysis (WHO) and sperm DNA integrity (DFI) analysis were performed. Fatty acid compositions were assessed by gas chromatography. When adjusted for possible confounders, BMI was negatively associated with levels of sperm docosahexaenoic acid (DHA) (p < 0.001) and palmitic acid (p < 0.001). The amount of sperm DHA correlated positively with total sperm count (r = 0.482), sperm concentration (r = 0.469), sperm vitality (r = 0.354), progressive sperm motility (r = 0.431) and normal sperm morphology (r = 0.265). A negative association was seen between DHA levels and DNA fragmentation index (r = -0.247). Levels of spermatozoa palmitic acid correlated positively with total sperm count (r = 0.227), while levels of linoleic acid correlated negatively (r = -0.254). When adjusted for possible confounders, only the levels of arachidonic acid showed positive correlation between spermatozoa and serum phospholipids (r = 0.262). Changes in the fatty acid composition of spermatozoa could be one of the mechanisms underlying the negative association between BMI and semen quality. The relationship between fatty acids of spermatozoa and serum phospholipids was minor, which indicates that BMI affects fatty acid composition of spermatozoa through regulation of fatty acid

  18. Proximate composition, fatty acid and lipid class composition of the muscle from deep-sea teleosts and elasmobranchs.

    PubMed

    Økland, Hege M W; Stoknes, Iren S; Remme, Jannicke F; Kjerstad, Margareth; Synnes, Marianne

    2005-03-01

    Proximate composition of muscle was determined for the following deep-sea fish species: roughhead grenadier (Macrourus berglax), mora/deep-sea cod (Mora moro), Portuguese dogfish (Centroscymnus coelolepis), black dogfish (Centroscyllium fabricii), leafscale gulper shark (Centrophorus squamosus), greater lantern shark (Etmopterus princeps), smalleyed rabbitfish/ghostshark (Hydrolagus affinis), birdbeak dogfish (Deania calcea) and two species of smooth head (Alepocephalus bairdii and Alepocephalus agassizii). The first eight species contained less than 1% fat in the muscle, while the last two contained 3.0% and 3.6% fat, respectively. Fatty acid and lipid class composition was determined for the first five fish species and showed that the dominant class of lipids was phospholipids. The lipids consisted mainly of polyunsaturated fatty acids (PUFA), and docosahexaenoic acid (DHA) was the dominant fatty acid. Roughhead grenadier and mora showed resemblance to cod (Gadus morhua) regarding protein content, fat content and fatty acid composition. However, the muscle from the deep-sea fish species did contain a higher proportion of arachidonic acid (20:4n-6) than cod muscle.

  19. Fatty acid composition of Euphausia superba, Thysanoessa macrura and Euphausia crystallorophias collected from Prydz Bay, Antarctica

    NASA Astrophysics Data System (ADS)

    Yang, Guang; Li, Chaolun; Wang, Yanqing

    2016-04-01

    The information of trophic relationship is important for studying the Southern Ocean ecosystems. In this study, three dominant krill species, Euphausia superba, Thysanoessa macrura and Euphausia crystallorophias, were collected from Prydz Bay, Antarctica, during austral summer of 2009/2010. The composition of fatty acids in these species was studied. E. superba and T. macrura showed a similar fatty acid composition which was dominated by C14:0, C16:0, EPA (eicosapentenoic acid) and DHA (decosahexenoic acid) while E. crystallorophias showed higher contents of C18:1(n-9), C18:1(n-7), DHA and EPA than the former two. Higher fatty acid ratios of C18:1(n-9)/18:1(n-7), PUFA (polyunsaturated fatty acid)/SFA (saturated fatty acid), and 18PUFA/16PUFA indicated that E. crystallorophias should be classified as a typical omnivore with a higher trophic position compared with E. superba and T. macrura.

  20. Associations between plasma branched-chain amino acids, β-aminoisobutyric acid and body composition.

    PubMed

    Rietman, Annemarie; Stanley, Takara L; Clish, Clary; Mootha, Vamsi; Mensink, Marco; Grinspoon, Steven K; Makimura, Hideo

    2016-01-01

    Plasma branched-chain amino acids (BCAA) are elevated in obesity and associated with increased cardiometabolic risk. β-Aminoisobutyric acid (B-AIBA), a recently identified small molecule metabolite, is associated with decreased cardiometabolic risk. Therefore, we investigated the association of BCAA and B-AIBA with each other and with detailed body composition parameters, including abdominal visceral adipose tissue (VAT) and subcutaneous adipose tissue (SAT). A cross-sectional study was carried out with lean (n 15) and obese (n 33) men and women. Detailed metabolic evaluations, including measures of body composition, insulin sensitivity and plasma metabolomics were completed. Plasma BCAA were higher (1·6 (se 0·08) (×10(7)) v. 1·3 (se 0·06) (×10(7)) arbitrary units; P = 0·005) in obese v. lean subjects. BCAA were positively associated with VAT (R 0·49; P = 0·0006) and trended to an association with SAT (R 0·29; P = 0·052). The association between BCAA and VAT, but not SAT, remained significant after controlling for age, sex and race on multivariate modelling (P < 0·05). BCAA were also associated with parameters of insulin sensitivity (Matsuda index: R -0·50, P = 0·0004; glucose AUC: R 0·53, P < 0·001). BCAA were not associated with B-AIBA (R -0·04; P = 0·79). B-AIBA was negatively associated with SAT (R -0·37; P = 0·01) but only trended to an association with VAT (R 0·27; P = 0·07). However, neither relationship remained significant after multivariate modelling (P > 0·05). Plasma B-AIBA was associated with parameters of insulin sensitivity (Matsuda index R 0·36, P = 0·01; glucose AUC: R -0·30, P = 0·04). Plasma BCAA levels were positively correlated with VAT and markers of insulin resistance. The results suggest a possible complex role of adipose tissue in BCAA homeostasis and insulin resistance. PMID:27313851

  1. A "Green" route to adipic acid: direct oxidation of cyclohexenes with 30 percent hydrogen peroxide

    PubMed

    Sato; Aoki; Noyori

    1998-09-11

    Currently, the industrial production of adipic acid uses nitric acid oxidation of cyclohexanol or a cyclohexanol/cyclohexanone mixture. The nitrous oxide emission from this process measurably contributes to global warming and ozone depletion. Therefore, the development of an adipic acid production process that is less damaging to the environment is an important subject in chemical research. Cyclohexene can now be oxidized directly to colorless crystalline adipic acid with aqueous 30 percent hydrogen peroxide under organic solvent- and halide-free conditions, which could provide an ideal solution to this serious problem.

  2. Determination of fatty acid composition and quality characteristics of oils from palm fruits using solvent extraction

    NASA Astrophysics Data System (ADS)

    Kasmin, Hasimah; Lazim, Azwan Mat; Awang, Roila

    2015-09-01

    Palm oil contains about 45% of saturated palmitic acid and 39% of mono-unsaturated oleic acid. Investigations made in the past to trace the fatty acid composition in palm revealed that ripeness of fresh fruit bunch (FFB) affect oil composition. However, there is no evidence that processing operations affect oil composition, although different stage of processing does affect the quality of oil extracted. An improved method for sterilizing the oil palm fruits by dry heating, followed by oil extraction has been studied. This method eliminates the use of water, thus, increasing the extraction of lipid soluble. The objective of this study is to determine the possibility production of palm oil with different fatty acid composition (FAC) as well as the changes in quality from conventional milling. The unripe and ripe FFB were collected, sterilized and extracted using different method of solvent extraction. Preliminary data have shown that variation in FAC will also alter the physical and chemical properties of the oil extracted.

  3. Fatty acid composition as a tool for screening alternative feedstocks for production of biodiesel

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Fatty acid (FA) composition was used as a screening tool for the selection of feedstocks high in monounsaturated content for evaluation as biodiesel. The feedstocks were ailanthus (Ailanthus altissima), anise (Pimpinella anisum), arugula (Eruca vesicaria), camelina (Camelina sativa), coriander (Cori...

  4. Influence of glyphosate on amino acid composition of Egyptian broomrape.

    PubMed

    Nandula, V K; Westwood, J H; Foster, J G; Foy, C L

    2001-03-01

    The parasitic plant broomrape is entirely dependent on its host for reduced carbon and nitrogen and is also susceptible to inhibition by glyphosate that is translocated to the parasite through a host. Studies were conducted to examine the effect of broomrape parasitism on amino acid concentrations of two hosts: common vetch that is tolerant of low levels of glyphosate and oilseed rape that has been genetically engineered for glyphosate resistance. The influence of glyphosate on the amino acid content of broomrape and the two hosts was also examined. Amino acid concentrations in leaves and roots of parasitized common vetch plants were generally similar to those of the corresponding tissues of nonparasitized plants. Amino acid concentrations in broomrape were lower than those of the parasitized common vetch root. For common vetch, glyphosate applied at rates that selectively inhibited broomrape growth did not alter individual amino acid concentrations in the leaves, but generally increased amino acid levels at 0.18 kg ha-1. Glyphosate application also increased the amino acid concentrations, with the exception of arginine, of broomrape growing on common vetch and did not generally influence concentrations in leaves or roots of common vetch. In oilseed rape, parasitization by broomrape generally led to higher amino acid concentrations in leaves but lower concentrations in roots of parasitized plants. Broomrape had higher amino acid concentrations than roots of the parasitized oilseed rape. Glyphosate applied at 0.25 and 0.5 kg ha-1 generally increased the amino acid concentrations in oilseed rape leaves, but the 0.75 kg ha-1 application caused the amino acid concentrations to decrease compared to those of untreated plants. In oilseed rape root the general trend was an increase in the concentration of amino acids at the two highest rates of glyphosate. Individual amino acid concentrations in broomrape attachments growing on oilseed rape were generally increased

  5. Fatty Acid Composition and Conjugated Linoleic Acid Content in Different Carcass parts of Dağlıç Lambs

    PubMed Central

    Karabacak, Ali; Boztepe, Saim

    2014-01-01

    This study was conducted to compare fatty acid composition and content of conjugated linoleic acid (CLA) in different regions of sheep carcasses. Lambs of the Dağlıç breed were used for this purpose. Subsequent to a 68-day period of intensive fattening, fatty acids were examined in samples taken from the legs, shoulders, breasts, and ribs of lamb carcasses. According to the analysis, in leg, shoulder, breast, and rib, respectively, total saturated fatty acids (SFA) were found to be 40.38, 42.69, 42.56, and 40.27%, unsaturated fatty acids (MUFA) were found to be 40.38, 44.17, 46.17, and 49.50%, polyunsaturated fatty acids (PUFA) were found to be 4.79, 4.29, 3.80, and 3.72%, and CLAs were found to be 1.49, 1.69, 1.53, and 1.59%. PMID:24523647

  6. Robustness of two-step acid hydrolysis procedure for composition analysis of poplar.

    PubMed

    Bhagia, Samarthya; Nunez, Angelica; Wyman, Charles E; Kumar, Rajeev

    2016-09-01

    The NREL standard procedure for lignocellulosic biomass composition has two steps: primary hydrolysis in 72% wt sulfuric acid at 30°C for 1h followed by secondary hydrolysis of the slurry in 4wt% acid at 121°C for 1h. Although pointed out in the NREL procedure, the impact of particle size on composition has never been shown. In addition, the effects of primary hydrolysis time and separation of solids prior to secondary hydrolysis on composition have never been shown. Using poplar, it was found that particle sizes less than 0.250mm significantly lowered the glucan content and increased the Klason lignin but did not affect xylan, acetate, or acid soluble lignin contents. Composition was unaffected for primary hydrolysis time between 30 and 90min. Moreover, separating solids prior to secondary hydrolysis had negligible effect on composition suggesting that lignin and polysaccharides are completely separated in the primary hydrolysis stage. PMID:27282557

  7. Large scale synthesis of uniform silver@carbon rich composite (carbon and cross-linked PVA) sub-microcables by a facile green chemistry carbonization approach.

    PubMed

    Luo, Lin-Bao; Yu, Shu-Hong; Qian, Hai-Sheng; Gong, Jun-Yan

    2006-02-21

    A facile green chemistry carbonization method has been discovered for the synthesis of uniform silver@carbon rich composite (carbon and cross-linked polyvinyl alcohol) core-shell sub-microcables in large quantities, where the carbon sources such as glucose-based saccharides have played important roles in the formation of these novel sub-microcables. PMID:16465343

  8. Lipid complex effect on fatty acid profile and chemical composition of cow milk and cheese.

    PubMed

    Bodkowski, R; Czyż, K; Kupczyński, R; Patkowska-Sokoła, B; Nowakowski, P; Wiliczkiewicz, A

    2016-01-01

    The effect of administration of lipid complex (LC) on cow milk and cheese characteristics was studied. Lipid complex was elaborated based on grapeseed oil with synthesized conjugated linoleic acid (CLA) and Atlantic mackerel oil enriched in n-3 fatty acids. The 4-wk experiment was conducted on 30 Polish Holstein Friesian cows. The experimental group cow diet was supplemented with 400 g/d of LC (containing 38% CLA, and eicosapentaenoic acid + docosahexaenoic acid in a relative amount of 36.5%) on a humic-mineral carrier. The chemical composition and fatty acid profile of milk and rennet cheese from raw fresh milk were analyzed. Lipid complex supplementation of the total mixed ration had no effect on milk yield and milk composition, except fat content, which decreased from 4.6 to 4.1%, a 10.9% decrease. Milk from cows treated with LC had greater relative amounts of unsaturated fatty acids, particularly polyunsaturated fatty acids, and lesser relative amounts of saturated fatty acids. Lipid complex addition changed milk fat fatty acid profile: C18:2 cis-9,trans-11 and trans-10,cis-12 isomer (CLA) contents increased by 278 and 233%, respectively, as did eicosapentaenoic acid (C20:5) and docosahexaenoic acid (C22:6) contents. Milk fat fatty acid profile changes were correlated with the modifications in rennet cheese fatty acid profile. Lipid complex supplementation of dairy cows produced considerable changes in the biological value of milk and cheese fat.

  9. Lipid complex effect on fatty acid profile and chemical composition of cow milk and cheese.

    PubMed

    Bodkowski, R; Czyż, K; Kupczyński, R; Patkowska-Sokoła, B; Nowakowski, P; Wiliczkiewicz, A

    2016-01-01

    The effect of administration of lipid complex (LC) on cow milk and cheese characteristics was studied. Lipid complex was elaborated based on grapeseed oil with synthesized conjugated linoleic acid (CLA) and Atlantic mackerel oil enriched in n-3 fatty acids. The 4-wk experiment was conducted on 30 Polish Holstein Friesian cows. The experimental group cow diet was supplemented with 400 g/d of LC (containing 38% CLA, and eicosapentaenoic acid + docosahexaenoic acid in a relative amount of 36.5%) on a humic-mineral carrier. The chemical composition and fatty acid profile of milk and rennet cheese from raw fresh milk were analyzed. Lipid complex supplementation of the total mixed ration had no effect on milk yield and milk composition, except fat content, which decreased from 4.6 to 4.1%, a 10.9% decrease. Milk from cows treated with LC had greater relative amounts of unsaturated fatty acids, particularly polyunsaturated fatty acids, and lesser relative amounts of saturated fatty acids. Lipid complex addition changed milk fat fatty acid profile: C18:2 cis-9,trans-11 and trans-10,cis-12 isomer (CLA) contents increased by 278 and 233%, respectively, as did eicosapentaenoic acid (C20:5) and docosahexaenoic acid (C22:6) contents. Milk fat fatty acid profile changes were correlated with the modifications in rennet cheese fatty acid profile. Lipid complex supplementation of dairy cows produced considerable changes in the biological value of milk and cheese fat. PMID:26506539

  10. Fatty acid compositions of triglycerides and free fatty acids in sebum depend on amount of triglycerides, and do not differ in presence or absence of acne vulgaris.

    PubMed

    Akaza, Narifumi; Akamatsu, Hirohiko; Numata, Shigeki; Matsusue, Miyuki; Mashima, Yasuo; Miyawaki, Masaaki; Yamada, Shunji; Yagami, Akiko; Nakata, Satoru; Matsunaga, Kayoko

    2014-12-01

    To clarify the influence of the fatty acid composition of sebum in acne vulgaris, we investigated the amounts and fatty acid compositions of triglycerides (TG) and free fatty acids (FFA), and the amounts of cutaneous superficial Propionibacterium acnes in acne patients and healthy subjects. The foreheads of 18 female patients, 10 male patients, 10 healthy females and 10 healthy males were studied in a Japanese population. There were significant differences in the amounts of sebum, TG and cutaneous superficial P. acnes, as well as the fatty acid compositions of TG and FFA between acne patients and healthy subjects in females. Their fatty acid compositions were correlated with the amount of TG with or without acne. It was clarified that the fatty acid compositions of TG and FFA depended on the amount of TG, and there were no differences in the fatty acid composition in the presence and absence of acne.

  11. New estimation method for fatty acid composition in oil using near infrared spectroscopy.

    PubMed

    Sato, Tetsuo

    2002-12-01

    The absorption bands of cis-unsaturation and the carbon chain length of the fatty acid moieties in oil appear in the near infrared (NIR) wavelength region, especially around 1600-1800 nm. Using this region, a new estimation method for fatty acid composition analysis is proposed. Because the differences of the original NIR spectra are miniscule even in this region, the second derivative NIR spectra were examined in order to estimate the fatty acid composition in oil exclusively from the spectral patterns obtained. The parameters for calculating the second derivative NIR spectra were examined to make the spectral difference clearer. In any parameter, the absorption band was shifted to the shorter wavelength region when the unsaturation in fatty acid moieties increased, and it was shifted to the longer wavelength region when the carbon chain length increased. When the parameters were correct, this NIR method can estimate the fatty acid composition roughly, but simply, easily, and sometimes nondestructively.

  12. Changes in fatty acid and hydrocarbon composition of zooplankton assemblages related to environmental conditions

    SciTech Connect

    Lambert, R.M.

    1989-01-01

    Changes in zooplankton fatty acid and hydrocarbon patterns are described in relation to changes in environmental conditions and species composition. The regulation of zooplankton abundance by sea nettle-ctenophore interaction was examined in a small Rhode Island coastal pond. Sea nettles were nettles were able to eliminate ctenophores from the pond and subsequently zooplankton abundance increased. During one increase in zooplankton abundance, it was found that polyunsaturated fatty acids decreased while monounsaturated fatty acids increased. It was concluded that this shift in biochemical pattern was due to food limitation. In addition, zooplankton fatty acids were used in multivariate discriminant analysis to classify whether zooplankton were from coastal or estuarine environments. Zooplankton from coastal environments were characterized by higher monounsaturate fatty acids. Zooplankton hydrocarbon composition was affected by species composition and by pollution inputs. The presence of Calanus finmarchicus was detected by increased levels of pristane.

  13. Evaluating and predicting the oxidative stability of vegetable oils with different fatty acid compositions.

    PubMed

    Li, Hongyan; Fan, Ya-wei; Li, Jing; Tang, Liang; Hu, Jiang-ning; Deng, Ze-yuan

    2013-04-01

    The aim of this research was to evaluate the oxidative stabilities and qualities of different vegetable oils (almond, blend 1-8, camellia, corn, palm, peanut, rapeseed, sesame, soybean, sunflower, and zanthoxylum oil) based on peroxide value (PV), vitamin E content, free fatty acid, and fatty acid composition. The vegetable oils with different initial fatty acid compositions were studied under accelerated oxidation condition. It showed that PV and n-3 polyunsaturated fatty acid (PUFA) changed significantly during 21 d accelerated oxidation storage. Based on the changes of PV and fatty acid composition during the oxidation process, mathematical models were hypothesized and the models were simulated by Matlab to generate the proposed equations. These equations were established on the basis of the different PUFA contents as 10% to 28%, 28% to 46%, and 46% to 64%, respectively. The simulated models were proven to be validated and valuable for assessing the degree of oxidation and predicting the shelf life of vegetable oils.

  14. [FATTY ACID COMPOSITION ALTEROMONAS-LIKE BACTERIA ISOLATED FROM THE BLACK SEA WATER].

    PubMed

    Klochko, V V; Avdeeva, L V

    2015-01-01

    Alteromonas macleodii strains isolated from the Black sea water were similar in their fatty acids composition with the type strain of this species. Analysis of lipid composition of 10 A. macleodii strains isolated from the deep and surface water layers in different World ocean regions including the Black sea water has shown that the deep and surface isolates of this species formed two groups different in their fatty acids profiles. The Black sea isolates of Pseudoalteromonas haloplanktis, P. citrea, P. flavipulchra conformed to these species type strains in their fatty acids composition. On the basis of the fatty acids spectra similarity of three Pseudoalteromonas species strains with Plipolytica described in 2010 has been established. Presence of three isomers C16:1ψ7, C 16:1ψ9 and C16:1ψ6--components of hexadecenic acid in the Black sea isolates of Shewanella baltica has been shown. PMID:26638484

  15. Fatty acid composition of brown adipose tissue in genetically heat-tolerant FOK rats

    NASA Astrophysics Data System (ADS)

    Ohno, T.; Furuyama, F.; Kuroshima, A.

    The phospholipid fatty acid composition of brown adipose tissue (BAT) was examined in inbred heat-tolerant FOK rats and compared with that in conventional Wistar rats not previously exposed to heat. The FOK rats showed higher unsaturation states, as indicated by higher levels of polyunsaturated fatty acids and a higher unsaturation index and polyunsaturated fatty acids/saturated fatty acids ratio. This higher level of unsaturation was characterized by the higher amount of polyunsaturated fatty acids such as linoleic acid, arachidonic acid and docosahexaenoic acid. It may be concluded that the increased docosahexaenoic acid level in BAT phospholipids brings about the hyperplasia of BAT, causing an enhancement of its in vivo thermogernic activity as well as the systemic non-shivering thermogenesis observed in heat-tolerant FOK rats.

  16. Generalized green synthesis and formation mechanism of sponge-like ferrite micro-polyhedra with tunable structure and composition.

    PubMed

    Tong, Guoxiu; Du, Fangfang; Xiang, Lingjing; Liu, Fangting; Mao, Lulu; Guan, Jianguo

    2014-01-21

    This paper describes a green versatile glucose-engineered precipitation-sintering process that allows for the selective and mass preparation of spongy porous ferrite (M = Fe, Zn, Co, Ni, Mn, etc.) micro-polyhedra with tunable morphology, texture, and composition. Some kinetic factors, such as the molar ratio of glucose to metal nitrates, reaction temperature, sintering temperature and time, and type of metal nitrates, can be expediently employed to modulate their aspect ratio, shape, size, composition, and textural properties. In this protocol, glucose functions as a reductant, protecting agent, structure-directing agent, and a sacrificial template to guide the assembly of sheet-like nuclei into polyhedral precursors and the formation of spongy porous structures. Owing to larger EM parameters, multiresonant behavior, and dissipative current, spongy porous Fe3O4 polyhedra exhibited enhanced microwave-absorbing properties. This endows them with important potential applications in magnetic devices, catalysis, sorption, photoluminescence, electromagnetic wave absorbing materials, anode materials, and so on. Meanwhile, this general approach can be extended to synthesize other porous sponges with regular geometric configuration because it is simple, inexpensive, environmentally benign, and suitable for extensive production. PMID:24257742

  17. Curative and preventive activity of hydroxypropyl methylcellulose-lipid edible composite coatings containing antifungal food additives to control citrus postharvest green and blue molds.

    PubMed

    Valencia-Chamorro, Silvia A; Pérez-Gago, María B; Del Río, Miguel A; Palou, Lluís

    2009-04-01

    Edible composite coatings based on hydroxypropyl methylcellulose (HPMC), lipid components (beeswax and shellac), and food preservatives with antifungal properties were evaluated in vivo on clementine mandarins cv. Clemenules, hybrid mandarins cv. Ortanique, and oranges cv. Valencia. Their curative and preventive activity against citrus postharvest green (GM) and blue molds (BM), caused by Penicillium digitatum (PD) or Penicillium italicum (PI), respectively, were determined. Fruits were artificially inoculated before or after the application of the coatings and incubated up to 7 days at 20 degrees C. Selected food preservatives included mineral salts, organic acid salts, parabens, and 2-deoxy-d-glucose. Inoculated but uncoated fruits were used as controls. For curative activity, HPMC-lipid edible composite coatings containing sodium benzoate (SB) were most effective in reducing the incidence and severity of GM on clementine mandarins cv. Clemenules (86 and 90%, respectively). On this cultivar, the reduction in GM incidence by the SB-based coating was twice that of potassium sorbate (PS)-based coating. On mandarins cv. Ortanique, PS- and SB-based coatings reduced the incidence of GM and BM by more than 40 and 21%, respectively. However, the HPMC-lipid coating containing a mixture of PS and sodium propionate (PS + SP) exhibited a synergistic effect in the reduction of the incidence of GM (78%) and BM (67%). Coatings with parabens modestly reduced disease incidence and severity. On oranges cv. Valencia, coatings with food preservatives better controlled BM than GM. Coatings containing SB + PS and SB + SP reduced the incidence and severity of BM by 85% and 95%, respectively. PS- and SB- based coatings controlled GM more effectively than coatings formulated with other food preservatives. In every cultivar, fruit coated before inoculation did not show any incidence or severity reduction of both GM and BM (preventive activity). In every test, the antifungal action of the

  18. The Amino Acid Composition of the Sutter's Mill Carbonaceous Chondrite

    NASA Technical Reports Server (NTRS)

    Glavin, D. P.; Burton, A. S.; Elsila, J. E.; Dworkin, J. P.; Yin, Q. Z.; Cooper, G.; Jenniskens, P.

    2012-01-01

    In contrast to the Murchison meteorite which had a complex distribution of amino acids with a total C2 to Cs amino acid abundance of approx.14,000 parts-per-billion (ppb) [2], the Sutters Mill meteorite was found to be highly depleted in amino acids. Much lower abundances (approx.30 to 180 ppb) of glycine, beta-alanine, L-alanine and L-serine were detected in SM2 above procedural blank levels indicating that this meteorite sample experienced only minimal terrestrial amino acid contamination after its fall to Earth. Carbon isotope measurements will be necessary to establish the origin of glycine and beta-alanine in SM2. Other non-protein amino acids that are rare on Earth, yet commonly found in other CM meteorites such as aaminoisobutyric acid (alpha-AIB) and isovaline, were not identified in SM2. However, traces of beta-AIB (approx.1 ppb) were detected in SM2 and could be" extraterrestrial in origin. The low abundances of amino acids in the Sutter's Mill meteorite is consistent with mineralogical evidence that at least some parts of the Sutter's Mill meteorite parent body experienced extensive aqueous and/or thermal alteration.

  19. Maximized PUFA measurements improve insight in changes in fatty acid composition in response to temperature.

    PubMed

    van Dooremalen, Coby; Pel, Roel; Ellers, Jacintha

    2009-10-01

    A general mechanism underlying the response of ectotherms to environmental changes often involves changes in fatty acid composition. Theory predicts that a decrease in temperature causes an increase in unsaturation of fatty acids, with an important role for long-chain poly-unsaturated fatty acids (PUFAs). However, PUFAs are particularly unstable and susceptible to peroxidation, hence subtle differences in fatty acid composition can be challenging to detect. We determined the fatty acid composition in springtail (Collembola) in response to two temperatures (5 degrees C and 25 degrees C). First, we tested different sample preparation methods to maximize PUFAs. Treatments consisted of different solvents for primary lipid extraction, mixing with antioxidant, flushing with inert gas, and using different temperature exposures during saponification. Especially slow saponification at low temperature (90 min at 70 degrees C) in combination with replacement of headspace air with nitrogen during saponification and methylation maximized PUFAs for GC analysis. Applying these methods to measure thermal responses in fatty acid composition, the data showed that the (maximized) proportion of C(20) PUFAs increased at low acclimation temperature. However, C(18) PUFAs increased at high acclimation temperature, which is contrary to expectations. Our study illustrates that PUFA levels in lipids may often be underestimated and this may hamper a correct interpretation of differential responses of fatty acid composition. PMID:19557745

  20. Maximized PUFA measurements improve insight in changes in fatty acid composition in response to temperature.

    PubMed

    van Dooremalen, Coby; Pel, Roel; Ellers, Jacintha

    2009-10-01

    A general mechanism underlying the response of ectotherms to environmental changes often involves changes in fatty acid composition. Theory predicts that a decrease in temperature causes an increase in unsaturation of fatty acids, with an important role for long-chain poly-unsaturated fatty acids (PUFAs). However, PUFAs are particularly unstable and susceptible to peroxidation, hence subtle differences in fatty acid composition can be challenging to detect. We determined the fatty acid composition in springtail (Collembola) in response to two temperatures (5 degrees C and 25 degrees C). First, we tested different sample preparation methods to maximize PUFAs. Treatments consisted of different solvents for primary lipid extraction, mixing with antioxidant, flushing with inert gas, and using different temperature exposures during saponification. Especially slow saponification at low temperature (90 min at 70 degrees C) in combination with replacement of headspace air with nitrogen during saponification and methylation maximized PUFAs for GC analysis. Applying these methods to measure thermal responses in fatty acid composition, the data showed that the (maximized) proportion of C(20) PUFAs increased at low acclimation temperature. However, C(18) PUFAs increased at high acclimation temperature, which is contrary to expectations. Our study illustrates that PUFA levels in lipids may often be underestimated and this may hamper a correct interpretation of differential responses of fatty acid composition.

  1. [Fatty acid composition variability of rapeseed oil: classical selection and biotechnology].

    PubMed

    Sakhno, L A

    2010-01-01

    The problems and achievements in the rapeseed Brassica napus L. var. oleifera breeding directed on the change of fatty acid composition in seed oil with the use of traditional and genetic engineering approaches are analyzed. It is noticed that the combination of biotechnological workings out and methods of classical breeding is the optimum for the further improvement of rapeseed oil composition.

  2. Starch/fiber/poly(lactic acid) foam and compressed foam composites

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Composites of starch, fiber, and poly(lactic acid) (PLA) were made using a foam substrate formed by dehydrating starch or starch/fiber gels. PLA was infiltrated into the dry foam to provide better moisture resistance. Foam composites were compressed into plastics using force ranging from 4-76MPa. Te...

  3. New green polymeric composites based on hemp and natural rubber processed by electron beam irradiation.

    PubMed

    Stelescu, Maria-Daniela; Manaila, Elena; Craciun, Gabriela; Dumitrascu, Maria

    2014-01-01

    A new polymeric composite based on natural rubber reinforced with hemp has been processed by electron beam irradiation and characterized by several methods. The mechanical characteristics: gel fraction, crosslink density, water uptake, swelling parameters, and FTIR of natural rubber/hemp fiber composites have been investigated as a function of the hemp content and absorbed dose. Physical and mechanical properties present a significant improvement as a result of adding hemp fibres in blends. Our experiments showed that the hemp fibers have a reinforcing effect on natural rubber similar to mineral fillers (chalk, carbon black, silica). The crosslinking rates of samples, measured using the Flory-Rehner equation, increase as a result of the amount of hemp in blends and the electron beam irradiation dose increasing. The swelling parameters of samples significantly depend on the amount of hemp in blends, because the latter have hydrophilic characteristics.

  4. New Green Polymeric Composites Based on Hemp and Natural Rubber Processed by Electron Beam Irradiation

    PubMed Central

    Stelescu, Maria-Daniela; Craciun, Gabriela; Dumitrascu, Maria

    2014-01-01

    A new polymeric composite based on natural rubber reinforced with hemp has been processed by electron beam irradiation and characterized by several methods. The mechanical characteristics: gel fraction, crosslink density, water uptake, swelling parameters, and FTIR of natural rubber/hemp fiber composites have been investigated as a function of the hemp content and absorbed dose. Physical and mechanical properties present a significant improvement as a result of adding hemp fibres in blends. Our experiments showed that the hemp fibers have a reinforcing effect on natural rubber similar to mineral fillers (chalk, carbon black, silica). The crosslinking rates of samples, measured using the Flory-Rehner equation, increase as a result of the amount of hemp in blends and the electron beam irradiation dose increasing. The swelling parameters of samples significantly depend on the amount of hemp in blends, because the latter have hydrophilic characteristics. PMID:24688419

  5. Blue-green color and composition of Stejneger's beaked whale (Mesoplodon stejnegeri) milk.

    PubMed

    Ullrey, D E; Schwartz, C C; Whetter, P A; Rajeshwar Rao, T; Euber, J R; Cheng, S G; Brunner, J R

    1984-01-01

    Two hundred ml of milk were obtained from a lactating Stejneger's beaked whale stranded at Ninilchik, Alaska on 21 Oct, 1980. Total solids (41%) were similar to values reported for sperm and belukha whales, while fat (17%) was half as great and crude protein (17%) was 2-4 times greater than in milk of these species. Lactose was not detected. Calcium (0.22%) was greater than reported for pigmy sperm whales but less than for blue whales. Phosphorus (0.07%) was less than for any of the above species. Sodium and potassium concentrations were 0.13% and 0.11%, respectively. Values (microgram/g) for other elements analyzed (magnesium, 42; iron, 35; copper, 2.6; zinc, 1.5; manganese, 0.3; selenium, 0.36) have not been reported for whale milk. Based on SDS-gel electropherograms, this whale milk did not contain a whey protein corresponding to cattle milk alpha-lactalbumin. A blue-green pigment in the milk was identified as biliverdin.

  6. Sensitive Amino Acid Composition and Chirality Analysis with the Mars Organic Analyzer (MOA)

    NASA Technical Reports Server (NTRS)

    Skelley, Alison M.; Scherer, James R.; Aubrey, Andrew D.; Grover, William H.; Ivester, Robin H. C.; Ehrenfreund, Pascale; Grunthaner, Frank J.; Bada, Jeffrey L.; Mathies, Richard A.

    2005-01-01

    Detection of life on Mars requires definition of a suitable biomarker and development of sensitive yet compact instrumentation capable of performing in situ analyses. Our studies are focused on amino acid analysis because amino acids are more resistant to decomposition than other biomolecules, and because amino acid chirality is a well-defined biomarker. Amino acid composition and chirality analysis has been previously demonstrated in the lab using microfabricated capillary electrophoresis (CE) chips. To analyze amino acids in the field, we have developed the Mars Organic Analyzer (MOA), a portable analysis system that consists of a compact instrument and a novel multi-layer CE microchip.

  7. Green tea polyphenol epigallocatechin-O-gallate induces cell death by acid sphingomyelinase activation in chronic myeloid leukemia cells

    PubMed Central

    HUANG, YUHUI; KUMAZOE, MOTOFUMI; BAE, JAEHOON; YAMADA, SHUHEI; TAKAI, MIKA; HIDAKA, SHIORI; YAMASHITA, SHUYA; KIM, YOONHEE; WON, YEONGSEON; MURATA, MOTOKI; TSUKAMOTO, SHUNTARO; TACHIBANA, HIROFUMI

    2015-01-01

    An epidemiological study showed that green tea consumption is associated with a reduced risk of hematopoietic malignancy. The major green tea polyphenol epigallocatechin-3-O-gallate (EGCG) is reported to have anticancer effects. Chronic myeloid leukemia (CML) is a major hematopoietic malignancy characterized by expansion of myeloid cells. In the present study, we showed EGCG-induced acid sphingomyelinase (ASM) activation and lipid raft clustering in CML cells. The ASM inhibitor desipramine significantly reduced EGCG-induced cell death. Protein kinase Cδ is a well-known kinase that plays an important role in ASM activation. We observed EGCG-induced phos-phorylation of protein kinase Cδ at Ser664. Importantly, EGCG-induced ASM activation was significantly reduced by pretreatment of CML cells with the soluble guanylate cyclase inhibitor NS2028, suggesting that EGCG induced ASM activation through the cyclic guanosine monophosphate (cGMP)-dependent pathway. Indeed, pharmacological inhibition of a cGMP-negative regulator enhanced the anti-CML effect of EGCG. These results indicate that EGCG-induced cell death via the cGMP/ASM pathway in CML cells. PMID:26135316

  8. Antiviral activity of acidic polysaccharides from Coccomyxa gloeobotrydiformi, a green alga, against an in vitro human influenza A virus infection.

    PubMed

    Komatsu, Takayuki; Kido, Nobuo; Sugiyama, Tsuyoshi; Yokochi, Takashi

    2013-02-01

    The extracts prepared from green algae are reported to possess a variety of biological activities including antioxidant, antitumor and antiviral activities. The acidic polysaccharide fraction from a green alga Coccomyxa gloeobotrydiformi (CmAPS) was isolated and the antiviral action on an in vitro infection of influenza A virus was examined. CmAPS inhibited the growth and yield of all influenza A virus strains tested, such as A/H1N1, A/H2N2, A/H3N2 and A/H1N1 pandemic strains. The 50% inhibitory concentration of CmAPS on the infection of human influenza A virus strains ranged from 26 to 70 µg/mL and the antiviral activity of CmAPS against influenza A/USSR90/77 (H1N1) was the strongest. The antiviral activity of CmAPS was not due to the cytotoxicity against host cells. The antiviral activity of CmAPS required its presence in the inoculation of virus onto MDCK cells. Pretreatment and post-treatment with CmAPS was ineffective for the antiviral activity. CmAPS inhibited influenza A virus-induced erythrocyte hemagglutination and hemolysis. Taken together, CmAPS was suggested to exhibit the anti-influenza virus activity through preventing the interaction of virus and host cells. The detailed antiviral activity of CmAPS is discussed.

  9. Application of peanut butter to improve fatty acid composition of biscuits.

    PubMed

    Gajera, H P; Kapopara, M B; Patel, V H

    2010-06-01

    Biscuits prepared with different levels of hydrogenated fat (vanaspati) and peanut (Arachis hypogaea L.) butter (PB) (100:00, 75:25, 50;50, 25;75, 00:100) were evaluated for their fatty acid composition and textural property. Saturated fatty acids like myristic, palmitic, stearic acids were higher in control biscuits (100% vanaspati), which decreased with increasing proportion of PB in the experimental biscuits. Oleic acid and linoleic acid were lowest in control biscuits and it gradually increased upon incorporation of PB. The hardness of biscuits also increased with increasing proportion of PB. Overall sensory quality of experimental biscuits improved when 50% vanaspati replaced by PB in the standard biscuits recipe. Biscuits prepared with 50% supplementation of PB had better fatty acid composition with balanced oil quality and also had a greater acceptability by sensory evaluation panel.

  10. Analysis of fatty acid composition of sea cucumber Apostichopus japonicus using multivariate statistics

    NASA Astrophysics Data System (ADS)

    Xu, Qinzeng; Gao, Fei; Xu, Qiang; Yang, Hongsheng

    2014-11-01

    Fatty acids (FAs) provide energy and also can be used to trace trophic relationships among organisms. Sea cucumber Apostichopus japonicus goes into a state of aestivation during warm summer months. We examined fatty acid profiles in aestivated and non-aestivated A. japonicus using multivariate analyses (PERMANOVA, MDS, ANOSIM, and SIMPER). The results indicate that the fatty acid profiles of aestivated and non-aestivated sea cucumbers differed significantly. The FAs that were produced by bacteria and brown kelp contributed the most to the differences in the fatty acid composition of aestivated and nonaestivated sea cucumbers. Aestivated sea cucumbers may synthesize FAs from heterotrophic bacteria during early aestivation, and long chain FAs such as eicosapentaenoic (EPA) and docosahexaenoic acid (DHA) that produced from intestinal degradation, are digested during deep aestivation. Specific changes in the fatty acid composition of A. japonicus during aestivation needs more detailed study in the future.

  11. A citric acid-based hydroxyapatite composite for orthopedic implants.

    PubMed

    Qiu, Hongjin; Yang, Jian; Kodali, Pradeep; Koh, Jason; Ameer, Guillermo A

    2006-12-01

    We describe a novel approach to process bioceramic microparticles and poly(diol citrates) into bioceramic-elastomer composites for potential use in orthopedic surgery. The composite consists of the biodegradable elastomer poly(1,8-octanediol-citrate) (POC) and the bioceramic hydroxyapatite (HA). The objective of this work was to characterize POC-HA composites and assess the feasibility of fabricating tissue fixation devices using machining and molding techniques. The mechanical properties of POC-HA composites with HA (40, 50, 60, 65wt.%) were within the range of values reported for tissue fixation devices (for POC-HA 65wt.%, S(b)=41.4+/-3.1, E(b)=501.7+/-40.3, S(c)=74.6+/-9.0, E(c)=448.8+/-27.0, S(t)=9.7+/-2.3, E(t)=334.8+/-73.5, S(s)=27.7+/-2.4, T(s)=27.3+/-4.9, all values in MPa). At 20 weeks, the weight loss of POC-HA composites ranged between 8 and 12wt.%, with 65wt.% HA composites degrading the slowest. Exposure of POC-HA to simulated body fluid resulted in extensive mineralization in the form of calcium phosphate with Ca/P of 1.5-1.7 similar to bone. POC-HA supported osteoblast adhesion in vitro and histology results from POC-HA samples that were implanted in rabbit knees for 6 weeks suggest that the composite is biocompatible. Synthesis of POC-HA is easy and inexpensive, does not involve harsh solvents or initiators, and the mechanical properties of POC-HA with 65wt.% HA are suitable for the fabrication of potentially osteoconductive bone screws.

  12. Fatty acid composition of erythrocyte, platelet, and serum lipids in strict vegans.

    PubMed

    Agren, J J; Törmälä, M L; Nenonen, M T; Hänninen, O O

    1995-04-01

    The fatty acid composition of erythrocytes, platelets, and serum lipids was compared between subjects who had been eating a strict uncooked vegan diet ("living food") for years and omnivore controls. The vegan diet contains equal amounts of fat but more monounsaturated and polyunsaturated and less saturated fatty acids than the mixed diet of the control group. In vegans, the proportion of linoleic acid was greater in all lipid fractions studied. Also, the levels of other n-6 fatty acids were greater, with the exception of arachidonic acid levels, which were similar in most fractions. In erythrocytes, platelets and serum phospholipid fractions, this increase was mainly at the expense of the n-3 fatty acids. The proportions of eicosapentaenoic and docosahexaenoic acid were only 29-36% and 49-52% of those in controls, respectively. In vegans the ratio of n-3 to n-6 fatty acids was only about half that in omnivores. In addition to the lower levels of n-3 fatty acids, the proportions of palmitic and stearic acids were lower in serum cholesteryl esters, triglycerides and free fatty acids of vegans. The proportion of oleic acid was slightly lower only in serum cholesteryl esters and erythrocyte phosphatidylserine. The results show that, in the long term, the vegan diet has little effect on the proportions of oleic and arachidonic acids, whereas the levels of n-3 fatty acids are depressed to very low levels with prolonged consumption of the high linoleic and oleic acid components of this diet.

  13. Comparative study of aluminum and copper transport and toxicity in an acid-tolerant freshwater green alga

    SciTech Connect

    Folsom, B.R.; Popescu, N.A.; Wood, J.M.

    1986-06-01

    A comparative study of the transport and toxicity of one nonessential metal (aluminum), and one essential metal (copper), has been performed with the acid-tolerant green alga Chlorella saccarophila. This organism was isolated from a naturally acidified lake and grows well in laboratory cultures at pH 3.0. Our results show that the fast-exchange ions Ca/sup 2 +/, Mg/sup 2 +/, and Na/sup +/ offer some protection against both Al/sup 3 +/ and Cu/sup 2 +/ toxicity whereas K/sup +/ protects against Al/sup 3 +/ toxicity but enhances Cu/sup 2 +/ toxicity. Plasma emission spectroscopy shows that complexation of Al/sup 3 +/ and Fe/sup 3 +/ to cell surfaces is important in preventing toxic cytoplasmic levels of these metals, both in culture media and in acid mine water. The aqueous ion chemistry for toxic metal uptake is simplified considerably in acidic conditions, where competing hydrolysis and precipitation reactions are eliminated. Therefore, simple competitive experiments can be performed quantitatively. 12 references, 7 figures, 1 table.

  14. Investigating Acid Production by Streptococcus mutans with a Surface-Displayed pH-Sensitive Green Fluorescent Protein

    PubMed Central

    Guo, Lihong; Hu, Wei; He, Xuesong; Lux, Renate; McLean, Jeff; Shi, Wenyuan

    2013-01-01

    Acidogenicity and aciduricity are the main virulence factors of the cavity-causing bacterium Streptococcus mutans. Monitoring at the individual cell level the temporal and spatial distribution of acid produced by this important oral pathogen is central for our understanding of these key virulence factors especially when S. mutans resides in multi-species microbial communities. In this study, we explored the application of pH-sensitive green fluorescent proteins (pHluorins) to investigate these important features. Ecliptic pHluorin was functionally displayed on the cell surface of S. mutans as a fusion protein with SpaP. The resulting strain (O87) was used to monitor temporal and spatial pH changes in the microenvironment of S. mutans cells under both planktonic and biofilm conditions. Using strain O87, we revealed a rapid pH drop in the microenviroment of S. mutans microcolonies prior to the decrease in the macro-environment pH following sucrose fermentation. Meanwhile, a non-uniform pH distribution was observed within S. mutans biofilms, reflecting differences in microbial metabolic activity. Furthermore, strain O87 was successfully used to monitor the S. mutans acid production profiles within dual- and multispecies oral biofilms. Based on these findings, the ecliptic pHluorin allows us to investigate in vivo and in situ acid production and distribution by the cariogenic species S. mutans. PMID:23468929

  15. Efficient removal of malachite green dye using biodegradable graft copolymer derived from amylopectin and poly(acrylic acid).

    PubMed

    Sarkar, Amit Kumar; Pal, Aniruddha; Ghorai, Soumitra; Mandre, N R; Pal, Sagar

    2014-10-13

    This article reports on the application of a high performance biodegradable adsorbent based on amylopectin and poly(acrylic acid) (AP-g-PAA) for removal of toxic malachite green dye (MG) from aqueous solution. The graft copolymer has been synthesized and characterized using various techniques including FTIR, GPC, SEM and XRD analyses. Biodegradation study suggests that the co-polymer is biodegradable in nature. The adsorbent shows excellent potential (Qmax, 352.11 mg g(-1); 99.05% of MG has been removed within 30 min) for removal of MG from aqueous solution. It has been observed that point to zero charge (pzc) of graft copolymer plays significant role in adsorption efficacy. The adsorption kinetics and isotherm follow pseudo-second order and Langmuir isotherm models, respectively. Thermodynamics parameters suggest that the process of dye uptake is spontaneous. Finally desorption study shows excellent regeneration efficiency of adsorbent.

  16. The blood pressure-lowering effect and safety of chlorogenic acid from green coffee bean extract in essential hypertension.

    PubMed

    Watanabe, Takuya; Arai, Yoichi; Mitsui, Yuki; Kusaura, Tatsuya; Okawa, Wataru; Kajihara, Yasushi; Saito, Ikuo

    2006-07-01

    Chlorogenic acids (CGA) in green coffee bean extract (GCE) reduce blood pressure in spontaneously hypertensive rats and humans. The authors examined the blood pressure-lowering effect and safety of CGA in patients with mild hypertension through a placebo-controlled, randomized clinical trial. Subjects (n = 28) were randomized to receive treatment with CGA (140 mg/day) from GCE or placebo. Blood pressure, pulse rate, body mass index, routine blood test, hematochemistry, urinalysis, and subjective symptoms were recorded throughout the study. In the CGA group, but not the placebo group, blood pressure (systolic and diastolic) decreased significantly during the ingestion period. There was no difference in body mass index and pulse rate between groups, nor were there any apparent side effects. Thus, CGA from GCE is effective in decreasing blood pressure and safe for patients with mild hypertension.

  17. Inhibition of corneal neovascularization with a nutrient mixture containing lysine, proline, ascorbic acid, and green tea extract.

    PubMed

    Shakiba, Yadollah; Mostafaie, Ali

    2007-10-01

    Corneal neovascularization is a significant, sight-threatening complication of many ocular surface disorders. Various growth factors and proteinases are involved in corneal neovascularization. The data supporting a causal role for vascular endothelial growth factor (VEGF) and matrix metalloproteinases (MMPs) are extensive. Inhibition of VEGF and MMPs is a main strategy for treating corneal neovascularization. Several findings have shown that corneal neovascularization can be reduced by using anti-VEGF and anti-MMPs agents. Efficacy of a nutrient mixture (NM) containing lysine, proline, ascorbic acid, and green tea extract has been demonstrated for reducing VEGF and MMPs secretion by various cells. Moreover, NM can inhibit endothelial cell migration and capillary tube formation. We herein note that topical application of NM is potentially useful for inhibiting corneal neovascularization and restoration of corneal clarity. Further investigations in animal models are needed to place NM alongside corneal neovascularization therapeutics.

  18. Fatty acid composition and egg components of specialty eggs.

    PubMed

    Cherian, G; Holsonbake, T B; Goeger, M P

    2002-01-01

    Egg components, total fat, and fatty acid content of specialty eggs were compared. One dozen eggs were collected and analyzed from each of five different brands from hens fed a diet free of animal fat (SP1), certified organic free-range brown eggs (SP2), uncaged unmedicated brown eggs (SP3), cage-free vegetarian diet brown eggs (SP4), or naturally nested uncaged (SP5). Regular white-shelled eggs were the control. A significant (P < 0.05) difference was observed in the egg components and fatty acid content in different brands. The percentage of yolk was lower (P < 0.05) in SP2 and SP4 with a concomitant increase (P < 0.05) in the percentage of white. The percentage of shell was lower (P < 0.05) in SP4 and SP5. The total edible portion was greater in SP4 and SP5. The yolk:white ratio was greater (P < 0.05) in SP3. The total lipid content was lower in SP4 eggs. The content of palmitic (C16:0), stearic (C18:0), and total saturated fatty acids were lower (P < 0.05) in SP1. No difference was observed in the content of palmitoleic (C16:1), oleic (C18:1), or total monounsaturated fatty acids. The content of n-3 fatty acids in SP2, SP4, and SP5 were similar to control eggs. The ratio of total n-6:n-3 polyunsaturated fatty acids ranged from 39.2 for SP5 to 11.5 for SP1 (P < 0.05). No difference was observed in the total polyunsaturated fatty acid content of eggs (P > 0.05).

  19. Composition of antioxidants and amino acids in Stevia leaf infusions.

    PubMed

    Periche, Angela; Koutsidis, Georgios; Escriche, Isabel

    2014-03-01

    Stevia, a non-caloric natural sweetener with beneficial properties and considerable antioxidants and amino acids, is increasingly consumed as an infusion. This work evaluates the influence of the conditions (temperature: 50, 70 or 90 °C and time: 1, 5, 20 or 40 min) applied to obtain Stevia infusions, on antioxidants (total phenols, flavonoids and antioxidant activity) and amino acids. The total concentration of the eleven amino acids found was 11.70 mg/g in dried leaves and from 6.84 to 9.11 mg/g per gram of Stevia in infusions. However, infusions showed higher levels of certain amino acids (alanine, asparagine, leucine and proline), and greater values of the three antioxidant parameters in comparison with dry leaves. Temperature had more influence (minimum values at 50 °C and maximum at 90 °C) than time in the case of antioxidants. At 90 °C there were no important increases in the extraction of antioxidant compounds after 5 min; each gram of Stevia had 117 mg trolox (total antioxidant activity), 90 mg gallic acid (total phenols) and 56 mg catechin equivalents (flavonoids). Varying the temperature and time conditions no notable differences were observed in the concentrations of the majority of amino acids. However, the infusion treatment at 90 °C for 5 min was the best, as it gave the highest yield of 8 of the 11 amino acids. Therefore, with respect to the compounds analyzed in this study, the best way to obtain Stevia leaf infusions is the same as the domestic process, almost boiling water for a short time.

  20. Compositions containing amino acids, phosphate and manganese and their uses

    DOEpatents

    Daly, Michael J.; Gaidamakova, Elena K.

    2016-01-12

    The invention provides methods of producing vaccines directed against microorganisms, with the methods comprising culturing, harvesting and/or suspending the microorganism in the presence of a radiation-protective composition and irradiating the bacteria or viruses with a dose of radiation sufficient to render the microorganism replication-deficient and/or non-infective. The radiation-protective compositions used in the methods of the present invention comprise at least one nucleoside, at least one antioxidant and at least one small peptide. The invention also provides methods of rendering bacteria in culture resistant to ionizing radiation (IR), with these methods comprising culturing the bacteria in the presence of a radiation-protective composition.

  1. Carbon composite micro- and nano-tubes-based electrodes for detection of nucleic acids

    PubMed Central

    2011-01-01

    The first aim of this study was to fabricate vertically aligned multiwalled carbon nanotubes (MWCNTs). MWCNTs were successfully prepared by using plasma enhanced chemical vapour deposition. Further, three carbon composite electrodes with different content of carbon particles with various shapes and sizes were prepared and tested on measuring of nucleic acids. The dependences of adenine peak height on the concentration of nucleic acid sample were measured. Carbon composite electrode prepared from a mixture of glassy and spherical carbon powder and MWCNTs had the highest sensitivity to nucleic acids. Other interesting result is the fact that we were able to distinguish signals for all bases using this electrode. PMID:21711910

  2. Effects of fatty acid oxidation products (green odor) on rumen bacterial populations and lipid metabolism in vitro.

    PubMed

    Lee, M R F; Huws, S A; Scollan, N D; Dewhurst, R J

    2007-08-01

    This study investigated the effects of green odor fatty acid oxidation products (FAOP) from cut grass on lipid metabolism and microbial ecology using in vitro incubations of rumen microorganisms. These compounds have antimicrobial roles in plant defense, and we hypothesized that they may influence rumen lipid metabolism. Further, they may partially explain the higher levels of conjugated linoleic acid cis-9, trans-11 in milk from cows grazing pasture. The first of 2 batch culture experiments screened 6 FAOP (1 hydroperoxide, 3 aldehydes, 1 ketone, and 1 alcohol) for effects on lipid profile, and in particular C(18) polyunsaturated fatty acid biohydrogenation. Experiment 2 used the most potent FAOP to determine effects of varying concentrations and identify relationships with effects on microbial ecology. Batch cultures contained anaerobic buffer, rumen liquor, and FAOP to a final concentration of 100 microM for experiment 1. Triplicates for each compound and controls (water addition) were incubated at 39 degrees C for 6 h. The hydroperoxide (1,2-dimethylethyl hydroperoxide, 1,2-DMEH) and the long chain aldehyde (trans-2 decenal) had the largest effects on lipid metabolism with significant increases in C(18:0) and C(18:1) trans and reductions in C(12:0), C(14:0), C(16:0), C(18:1) cis, C(18:2n-6), C(18:3n-3), C(20:0) and total branch and odd chain fatty acids compared with the control. This was associated with significantly higher biohydrogenation of C(18) polyunsaturated fatty acid. In experiment 2, 1,2-DMEH was incubated at 50, 100, and 200 microM for 2, 6, and 24 h. Increasing 1,2-DMEH concentration resulted in a significant linear increase in C(18:1) trans-10, trans-11, conjugated linoleic acid, and C(18:0) and a linear decrease in C(18:2n-6) and C(18:3n-3), although the scale of this response declined with time. Microbial profiling techniques showed that 1,2-DMEH at concentrations of 100 and 200 microM changed the microbial community from as early as 2 h after

  3. Fatty acid composition of lipopolysaccharides of the strains of different species of Yersinia.

    PubMed

    Frolov, A F; Ruban, N M; Vasyurenko, Z P

    1989-01-01

    The fatty acid composition of lipopolysaccharides of the strains of Y. enterocolitica, Y. intermedia, Y. frederiksenii and Y. ruckeri studied during cultivation on meat-peptone agar is characterized by the predominance of 3-hydroxytetradecanoic and dodecanoic acids. Closely related to the mentioned bacteria is the strain of Y. kristensenii which is distinguished only by its higher level of hexadecanoic acid. The strains of Y. pseudotuberculosis and the vaccine strain of Y. pestis have a uniform fatty acid composition of lipopolysaccharides with predominance of 3-hydroxytetradecanoic acid. Their relatively low level of dodecanoic acid conditions the characteristic fatty acid spectrum of lipopolysaccharides which differs from that of the above mentioned group of Yersinia. The peculiarities of the fatty acid composition of lipopolysaccharides of both groups of Yersinia are preserved during growth on meat-peptone broth, but the increase in the level of hexadecanoic acid balances the differences between Y. kristensenii, the other Y. enterocolitica-like bacteria and Y. ruckeri. The obtained results confirm close relationship of Y. pseudotuberculosis and Y. pestis, and also of Y. enterocolitica and Y. enterocolitica-like bacteria, showing propinquity of Y. ruckeri to the latter.

  4. Fatty acid composition and extreme temperature tolerance following exposure to fluctuating temperatures in a soil arthropod.

    PubMed

    van Dooremalen, Coby; Suring, Wouter; Ellers, Jacintha

    2011-09-01

    Ectotherms commonly adjust their lipid composition to ambient temperature to counteract detrimental thermal effects on lipid fluidity. However, the extent of lipid remodeling and the associated fitness consequences under continuous temperature fluctuations are not well-described. The objective of this study was to investigate the effect of repeated temperature fluctuations on fatty acid composition and thermal tolerance. We exposed the springtail Orchesella cincta to two constant temperatures of 5 and 20°C, and a continuously fluctuating treatment between 5 and 20°C every 2 days. Fatty acid composition differed significantly between constant low and high temperatures. As expected, animals were most cold tolerant in the low temperature treatment, while heat tolerance was highest under high temperature. Under fluctuating temperatures, fatty acid composition changed with temperature initially, but later in the experiment fatty acid composition stabilized and closely resembled that found under constant warm temperatures. Consistent with this, heat tolerance in the fluctuating temperature treatment was comparable to the constant warm treatment. Cold tolerance in the fluctuating temperature treatment was intermediate compared to animals acclimated to constant cold or warmth, despite the fact that fatty acid composition was adjusted to warm conditions. This unexpected finding suggests that in animals acclimated to fluctuating temperatures an additional underlying mechanism is involved in the cold shock response. Other aspects of homeoviscous adaptation may protect animals during extreme cold. This paper forms a next step to fully understand the functioning of ectotherms in more thermally variable environments. PMID:21704631

  5. Salicylhydroxamic acid (SHAM) inhibition of the dissolved inorganic carbon concentrating process in unicellular green algae

    SciTech Connect

    Goyal, A.; Tolbert, N.E. )

    1990-03-01

    Rates of photosynthetic O{sub 2} evolution, for measuring K{sub 0.5}(CO{sub 2} + HCO{sub 3}{sup {minus}}) at pH 7, upon addition of 50 micromolar HCO{sub 3}{sup {minus}} to air-adapted Chlamydomonas, Dunaliella, or Scenedesmus cells, were inhibited up to 90% by the addition of 1.5 to 4.0 millimolar salicylhydroxamic acid (SHAM) to the aqueous medium. The apparent K{sub i}(SHAM) for Chlamydomonas cells was about 2.5 millimolar, but due to low solubility in water effective concentrations would be lower. Salicylhydroxamic acid did not inhibit oxygen evolution or accumulation of bicarbonate by Scenedesmus cells between pH 8 to 11 or by isolated intact chloroplasts from Dunaliella. Thus, salicylhydroxamic acid appears to inhibit CO{sub 2} uptake, whereas previous results indicate that vanadate inhibits bicarbonate uptake. These conclusions were confirmed by three test procedures with three air-adapted algae at pH 7. Salicylhydroxamic acid inhibited the cellular accumulation of dissolved inorganic carbon, the rate of photosynthetic O{sub 2} evolution dependent on low levels of dissolved inorganic carbon (50 micromolar NaHCO{sub 3}), and the rate of {sup 14}CO{sub 2} fixation with 100 micromolar ({sup 14}C)HCO{sub 3}{sup {minus}}. Salicylhydroxamic acid inhibition of O{sub 2} evolution and {sup 14}CO{sub 2}-fixation was reversed by higher levels of NaHCO{sub 3}. Thus, salicylhydroxamic acid inhibition was apparently not affecting steps of photosynthesis other than CO{sub 2} accumulation. Although salicylhydroxamic acid is an inhibitor of alternative respiration in algae, it is not known whether the two processes are related.

  6. Salicylhydroxamic Acid (SHAM) Inhibition of the Dissolved Inorganic Carbon Concentrating Process in Unicellular Green Algae.

    PubMed

    Goyal, A; Tolbert, N E

    1990-03-01

    Rates of photosynthetic O(2) evolution, for measuring K(0.5)(CO(2) + HCO(3) (-)) at pH 7, upon addition of 50 micromolar HCO(3) (-) to air-adapted Chlamydomonas, Dunaliella, or Scenedesmus cells, were inhibited up to 90% by the addition of 1.5 to 4.0 millimolar salicylhydroxamic acid (SHAM) to the aqueous medium. The apparent K(1)(SHAM) for Chlamydomonas cells was about 2.5 millimolar, but due to low solubility in water effective concentrations would be lower. Salicylhydroxamic acid did not inhibit oxygen evolution or accumulation of bicarbonate by Scenedesmus cells between pH 8 to 11 or by isolated intact chloroplasts from Dunaliella. Thus, salicylhydroxamic acid appears to inhibit CO(2) uptake, whereas previous results indicate that vanadate inhibits bicarbonate uptake. These conclusions were confirmed by three test procedures with three air-adapted algae at pH 7. Salicylhydroxamic acid inhibited the cellular accumulation of dissolved inorganic carbon, the rate of photosynthetic O(2) evolution dependent on low levels of dissolved inorganic carbon (50 micromolar Na-HCO(3)), and the rate of (14)CO(2) fixation with 100 micromolar [(14)C] HCO(3) (-). Salicylhydroxamic acid inhibition of O(2) evolution and (14)CO(2)-fixation was reversed by higher levels of NaHCO(3). Thus, salicylhydroxamic acid inhibition was apparently not affecting steps of photosynthesis other than CO(2) accumulation. Although salicylhydroxamic acid is an inhibitor of alternative respiration in algae, it is not known whether the two processes are related.

  7. Complete doping in solid-state by silica-supported perchloric acid as dopant solid acid: Synthesis and characterization of the novel chiral composite of poly [(±)-2-(sec-butyl) aniline

    NASA Astrophysics Data System (ADS)

    Farrokhzadeh, Abdolkarim; Modarresi-Alam, Ali Reza

    2016-05-01

    Poly [(±)-2-(sec-butyl) aniline]/silica-supported perchloric acid composites were synthesized by combination of poly[(±)-2-sec-butylaniline] base (PSBA) and the silica-supported perchloric acid (SSPA) as dopant solid acid in solid-state. The X-ray photoelectron spectroscopy (XPS) and CHNS results confirm nigraniline oxidation state and complete doping for composites (about 75%) and non-complete for the PSBA·HCl salt (about 49%). The conductivity of samples was (≈0.07 S/cm) in agreement with the percent of doping obtained of the XPS analysis. Also, contact resistance was determined by circular-TLM measurement. The morphology of samples by the scanning electron microscopy (SEM) and their coating were investigated by XPS, SEM-map and energy-dispersive X-ray spectroscopy (EDX). The key benefits of this work are the preparation of conductive chiral composite with the delocalized polaron structure under green chemistry and solid-state condition, the improvement of the processability by inclusion of the 2-sec-butyl group and the use of dopant solid acid (SSPA) as dopant.

  8. Genotype, production system and sex effects on fatty acid composition of meat from goat kids.

    PubMed

    Özcan, Mustafa; Demirel, Gulcan; Yakan, Akın; Ekiz, Bülent; Tölü, Cemil; Savaş, Türker

    2015-02-01

    Two trials were performed to assess the meat fatty acid profile of goat kids from different genotypes, production systems and sex. In the first trial, genotype effect was determined in 24 suckling male kids from Turkish Saanen, Maltese and Gokceada breeds. In the second trial, male and female Gokceada Goat kids were used to compare the effect of extensive and semi-intensive production systems on fatty acid composition of meat. Significant genotype effect was observed in the percentages of myristic acid (C14:0), palmitic acid (C16:0), oleic acid (C18:1 n-9), linolenic acid (C18:3 n-3), arachidonic acid (C20:4 n-6) and docosahexaenoic acid (C22:6 n-3), despite no differences on the ratios of polyunsaturated fatty acids to saturated fatty acids (PUFA/SFA) and n-6/n-3 (P > 0.05). The effect of production system had also significant effects on fatty acids, but sex only influenced significantly stearic acid (C18:0), C18:1 n-9 and C18:3 n-3 fatty acids and total PUFA level and PUFA/SFA ratio. This study confirms that dairy breeds are prone to produce higher levels of unsaturated fatty acids in their muscle. Meanwhile, meat from Gokceada goat kids, which is one of the indigenous breeds in Turkey, had similar PUFA/SFA and n-6/n-3 ratios to Turkish Saanen and Maltase.

  9. Amino acid composition of cadmium-binding protein induced in a marine diatom

    SciTech Connect

    Maita, Y.; Kawaguchi, S. )

    1989-09-01

    Organisms living in environments polluted with heavy metals develop tolerance against these contaminants. The tolerance has been attributed to the ability to synthesize metal binding substances. These recent findings imply metal binding complexes from animals and plants, although having very similar functional properties, may have entirely different amino acid compositions. Researchers reported that cadystin from fission yeast, Schizosaccharomyces pombe was composed of only glutamic acid, cysteine, and glycine. A year later, a heavy metal binding substance was isolated from Rauwolfia serpetina which contains only Glu, Cys, and Gly. Heavy metal binding complexes isolated from the water hyacinth and morning glory Datura innoxia also showed an amino acid composition similar to cadystin or phytochelatin. In this study, the cadmium binding protein induced in the marine diatom, Phaeodactylum tricornutum, was isolated and purified and its amino acid composition determined.

  10. Quality assessment of Iberian pigs through backfat ultrasound characterization and fatty acid composition.

    PubMed

    Niñoles, L; Clemente, G; Ventanas, S; Benedito, J

    2007-05-01

    Five batches of Iberian pig backfat of different breeds and with differing feeding regimes were analysed as to their fatty acid composition and textural, thermal and ultrasonic properties. The feeding regime affected the backfat composition more than the breed of the animals. The higher the oleic acid content in the feeding regime, the higher the monounsaturated fatty acid content in the samples. Ultrasonic velocities ranged from 1609 to 1631m/s. A change in the slope of the velocity versus temperature curve was found at 6°C, coincident with a change in the melting rate found in the differential scanning calorimetry. Discriminant analysis using ultrasonic measurements allowed 94.7% of the samples to be correctly classified in the batches considered, while the use of the fatty acids composition correctly classified 86.2% of the samples. Therefore, ultrasonic techniques could be useful in the characterization and classification of backfat samples from Iberian pigs.

  11. Phytic acid in green leaves of herbaceous plants-temporal variation in situ and response to different nitrogen/phosphorus fertilizing regimes.

    PubMed

    Alkarawi, Hassan Hadi; Zotz, Gerhard

    2014-08-13

    Phytic acid is the major storage compound for phosphorus (P) in plants. While accounting for up to 90 % in many seeds, usually only <10 % of total P is found in phytic acid in green leaves. This study follows up on the findings of a recent review of the occurrence of phytic acid in green leaves which revealed that (i) the current knowledge of phytic acid in leaves is mostly based on data from (fertilized) crop plants and (ii) the proportion of total P in phytic acid seems to decrease with improved P status in leaves in contrast to an increase in seeds and fruit. We studied five species of wild herbaceous plants in the field and under controlled conditions. Foliar P concentrations were much lower than those of the crops of earlier studies, but the proportion of P in phytic acid was similar, with little variation during the observation period. Both the field data and the experimental data showed a statistically indistinguishable negative correlation of phytic acid-P/total P and total P. In contrast to our expectation, this negative relationship was not related to differences in relative growth rates. We conclude that (i) our data of phytic acid concentrations in leaves of wild plants are in line with earlier observations on crops, and (ii) the trend towards lower proportions of phytic acid-P with increasing P status is probably a general phenomenon. Currently lacking a convincing explanation for the second observation, the role of phytic acid in foliar P metabolism is still unclear.

  12. Thermoformed protein based composites in presence of organic acids

    Technology Transfer Automated Retrieval System (TEKTRAN)

    World industrialization has generated substantial quantities of petroleum-based plastics over many years, which are non biodegradable. There is a growing demand for the use of renewable agricultural sources to develop eco-friendly biobased composites. Agriculture-sourced proteins and starches are b...

  13. A New Green Ionic Liquid-Based Corrosion Inhibitor for Steel in Acidic Environments.

    PubMed

    Atta, Ayman M; El-Mahdy, Gamal A; Al-Lohedan, Hamad A; Ezzat, Abdel Rahman O

    2015-06-17

    This work examines the use of new hydrophobic ionic liquid derivatives, namely octadecylammonium tosylate (ODA-TS) and oleylammonium tosylate (OA-TS) for corrosion protection of steel in 1 M hydrochloric acid solution. Their chemical structures were determined from NMR analyses. The surface activity characteristics of the prepared ODA-TS and OA-TS were evaluated from conductance, surface tension and contact angle measurements. The data indicate the presence of a double bond in the chemical structure of OA-TS modified its surface activity parameters. Potentiodynamic polarization, electrochemical impedance spectroscopy (EIS) measurements, scanning electron microscope (SEM), Energy dispersive X-rays (EDX) analysis and contact angle measurements were utilized to investigate the corrosion protection performance of ODA-TS and OA-TS on steel in acidic solution. The OA-TS and ODA-TS compounds showed good protection performance in acidic chloride solution due to formation of an inhibitive film on the steel surface.

  14. Choline Chloride Catalyzed Amidation of Fatty Acid Ester to Monoethanolamide: A Green Approach.

    PubMed

    Patil, Pramod; Pratap, Amit

    2016-01-01

    Choline chloride catalyzed efficient method for amidation of fatty acid methyl ester to monoethanolamide respectively. This is a solvent free, ecofriendly, 100% chemo selective and economically viable path for alkanolamide synthesis. The Kinetics of amidation of methyl ester were studied and found to be first order with respect to the concentration of ethanolamine. The activation energy (Ea) for the amidation of lauric acid methyl ester catalyzed by choline chloride was found to be 50.20 KJ mol(-1). The 98% conversion of lauric acid monoethanolamide was obtained at 110°C in 1 h with 6% weight of catalyst and 1:1.5 molar ratio of methyl ester to ethanolamine under nitrogen atmosphere. PMID:26666271

  15. Selenium Catalyzed Oxidation of Aldehydes: Green Synthesis of Carboxylic Acids and Esters.

    PubMed

    Sancineto, Luca; Tidei, Caterina; Bagnoli, Luana; Marini, Francesca; Lenardão, Eder J; Santi, Claudio

    2015-01-01

    The stoichiometric use of hydrogen peroxide in the presence of a selenium-containing catalyst in water is here reported as a new ecofriendly protocol for the synthesis of variously functionalized carboxylic acids and esters. The method affords the desired products in good to excellent yields under very mild conditions starting directly from commercially available aldehydes. Using benzaldehyde as a prototype the gram scale synthesis of benzoic acid is described, in which the aqueous medium and the catalyst could be recycled at last five times while achieving an 87% overall yield.

  16. Amino acid composition and amino acid-metabolic network in supragingival plaque.

    PubMed

    Washio, Jumpei; Ogawa, Tamaki; Suzuki, Keisuke; Tsukiboshi, Yosuke; Watanabe, Motohiro; Takahashi, Nobuhiro

    2016-01-01

    Dental plaque metabolizes both carbohydrates and amino acids. The former can be degraded to acids mainly, while the latter can be degraded to various metabolites, including ammonia, acids and amines, and associated with acid-neutralization, oral malodor and tissue inflammation. However, amino acid metabolism in dental plaque is still unclear. This study aimed to elucidate what kinds of amino acids are available as metabolic substrates and how the amino acids are metabolized in supragingival plaque, by a metabolome analysis. Amino acids and the related metabolites in supragingival plaque were extracted and quantified comprehensively by CE-TOFMS. Plaque samples were also incubated with amino acids, and the amounts of ammonia and amino acid-related metabolites were measured. The concentration of glutamate was the highest in supragingival plaque, while the ammonia-production was the highest from glutamine. The obtained metabolome profile revealed that amino acids are degraded through various metabolic pathways, including deamination, decarboxylation and transamination and that these metabolic systems may link each other, as well as with carbohydrate metabolic pathways in dental plaque ecosystem. Moreover, glutamine and glutamate might be the main source of ammonia production, as well as arginine, and contribute to pH-homeostasis and counteraction to acid-induced demineralization in supragingival plaque. PMID:27545001

  17. UHPLC-PDA-ESI/HRMS/MSn analysis of anthocyanins, flavonol glycosides, and hydroxycinnamic acid derivatives in red mustard green (Brassica juncea (L) Coss variety)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    An UHPLC-PDA-ESI/HRMS/MSn profiling method was used for a comprehensive study of the polyphenols in red mustard greens and identified 209 phenolic compounds: 67 anthocyanin, 102 flavonol glycosides, and 40 hydroxycinnamic acid derivatives. The glycosylation patterns of the flavonoids were assigned ...

  18. Collard, mustard and turnip greens: Effects of varieties and leaf position on concentrations of ascorbic acid, folate, B-carotene, lutein and phylloquinone

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Leafy Brassica crops: collard (Brassica oleracea L.), mustard (B. juncea L.) and turnip (B. rapa) greens are important commercial and culinary vegetables; especially in the southern United States. However, almost no information on essential human-health vitamins [ascorbic acid (vit C), folate (vit...

  19. Synthesis and swelling behavior of Protein-g-poly Methacrylic acid/kaolin superabsorbent hydrogel composites

    NASA Astrophysics Data System (ADS)

    Sadeghi, Mohammad

    2008-08-01

    A novel superabsorbent hydrogel composite based on Collagen have been prepared via graft copolymerization of Methacrylic acid (MAA) in the presence of kaolin powder using methylenebisacrylamide (MBA) as a crosslinking agent and ammonium persulfate (APS) as an initiator. The composite structure was confirmed using FTIR spectroscopy. A new absorption band at 1728 cm-1 in the composite spectrum confirmed kaolin-organic polymer linkage. The effect of kaolin amount and MBA concentration showed that with increasing of these parameters, the water absorbency of the superabsorbent composite was decreased. The swelling measurements of the hydrogels were conducted in aqueous salt solutions.

  20. Translating plasma and whole blood fatty acid compositional data into the sum of eicosapentaenoic and docosahexaenoic acid in erythrocytes.

    PubMed

    Stark, Ken D; Aristizabal Henao, Juan J; Metherel, Adam H; Pilote, Louise

    2016-01-01

    Specific blood levels of eicosapentaenoic plus docosahexaenoic acid (EPA+DHA, wt% of total) in erythrocytes or "the omega-3 index" have been recommended for cardio-protection, but fatty acids are often measured in different blood fractions. The ability to estimate the % of EPA+DHA in erythrocytes from the fatty acid composition of other blood fractions would enable clinical assessments of omega-3 status when erythrocyte fractions are not available and increase the ability to compare blood levels of omega-3 fatty acids across clinical studies. The fatty acid composition of baseline plasma, erythrocytes and whole blood samples from participants (n=1104) in a prospective, multicenter study examining acute coronary syndrome were determined. The ability to predict the % of EPA+DHA in erythrocytes from other blood fractions were examined using bivariate and multiple linear regression modelling. Concordance analysis was also used to compare the actual erythrocytes EPA+DHA values to values estimated from other blood fractions. EPA+DHA in erythrocytes was significantly (p<0.001) correlated EPA+DHA in plasma (r(2)=0.54) and whole blood (r(2)=0.79). Using multiple linear regression to predict EPA+DHA in erythrocytes resulted in stronger coefficients of determination in both plasma (R(2)=0.70) and whole blood (R(2)=0.84). Concordance analyses indicated agreement between actual and estimated EPA+DHA in erythrocytes, although estimating from plasma fatty acids appears to require translation by categorization rather than by translation as continuous data. This study shows that the fatty acid composition of different blood fractions can be used to estimate erythrocyte EPA+DHA in a population with acute coronary syndrome.

  1. [Study on ionic composition of rainwater at Guangzhou and the primary factors of rainwater acidity].

    PubMed

    Liu, Jun-feng; Song, Zhi-guang; Xu, Tao

    2006-10-01

    All rainwater samples were collected during the period Oct. 2003 to Sep. 2004 and analysed in terms of pH values, major cation, anion composition and soluble organic carbon (DOC). The measurement of pH values shows that 85% of these rain events were acid rain. The ionic composition analysis indicates that NO3-, SO4(2-), NH4+ and Ca2+ are dominant ions in the rainwater. DOC approximately consisted of 24.0% of total chemical components. Although SO4(2-) remains the dominant acidic ion in term of concentration, NO3- has become very important to the acidity of rainwater and as well as the organic acids. Furthermore, dust sourced Ca2+ appears to play significant role in neutralizing the acidity in rainwater.

  2. Fatty acid composition of beef is associated with exonic nucleotide variants of the gene encoding FASN.

    PubMed

    Oh, Dongyep; Lee, Yoonseok; La, Boomi; Yeo, Jungsou; Chung, Euiryong; Kim, Younyoung; Lee, Chaeyoung

    2012-04-01

    Genetic associations of fatty acid composition with exonic single nucleotide polymorphisms (SNPs) in the gene encoding fatty acid synthase (FASN) were examined using 513 Korean cattle. All five individual SNPs of g.12870 T>C, g.13126 T>C, g.15532 C>A, g.16907 T>C and g.17924 G>A were associated with a variety of fatty acid compositions and further with marbling score (P < 0.05). Their genotypes of CC, TT, AA, TT, and GG were associated with increased monounsaturated fatty acids and with decreased saturated fatty acids (P < 0.05). The genotypes at all the SNPs also increased marbling score (P < 0.05). Further genetic associations with fatty acid composition suggested that homozygous genotype with the haplotype of ATG at g.15532, g.16907, and g.17924 in a linkage disequilibrium block increased monounsaturated fatty acids and marbling score (P < 0.05). We concluded that the five exonic SNPs of g.12870, g.13126, g.15532, g.16907, and g.17924 in the FASN gene could change fatty acid contents. Their genotypes of CC, TT, AA, TT, and GG and haplotype of ATG at g.15532, g.16907, and g.17924 were recommended for genetic improvement of beef quality.

  3. Green Synthesis and Urease Inhibitory Activity of Spiro-Pyrimidinethiones/Spiro-Pyrimidinones-Barbituric Acid Derivatives

    PubMed Central

    Mohammadi Ziarani, Ghodsi; Asadi, Shima; Faramarzi, Sakineh; Amanlou, Massoud

    2015-01-01

    Sulfonic acid functionalized SBA-15 (SBA-Pr-SO3H) with pore size 6 nm as an efficient heterogeneous nanoporous solid acid catalyst exhibited good catalytic activity in the Biginelli-like reaction in the synthesis of spiroheterobicyclic rings with good yield and good recyclability. Spiro-pyrimidinethiones/spiro-pyrimidinones-barbituric acid derivatives were synthesized in a simple and efficient method using the one-pot three-component reaction of a cyclic 1,3- dicarbonyl compounds (barbituric acid), an aromatic aldehyde and urea or thiourea in the presence of nanoporous silica SBA-Pr-SO3H under solvent free conditions. Urease inhibitory activity of spiro compounds were tested against Jack bean urease using Berthelot alkaline phenol–hypochlorite method. Five of 13 compounds were inhibitor and two of them were enzyme activators. Analysis of the docking results showed that, in most of the spiro molecules, one of the carbonyl groups is coordinated with both nickel atoms, while the other one is involved in the formation of hydrogen bonds with important active-site residues. The effect of inserting two methyl groups on N atoms of barbiturate ring, S substituted, ortho, meta and para substituted compounds were investigated too. PMID:26664377

  4. Stable carbon isotopic compositions of low-molecular-weight dicarboxylic acids, oxocarboxylic acids, α-dicarbonyls, and fatty acids: Implications for atmospheric processing of organic aerosols

    NASA Astrophysics Data System (ADS)

    Zhang, Yan-Lin; Kawamura, Kimitaka; Cao, Fang; Lee, Meehye

    2016-04-01

    Stable carbon isotopic compositions (δ13C) were measured for 23 individual organic species including 9 dicarboxylic acids, 7 oxocarboxylic acids, 1 tricarboxylic acid, 2 α-dicarbonyls, and 4 fatty acids in the aerosols from Gosan background site in East Asia. δ13C values of particle phase glyoxal and methylglyoxal are significantly larger than those previously reported for isoprene and other precursors. The values are consistently less negative in oxalic acid (C2, average -14.1‰), glyoxylic acid (-13.8‰), pyruvic acid (-19.4‰), glyoxal (-13.5‰), and methylglyoxal (-18.6‰) compared to other organic species (e.g., palmitic acid, -26.3‰), which can be explained by the kinetic isotope effects during atmospheric oxidation of pre-aged precursors (e.g., isoprene) and the subsequent gas-particle partitioning after the evaporation of clouds or wet aerosols. The δ13C values of C2 is positively correlated with C2 to organic carbon ratio, indicating that photochemical production of C2 is more pronounced than its degradation during long-range atmospheric transport. The isotopic results also suggest that aqueous phase oxidation of glyoxal and methylglyoxal is a major formation process of oxalic acid via the intermediates such as glyoxylic acid and pyruvic acid. This study provides evidence that organic aerosols are intensively photochemically aged in the western North Pacific rim.

  5. Fatty acid, carotenoid and tocopherol compositions of 20 Canadian lentil cultivars and synergistic contribution to antioxidant activities.

    PubMed

    Zhang, Bing; Deng, Zeyuan; Tang, Yao; Chen, Peter; Liu, Ronghua; Ramdath, D Dan; Liu, Qiang; Hernandez, Marta; Tsao, Rong

    2014-10-15

    Understanding the profile of lipophilic phytochemicals in lentils is necessary to better understand the health benefits of lentils. The fatty acid, carotenoid and tocopherol compositions and antioxidant activities of the lipophilic extracts of 20 lentil cultivars (10 red and 10 green) were therefore examined. Lentils contained 1.52-2.95% lipids, of which 77.5-81.7% were unsaturated essential fatty acids. Total tocopherols ranged from 37 to 64μg/g DW, predominantly γ-tocopherol (96-98% of the tocopherol content), followed by δ- and α-tocopherol. trans-Lutein was the primary and major carotenoid (64-78%) followed by trans-zeaxanthin (5-13%). Carotenoids and tocopherols showed weak correlation with 2,2-diphenyl-1-picrylhydrazyl (DPPH) activity (r=0.4893 and 0.3259, respectively), but good correlation when combined (r=0.6688), suggesting they may act synergistically. Carotenoids were found to contribute the most to the strong antioxidant activity measured by photochemiluminescence (PCL) assay. Results from this study contribute to the development of lentil cultivars and related functional foods with increased health benefits.

  6. 4-Mercaptophenylboronic acid functionalized graphene oxide composites: Preparation, characterization and selective enrichment of glycopeptides.

    PubMed

    Jiang, Bo; Qu, Yanyan; Zhang, Lihua; Liang, Zhen; Zhang, Yukui

    2016-03-17

    Selective enrichment and isolation of glycopeptides from complex biological samples was indispensable for mass spectrometry (MS)-based glycoproteomics, however, it remained a great challenge due to the low abundance of glycoproteins and the ion suppression of non-glycopeptides. In this work, 4-mercaptophenylboronic acid functionalized graphene oxide composites were synthesized via loading gold nanoparticles on polyethylenimine modified graphene oxide surface, followed by 4-mercaptophenylboronic acid immobilization by the formation of Au-S bonding (denoted as GO/PEI/Au/4-MPB composites). The composites showed highly specific and efficient capture of glycopeptides due to their excellent hydrophilicity and abundant boronic acid groups. The composites could selectively capture the glycopeptides from the mixture of glycopeptides and nonglycopeptides, even when the amounts of non-glycopeptides were 100 times more than glycopeptides. Compared with commercial meta-amino phenylboronic acid agarose, the composites showed better selectivity when the sample was decreased to 10 ng. These results clearly verified that the GO/PEI/Au/4-MPB composites might be a promising material for glycoproteomics analysis.

  7. Investigation of citric acid-glycerol based pH-sensitive biopolymeric hydrogels for dye removal applications: A green approach.

    PubMed

    Franklin, D S; Guhanathan, S

    2015-11-01

    Hydrogels are three dimensional polymeric structure with segments of hydrophilic groups. The special structure of hydrogels facilitates the diffusion of solutes into the interior network and possess numerous ionic and non-ionic functional groups, which can absorb or trap ionic dyes from waste water. The present investigation was devoted to the synthesis of a series of citric acid and glycerol based pH sensitive biopolymeric hydrogels using a solventless green approach via condensation polymerization in the presence of acidic medium. The formations of hydrogels were confirmed using various spectral investigations viz., FT-IR, (1)H and (13)C NMR. The thermal properties of various hydrogels have been studied using TGA, DTA and DSC analysis. The rationalized relationship was noticed with increasing of pH from 4.0 to 10.0. The surface morphologies of hydrogels were analyzed using SEM technique which was well supported from the results of swelling studies. Methylene blue has been selected as a cationic dye for its removal from various environmental sources using pH-sensitive biopolymeric hydrogels. The results of dye removal revealed that glycerol based biopolymeric hydrogels have shown an excellent dye removal capacity. Hence, the synthesized pH sensitive biopolymeric hydrogels have an adaptability with pH tuned properties might have greater potential opening in various environmental applications viz., metal ion removal, agrochemical release, purification of water, dye removal etc.

  8. The effect of ambient ozone pollution and acidic rain on the growth and chlorophyll content of green and white ash.

    PubMed

    Elliott, C L; Eberhardt, J C; Brennan, E G

    1987-01-01

    Two- and three-year old green ash (Fraxinus americana L.) and white ash (Fraxinus pennsylvanica Marsh.) seedlings were exposed to combinations of ambient ozone and acidic ambient rainfall in New Brunswick, New Jersey. During the 3-year study the potted seedlings did not develop typical foliar ozone toxicity symptoms, despite the occurrence of as many as 78 h in exceedance of the National Ambient Air Quality Standard of 0.12 ppm. Although the pH of the rainfall was as low as 3.6 and averaged 4.1, no symptoms were observed resulting from the ambient precipitation. The rate of shoot growth in terms of height and diameter was generally not affected by either of the pollutants during the growing season. Although the chlorophyll content of white ash foliage was low following frequent rainfall in the early summer of 1984, there was no statistically significant evidence that acid raid or ambient ozone decreased chlorophyll in ash seedlings during the 3-year study.

  9. Natural weathering studies of oil palm trunk lumber (OPTL) green polymer composites enhanced with oil palm shell (OPS) nanoparticles.

    PubMed

    Islam, Md Nazrul; Dungani, Rudi; Abdul Khalil, Hps; Alwani, M Siti; Nadirah, Wo Wan; Fizree, H Mohammad

    2013-01-01

    In this study, a green composite was produced from Oil Palm Trunk Lumber (OPTL) by impregnating oil palm shell (OPS) nanoparticles with formaldehyde resin. The changes of physical, mechanical and morphological properties of the OPS nanoparticles impregnated OPTL as a result of natural weathering was investigated. The OPS fibres were ground with a ball-mill for producing nanoparticles before being mixed with the phenol formaldehyde (PF) resin at a concentration of 1, 3, 5 and 10% w/w basis and impregnated into the OPTL by vacuum-pressure method. The treated OPTL samples were exposed to natural weathering for the period of 6 and 12 months in West Java, Indonesia according to ASTM D1435-99 standard. Physical and mechanical tests were done for analyzing the changes in phenol formaldehyde-nanoparticles impregnated (PF-NPI) OPTL. FT-IR and SEM studies were done to analyze the morphological changes. The results showed that both exposure time of weathering and concentration of PF-NPI had significant impact on physical and mechanical properties of OPTL. The longer exposure of samples to weathering condition reduced the wave numbers during FT-IR test. However, all these physical, mechanical and morphological changes were significant when compared with the untreated samples or only PF impregnated samples. Thus, it can be concluded that PF-NP impregnation into OPTL improved the resistance against natural weathering and would pave the ground for improved products from OPTL for outdoor conditions.

  10. Recyclable epoxy resins: An example of green approach for advanced composite applications

    NASA Astrophysics Data System (ADS)

    Cicala, Gianluca; Rosa, Daniela La; Musarra, Marco; Saccullo, Giuseppe; Banatao, Rey; Pastine, Stefan

    2016-05-01

    Automotive composite applications are increasingly growing due to demand for lightweight structures to comply to the requirements for fuel reduction. HP-RTM is gaining relevance as one of the preferred production technologies for high volume applications. The BMW i3 life module being a notable example of HP-RTM application. The key aspects of HP-RTM are the short injection times (i.e. less than 1min) and the fast curing of the thermoset resins (i.e. less than 10min). The choice of using thermosets poses relevant issues for their limited recycling options. The standard recycling solution is the incineration but, this solution poses some concerns in terms of global environmental impact. Novel solutions are presented in this work based on the use of recyclable epoxy systems. In our work the results of experimentation carried out by our group with cleavable ammines by Connora Technologies and bioepoxy resins by Entropy Resins will be discussed. The multiple uses of recycled matrices obtained treating the recyclable epoxy resins are discussed in the framework of a "cradle" to "crave" approach. Finally, Life Cycle Assessment (LCA) is used to evaluate the environmental benefits of the proposed approach.

  11. Fatty acid, amino acid, and mineral composition of four common vetch seeds on Qinghai-Tibetan plateau.

    PubMed

    Mao, Zhuxin; Fu, Hua; Nan, Zhibiao; Wan, Changgui

    2015-03-15

    The chemical composition of four common vetch (Vicia sativa L.) seeds was investigated to determine their nutrition value. The result shows that the seeds are low in lipid (1.55-2.74% of dry weight), and high in the unsaturated fatty acid (74.51-77.36% of total fatty acid). The ratio of essential amino acid to non-essential amino acid (0.62-0.69) is even higher than the amount (0.38) recommended by World Health Organization. Besides, the seeds are also found rich in Mg, Mn and Cu, but with a low ratio of Ca to P (0.24-0.73), which may increase the risk of the mineral element toxicity. The results indicate that the four common vetch seeds could be taken as an alternative food source, but the possible toxic effect should be taken into consideration.

  12. Kinetics of formation of green rust 2 in the steady acidic sulphated medium

    NASA Astrophysics Data System (ADS)

    Olowe, A. A.; Genin, J. M. R.

    1990-07-01

    The kinetics of formation of green rust 2, 4Fe(OH)2.2FeOOH.FeSO4.nH2O, called “GR2, was followed by Mössbauer spectroscopy in the controlled aeration of a mixture of 0.4 M FeSO4 and 0.4 M NaOH. Mössbauer spectra run at 78 K of the reaction products taken at different time intervals display an average of seven doublets. The initial products of reaction consists of a badly crystallized ferrous hydroxide, FE(OH)2., called “FH”, which disappears first at about 1/3 of the total time of formation of GR2, and sulphated ferrous hydroxide, 4Fe(OH)2.FeSO4. nH2O, called “SFH”. The kinetics of oxidation of SFH into GR2 can be described by a linear growth reaction and the transformation is considered to be in situ.

  13. Characterization of Fatty Acid Composition in Bone Marrow Fluid From Postmenopausal Women: Modification After Hip Fracture.

    PubMed

    Miranda, Melissa; Pino, Ana María; Fuenzalida, Karen; Rosen, Clifford J; Seitz, Germán; Rodríguez, J Pablo

    2016-10-01

    Bone marrow adipose tissue (BMAT) is associated with low bone mass, although the functional consequences for skeletal maintenance of increased BMAT are currently unclear. BMAT might have a role in systemic energy metabolism, and could be an energy source as well as an endocrine organ for neighboring bone cells, releasing cytokines, adipokines and free fatty acids into the bone marrow microenvironment. The aim of the present report was to compare the fatty acid composition in the bone marrow supernatant fluid (BMSF) and blood plasma of postmenopausal women women (65-80 years old). BMSF was obtained after spinning the aspirated bone marrow samples; donors were classified as control, osteopenic or osteoporotic after dual-energy X-ray absorptiometry. Total lipids from human bone marrow fluid and plasma were extracted, converted to the corresponding methyl esters, and finally analyzed by a gas chromatographer coupled with a mass spectrometer. Results showed that fatty acid composition in BMSF was dynamic and distinct from blood plasma, implying significance in the locally produced lipids. The fatty acid composition in the BMSF was enriched in saturated fatty acid and decreased in unsaturated fatty acids as compared to blood plasma, but this relationship switched in women who suffered a hip fracture. On the other hand, there was no relationship between BMSF and bone mineral density. In conclusion, lipid composition of BMSF is distinct from the circulatory compartment, most likely reflecting the energy needs of the marrow compartment. J. Cell. Biochem. 117: 2370-2376, 2016. © 2016 Wiley Periodicals, Inc. PMID:27416518

  14. Characterization of Fatty Acid Composition in Bone Marrow Fluid From Postmenopausal Women: Modification After Hip Fracture.

    PubMed

    Miranda, Melissa; Pino, Ana María; Fuenzalida, Karen; Rosen, Clifford J; Seitz, Germán; Rodríguez, J Pablo

    2016-10-01

    Bone marrow adipose tissue (BMAT) is associated with low bone mass, although the functional consequences for skeletal maintenance of increased BMAT are currently unclear. BMAT might have a role in systemic energy metabolism, and could be an energy source as well as an endocrine organ for neighboring bone cells, releasing cytokines, adipokines and free fatty acids into the bone marrow microenvironment. The aim of the present report was to compare the fatty acid composition in the bone marrow supernatant fluid (BMSF) and blood plasma of postmenopausal women women (65-80 years old). BMSF was obtained after spinning the aspirated bone marrow samples; donors were classified as control, osteopenic or osteoporotic after dual-energy X-ray absorptiometry. Total lipids from human bone marrow fluid and plasma were extracted, converted to the corresponding methyl esters, and finally analyzed by a gas chromatographer coupled with a mass spectrometer. Results showed that fatty acid composition in BMSF was dynamic and distinct from blood plasma, implying significance in the locally produced lipids. The fatty acid composition in the BMSF was enriched in saturated fatty acid and decreased in unsaturated fatty acids as compared to blood plasma, but this relationship switched in women who suffered a hip fracture. On the other hand, there was no relationship between BMSF and bone mineral density. In conclusion, lipid composition of BMSF is distinct from the circulatory compartment, most likely reflecting the energy needs of the marrow compartment. J. Cell. Biochem. 117: 2370-2376, 2016. © 2016 Wiley Periodicals, Inc.

  15. Effect of DNA polymorphisms related to fatty acid composition in adipose tissue of Holstein cattle.

    PubMed

    Narukami, Takahiro; Sasazaki, Shinji; Oyama, Kenji; Nogi, Takuya; Taniguchi, Masaaki; Mannen, Hideyuki

    2011-06-01

    Fatty acid composition of adipose tissue has been recognized as an important carcass trait because of its relationship with eating quality such as favorable beef flavor and tenderness. Therefore, we investigated the effects of genetic polymorphisms of liver X receptor, alpha (LXR), stearoyl-CoA desaturase (SCD), Fatty acid synthase (FASN), and Fatty acid binding protein 4 (FABP4) on fatty acid composition in intramuscular fat tissue of Holstein steers. The major allele frequencies were 0.705 in SCD, 0.518 in FABP4, 0.888 in FASN, and 0.984 in LXR. Genotyping of SCD showed significant effect on C14:0, C14:1, C18:0 and saturated fatty acid (P < 0.05). In addition, the result suggested that SCD genotype possibly had effect on composition of C18:1 and monounsaturated fatty acid. Genotype of FABP4 had significant effect on composition of C16:0. Effect of LXR genotypes could not be analyze because of extremely biased genotype frequencies. Our results suggest that genotypes of SCD and FABP4 may in part affect meat quality in Holstein.

  16. Prebiotic syntheses of vitamin coenzymes: II. Pantoic acid, pantothenic acid, and the composition of coenzyme A

    NASA Technical Reports Server (NTRS)

    Miller, S. L.; Schlesinger, G.

    1993-01-01

    Pantoic acid can by synthesized in good prebiotic yield from isobutyraldehyde or alpha-ketoisovaleric acid + H2CO + HCN. Isobutyraldehyde is the Strecker precursor to valine and alpha-ketoisovaleric acid is the valine transamination product. Mg2+ and Ca2+ as well as several transition metals are catalysts for the alpha-ketoisovaleric acid reaction. Pantothenic acid is produced from pantoyl lactone (easily formed from pantoic acid) and the relatively high concentrations of beta-alanine that would be formed on drying prebiotic amino acid mixtures. There is no selectivity for this reaction over glycine, alanine, or gamma-amino butyric acid. The components of coenzyme A are discussed in terms of ease of prebiotic formation and stability and are shown to be plausible choices, but many other compounds are possible. The gamma-OH of pantoic acid needs to be capped to prevent decomposition of pantothenic acid. These results suggest that coenzyme A function was important in the earliest metabolic pathways and that the coenzyme A precursor contained most of the components of the present coenzyme.

  17. Photo-degradation of acid green dye over Co-ZSM-5 catalysts prepared by incipient wetness impregnation technique.

    PubMed

    El-Bahy, Zeinhom M; Mohamed, Mohamed M; Zidan, Farouk I; Thabet, Mohamed S

    2008-05-01

    Co-ZSM-5 catalysts with different Co-loadings (2-30wt.%) were prepared by incipient wetness impregnation method. The prepared solid catalysts were characterized by X-ray diffraction, FTIR, in situ FTIR of pyridine adsorption and surface area measurements. The XRD data presented disintegration in the zeolitic crystalline structure accompanied by an increase in particle size of the prepared solids. New phases, Co(3)O(4) and Co(2)SiO(4), were detected with increasing the Co-loading, which indicate the strong interaction of cobalt ions with the ZSM-5 zeolite. FTIR study proved the presence of Co ions in stabilized sites inside the ZSM-5 framework. The in situ FTIR of adsorbed pyridine determined the type and relative strength of acidity on the surface of the prepared solids. The acidity switched from B-acid sites to L-acid sites with impregnation of cobalt ions in ZSM-5 zeolite. The acidity decreased with increasing Co-loading, which might be due to the destruction of zeolite framework and presence of new phases such as cobalt silicate and cobalt oxide on the surface. The surface texture characteristics changed with the promotion of ZSM-5 by cobalt ions, since a decrease of surface area, mean pore radius and pore volume was observed. The assessment of the catalytic activity was performed by the use of the photo-degradation of acid green (AG) dye as a probe reaction in presence of H(2)O(2) as an oxidant. The pH value controlled the degradation rate since a gradual increase of AG degradation rate was observed with increasing pH value and the optimum H(2)O(2) concentration was 61.6 mmol/l. It was found that, the AG degradation rate increased until an optimum value of Co-loading (ca. 10 wt.%), beyond which a monotonic decrease of reaction rate was recognized. The experimental data pointed to the importance of both the cobalt moieties and the zeolite framework structure in the AG degradation reaction. PMID:17904732

  18. Additive Manufacturing and Characterization of Polylactic Acid (PLA) Composites Containing Metal Reinforcements

    NASA Technical Reports Server (NTRS)

    Kuentz, Lily; Salem, Anton; Singh, M.; Halbig, M. C.; Salem, J. A.

    2016-01-01

    Additive manufacturing of polymeric systems using 3D printing has become quite popular recently due to rapid growth and availability of low cost and open source 3D printers. Two widely used 3D printing filaments are based on polylactic acid (PLA) and acrylonitrile butadiene styrene (ABS) systems. PLA is much more environmentally friendly in comparison to ABS since it is made from renewable resources such as corn, sugarcane, and other starches as precursors. Recently, polylactic acid-based metal powder containing composite filaments have emerged which could be utilized for multifunctional applications. The composite filaments have higher density than pure PLA, and the majority of the materials volume is made up of polylactic acid. In order to utilize functionalities of composite filaments, printing behavior and properties of 3-D printed composites need to be characterized and compared with the pure PLA materials. In this study, pure PLA and composite specimens with different metallic reinforcements (Copper, Bronze, Tungsten, Iron, etc) were 3D printed at various layer heights and resulting microstructures and properties were characterized. Differential scanning calorimetry (DSC) and thermogravimetric analysis (TGA) behavior of filaments with different reinforcements were studied. The microscopy results show an increase in porosity between 3-D printed regular PLA and the metal composite PLA samples, which could produce weaker mechanical properties in the metal composite materials. Tensile strength and fracture toughness behavior of specimens as a function of print layer height will be presented.

  19. Cd(II) Sorption on Montmorillonite-Humic acid-Bacteria Composites

    PubMed Central

    Du, Huihui; Chen, Wenli; Cai, Peng; Rong, Xingmin; Dai, Ke; Peacock, Caroline L.; Huang, Qiaoyun

    2016-01-01

    Soil components (e.g., clays, bacteria and humic substances) are known to produce mineral-organic composites in natural systems. Herein, batch sorption isotherms, isothermal titration calorimetry (ITC), and Cd K-edge EXAFS spectroscopy were applied to investigate the binding characteristics of Cd on montmorillonite(Mont)-humic acid(HA)-bacteria composites. Additive sorption and non-additive Cd(II) sorption behaviour is observed for the binary Mont-bacteria and ternary Mont-HA-bacteria composite, respectively. Specifically, in the ternary composite, the coexistence of HA and bacteria inhibits Cd adsorption, suggesting a “blocking effect” between humic acid and bacterial cells. Large positive entropies (68.1 ~ 114.4 J/mol/K), and linear combination fitting of the EXAFS spectra for Cd adsorbed onto Mont-bacteria and Mont-HA-bacteria composites, demonstrate that Cd is mostly bound to bacterial surface functional groups by forming inner-sphere complexes. All our results together support the assertion that there is a degree of site masking in the ternary clay mineral-humic acid-bacteria composite. Because of this, in the ternary composite, Cd preferentially binds to the higher affinity components-i.e., the bacteria. PMID:26792640

  20. "Green preservatives": combating fungi in the food and feed industry by applying antifungal lactic acid bacteria.

    PubMed

    Pawlowska, Agata M; Zannini, Emanuele; Coffey, Aidan; Arendt, Elke K

    2012-01-01

    Fungal food spoilage plays a pivotal role in the deterioration of food and feed systems and some of them are also able to produce toxic compounds for humans and animals. The mycotoxins produced by fungi can cause serious health hazards, including cancerogenic, immunotoxic, teratogenic, neurotoxic, nephrotoxic and hepatotoxic effects, and Kashin-Beck disease. In addition to this, fungal spoilage/pathogens are causing losses of marketable quality and hygiene of foodstuffs, resulting in major economic problem throughout the world. Nowadays, food spoilage can be prevented using physical and chemical methods, but no efficient strategy has been proposed so far to reduce the microbial growth ensuring public health. Therefore, lactic acid bacteria (LAB) can play an important role as natural preservatives. The protection of food products using LAB is mainly due to the production of antifungal compounds such as carboxylic acids, fatty acids, ethanol, carbon dioxide, hydrogen peroxide, and bacteriocins. In addition to this, LAB can also positively contribute to the flavor, texture, and nutritional value of food products. This review mainly focuses on the use of LAB for food preservation given their extensive industrial application in a wide range of foods and feeds. The attention points out the several industrial patents concerning the use of antifungal LAB as biocontrol agent against spoilage organisms in different fermented foods and feeds.

  1. Effect of Composition and Impurities on the Phosphorescence of Green-Emitting Alkaline Earth Aluminate Phosphor.

    PubMed

    Kim, Doory; Kim, Han-Eol; Kim, Chang-Hong

    2016-01-01

    Recent improvements to SrAl2O4:Eu2+, Dy3+ phosphors have enabled the use of luminescent hosts with a stable crystal structure and high physical and chemical stability, thus overcoming the bottleneck in the applicability of ZnS:Cu phosphors. However, enhancement of afterglow lifetime and brightness in SrAl2O4:Eu2+, Dy3+ phosphors remains a challenging task. Here, we have improved the afterglow characteristics in terms of persistence time and brightness by a systematic investigation of the composition of Eu-doped alkaline earth aluminate SrAl2O4:Eu2+, Dy3+ crystals. We found that a Dy3+/Eu2+ ratio of ~2.4 and ~0.935 mol Eu2+ (per mol of SrAl2O4) gave the brightest and longest emissions (11% and 9% increase for each). Doping with Si4+ also resulted in a slight increase in brightness up to ~15%. Doping with alkali metal or alkaline earth metal significantly enhanced the phosphorescence intensity. In particular, doping with 0.005 mol Li+ (per mol of SrAl2O4) alone boosted the phosphorescence intensity to 239% of the initial value, as compared to that observed for the non-doped crystal, while doping with 0.01 mol Mg2+ and 0.005 mol Li+ (per 1 mol SrAl2O4) boosted the phosphorescence intensity up to 313% of the initial value. The results of this investigation are expected to act as a guideline for the synthesis of bright and long persistent phosphors, and facilitate the development of persistent phosphors with afterglow characteristics superior to those of conventional phosphors. PMID:26731086

  2. Effect of Composition and Impurities on the Phosphorescence of Green-Emitting Alkaline Earth Aluminate Phosphor

    PubMed Central

    Kim, Doory; Kim, Han-Eol; Kim, Chang-Hong

    2016-01-01

    Recent improvements to SrAl2O4:Eu2+, Dy3+ phosphors have enabled the use of luminescent hosts with a stable crystal structure and high physical and chemical stability, thus overcoming the bottleneck in the applicability of ZnS:Cu phosphors. However, enhancement of afterglow lifetime and brightness in SrAl2O4:Eu2+, Dy3+ phosphors remains a challenging task. Here, we have improved the afterglow characteristics in terms of persistence time and brightness by a systematic investigation of the composition of Eu-doped alkaline earth aluminate SrAl2O4:Eu2+, Dy3+ crystals. We found that a Dy3+/Eu2+ ratio of ~2.4 and ~0.935 mol Eu2+ (per mol of SrAl2O4) gave the brightest and longest emissions (11% and 9% increase for each). Doping with Si4+ also resulted in a slight increase in brightness up to ~15%. Doping with alkali metal or alkaline earth metal significantly enhanced the phosphorescence intensity. In particular, doping with 0.005 mol Li+ (per mol of SrAl2O4) alone boosted the phosphorescence intensity to 239% of the initial value, as compared to that observed for the non-doped crystal, while doping with 0.01 mol Mg2+ and 0.005 mol Li+ (per 1 mol SrAl2O4) boosted the phosphorescence intensity up to 313% of the initial value. The results of this investigation are expected to act as a guideline for the synthesis of bright and long persistent phosphors, and facilitate the development of persistent phosphors with afterglow characteristics superior to those of conventional phosphors. PMID:26731086

  3. Egg fatty acid composition from lake trout fed two Lake Michigan prey fish species.

    USGS Publications Warehouse

    Honeyfield, D.C.; Fitzsimons, J.D.; Tillitt, D.E.; Brown, S.B.

    2009-01-01

    We previously demonstrated that there were significant differences in the egg thiamine content in lake trout Salvelinus namaycush fed two Lake Michigan prey fish (alewife Alosa pseudoharengus and bloater Coregonus hoyi). Lake trout fed alewives produced eggs low in thiamine, but it was unknown whether the consumption of alewives affected other nutritionally important components. In this study we investigated the fatty acid composition of lake trout eggs when females were fed diets that resulted in different egg thiamine concentrations. For 2 years, adult lake trout were fed diets consisting of four combinations of captured alewives and bloaters (100% alewives; 65% alewives, 35% bloaters; 35% alewives, 65% bloaters; and 100% bloaters). The alewife fatty acid profile had higher concentrations of arachidonic acid and total omega-6 fatty acids than the bloater profile. The concentrations of four fatty acids (cis-13, 16-docosadienoic, eicosapentaenoic, docosapentaenoic, and docosahexaenoic acids) were higher in bloaters than in alewives. Although six fatty acid components were higher in lake trout eggs in 2001 than in 2000 and eight fatty acids were lower, diet had no effect on any fatty acid concentration measured in lake trout eggs in this study. Based on these results, it appears that egg fatty acid concentrations differ between years but that the egg fatty acid profile does not reflect the alewife-bloater mix in the diet of adults. The essential fatty acid content of lake trout eggs from females fed alewives and bloaters appears to be physiologically regulated and adequate to meet the requirements of developing embryos.

  4. Solar thermal charging properties of graphene oxide embedded myristic acid composites phase change material

    NASA Astrophysics Data System (ADS)

    Yadav, Apurv; Barman, Bidyut; Kumar, Vivek; Kardam, Abhishek; Narayanan, S. Shankara; Verma, Abhishek; Madhwal, Devinder; Shukla, Prashant; Jain, V. K.

    2016-05-01

    The present paper reports the heat transfer characteristics of graphene oxide (GO) embedded myristic acid based phase change material (GO-PCM) composites. By varying concentrations of GO (0.1-0.5 wt%), different GO-PCM composites were preapred. Two different experimental setups were used for investigating the heat transfer characteristics of the prepared GO-PCM composites during the melting and solidification processes: (i) conventional heating and (ii) solar illumination. The experimental observations indicated a higher heat transfer rate in the GO-PCM composites as compared to pristine PCM for both experimental setups. From the experimental results of conventional heating setup, it was observed that the melting and solidification rate for GO-PCM composites, at 0.5 wt% of GO, increased by 48% and 70%, respectively in comparison to pristine PCM. The experimental results using solar illumination setup demonstrated an ultrafast heating rate for GO-PCM composites than the conventional heating based approach.

  5. Biocompatibility and characterization of polylactic acid/styrene-ethylene-butylene-styrene composites.

    PubMed

    Tsou, Chi-Hui; Kao, Bo-Jyue; Yang, Ming-Chien; Suen, Maw-Cherng; Lee, Yi-Hsuan; Chen, Jui-Chin; Yao, Wei-Hua; Lin, Shang-Ming; Tsou, Chih-Yuan; Huang, Shu-Hsien; De Guzman, Manuel; Hung, Wei-Song

    2015-01-01

    Polylactic acid (PLA)/styrene-ethylene-butylene-styrene (SEBS) composites were prepared by melt blending. Differential scanning calorimetry (DSC) and wide angle X-ray diffraction (WXRD) were used to characterize PLA and PLA/SEBS composites in terms of their melting behavior and crystallization. Curves from thermal gravimetric analysis (TGA) illustrated that thermostability increased with SEBS content. Further morphological analysis of PLA/SEBS composites revealed that SEBS molecules were not miscible with PLA molecules in PLA/SEBS composites. The tensile testing for PLA and PLA/SEBS composites showed that the elongation at the break was enhanced, but tensile strength decreased with increasing SEBS content. L929 fibroblast cells were chosen to assess the cytocompatibility; the cell growth of PLA was found to decrease with increasing SEBS content. This study proposes possible reasons for these properties of PLA/SEBS composites.

  6. Properties of polylactic acid composites reinforced with oil palm biomass microcrystalline cellulose.

    PubMed

    Haafiz, M K Mohamad; Hassan, Azman; Zakaria, Zainoha; Inuwa, I M; Islam, M S; Jawaid, M

    2013-10-15

    In this work, polylactic acid (PLA) composites filled with microcrystalline cellulose (MCC) from oil palm biomass were successfully prepared through solution casting. Fourier transform infrared (FT-IR) spectroscopy indicates that there are no significant changes in the peak positions, suggesting that incorporation of MCC in PLA did not result in any significant change in chemical structure of PLA. Thermogravimetric analysis was conducted on the samples. The T50 decomposition temperature improved with addition of MCC, showing increase in thermal stability of the composites. The synthesized composites were characterized in terms of tensile properties. The Young's modulus increased by about 30%, while the tensile strength and elongation at break for composites decreased with addition of MCC. Scanning electron microscopy (SEM) of the composites fractured surface shows that the MCC remained as aggregates of crystalline cellulose. Atomic force microscopy (AFM) topographic image of the composite surfaces show clustering of MCC with uneven distribution. PMID:23987327

  7. Characterization of lactic acid bacteria from naturally-fermented Manzanilla Aloreña green table olives.

    PubMed

    Abriouel, Hikmate; Benomar, Nabil; Cobo, Antonio; Caballero, Natacha; Fernández Fuentes, Miguel Ángel; Pérez-Pulido, Rubén; Gálvez, Antonio

    2012-12-01

    Manzanilla Aloreña (or Aloreña) table olives are naturally fermented traditional green olives with a denomination of protection (DOP). The aim of this study was to search for lactic acid bacteria (LAB) with technological properties of interest for possible inclusion in a starter or protective culture preparation or also as probiotics. A collection of 144 LAB obtained from Aloreña green table olives naturally-fermented by four small-medium enterprises (SMEs) from Málaga (Spain), including lactobacilli (81.94%), leuconostocs (10.42%) and pediococci (7.64%) were studied. REP-PCR clustering and further identification of strains by sequencing of phes and rpo genes revealed that all lactobacilli from the different SMEs were Lactobacillus pentosus. Pediococci were identified as Pediococcus parvulus (SME1) and leuconostocs as Leuconostoc pseudomesenteroides (SME1 and SME4). Genotyping revealed that strains were not clonally related and exhibited a considerable degree of genomic diversity specially for lactobacilli and also for leuconostocs. Some strains exhibit useful technological properties such as production of antimicrobial substances active against pathogenic bacteria such as Listeria monocytogenes, Bacillus cereus, Staphylococcus aureus, Streptococcus mutans and Salmonella enterica, utilization of raffinose and stachyose, production of bile salt hydrolase, phytase and haeme-dependent catalase activities, growth at 10 °C and in the presence of 6.5% NaCl, good acidifying capacity and also resistance to freezing. However, none of the isolates showed protease or amylase activity, and also did not exhibit biogenic amine production from histidine, ornithine, cysteine or tyrosine. On the basis of data obtained, selected strains with potential traits were tested for their survival at low pH and their tolerance to bile salts, and the survival capacity demonstrated by some of the analysed strains are encouraging to further study their potential as probiotics. PMID

  8. Amino acid composition, score and in vitro protein digestibility of foods commonly consumed in northwest Mexico.

    PubMed

    Caire-Juvera, Graciela; Vázquez-Ortiz, Francisco A; Grijalva-Haro, Maria I

    2013-01-01

    A better knowledge of the amino acid composition of foods commonly consumed in different regions is essential to calculate their scores and, therefore, to predict their protein quality. This paper presents the amino acid composition, amino acid score and in vitro protein digestibility of fifteen foods that are commonly consumed in Northwest Mexico. The foods were prepared by the traditional methods and were analyzed by reverse-phase HPLC. The chemical score for each food was determined using the recommendations for children of 1-2 years of age, and the digestibility was evaluated using a multienzyme technique. Lysine was the limiting amino acid in cereal-based products (scores 15 to 54), and methionine and cysteine were limiting in legume products (scores 41 to 47), boiled beef (score = 75) and hamburger (score = 82). The method of preparation had an effect on the content of certain amino acids, some of them increased and others decreased their content. Meat products and regional cheese provided a high amino acid score (scores 67 to 91) and digestibility (80.7 to 87.8%). Bologna, a processed meat product, had a lower digestibility (75.4%). Data on the amino acid composition of foods commonly consumed in Mexico can be used to provide valuable information on food analysis and protein quality, and to contribute to nutrition and health research and health programs.

  9. Amino acid composition determined using multiple hydrolysis times for three goat milk formulations.

    PubMed

    Rutherfurd, Shane M; Moughan, Paul J; Lowry, Dianne; Prosser, Colin G

    2008-01-01

    The amino acid composition of goat milk formulations with varying protein and carbohydrate concentrations were determined. Proteins in goat milk infant formula, goat milk growing-up formula and goat whole milk powder were hydrolysed using multiple hydrolysis time intervals. A least-squares non-linear regression model was used to predict the free and protein bound amino acid concentrations. The amino acid composition of goat infant formula was compared with human milk reference values. There was good agreement between the multiple hydrolysis and single 24-h hydrolysis methods for approximately one-half of the amino acids. Tryptophan, aspartic acid, threonine, tyrosine, isoleucine, valine, serine and alanine contents were underestimated by 10.6, 5.6, 5.6, 4.7, 4.4, 3.7, 3.7 and 3.6%, respectively, by the single 24-h hydrolysis. The study provides accurate reference data on the amino acid composition of goat milk powders. Goat milk infant formula has amino acids in amounts similar to human milk reference values, when expressed on a per-energy basis.

  10. Stable carbon isotopic compositions of low-molecular-weight dicarboxylic acids, oxocarboxylic acids, α-dicarbonyls, and fatty acids: implications for atmospheric processing of organic aerosols

    NASA Astrophysics Data System (ADS)

    Zhang, Y.; Kawamura, K.; Cao, F.; Lee, M.

    2015-12-01

    Stable carbon isotopic compositions (δ13C) were measured for 23 individual organic species including 9 dicarboxylic acids, 7 oxocarboxylic acids, 1 tricarboxylic acid, 2 α-dicarbonyls and 4 fatty acids in the aerosols from Gosan background site in East Asia. δ13C of particle-phase glyoxal and methylglyoxal are significantly higher than those previously reported for isoprene and other precursors, associated with isotope fractionation during atmospheric oxidation. 13C is consistently more enriched for oxalic acid (C2), glyoxylic acid, pyruvic acid, glyoxal and methylglyoxal compared to other organic compounds identified, which can be explained by the kinetic isotope effects during aqueous-phase processing and the subsequent gas-particle partitioning after clouds or wet aerosols evaporation δ13C of C2 is positively correlated with C2 and organic carbon ratio, indicating that a photochemical production of C2 is more pronounced than its degradation process during long-range transport. The 13C results also suggest that aqueous-phase oxidation of glyoxal and methylglyoxal is major formation process of oxalic acid production via the major intermediates glyoxylic acid and pyruvic acid. This study provides evidence that organic aerosols are intensively photo-chemically aged in this region.

  11. Radical scavenging capacity of methanolic Phillyrea latifolia L. extract: anthocyanin and phenolic acids composition of fruits.

    PubMed

    Ayranci, Erol; Erkan, Naciye

    2013-01-01

    Radical scavenging capacity of a crude methanolic extract from the fruits of Phillyrea latifolia L., commonly known as green olive tree or mock privet, was investigated with reference to anthocyanin standards, as flavonoids, and phenolic acid standards, as phenylpropanoids. Characterization with high performance liquid chromatography-diode array detection (HPLC-DAD) indicated the presence of keracyanin, kuromanin, cyanidin, ferulic acid, caffeic acid and rosmarinic acid at amounts of 289.1, 90.4, 191.4, 225.2, 221.2 and 190.1 mg/100 g fresh weight (FW) of fruits, respectively. Chlorogenic and p-coumaric acids were found to exist in lower amounts. Trolox equivalent antioxidant capacity (TEAC) and IC(50) values of the plant extract were found to be 1.8 mM Trolox equivalents (TE)/g FW of fruits and 69.4 µg/mL, respectively, indicating the close radical scavenging activity of the extract to those of keracyanin and p-coumaric acid. The crude methanolic P. latifolia L. fruit extract was seen to be fairly potent in radical scavenging. Total phenolic content (TPC) of the plant extract was found to be 1652.9 mg gallic acid equivalent (GAE)/100 g FW of fruits. PMID:23364751

  12. Green chemistry in urinalysis for trichloroethanol and trichloroacetic acid as markers of exposure to chlorinated hydrocarbon solvents.

    PubMed

    Inoue, Osamu; Ukai, Hirohiko; Ikeda, Masayuki

    2006-01-01

    The aim of the present study was to develop a method of urinalysis for trichloroacetic acid (TCA) and trichloroethanol (TCE), and therefore total trichloro-compounds (TTC) as the sum, with least use of hazardous chemicals, being green in that sense. After acid hydrolysis followed by dilution with an ethanol (EtOH)-methanol (MeOH)-water mixture, capillary gas-choromatography with an electron-capture detector can quantify TCA and TCE in the diluted hydrolyzate. Comparison studies showed that the results were identical among three methods, i.e., 1. the method developed in the present study, 2. a head-space GC with acid hydrolysis of conjugated TCE and methyl-esterification of TCA, and 3. traditional colorimetry with Fujiwara reaction. When applied to exposure-excretion analysis, the three methods gave results reproducible to each other. Over-all evaluation therefore was such that the method developed in the present study is as equally reliable as previously developed methods. It should be further noted that the procedures are very simple, with minimum use of occupationally or environmentally hazardous chemicals. In case the determination of only TCA is requested, it is possible to skip the hydrolysis step so that the treatment prior to the GC analysis is even simpler, i.e., just a 60-fold dilution of the urine sample with the EtOH-MeOH-water mixture. It was also demonstrated that correction of urinary analyte levels for urine density in terms of creatinine or specific gravity did not improve the correlation with the intensity of TRI exposure. PMID:16610561

  13. Submesoscale characteristics and transcription of a fatty acid elongase gene from a freshwater green microalgae, Myrmecia incisa Reisigl

    NASA Astrophysics Data System (ADS)

    Yu, Shuiyan; Liu, Shicheng; Li, Chunyang; Zhou, Zhigang

    2011-01-01

    Myrmecia incisa is a green coccoid freshwater microalgae, which is rich in arachidonic acid (ArA, C20: 4ω-6, δ5, 8, 11, 14), a long chain polyunsaturated fatty acid (PUFA), especially under nitrogen starvation stress. A cDNA library of M. incisa was constructed with λ phage vectors and a 545 nt expressed sequence tag (EST) was screened from this library as a putative elongase gene due to its 56% and 49% identity to Marchantia polymorpha L. and Ostreococcus tauri Courties et Chrétiennot-Dinet, respectively. Based upon this EST sequence, an elongase gene designated MiFAE was isolated from M. incisa via 5'/3' rapid amplification of cDNA ends (RACE). The cDNA sequence was 1 331 bp long and included a 33 bp 5'-untranslated region (UTR) and a 431 bp 3'-UTR with a typical poly-A tail. The 867 bp ORF encoded a predicted protein of 288 amino acids. This protein was characterized by a conserved histidine-rich box and a MYxYY motif that was present in other members of the elongase family. The genomic DNA sequence of MiFAE was found to be interrupted by three introns with splicing sites of Introns I (81 bp), II (81 bp), and III (67 bp) that conformed to the GT-AG rule. Quantitative real-time PCR showed that the transcription level of MiFAE in this microalga under nitrogen starvation was higher than that under normal condition. Prior to the ArA content accumulation, the transcription of MiFAE was enhanced, suggesting that it was possibly responsible for the ArA accumulation in this microalga cultured under nitrogen starvation conditions.

  14. Photoproducts of carminic acid formed by a composite from Manihot dulcis waste.

    PubMed

    Antonio-Cisneros, Cynthia M; Dávila-Jiménez, Martín M; Elizalde-González, María P; García-Díaz, Esmeralda

    2015-04-15

    Carbon-TiO2 composites were obtained from carbonised Manihot dulcis waste and TiO2 using glycerol as an additive and thermally treating the composites at 800 °C. Furthermore, carbon was obtained from manihot to study the adsorption, desorption and photocatalysis of carminic acid on these materials. Carminic acid, a natural dye extracted from cochineal insects, is a pollutant produced by the food industry and handicrafts. Its photocatalysis was observed under different atmospheres, and kinetic curves were measured by both UV-Vis and HPLC for comparison, yielding interesting differences. The composite was capable of decomposing approximately 50% of the carminic acid under various conditions. The reaction was monitored by UV-Vis spectroscopy and LC-ESI-(Qq)-TOF-MS-DAD, enabling the identification of some intermediate species. The deleterious compound anthracene-9,10-dione was detected both in N2 and air atmospheres. PMID:25466082

  15. Solid Sulfonic Acid Catalysts Based on Porous Carbons and Carbon-Silica Composites

    NASA Astrophysics Data System (ADS)

    Tian, Xiao Ning; Luo, Lijuan; Jiang, Zhongqing; Zhao, X. S.

    Mesoporous carbons prepared using a templating method under different carbonization temperatures are sulfonated with concentrated H2SO4. Without the moving of silica template carbon-silica composites were prepared, which can maintain the pore structure well during sulfonation reaction process. The resultant samples are characterized using nitrogen adsorption, transmission electron microscope, field-emission scanning electron microscope, X-ray diffraction, X-ray photoelectron spectroscopy, and elemental analysis techniques. The catalytic performances of the sulfonated carbons and composites are evaluated by esterification reaction of methanol with acetic acid. The results show that a low-temperature carbonization process is favorable for improving the reaction conversion of acetic acid. In addition, the sulfonated carbon-silica composites show a higher acetic acid conversion than the sulfonated mesoporous carbons.

  16. Influence of Fatty Acid Precursors, Including Food Preservatives, on the Growth and Fatty Acid Composition of Listeria monocytogenes at 37 and 10°C ▿

    PubMed Central

    Julotok, Mudcharee; Singh, Atul K.; Gatto, Craig; Wilkinson, Brian J.

    2010-01-01

    Listeria monocytogenes is a food-borne pathogen that grows at refrigeration temperatures and increases its content of anteiso-C15:0 fatty acid, which is believed to be a homeoviscous adaptation to ensure membrane fluidity, at these temperatures. As a possible novel approach for control of the growth of the organism, the influences of various fatty acid precursors, including branched-chain amino acids and branched- and straight-chain carboxylic acids, some of which are also well-established food preservatives, on the growth and fatty acid composition of the organism at 37°C and 10°C were studied in order to investigate whether the organism could be made to synthesize fatty acids that would result in impaired growth at low temperatures. The results indicate that the fatty acid composition of L. monocytogenes could be modulated by the feeding of branched-chain amino acid, C4, C5, and C6 branched-chain carboxylic acid, and C3 and C4 straight-chain carboxylic acid fatty acid precursors, but the growth-inhibitory effects of several preservatives were independent of effects on fatty acid composition, which were minor in the case of preservatives metabolized via acetyl coenzyme A. The ability of a precursor to modify fatty acid composition was probably a reflection of the substrate specificities of the first enzyme, FabH, in the condensation of primers of fatty acid biosynthesis with malonyl acyl carrier protein. PMID:20048057

  17. Influence of fatty acid precursors, including food preservatives, on the growth and fatty acid composition of Listeria monocytogenes at 37 and 10degreesC.

    PubMed

    Julotok, Mudcharee; Singh, Atul K; Gatto, Craig; Wilkinson, Brian J

    2010-03-01

    Listeria monocytogenes is a food-borne pathogen that grows at refrigeration temperatures and increases its content of anteiso-C(15:0) fatty acid, which is believed to be a homeoviscous adaptation to ensure membrane fluidity, at these temperatures. As a possible novel approach for control of the growth of the organism, the influences of various fatty acid precursors, including branched-chain amino acids and branched- and straight-chain carboxylic acids, some of which are also well-established food preservatives, on the growth and fatty acid composition of the organism at 37 degrees C and 10 degrees C were studied in order to investigate whether the organism could be made to synthesize fatty acids that would result in impaired growth at low temperatures. The results indicate that the fatty acid composition of L. monocytogenes could be modulated by the feeding of branched-chain amino acid, C(4), C(5), and C(6) branched-chain carboxylic acid, and C(3) and C(4) straight-chain carboxylic acid fatty acid precursors, but the growth-inhibitory effects of several preservatives were independent of effects on fatty acid composition, which were minor in the case of preservatives metabolized via acetyl coenzyme A. The ability of a precursor to modify fatty acid composition was probably a reflection of the substrate specificities of the first enzyme, FabH, in the condensation of primers of fatty acid biosynthesis with malonyl acyl carrier protein.

  18. Determination of fatty acid composition of γ-irradiated hazelnuts, walnuts, almonds, and pistachios

    NASA Astrophysics Data System (ADS)

    Gecgel, Umit; Gumus, Tuncay; Tasan, Murat; Daglioglu, Orhan; Arici, Muhammet

    2011-04-01

    Hazelnut, walnut, almonds, and pistachio nuts were treated with 1, 3, 5, and 7 kGy of gamma irradiation, respectively. Oil content, free fatty acid, peroxide value, and fatty acid composition of the nuts were investigated immediately after irradiation. The data obtained from the experiments indicated that gamma irradiation did not cause any significant change in the oil content of nuts. In contrast, free fatty acid and peroxide value of the nuts increased proportionally to the dose (p<0.05). Among the fatty acids determined, the concentration of total saturated fatty acids increased while total monounsaturated and total polyunsaturated fatty acids decreased with the irradiation dose (p<0.05 and <0.01).

  19. Mechanical properties of a reactive endcapped polyimide based composite from polyamide acid

    SciTech Connect

    Hergenrother, P.M.; Rommel, M.L.

    1996-12-31

    The objective of this study was to characterize a composite unidirectional tape made with unsized Hercules IM7 fibers and a phenylethynyl terminated polyimide in the form of a polyamide acid. A processing study to examine the effect of cure parameters and robustness of the consolidation process was conducted and showed the versatile processing afforded by the phenylethynyl terminated polyimide. The mechanical and physical properties of laminates produced from the optimized composite cure process are presented and compared to a commercially available polyimide.

  20. Stable carbon isotopic compositions of organic acids in total suspended particles and dusts from Guangzhou, China

    NASA Astrophysics Data System (ADS)

    Ma, Shexia; Peng, Ping'an; Song, Jianzhong; Zhao, Jinping; He, Lulu; Sheng, Guoying; Fu, Jiamo

    2010-10-01

    Stable carbon isotopic compositions of individual organic acids were determined in total suspended particles and dusts from Guangzhou. The δ 13C values of high molecular weight n-alkanoic acids (C 20-C 28) varied from -34.1‰ to -32.4‰ and tended to be heavier in summer and lighter in winter. These δ 13C values indicate that high molecular weight n-alkanoic acids were derived mainly from emission by C 3 plants. Reduced biological synthesis of high molecular weight n-alkanoic acids in winter may be the reason for the light carbon isotopic composition. The δ 13C values of low molecular weight n-alkanoic acids (C 10-C 18) changed from -31.7‰ to -30.3‰ and exhibited a reverse seasonal trend, i.e., heavier in winter and lighter in summer. Slightly heavier δ 13C values of low molecular weight n-alkanoic acids than those of high molecular weight n-alkanoic acids suggested that they may be emitted from blended sources, e.g., anthropogenic sources and vegetation waxes. Lighter δ 13C values in summer may be attributed to relatively low anthropogenic sources and high botanic sources in summer. Dicarboxylic acids and aromatic acids have been proposed as secondary products from photochemical degradation. The average δ 13C values of dicarboxylic acids and aromatic acids were heavier, and ranged from -25.2‰ to -22.9‰ and from -30.0‰ to -27.6‰, respectively. Both dicarboxylic acids and aromatic acids displayed the same temporal variations in the δ 13C values, i.e., negative δ 13C in the summer samples and positive in the winter samples, which may be controlled by photochemical reactions; they are generally severe in winter in Guangzhou under the monsoon weather system. The heaviest δ 13C values were observed in dicarboxylic acids, indicating that dicarboxylic acids were formed by fast and more complete oxidation reactions. These results indicate that the stable carbon isotopic composition of organic acids may provide important information about sources and

  1. Fatty acid composition of breast milk from three racial groups from Penang, Malaysia.

    PubMed

    Kneebone, G M; Kneebone, R; Gibson, R A

    1985-04-01

    The fatty acid composition of samples of breast milk obtained from 51 mothers (26 Malay, 15 Chinese, 10 Indian) residing in Penang, Malaysia was determined by gas chromatography. Despite living in close physical proximity the mothers from the three racial groups showed distinct cultural differences in dietary intake. These differences were reflected in differences in the fatty acid composition of breast milk samples. The milk of Chinese mothers was generally less saturated (41%) than that of Malay and Indian mothers (52 and 50% respectively). The milk of Chinese mothers was also richer in linoleic acid (17%) than that of Malay and Indian mothers (9% and 11% respectively). Overall the level of individual fatty acids fell within the range of values reported for Western mothers on well nourished diets and pointed to breast milk of high standard despite large variations in the diet of Malaysian mothers. PMID:3984928

  2. Fatty acid composition of breast milk from three racial groups from Penang, Malaysia.

    PubMed

    Kneebone, G M; Kneebone, R; Gibson, R A

    1985-04-01

    The fatty acid composition of samples of breast milk obtained from 51 mothers (26 Malay, 15 Chinese, 10 Indian) residing in Penang, Malaysia was determined by gas chromatography. Despite living in close physical proximity the mothers from the three racial groups showed distinct cultural differences in dietary intake. These differences were reflected in differences in the fatty acid composition of breast milk samples. The milk of Chinese mothers was generally less saturated (41%) than that of Malay and Indian mothers (52 and 50% respectively). The milk of Chinese mothers was also richer in linoleic acid (17%) than that of Malay and Indian mothers (9% and 11% respectively). Overall the level of individual fatty acids fell within the range of values reported for Western mothers on well nourished diets and pointed to breast milk of high standard despite large variations in the diet of Malaysian mothers.

  3. Role of fatty acid composites in the toxicity of titanium dioxide nanoparticles used in cosmetic products.

    PubMed

    Chang, JuOae; Lee, Chang-Woo; Alsulimani, Helal Hussain; Choi, Jee Eun; Lee, Joo-Kyung; Kim, AhYoung; Park, Bae Ho; Kim, Jonghan; Lee, HeaYeon

    2016-01-01

    It has been recognized that the use of nanoparticles (NPs) in the cosmetic industry results in products with better efficacy and functionality. However, recent advances in molecular toxicology have revealed that NP exposure can promote cytotoxicity and oxidative damage, which has raised health concerns in the use of NPs in personal care products. Nevertheless, the mechanistic basis for the toxicity and safety of cosmetic NPs is poorly understood. The goal of the study was to determine the cytotoxicity and intracellular distribution of titanium dioxide (TiO2) NPs containing fatty acid composites (palmitoleic acid, palmitic acid, stearic acid and oleic acid) commonly used in cosmetic products. Two types of cells, human fibroblast skin cells and adenocarcinoma lung cells, were exposed to either bare TiO2 NPs or TiO2 NPs mixed with fatty acids for up to 48 hr. NMR analysis confirmed that the fatty acid composites remained in the NPs after wash. The cytotoxicity of TiO2 NPs was determined by cell viability measurement using quantitative confocal microscopy, and the localization of two different forms of TiO2 NPs were assessed using electron spectroscopic imaging with transmission electron microscopy. TiO2 NPs containing fatty acids posed significantly reduced cytotoxicity (80-88% decreases) than bare NPs in both cell types. Furthermore, there was less intracellular penetration of the NPs containing fatty acid composites compared with bare NPs. These results provide important insights into the role of fatty acids in protecting the cells from possible toxicity caused by NPs used in the production of cosmetic products.

  4. Decreased hepatotoxic bile acid composition and altered synthesis in progressive human nonalcoholic fatty liver disease

    SciTech Connect

    Lake, April D.; Novak, Petr; Shipkova, Petia; Aranibar, Nelly; Robertson, Donald; Reily, Michael D.; Lu, Zhenqiang; Lehman-McKeeman, Lois D.; Cherrington, Nathan J.

    2013-04-15

    Bile acids (BAs) have many physiological roles and exhibit both toxic and protective influences within the liver. Alterations in the BA profile may be the result of disease induced liver injury. Nonalcoholic fatty liver disease (NAFLD) is a prevalent form of chronic liver disease characterized by the pathophysiological progression from simple steatosis to nonalcoholic steatohepatitis (NASH). The hypothesis of this study is that the ‘classical’ (neutral) and ‘alternative’ (acidic) BA synthesis pathways are altered together with hepatic BA composition during progression of human NAFLD. This study employed the use of transcriptomic and metabolomic assays to study the hepatic toxicologic BA profile in progressive human NAFLD. Individual human liver samples diagnosed as normal, steatosis, and NASH were utilized in the assays. The transcriptomic analysis of 70 BA genes revealed an enrichment of downregulated BA metabolism and transcription factor/receptor genes in livers diagnosed as NASH. Increased mRNA expression of BAAT and CYP7B1 was observed in contrast to decreased CYP8B1 expression in NASH samples. The BA metabolomic profile of NASH livers exhibited an increase in taurine together with elevated levels of conjugated BA species, taurocholic acid (TCA) and taurodeoxycholic acid (TDCA). Conversely, cholic acid (CA) and glycodeoxycholic acid (GDCA) were decreased in NASH liver. These findings reveal a potential shift toward the alternative pathway of BA synthesis during NASH, mediated by increased mRNA and protein expression of CYP7B1. Overall, the transcriptomic changes of BA synthesis pathway enzymes together with altered hepatic BA composition signify an attempt by the liver to reduce hepatotoxicity during disease progression to NASH. - Highlights: ► Altered hepatic bile acid composition is observed in progressive NAFLD. ► Bile acid synthesis enzymes are transcriptionally altered in NASH livers. ► Increased levels of taurine and conjugated bile acids

  5. Effect of acidic solutions on the surface degradation of a micro-hybrid composite resin.

    PubMed

    Münchow, Eliseu A; Ferreira, Ana Cláudia A; Machado, Raissa M M; Ramos, Tatiana S; Rodrigues-Junior, Sinval A; Zanchi, Cesar H

    2014-01-01

    Composite resins may undergo wear by the action of chemical substances (e.g., saliva, alcohol, bacterial acids) of the oral environment, which may affect the material's structure and surface properties. This study evaluated the effect of acidic substances on the surface properties of a micro-hybrid composite resin (Filtek Z-250). Eighty specimens were prepared, and baseline hardness and surface roughness (KMN0 and Ra0, respectively) were measured. The specimens were subjected to sorption (SO) and solubility (SL) tests according to ISO 4049:2009, but using different storage solutions: deionized water; 75/25 vol% ethanol/water solution; lactic acid; propionic acid; and acetic acid. The acids were used in two concentrations: PA and 0.02 N. pH was measured for all solutions and final hardness (KMN1) and surface roughness (Ra1) were measured. Data were analyzed with paired t-tests and one-way ANOVA and Tukey's test (a=5%). All solutions decreased hardness and increased the Ra values, except for the specimens stored in water and 0.02 N lactic acid, which maintained the hardness. All solutions produced similar SO and SL phenomena, except for the 0.02 N lactic acid, which caused lower solubility than the other solutions. Ethanol showed the highest pH (6.6) and the 0.02 N lactic acid the lowest one (2.5). The solutions affected negatively the surface properties of the composite resin; in addition, an acidic pH did not seem to be a significant factor that intensifies the surface degradation phenomena. PMID:25250496

  6. Role of fatty acid composites in the toxicity of titanium dioxide nanoparticles used in cosmetic products.

    PubMed

    Chang, JuOae; Lee, Chang-Woo; Alsulimani, Helal Hussain; Choi, Jee Eun; Lee, Joo-Kyung; Kim, AhYoung; Park, Bae Ho; Kim, Jonghan; Lee, HeaYeon

    2016-01-01

    It has been recognized that the use of nanoparticles (NPs) in the cosmetic industry results in products with better efficacy and functionality. However, recent advances in molecular toxicology have revealed that NP exposure can promote cytotoxicity and oxidative damage, which has raised health concerns in the use of NPs in personal care products. Nevertheless, the mechanistic basis for the toxicity and safety of cosmetic NPs is poorly understood. The goal of the study was to determine the cytotoxicity and intracellular distribution of titanium dioxide (TiO2) NPs containing fatty acid composites (palmitoleic acid, palmitic acid, stearic acid and oleic acid) commonly used in cosmetic products. Two types of cells, human fibroblast skin cells and adenocarcinoma lung cells, were exposed to either bare TiO2 NPs or TiO2 NPs mixed with fatty acids for up to 48 hr. NMR analysis confirmed that the fatty acid composites remained in the NPs after wash. The cytotoxicity of TiO2 NPs was determined by cell viability measurement using quantitative confocal microscopy, and the localization of two different forms of TiO2 NPs were assessed using electron spectroscopic imaging with transmission electron microscopy. TiO2 NPs containing fatty acids posed significantly reduced cytotoxicity (80-88% decreases) than bare NPs in both cell types. Furthermore, there was less intracellular penetration of the NPs containing fatty acid composites compared with bare NPs. These results provide important insights into the role of fatty acids in protecting the cells from possible toxicity caused by NPs used in the production of cosmetic products. PMID:27432239

  7. The Effect of Light on the Tricarboxylic Acid Cycle in Green Leaves

    PubMed Central

    Chapman, E. A.; Graham, D.

    1974-01-01

    Long term feeding of acetate-2-14C, 14CO2, citrate-1,5-14C, fumarate-2,3-14C, and succinate-2,3-14C to mung bean (Phaseolus aureus L. var. Mungo) leaves in the dark gave labeling predominantly in tricarboxylic acid cycle intermediates. Kinetics of the intermediates during dark/light/dark transitions showed a light-induced interchange of 14C between malate and aspartate, usually resulting in an accumulation of 14C in malate and a decrease of it in aspartate. 14C-Phosphoenolpyruvate also showed a marked decrease during illumination. Changes in other intermediates of the tricarboxylic acid cycle were relatively minor. The kinetic data have been analyzed using the Chance crossover theorem to locate control points during the dark/light/dark transitions. The major apparent control points are located at malate and isocitrate dehydrogenases, and less frequently at citrate synthase and fumarase. These findings are explained in terms of the light-induced changes in adenine nucleotides and nicotinamide adenine dinucleotides. PMID:16658810

  8. Effect of Maturation Degree on Composition of Fatty Acids and Tocopherols of Fruit Oil from Pistacia atlantica Growing Wild in Algeria.

    PubMed

    Guenane, Hamid; Bombarda, Isabelle; OuldElhadj, Mohamed Didi; Yousfi, Mohamed

    2015-10-01

    Pistacia atlantica fruit oil has been used for a long time by local populations for culinary and medicinal purposes. In this study, the fatty acid composition and tocopherol content were determined in twelve samples of P. atlantica fruit oil at three stages of maturation (immature, intermediate maturity and mature) collected in three different sites from the region of Laghouat. The results indicated a significant difference between the oil of mature fruits (green and black) and the immature ones (light red), which were distinguished by richness in unsaturated fatty acids and tocopherols. The oil from fruits of intermediate maturity (dark red) seems to combine these properties with those of the mature group, including oil yields. Such data emphasize the value of this oil, which needs further investigation.

  9. Effect of Maturation Degree on Composition of Fatty Acids and Tocopherols of Fruit Oil from Pistacia atlantica Growing Wild in Algeria.

    PubMed

    Guenane, Hamid; Bombarda, Isabelle; OuldElhadj, Mohamed Didi; Yousfi, Mohamed

    2015-10-01

    Pistacia atlantica fruit oil has been used for a long time by local populations for culinary and medicinal purposes. In this study, the fatty acid composition and tocopherol content were determined in twelve samples of P. atlantica fruit oil at three stages of maturation (immature, intermediate maturity and mature) collected in three different sites from the region of Laghouat. The results indicated a significant difference between the oil of mature fruits (green and black) and the immature ones (light red), which were distinguished by richness in unsaturated fatty acids and tocopherols. The oil from fruits of intermediate maturity (dark red) seems to combine these properties with those of the mature group, including oil yields. Such data emphasize the value of this oil, which needs further investigation. PMID:26669112

  10. Amino acid composition, including key derivatives of eccrine sweat: potential biomarkers of certain atopic skin conditions.

    PubMed

    Mark, Harker; Harding, Clive R

    2013-04-01

    The free amino acid (AA) composition of eccrine sweat is different from other biological fluids, for reasons which are not properly understood. We undertook the detailed analysis of the AA composition of freshly isolated pure human eccrine sweat, including some of the key derivatives of AA metabolism, to better understand the key biological mechanisms governing its composition. Eccrine sweat was collected from the axillae of 12 healthy subjects immediately upon formation. Free AA analysis was performed using an automatic AA analyser after ninhydrin derivatization. Pyrrolidine-5-carboxylic acid (PCA) and urocanic acid (UCA) levels were determined using GC/MS. The free AA composition of sweat was dominated by the presence of serine accounting for just over one-fifth of the total free AA composition. Glycine was the next most abundant followed by PCA, alanine, citrulline and threonine, respectively. The data obtained indicate that the AA content of sweat bears a remarkable similarity to the AA composition of the epidermal protein profilaggrin. This protein is the key source of free AAs and their derivatives that form a major part of the natural moisturizing factor (NMF) within the stratum corneum (SC) and plays a major role in maintaining the barrier integrity of human skin. As perturbations in the production of NMF can lead to abnormal barrier function and can arise as a consequence of filaggrin genotype, we propose the quantification of AAs in sweat may serve as a non-invasive diagnostic biomarker for certain atopic skin conditions, that is, atopic dermatitis (AD).

  11. Enzymatically cross-linked alginic-hyaluronic acid composite hydrogels as cell delivery vehicles.

    PubMed

    Ganesh, Nitya; Hanna, Craig; Nair, Shantikumar V; Nair, Lakshmi S

    2013-04-01

    An injectable composite gel was developed from alginic and hyaluronic acid. The enzymatically cross-linked injectable gels were prepared via the oxidative coupling of tyramine modified sodium algiante and sodium hyaluronate in the presence of horse radish peroxidase (HRP) and hydrogen peroxide (H2O2). The composite gels were prepared by mixing equal parts of the two tyraminated polymer solutions in 10U HRP and treating with 1.0% H2O2. The properties of the alginate gels were significantly affected by the addition of hyaluronic acid. The percentage water absorption and storage modulus of the composite gels were found to be lower than the alginate gels. The alginate and composite gels showed lower protein release compared to hyaluronate gels in the absence of hyaluronidase. Even hyaluronate gels showed only approximately 10% protein release after 14 days incubation in phosphate buffer solution. ATDC-5 cells encapsulated in the injectable gels showed high cell viability. The composite gels showed the presence of enlarged spherical cells with significantly higher metabolic activity compared to cells in hyaluronic and alginic acid gels. The results suggest the potential of the composite approach to develop covalently cross-linked hydrogels with tuneable physical, mechanical, and biological properties. PMID:23357799

  12. Enzymatically Cross-linked Alginic-Hyaluronic acid Composite Hydrogels As Cell Delivery Vehicles

    PubMed Central

    Ganesh, Nitya; Hanna, Craig; Nair, Shantikumar V.; Nair, Lakshmi S.

    2013-01-01

    An injectable composite gel was developed from alginic and hyaluronic acid. The ezymatically cross-linked injectable gels were prepared via the oxidative coupling of tyramine modified sodium algiante and sodium hyaluronate in the presence of horse radish peroxidase (HRP) and hydrogen peroxide (H2O2). The composite gels were prepared by mixing equal parts of the two tryaminated polymer solutions in 10U HRP and treating with 1.0% H2O2. The properties of the alginate gels were significanly affected by the addition of hyaluronic acid. The percentage water absorption and storage modulus of the composite gels were found to be lower than the alginate gels. The alginate and composite gels showed lower protein release compared to hyaluronate gels in the absence of hyaluronidase. Even hyaluronate gels showed only approximately 10% protein release after 14 days incubation in phosphate buffer solution. ATDC-5 cells encapsulated in the injectable gels showed high cell viability. The composite gels showed the presence of enlarged spherical cells with significantly higher metabolic activity compared to cells in hyaluronic and alginic acid gels. The results suggest the potential of the composite approach to develop covalently cross-linked hydrogels with tuneable physical, mechanical, and biological properties. PMID:23357799

  13. Tables of critical values for examining compositional non-randomness in proteins and nucleic acids

    NASA Technical Reports Server (NTRS)

    Laird, M.; Holmquist, R.

    1975-01-01

    A binomially distributed statistic is defined to show whether or not the proportion of a particular amino acid in a protein deviates from random expectation. An analogous statistic is derived for nucleotides in nucleic acids. These new statistics are simply related to the classical chi-squared test. They explicitly account for the compositional fluctuations imposed by the finite length of proteins, and they are more accurate than previous tables.

  14. Amino Acid compositions of 27 food fishes and their importance in clinical nutrition.

    PubMed

    Mohanty, Bimal; Mahanty, Arabinda; Ganguly, Satabdi; Sankar, T V; Chakraborty, Kajal; Rangasamy, Anandan; Paul, Baidyanath; Sarma, Debajit; Mathew, Suseela; Asha, Kurukkan Kunnath; Behera, Bijay; Aftabuddin, Md; Debnath, Dipesh; Vijayagopal, P; Sridhar, N; Akhtar, M S; Sahi, Neetu; Mitra, Tandrima; Banerjee, Sudeshna; Paria, Prasenjit; Das, Debajeet; Das, Pushpita; Vijayan, K K; Laxmanan, P T; Sharma, A P

    2014-01-01

    Proteins and amino acids are important biomolecules which regulate key metabolic pathways and serve as precursors for synthesis of biologically important substances; moreover, amino acids are building blocks of proteins. Fish is an important dietary source of quality animal proteins and amino acids and play important role in human nutrition. In the present investigation, crude protein content and amino acid compositions of important food fishes from different habitats have been studied. Crude protein content was determined by Kjeldahl method and amino acid composition was analyzed by high performance liquid chromatography and information on 27 food fishes was generated. The analysis showed that the cold water species are rich in lysine and aspartic acid, marine fishes in leucine, small indigenous fishes in histidine, and the carps and catfishes in glutamic acid and glycine. The enriched nutrition knowledge base would enhance the utility of fish as a source of quality animal proteins and amino acids and aid in their inclusion in dietary counseling and patient guidance for specific nutritional needs.

  15. Impact of metabolism and growth phase on the hydrogen isotopic composition of microbial fatty acids

    PubMed Central

    Heinzelmann, Sandra M.; Villanueva, Laura; Sinke-Schoen, Danielle; Sinninghe Damsté, Jaap S.; Schouten, Stefan; van der Meer, Marcel T. J.

    2015-01-01

    Microorganisms are involved in all elemental cycles and therefore it is important to study their metabolism in the natural environment. A recent technique to investigate this is the hydrogen isotopic composition of microbial fatty acids, i.e., heterotrophic microorganisms produce fatty acids enriched in deuterium (D) while photoautotrophic and chemoautotrophic microorganisms produce fatty acids depleted in D compared to the water in the culture medium (growth water). However, the impact of factors other than metabolism have not been investigated. Here, we evaluate the impact of growth phase compared to metabolism on the hydrogen isotopic composition of fatty acids of different environmentally relevant microorganisms with heterotrophic, photoautotrophic and chemoautotrophic metabolisms. Fatty acids produced by heterotrophs are enriched in D compared to growth water with εlipid/water between 82 and 359‰ when grown on glucose or acetate, respectively. Photoautotrophs (εlipid/water between −149 and −264‰) and chemoautotrophs (εlipid/water between −217 and −275‰) produce fatty acids depleted in D. Fatty acids become, in general, enriched by between 4 and 46‰ with growth phase which is minor compared to the influence of metabolisms. Therefore, the D/H ratio of fatty acids is a promising tool to investigate community metabolisms in nature. PMID:26005437

  16. Amino Acid Compositions of 27 Food Fishes and Their Importance in Clinical Nutrition

    PubMed Central

    Mahanty, Arabinda; Sankar, T. V.; Chakraborty, Kajal; Rangasamy, Anandan; Paul, Baidyanath; Sarma, Debajit; Mathew, Suseela; Asha, Kurukkan Kunnath; Behera, Bijay; Aftabuddin, Md.; Debnath, Dipesh; Vijayagopal, P.; Sridhar, N.; Akhtar, M. S.; Sahi, Neetu; Mitra, Tandrima; Banerjee, Sudeshna; Das, Debajeet; Das, Pushpita; Vijayan, K. K.; Laxmanan, P. T.; Sharma, A. P.

    2014-01-01

    Proteins and amino acids are important biomolecules which regulate key metabolic pathways and serve as precursors for synthesis of biologically important substances; moreover, amino acids are building blocks of proteins. Fish is an important dietary source of quality animal proteins and amino acids and play important role in human nutrition. In the present investigation, crude protein content and amino acid compositions of important food fishes from different habitats have been studied. Crude protein content was determined by Kjeldahl method and amino acid composition was analyzed by high performance liquid chromatography and information on 27 food fishes was generated. The analysis showed that the cold water species are rich in lysine and aspartic acid, marine fishes in leucine, small indigenous fishes in histidine, and the carps and catfishes in glutamic acid and glycine. The enriched nutrition knowledge base would enhance the utility of fish as a source of quality animal proteins and amino acids and aid in their inclusion in dietary counseling and patient guidance for specific nutritional needs. PMID:25379285

  17. Impact of metabolism and growth phase on the hydrogen isotopic composition of microbial fatty acids.

    PubMed

    Heinzelmann, Sandra M; Villanueva, Laura; Sinke-Schoen, Danielle; Sinninghe Damsté, Jaap S; Schouten, Stefan; van der Meer, Marcel T J

    2015-01-01

    Microorganisms are involved in all elemental cycles and therefore it is important to study their metabolism in the natural environment. A recent technique to investigate this is the hydrogen isotopic composition of microbial fatty acids, i.e., heterotrophic microorganisms produce fatty acids enriched in deuterium (D) while photoautotrophic and chemoautotrophic microorganisms produce fatty acids depleted in D compared to the water in the culture medium (growth water). However, the impact of factors other than metabolism have not been investigated. Here, we evaluate the impact of growth phase compared to metabolism on the hydrogen isotopic composition of fatty acids of different environmentally relevant microorganisms with heterotrophic, photoautotrophic and chemoautotrophic metabolisms. Fatty acids produced by heterotrophs are enriched in D compared to growth water with εlipid/water between 82 and 359‰ when grown on glucose or acetate, respectively. Photoautotrophs (εlipid/water between -149 and -264‰) and chemoautotrophs (εlipid/water between -217 and -275‰) produce fatty acids depleted in D. Fatty acids become, in general, enriched by between 4 and 46‰ with growth phase which is minor compared to the influence of metabolisms. Therefore, the D/H ratio of fatty acids is a promising tool to investigate community metabolisms in nature. PMID:26005437

  18. Polymorphism of SREBP1 is associated with beef fatty acid composition in Simmental bulls.

    PubMed

    Xu, L; Zhang, L P; Yuan, Z R; Guo, L P; Zhu, M; Gao, X; Gao, H J; Li, J Y; Xu, S Z

    2013-01-01

    The sterol regulatory element binding factor 1 gene (SREBP1) plays an important role in the biosynthesis of fatty acids and cholesterol, and in lipid metabolism. The objective of this study was to investigate the effect of genetic polymorphisms of SREBP1 on the fatty acid composition of muscle and carcass traits in Simmental bulls and Snow Dragon black cattle. The 84-bp insertion/deletion (indel) in intron 5 of the bovine SREBP1 gene was genotyped by polymerase chain reaction to investigate its associations with traits. The results showed that the 84-bp indel in intron 5 was significantly associated with palmitoleic acid (C16:1), stearic acid (C18:0), saturated fatty acids (SFA), triglycerides (TAG), and the C16 index in Simmental bulls (P < 0.05). Cattle with the LL genotype had higher palmitic acid (C16:1), triglycerides, and C16 index but lower stearic acid (C18:0) and SFA compared to those with the LS genotype (P < 0.05). In conclusion, the 84-bp indel of SREBP1 could be used as a genetic marker for selecting Simmental breeding stock for healthier fatty acid composition. PMID:24301949

  19. [Composition of fat acids in three Mexican populations of Artemia franciscana from epicontinental waters].

    PubMed

    Malpica Sánchez, Aída; Castro Barrera, Thalía; Sandoval Trujillo, Horacio; Castro Mejía, Jorge; De Lara Andrade, Ramón; Castro Mejía, Germán

    2004-03-01

    In this paper is presented the percentage of fatty acids composition of three Artemia franciscana Mexican populations of epicontinentals waters; two are from natural environments (Coahuila and San Luis Potosf) and one (Texcoco) is a culture fed with Spirulina. Determination of fatty acids composition in each population, was performed by extraction of total lipid by the soxhlet method and the fatty acids methyl esters were determined by gas chromatography. The results show that Artemia of Texcoco contains the six fatty acids recommended for the culture of fish and crustaceans (16:0; 16:1; 18:1; 18:2w6; 18:3w3 and 20:5w3); Artemia from San Luis Potosi showed the poorest content in these acids and Artemia from Coahuila, although it showed a wide profile, it lacks the linolenic acid. When comparing results among the three populations with ecological data that have been published, it can be pointed out that the environment is decisive for this crustacean; Artemia from Texcoco fed with Spirulina showed the largest variety of fatty acids; the other two populations are wild, and lives in different habitats, Artemia of Coahuila is found in waters that are rich in sulfates and Artemia of San Luis Potosf lives in evaporation saltern ponds, built with stone blocks and therefore with scarce phytoplankton growth. Both Artemia populations showed deficiencies in essential fatty acids, mainly the last one.

  20. Isolation of Arabidopsis mutants with altered seed fatty acid composition

    SciTech Connect

    Lemieux, B.; Browse, J.; Somerville, C. Washington State Univ., Pullman )

    1989-04-01

    By direct screening of Arabidopsis seed fatty acid methyl esters, we have isolated mutants which are deficient in the elongation of 18:1 to 20:1 and the desaturation of 18:2 to 18:3. Both the elongation and the desaturation mutants, designated MB14 and BL1 respectively, have only 10% of the wild-type levels of 20:1 and 18:3 in their seeds. The intermediate levels of 20:1 and 18:3 in F1 seeds of crosses to the wild type indicate that the level of enzyme is regulating the amount of 20:1 and 18:3 in seeds. Consistent with this observation, the mutations were found to segregate 1:2:1 in F2 seeds. We have found that the 18:2 desaturase mutation is clearly expressed in root phosphatidylcholine.

  1. Green chemistry in protected horticulture: the use of peroxyacetic acid as a sustainable strategy.

    PubMed

    Carrasco, Gilda; Urrestarazu, Miguel

    2010-01-01

    Global reduction of chemical deposition into the environment is necessary. In protected horticulture, different strategies with biodegradable products are used to control pathogens. This review presents the available tools, especially for the management of protected horticultural species, including vegetables and ornamental plants. An analysis of the potential for degradable products that control pathogens and also encourage other productive factors, such as oxygen in the root system, is presented. Biosecurity in fertigation management of protected horticulture is conducted by using peroxyacetic acid mixtures that serve three basic principles: first, the manufacture of these products does not involve polluting processes; second, they have the same function as other chemicals, and third, after use and management there is no toxic residue left in the environment. The sustainability of protected horticulture depends on the development and introduction of technologies for implementation in the field. PMID:20559497

  2. Green Chemistry in Protected Horticulture: The Use of Peroxyacetic Acid as a Sustainable Strategy

    PubMed Central

    Carrasco, Gilda; Urrestarazu, Miguel

    2010-01-01

    Global reduction of chemical deposition into the environment is necessary. In protected horticulture, different strategies with biodegradable products are used to control pathogens. This review presents the available tools, especially for the management of protected horticultural species, including vegetables and ornamental plants. An analysis of the potential for degradable products that control pathogens and also encourage other productive factors, such as oxygen in the root system, is presented. Biosecurity in fertigation management of protected horticulture is conducted by using peroxyacetic acid mixtures that serve three basic principles: first, the manufacture of these products does not involve polluting processes; second, they have the same function as other chemicals, and third, after use and management there is no toxic residue left in the environment. The sustainability of protected horticulture depends on the development and introduction of technologies for implementation in the field. PMID:20559497

  3. Hemp hurds biorefining: A path to green L-(+)-lactic acid production.

    PubMed

    Gandolfi, Stefano; Pistone, Lucia; Ottolina, Gianluca; Xu, Ping; Riva, Sergio

    2015-09-01

    Sugars streams generated by organosolv pretreatment of hemp hurds, cellulose (C6) and hemicellulose (C5) fractions, were fermented to lactic acid (LA) by Bacillus coagulans strains XZL4 and DSM1. Pretreatment conditions and enzymatic hydrolysis were optimized and B. coagulans aptness to use lignocellulosic-derived sugars as a carbon source was evaluated. Methanolic organosolv pretreatment with 2.5% (w/w) H2SO4 gave the best results in terms of glucan recovery (98%), enzymatic hydrolysis of pretreated biomass (70%) and hemicellulosic sugars recovery (61%). C6 and C5 sugars fermentation by strain XZL4 gave, high LA yields (0.90 and 0.84 g/g), high titers (141 and 109 g/L), and high enantiomeric excess (>99%). Overall, 42 g of l-LA were obtained from 100 g of raw hemp hurds. These results can be considered promising for lignocellulosic feedstock valorization toward the production of polymer-grade LA.

  4. Life-history evolution at the molecular level: adaptive amino acid composition of avian vitellogenins

    PubMed Central

    Hughes, Austin L.

    2015-01-01

    Avian genomes typically encode three distinct vitellogenin (VTG) egg yolk proteins (VTG1, VTG2 and VTG3), which arose by gene duplication prior to the most recent common ancestor of birds. Analysis of VTG sequences from 34 avian species in a phylogenetic framework supported the hypothesis that VTG amino acid composition has co-evolved with embryo incubation time. Embryo incubation time was positively correlated with the proportions of dietary essential amino acids (EAAs) in VTG1 and VTG2, and with the proportion of sulfur-containing amino acids in VTG3. These patterns were seen even when only semi-altricial and/or altricial species were considered, suggesting that the duration of embryo incubation is a major selective factor on the amino acid composition of VTGs, rather than developmental mode alone. The results are consistent with the hypothesis that the level of EAAs provided to the egg represents an adaptation to the loss of amino acids through breakdown over the course of incubation and imply that life-history phenotypes and VTG amino acid composition have co-evolved throughout the evolutionary history of birds. PMID:26224713

  5. Effect of the fatty acid composition of acclimated oenological Lactobacillus plantarum on the resistance to ethanol.

    PubMed

    Bravo-Ferrada, B M; Gómez-Zavaglia, A; Semorile, L; Tymczyszyn, E E

    2015-02-01

    The aim of this work was to evaluate the changes due to acclimation to ethanol on the fatty acid composition of three oenological Lactobacillus plantarum strains and their effect on the resistance to ethanol and malic acid consumption (MAC). Lactobacillus plantarum UNQLp 133, UNQLp 65.3 and UNQLp 155 were acclimated in the presence of 6 or 10% v/v ethanol, for 48 h at 28°C. Lipids were extracted to obtain fatty acid methyl esters and analysed by gas chromatography interfaced with mass spectroscopy. The influence of change in fatty acid composition on the viability and MAC in synthetic wine was analysed by determining the Pearson correlation coefficient. Acclimated strains showed a significant change in the fatty composition with regard to the nonacclimated strains. Adaptation to ethanol led to a decrease in the unsaturated/saturated ratio, mainly resulting from an increase in the contribution of short-length fatty acid C12:0 and a decrease of C18:1. The content of C12:0 was related to a higher viability after inoculation of synthetic wine. The MAC increased at higher contents in saturated fatty acid, but its efficiency was strain dependent.

  6. Bacterial adherence to titanium, poly-L-lactic acid, and composite hydroxyapatite and poly-L-lactic acid interference screws.

    PubMed

    Masini, Brendan D; Stinner, Daniel J; Waterman, Scott M; Wenke, Joseph C; Gerlinger, Tad L

    2012-01-01

    This study investigates a potential site of bacterial adherence, the implant surface, comparing titanium, poly-L-lactic acid (PLLA), and composite hydroxyapatite and poly-L-lactic acid (PLLA-HA) interference screws using a bioluminescent in vitro model. Interference screws of three materials, titanium (Arthrex, Naples, FL), bioabsorbable poly-L-lactic acid (BIORCI, Smith & Nephew, Andover, MA), and bioabsorbable composite hydroxyapatite and poly-L-lactic acid (BIORCI-HA, Smith & Nephew, Andover, MA) were immersed in a broth of bioluminescent Staphylococcus aureus. The screws were irrigated and then imaged with a photon-capturing camera system yielding a total photon count correlating with residual adherent bacteria. The titanium screws had the lowest mean total bacterial counts followed by the PLLA-HA screws and with the PLLA screws having the highest mean total counts. The difference in means between the titanium group and the PLLA group was statistically significant (p < .001). Titanium interference screws have less bacterial adherence than comparable bioabsorbable PLLA screws.

  7. Beta-galactosidase and selective neutrality. [amino acid composition of proteins

    NASA Technical Reports Server (NTRS)

    Holmquist, R.

    1979-01-01

    Three hypotheses to explain the amino acid composition of proteins are inconsistent (about 10 to the minus 9th) with the experimental data for beta-galactosidase from Escherichia coli. The exceptional length of this protein, 1021 residues, permits rigorous tests of these hypotheses without complication from statistical artifacts. Either this protein is not at compositional equilibrium, which is unlikely from knowledge about other proteins, or the evolution of this protein and its coding gene have not been selectively neutral. However, the composition of approximately 60% of the molecule is consistent with either a selectively neutral or nonneutral evolutionary process.

  8. Soil and foliar nutrient and nitrogen isotope composition (δ(15)N) at 5 years after poultry litter and green waste biochar amendment in a macadamia orchard.

    PubMed

    Bai, Shahla Hosseini; Xu, Cheng-Yuan; Xu, Zhihong; Blumfield, Timothy J; Zhao, Haitao; Wallace, Helen; Reverchon, Frédérique; Van Zwieten, Lukas

    2015-03-01

    This study aimed to evaluate the improvement in soil fertility and plant nutrient use in a macadamia orchard following biochar application. The main objectives of this study were to assess the effects of poultry litter and green waste biochar applications on nitrogen (N) cycling using N isotope composition (δ(15)N) and nutrient availability in a soil-plant system at a macadamia orchard, 5 years following application. Biochar was applied at 10 t ha(-1) dry weight but concentrated within a 3-m diameter zone when trees were planted in 2007. Soil and leaf samples were collected in 2012, and both soil and foliar N isotope composition (δ(15)N) and nutrient concentrations were assessed. Both soil and foliar δ(15)N increased significantly in the poultry litter biochar plots compared to the green waste biochar and control plots. A significant relationship was observed between soil and plant δ(15)N. There was no influence of either biochars on foliar total N concentrations or soil NH4 (+)-N and NO3 (-)-N, which suggested that biochar application did not pose any restriction for plant N uptake. Plant bioavailable phosphorus (P) was significantly higher in the poultry litter biochar treatment compared to the green waste biochar treatment and control. We hypothesised that the bioavailability of N and P content of poultry litter biochar may play an important role in increasing soil and plant δ(15)N and P concentrations. Biochar application affected soil-plant N cycling and there is potential to use soil and plant δ(15)N to investigate N cycling in a soil-biochar-tree crop system. The poultry litter biochar significantly increased soil fertility compared to the green waste biochar at 5 years following biochar application which makes the poultry litter a better feedstock to produce biochar compared to green waste for the tree crops.

  9. Fatty acid composition of habitual omnivore and vegetarian diets.

    PubMed

    Mann, Neil; Pirotta, Yvonne; O'Connell, Stella; Li, Duo; Kelly, Fiona; Sinclair, Andy

    2006-07-01

    High-fat diets are implicated in the onset of cardiovascular disease (CVD), cancer, and obesity. Large intakes of saturated and trans FA, together with low levels of PUFA, particularly long-chain (LC) omega-3 (n-3) PUFA, appear to have the greatest impact on the development of CVD. A high n-6:n-3 PUFA ratio is also considered a marker of elevated risk of CVD, though little accurate data on dietary intake is available. A new Australian food composition database that reports FA in foods to two decimal places was used to assess intakes of FA in four habitual dietary groups. Analysis using the database found correlations between the dietary intakes of LC n-3 PUFA and the plasma phospholipid LC n-3 PUFA concentrations of omnivore and vegetarian subjects. High meat-eaters (HME), who consumed large amounts of food generally, had significantly higher LC n-3 PUFA intakes (0.29 g/d) than moderate meat-eaters (MME) (0.14 g/d), whose intakes in turn were significantly higher than those of ovolacto-vegetarians or vegans (both 0.01 g/d). The saturated FA intake of MME subjects (typical of adult male Australians) was not different from ovolacto-vegetarian intakes, whereas n-6:n-3 intake ratios in vegetarians were significantly higher than in omnivores. Thus, accurate dietary and plasma FA analyses suggest that regular moderate consumption of meat and fish maintains a plasma FA profile possibly more conducive to good health.

  10. Amino acid composition of lactating mothers' milk and confinement diet in rural North China.

    PubMed

    Ding, Ming; Li, Wei; Zhang, Yumei; Wang, Xiaoli; Zhao, Ai; Zhao, Xiaohui; Wang, Peiyu; Sheng, Qing Hai

    2010-01-01

    This study was designed to investigate the amino acids composition of lactating mothers' milk and their confinement diet in a town in Northern China, as well as to assess the relation of amino acids content in human milk and diet. Forty lactating mothers age 19 to 35 years participated in the study. They were 4 to 180 days postpartum. A 24-hour dietary recall was done and amino acids content of maternal milk was analyzed. The main findings are as follows: (1) The protein content of human milk is 1.58 g/dL and the ratio of EAA to NEAA is about 1:2. The most abundant amino acids in human milk are GLU (16.0%), PRO (10.2%), LEU (8.67%) and the lowest two are MET (1.76%) and TRP (0.91%). (2)The diet contains enough energy and protein, but lacks vitamins A, B and C, indicating that it is a characteristic confinement diet. Grain and eggs are the main source of protein, and soy and fish were consumed less frequently. (3) Amino acids composition in diet and milk are similar; and the correlation of the amino acids patterns between diet and milk is 0.989, demonstrating that the amino acid composition of diet is the foundation of that in human milk. However, almost no relation is found between the amino acids concentration in maternal diet and milk, suggesting that the amino acids content of the diet does not have a direct relation with that of human milk.

  11. [Fatty acids composition of the marine snails Phyllonotus pomum and Chicoreus brevifrons (Muricidae)].

    PubMed

    D'Armas, Haydelba; Yáñez, Dayanis; Reyes, Dilia; Salazar, Gabriel

    2010-06-01

    Muricid species of P. pomum and C. brevifrons are of economic importance in the Caribbean. This study includes a comparative evaluation of fatty acid content in the total lipid composition of Phyllonotus pomum and Chicoreus brevifrons. Snail samples were collected during the rainy, dry and transition seasons, in Punta Arena, Sucre (Venezuela). Total lipids were extracted and the specific fatty acid contents were analyzed by gas chromatography. Lipid concentrations varied between 0.87 and 1.85%, with minimum and maximum values corresponding to C. brevifrons collected during rainy and dry seasons, respectively. In the case of total lipids, a high concentration of unsaturated fatty acids (57.21-70.05%) was observed followed by saturated fatty acids (20.33-31.94%), during all seasons. The polyunsaturated occurred in higher proportion among the unsaturated fatty acids, except for P. pomum which showed higher proportion of monounsaturated fatty acids (38.95%) during the transition season. The prevailing fatty acids were: C14:0, C16:0, C18:0, C20:1, C22:1 omega-11, C22:1 omega-9, C18:3 omega-3, C20:5 omega-3 and C22:6 omega-3, among which docosahexaenoic acid was the predominant polyunsaturated fatty acid, showing values between 4.62 and 33.11%. The presence of high concentrations of polyunsaturated fatty acids found in P. Pomum and C. brevifrons allow their recommendation for human consumption with appropriate resource utilization.

  12. Proposition of an Accelerated Ageing Method for Natural Fibre/Polylactic Acid Composite

    NASA Astrophysics Data System (ADS)

    Zandvliet, Clio; Bandyopadhyay, N. R.; Ray, Dipa

    2015-10-01

    Natural fibre composite based on polylactic acid (PLA) composite is of special interest because it is entirely from renewable resources and biodegradable. Some samples of jute/PLA composite and PLA alone made 6 years ago and kept in tropical climate on a shelf shows too fast ageing degradation. In this work, an accelerated ageing method for natural fibres/PLA composite is proposed and tested. Experiment was carried out with jute and flax fibre/PLA composite. The method was compared with the standard ISO 1037-06a. The residual flexural strength after ageing test was compared with the one of common wood-based panels and of real aged samples prepared 6 years ago.

  13. Discrimination of acidic and alkaline enzyme using Chou's pseudo amino acid composition in conjunction with probabilistic neural network model.

    PubMed

    Khan, Zaheer Ullah; Hayat, Maqsood; Khan, Muazzam Ali

    2015-01-21

    Enzyme catalysis is one of the most essential and striking processes among of all the complex processes that have evolved in living organisms. Enzymes are biological catalysts, which play a significant role in industrial applications as well as in medical areas, due to profound specificity, selectivity and catalytic efficiency. Refining catalytic efficiency of enzymes has become the most challenging job of enzyme engineering, into acidic and alkaline. Discrimination of acidic and alkaline enzymes through experimental approaches is difficult, sometimes impossible due to lack of established structures. Therefore, it is highly desirable to develop a computational model for discriminating acidic and alkaline enzymes from primary sequences. In this study, we have developed a robust, accurate and high throughput computational model using two discrete sample representation methods Pseudo amino acid composition (PseAAC) and split amino acid composition. Various classification algorithms including probabilistic neural network (PNN), K-nearest neighbor, decision tree, multi-layer perceptron and support vector machine are applied to predict acidic and alkaline with high accuracy. 10-fold cross validation test and several statistical measures namely, accuracy, F-measure, and area under ROC are used to evaluate the performance of the proposed model. The performance of the model is examined using two benchmark datasets to demonstrate the effectiveness of the model. The empirical results show that the performance of PNN in conjunction with PseAAC is quite promising compared to existing approaches in the literature so for. It has achieved 96.3% accuracy on dataset1 and 99.2% on dataset2. It is ascertained that the proposed model might be useful for basic research and drug related application areas. PMID:25452135

  14. Comparison of acidulated phosphate fluoride gel and hydrofluoric acid etchants for porcelain-composite repair.

    PubMed

    Tylka, D F; Stewart, G P

    1994-08-01

    Hydrofluoric acid etches porcelain to produce a porous surface visible under scanning electron microscopy when compared to an acidulated phosphate fluoride gel. Some investigators have suggested the greater porosity of the hydrofluoric acid etch produces a greater composite-to-porcelain bond. This investigation tested that assumption with two common fluoride etchants. The etched surfaces were first viewed under scanning electron microscopy to ensure that a characteristic etch was achieved. Both etchants yielded bond strengths that produced cohesive failure of all samples. This suggested that the intraoral use of hydrofluoric acid is no more effective than the less dangerous acidulated phosphate fluoride gel.

  15. Fatty acid composition of phospholipids from platelets and erythrocytes in multiple sclerosis

    PubMed Central

    Gul, S.; Smith, A. D.; Thompson, R. H. S.; Wright, H. Payling; Zilkha, K. J.

    1970-01-01

    The fatty acid composition of the phospholipids of red blood cells and blood platelets has been investigated in multiple sclerosis patients and in normal individuals. The variation in the platelet phospholipid fatty acid pattern in normals has been measured for the first time and has been shown to be small. The relative level of linoleate, expressed as a percentage of the five main fatty acids, was found to be significantly lower in the multiple sclerosis patients than in healthy individuals, both in the red cells and platelets. A highly significant correlation was found between serum linoleate and both platelet and red cell linoleate. PMID:5505678

  16. Graphene Nanoplatelets as Novel Reinforcement Filler in Poly(lactic acid)/Epoxidized Palm Oil Green Nanocomposites: Mechanical Properties

    PubMed Central

    Chieng, Buong Woei; Ibrahim, Nor Azowa; Yunus, Wan Md Zin Wan; Hussein, Mohd Zobir; Giita Silverajah, V. S.

    2012-01-01

    Graphene nanoplatelet (xGnP) was investigated as a novel reinforcement filler in mechanical properties for poly(lactic acid) (PLA)/epoxidized palm oil (EPO) blend. PLA/EPO/xGnP green nanocomposites were successfully prepared by melt blending method. PLA/EPO reinforced with xGnP resulted in an increase of up to 26.5% and 60.6% in the tensile strength and elongation at break of the nanocomposites respectively, compared to PLA/EPO blend. XRD pattern showed the presence of peak around 26.5° in PLA/EPO nanocomposites which corresponds to characteristic peak of graphene nanoplatelets. However, incorporation of xGnP has no effect on the flexural strength and modulus. Impact strength of PLA/5 wt% EPO improved by 73.6% with the presence of 0.5 wt% xGnP loading. Mechanical properties of PLA were greatly improved by the addition of a small amount of graphene nanoplatelets (<1 wt%). PMID:23109829

  17. Green chemistry approaches to leather tanning process for making chrome-free leather by unnatural amino acids.

    PubMed

    Krishnamoorthy, G; Sadulla, S; Sehgal, P K; Mandal, Asit Baran

    2012-05-15

    In the present study, green and sustainable method or eco-friendly approaches to tanning process based on unnatural D-amino acids (D-AA)-aldehyde (Ald) as a substitute for chrome-free tanning has been attempted. The distribution of optically active D-AA in tanned leather, the hydrothermal stability, the mechanical properties and resistance to collagenolytic activity of tanned leather, the evaluation of eco-friendly characteristics were investigated. Scanning electron microscopic (SEM) and Atomic force microscopic (AFM) analyses indicate the surface morphology and roughness, respectively, of the tanned leather collagen matrix. Shrinkage and Differential scanning calorimetric (DSC) analyses shows that the shrinkage temperature (T(s)) and denaturation temperature (T(d)) of tanned leather are related to the content of D-AA+Ald present in the leather matrix. It has been found that the T(s) of D-AA tanned leather is more than that of Ald tanned leather and also more or less equal to chrome tanned leather. Environmental impact assessment (EIA) shows that the developed process results in significant reduction in total solids content (TSC) and improves better biodegradability of organic compound present in the effluent compared to chrome tanning. PMID:22421341

  18. Green chemistry approaches to leather tanning process for making chrome-free leather by unnatural amino acids.

    PubMed

    Krishnamoorthy, G; Sadulla, S; Sehgal, P K; Mandal, Asit Baran

    2012-05-15

    In the present study, green and sustainable method or eco-friendly approaches to tanning process based on unnatural D-amino acids (D-AA)-aldehyde (Ald) as a substitute for chrome-free tanning has been attempted. The distribution of optically active D-AA in tanned leather, the hydrothermal stability, the mechanical properties and resistance to collagenolytic activity of tanned leather, the evaluation of eco-friendly characteristics were investigated. Scanning electron microscopic (SEM) and Atomic force microscopic (AFM) analyses indicate the surface morphology and roughness, respectively, of the tanned leather collagen matrix. Shrinkage and Differential scanning calorimetric (DSC) analyses shows that the shrinkage temperature (T(s)) and denaturation temperature (T(d)) of tanned leather are related to the content of D-AA+Ald present in the leather matrix. It has been found that the T(s) of D-AA tanned leather is more than that of Ald tanned leather and also more or less equal to chrome tanned leather. Environmental impact assessment (EIA) shows that the developed process results in significant reduction in total solids content (TSC) and improves better biodegradability of organic compound present in the effluent compared to chrome tanning.

  19. Performance review of a fast HPLC-UV method for the quantification of chlorogenic acids in green coffee bean extracts.

    PubMed

    Craig, Ana Paula; Fields, Christine; Liang, Ningjian; Kitts, David; Erickson, Aron

    2016-07-01

    The aim of this study was to test the performance of a HPLC method, designated for rapid quantification of chlorogenic acids (CGA) in green coffee extract (GCE). The precision statistics associated with the method were assessed using three independent laboratories with five samples analyzed in triplicate. Seven main CGA isomers (3-CQA, 5-CQA, 4-CQA, 5-FQA, 3,4-diCQA, 3,5-diCQA and 4,5-diCQA) were quantified. The concentration of total CGA in the samples varied from 32.24% to 52.65% w/w. The repeatability and reproducibility standard deviations for the determination of individual isomers varied, respectively, from 0.01 to 0.28 and 0.05-1.59. The repeatability and reproducibility standard deviations of the calculated total CGA, corresponding to the sum of the seven main CGA isomers, varied respectively, from 0.17 to 0.58 and 0.55-2.01. The fast HPLC method evaluated in this study was considered precise and appropriate for the determination of CGA in GCE. PMID:27154703

  20. Effect of salicylhydroxamic acid on endosperm strength and embryo growth of Lactuca sativa L. cv Waldmann's Green seeds

    NASA Technical Reports Server (NTRS)

    Brooks, C. A.; Mitchell, C. A.

    1988-01-01

    Salicylhydroxamic acid (SHAM) stimulated germination of photosensitive lettuce (Lactuca sativa L. cv Waldmann's Green) seeds in darkness. To determine whether SHAM acts on the embryo or the endosperm, we investigated separately effects of SHAM on growth potential of isolated embryos as well as on endosperm strength. Embryo growth potential was quantified by incubating decoated embryos in various concentrations of osmoticum and measuring subsequent radicle elongation. Growth potential of embryos isolated from seeds pretreated with 4 millimolar SHAM was equal to that of untreated controls. Rupture strength of endosperm tissue excised from seeds pretreated with SHAM was 33% less than that of controls in the micropylar region. To determine if the embryo must be in contact with the endosperm of SHAM to weaken the endosperm, some endosperms were incubated with SHAM only after dissection from seeds. Rupture strength of SHAM-treated, isolated endosperms in the micropylar region was 25% less than that of untreated controls. There was no difference in rupture strength in the cotyledonary region of endosperm isolated from seeds treated with SHAM in buffer or buffer alone. SHAM therefore stimulates germination not by enhancing embryo growth potential, but by weakening the micropylar region of the endosperm enclosing the embryo.

  1. Effect of Salicylhydroxamic Acid on Endosperm Strength and Embryo Growth of Lactuca sativa L. cv Waldmann's Green Seeds 1

    PubMed Central

    Brooks, Carolyn Anne; Mitchell, Cary Arthur

    1988-01-01

    Salicylhydroxamic acid (SHAM) stimulated germination of photosensitive lettuce (Lactuca sativa L. cv Waldmann's Green) seeds in darkness. To determine whether SHAM acts on the embryo or the endosperm, we investigated separately effects of SHAM on growth potential of isolated embryos as well as on endosperm strength. Embryo growth potential was quantified by incubating decoated embryos in various concentrations of osmoticum and measuring subsequent radicle elongation. Growth potential of embryos isolated from seeds pretreated with 4 millimolar SHAM was equal to that of untreated controls. Rupture strength of endosperm tissue excised from seeds pretreated with SHAM was 33% less than that of controls in the micropylar region. To determine if the embryo must be in contact with the endosperm for SHAM to weaken the endosperm, some endosperms were incubated with SHAM only after dissection from seeds. Rupture strength of SHAM-treated, isolated endosperms in the micropylar region was 25% less than that of untreated controls. There was no difference in rupture strength in the cotyledonary region of endosperm isolated from seeds treated with SHAM in buffer or buffer alone. SHAM therefore stimulates germination not by enhancing embryo growth potential, but by weakening the micropylar region of the endosperm enclosing the embryo. Images Fig. 1 PMID:11538237

  2. Performance review of a fast HPLC-UV method for the quantification of chlorogenic acids in green coffee bean extracts.

    PubMed

    Craig, Ana Paula; Fields, Christine; Liang, Ningjian; Kitts, David; Erickson, Aron

    2016-07-01

    The aim of this study was to test the performance of a HPLC method, designated for rapid quantification of chlorogenic acids (CGA) in green coffee extract (GCE). The precision statistics associated with the method were assessed using three independent laboratories with five samples analyzed in triplicate. Seven main CGA isomers (3-CQA, 5-CQA, 4-CQA, 5-FQA, 3,4-diCQA, 3,5-diCQA and 4,5-diCQA) were quantified. The concentration of total CGA in the samples varied from 32.24% to 52.65% w/w. The repeatability and reproducibility standard deviations for the determination of individual isomers varied, respectively, from 0.01 to 0.28 and 0.05-1.59. The repeatability and reproducibility standard deviations of the calculated total CGA, corresponding to the sum of the seven main CGA isomers, varied respectively, from 0.17 to 0.58 and 0.55-2.01. The fast HPLC method evaluated in this study was considered precise and appropriate for the determination of CGA in GCE.

  3. Gradient enhanced-fluidity liquid hydrophilic interaction chromatography of ribonucleic acid nucleosides and nucleotides: A "green" technique.

    PubMed

    Beilke, Michael C; Beres, Martin J; Olesik, Susan V

    2016-03-01

    A "green" hydrophilic interaction liquid chromatography (HILIC) technique for separating the components of mixtures with a broad range of polarities is illustrated using enhanced-fluidity liquid mobile phases. Enhanced-fluidity liquid chromatography (EFLC) involves the addition of liquid CO2 to conventional liquid mobile phases. Decreased mobile phase viscosity and increased analyte diffusivity results when a liquefied gas is dissolved in common liquid mobile phases. The impact of CO2 addition to a methanol:water (MeOH:H2O) mobile phase was studied to optimize HILIC gradient conditions. For the first time a fast separation of 16 ribonucleic acid (RNA) nucleosides/nucleotides was achieved (16min) with greater than 1.3 resolution for all analyte pairs. By using a gradient, the analysis time was reduced by over 100% compared to similar separations conducted under isocratic conditions. The optimal separation using MeOH:H2O:CO2 mobile phases was compared to MeOH:H2O and acetonitrile:water (ACN:H2O) mobile phases. Based on chromatographic performance parameters (efficiency, resolution and speed of analysis) and an assessment of the environmental impact of the mobile phase mixtures, MeOH:H2O:CO2 mixtures are preferred over ACN:H2O or MeOH:H2O mobile phases for the separation of mixtures of RNA nucleosides and nucleotides.

  4. Curcumin Derivatives as Green Corrosion Inhibitors for α-Brass in Nitric Acid Solution

    NASA Astrophysics Data System (ADS)

    Fouda, A. S.; Elattar, K. M.

    2012-11-01

    1,7- Bis-(4-hydroxy-3-methoxy-phenyl)-hepta-1,6-diene-4-arylazo-3,5-dione I-V have been investigated as corrosion inhibitors for α-brass in 2 M nitric acid solution using weight-loss and galvanostatic polarization techniques. The efficiency of the inhibitors increases with the increase in the inhibitor concentration but decreases with a rise in temperature. The conjoint effect of the curcumin derivatives and KSCN has also been studied. The apparent activation energy ( E a*) and other thermodynamic parameters for the corrosion process have also been calculated. The galvanostatic polarization data indicated that the inhibitors were of mixed-type, but the cathode is more polarized than the anode. The slopes of the cathodic and anodic Tafel lines ( b c and b a) are maintained approximately equal for various inhibitor concentrations. However, the value of the Tafel slopes increases together as inhibitor concentration increases. The adsorption of these compounds on α-brass surface has been found to obey the Frumkin's adsorption isotherm. The mechanism of inhibition was discussed in the light of the chemical structure of the undertaken inhibitors.

  5. trans fatty acids. 5. Fatty acid composition of lipids of the brain and other organs in suckling piglets.

    PubMed

    Pettersen, J; Opstvedt, J

    1992-10-01

    The effects of dietary trans fatty acids on the fatty acid composition of the brain in comparison with other organs were studied in 3-wk-old suckling piglets. In Experiment (Expt.) 1 the piglets were delivered from sows fed partially hydrogenated fish oil (PHFO) (28% trans), partially hydrogenated soybean oil (PHSBO) (36% trans) or lard (0% trans). In Expt. 2 the piglets were delivered from sows fed PHFO, hydrogenated fish oil (HFO) (19% trans) or coconut fat (CF) (0% trans) with two levels of dietary linoleic acid (1 and 2.7%) according to factorial design. In both experiments the mother's milk was the piglets' only food. The level of incorporation of trans fatty acids in the organs was dependent on the levels in the diets and independent of fat source (i.e., PHSBO, PHFO or HFO). Incorporation of trans fatty acids into brain PE (phosphatidylethanolamine) was non-detectable in Expt. 1. In Expt. 2, small amounts (less than 0.5%) of 18:1 trans isomers were found in the brain, the level being slightly more on the lower level of dietary linoleic acid compared to the higher. In the other organs the percentage of 18:1 trans increased in the following order: heart PE, liver mitochondria PE, plasma lipids and subcutaneous adipose tissue. Small amounts of 20:1 trans were found in adipose tissue and plasma lipids. Other very long-chain fatty acids from PHFO or HFO (i.e., 20:1 cis and 22:1 cis + trans) were found in all organ lipids except for brain PE. Dietary trans fatty acids increased the percentage of 22:5n-6 in brain PE.(ABSTRACT TRUNCATED AT 250 WORDS) PMID:1435095

  6. Mapping quantitative trait loci (QTLs) for fatty acid composition in an interspecific cross of oil palm

    PubMed Central

    Singh, Rajinder; Tan, Soon G; Panandam, Jothi M; Rahman, Rahimah Abdul; Ooi, Leslie CL; Low, Eng-Ti L; Sharma, Mukesh; Jansen, Johannes; Cheah, Suan-Choo

    2009-01-01

    Background Marker Assisted Selection (MAS) is well suited to a perennial crop like oil palm, in which the economic products are not produced until several years after planting. The use of DNA markers for selection in such crops can greatly reduce the number of breeding cycles needed. With the use of DNA markers, informed decisions can be made at the nursery stage, regarding which individuals should be retained as breeding stock, which are satisfactory for agricultural production, and which should be culled. The trait associated with oil quality, measured in terms of its fatty acid composition, is an important agronomic trait that can eventually be tracked using molecular markers. This will speed up the production of new and improved oil palm planting materials. Results A map was constructed using AFLP, RFLP and SSR markers for an interspecific cross involving a Colombian Elaeis oleifera (UP1026) and a Nigerian E. guinneensis (T128). A framework map was generated for the male parent, T128, using Joinmap ver. 4.0. In the paternal (E. guineensis) map, 252 markers (199 AFLP, 38 RFLP and 15 SSR) could be ordered in 21 linkage groups (1815 cM). Interval mapping and multiple-QTL model (MQM) mapping (also known as composite interval mapping, CIM) were used to detect quantitative trait loci (QTLs) controlling oil quality (measured in terms of iodine value and fatty acid composition). At a 5% genome-wide significance threshold level, QTLs associated with iodine value (IV), myristic acid (C14:0), palmitic acid (C16:0), palmitoleic acid (C16:1), stearic acid (C18:0), oleic acid (C18:1) and linoleic acid (C18:2) content were detected. One genomic region on Group 1 appears to be influencing IV, C14:0, C16:0, C18:0 and C18:1 content. Significant QTL for C14:0, C16:1, C18:0 and C18:1 content was detected around the same locus on Group 15, thus revealing another major locus influencing fatty acid composition in oil palm. Additional QTL for C18:0 was detected on Group 3. A minor QTL

  7. Total lipid and fatty acid composition of eight strains of marine diatoms

    NASA Astrophysics Data System (ADS)

    Liang, Ying; Mai, Kang-Sen; Sun, Shi-Chun

    2000-12-01

    Fatty acid composition and total lipid content of 8 strains of marine diatoms ( Nitzschia frustrula, Nitzschia closterium, Nitzschia incerta, Navicula pelliculosa, Phaeodactylum tricornutum, Synedra fragilaroides) were examined. The microalgae were grown under defined conditions and harvested at the late exponential phase. The major fatty acids in most strains were 14∶0 (1.0% 6.3%), 16∶0 (13.5 26.4%), 16∶1n-7 (21.1% 46.3%) and 20∶5n-3 (6.5% 19.5%). The polyunsaturated fatty acids 16∶2n-4, 16∶3n-4, 16∶4n-1 and 20∶4n-6 also comprised a significant proportion of the total fatty acids in some strains. The characteristic fatty acid composition of diatoms is readily distinguishable from those of other microalgal groups. Significant concentration of the polyunsaturated fatty acid 20∶5n-3 (eicosapentaenoic acid) was present in each strain, with the highest proportion in B222 (19.5%).

  8. Comprehensive analysis of amino acid and nucleotide composition in eukaryotic genomes, comparing genes and pseudogenes.

    PubMed

    Echols, Nathaniel; Harrison, Paul; Balasubramanian, Suganthi; Luscombe, Nicholas M; Bertone, Paul; Zhang, Zhaolei; Gerstein, Mark

    2002-06-01

    Based on searches for disabled homologs to known proteins, we have identified a large population of pseudogenes in four sequenced eukaryotic genomes-the worm, yeast, fly and human (chromosomes 21 and 22 only). Each of our nearly 2500 pseudogenes is characterized by one or more disablements mid-domain, such as premature stops and frameshifts. Here, we perform a comprehensive survey of the amino acid and nucleotide composition of these pseudogenes in comparison to that of functional genes and intergenic DNA. We show that pseudogenes invariably have an amino acid composition intermediate between genes and translated intergenic DNA. Although the degree of intermediacy varies among the four organisms, in all cases, it is most evident for amino acid types that differ most in occurrence between genes and intergenic regions. The same intermediacy also applies to codon frequencies, especially in the worm and human. Moreover, the intermediate composition of pseudogenes applies even though the composition of the genes in the four organisms is markedly different, showing a strong correlation with the overall A/T content of the genomic sequence. Pseudogenes can be divided into 'ancient' and 'modern' subsets, based on the level of sequence identity with their closest matching homolog (within the same genome). Modern pseudogenes usually have a much closer sequence composition to genes than ancient pseudogenes. Collectively, our results indicate that the composition of pseudogenes that are under no selective constraints progressively drifts from that of coding DNA towards non-coding DNA. Therefore, we propose that the degree to which pseudogenes approach a random sequence composition may be useful in dating different sets of pseudogenes, as well as to assess the rate at which intergenic DNA accumulates mutations. Our compositional analyses with the interactive viewer are available over the web at http://genecensus.org/pseudogene.

  9. Photoperiod affects daily torpor and tissue fatty acid composition in deer mice.

    PubMed

    Geiser, Fritz; McAllan, B M; Kenagy, G J; Hiebert, Sara M

    2007-04-01

    Photoperiod and dietary lipids both influence thermal physiology and the pattern of torpor of heterothermic mammals. The aim of the present study was to test the hypothesis that photoperiod-induced physiological changes are linked to differences in tissue fatty acid composition of deer mice, Peromyscus maniculatus ( approximately 18-g body mass). Deer mice were acclimated for >8 weeks to one of three photoperiods (LD, light/dark): LD 8:16 (short photoperiod), LD 12:12 (equinox photoperiod), and LD 16:8 (long photoperiod). Deer mice under short and equinox photoperiods showed a greater occurrence of torpor than those under long photoperiods (71, 70, and 14%, respectively). The duration of torpor bouts was longest in deer mice under short photoperiod (9.3 +/- 2.6 h), intermediate under equinox photoperiod (5.1 +/- 0.3 h), and shortest under long photoperiod (3.7 +/- 0.6 h). Physiological differences in torpor use were associated with significant alterations of fatty acid composition in approximately 50% of the major fatty acids from leg muscle total lipids, whereas white adipose tissue fatty acid composition showed fewer changes. Our results provide the first evidence that physiological changes due to photoperiod exposure do result in changes in lipid composition in the muscle tissue of deer mice and suggest that these may play a role in survival of low body temperature and metabolic rate during torpor, thus, enhancing favourable energy balance over the course of the winter. PMID:17160415

  10. Photoperiod affects daily torpor and tissue fatty acid composition in deer mice

    NASA Astrophysics Data System (ADS)

    Geiser, Fritz; McAllan, B. M.; Kenagy, G. J.; Hiebert, Sara M.

    2007-04-01

    Photoperiod and dietary lipids both influence thermal physiology and the pattern of torpor of heterothermic mammals. The aim of the present study was to test the hypothesis that photoperiod-induced physiological changes are linked to differences in tissue fatty acid composition of deer mice, Peromyscus maniculatus (˜18-g body mass). Deer mice were acclimated for >8 weeks to one of three photoperiods (LD, light/dark): LD 8:16 (short photoperiod), LD 12:12 (equinox photoperiod), and LD 16:8 (long photoperiod). Deer mice under short and equinox photoperiods showed a greater occurrence of torpor than those under long photoperiods (71, 70, and 14%, respectively). The duration of torpor bouts was longest in deer mice under short photoperiod (9.3 ± 2.6 h), intermediate under equinox photoperiod (5.1 ± 0.3 h), and shortest under long photoperiod (3.7 ± 0.6 h). Physiological differences in torpor use were associated with significant alterations of fatty acid composition in ˜50% of the major fatty acids from leg muscle total lipids, whereas white adipose tissue fatty acid composition showed fewer changes. Our results provide the first evidence that physiological changes due to photoperiod exposure do result in changes in lipid composition in the muscle tissue of deer mice and suggest that these may play a role in survival of low body temperature and metabolic rate during torpor, thus, enhancing favourable energy balance over the course of the winter.

  11. Properties of polyvinyl alcohol/xylan composite films with citric acid.

    PubMed

    Wang, Shuaiyang; Ren, Junli; Li, Weiying; Sun, Runcang; Liu, Shijie

    2014-03-15

    Composite films of xylan and polyvinyl alcohol were produced with citric acid as a new plasticizer or a cross-linking agent. The effects of citric acid content and polyvinyl alcohol/xylan weight ratio on the mechanical properties, thermal stability, solubility, degree of swelling and water vapor permeability of the composite films were investigated. The intermolecular interactions and morphology of composite films were characterized by FTIR spectroscopy and SEM. The results indicated that polyvinyl alcohol/xylan composite films had good compatibility. With an increase in citric acid content from 10% to 50%, the tensile strength reduced from 35.1 to 11.6 MPa. However, the elongation at break increased sharply from 15.1% to 249.5%. The values of water vapor permeability ranged from 2.35 to 2.95 × 10(-7)g/(mm(2)h). Interactions between xylan and polyvinyl alcohol in the presence of citric acid become stronger, which were caused by hydrogen bond and ester bond formation among the components during film forming.

  12. Antimicrobial activity of nisin incorporated in pectin and polylactic acid composite films against Listeria monocytogenes

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Extruded composite films from 20% pectin and 80% polylactic acids (PLA) were developed and nisin was loaded into films by a diffusion post extrusion. Inhibitory activities of the films against Listeria monocytogenes were evaluated in brain heart infusion (BHI) broth, liquid egg white and orange juic...

  13. Effect of Finishing System on Subcutaneous Fat Melting Point and Fatty Acid Composition

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Angus-cross steers (n = 69) were used to determine the effect of finishing system on subcutaneous fat melting point and fatty acid composition. Three finishing systems were evaluated: 1) mixed pasture for 134 d [MP], 2) mixed pasture for 93 d and alfalfa for 41 d [AL], or 3) concentrate finishing f...

  14. Choice of solvent extraction technique affects fatty acid composition of pistachio (Pistacia vera L.) oil.

    PubMed

    Abdolshahi, Anna; Majd, Mojtaba Heydari; Rad, Javad Sharifi; Taheri, Mehrdad; Shabani, Aliakbar; Teixeira da Silva, Jaime A

    2015-04-01

    Pistachio (Pistacia vera L.) oil has important nutritional and therapeutic properties because of its high concentration of essential fatty acids. The extraction method used to obtain natural compounds from raw material is critical for product quality, in particular to protect nutritional value. This study compared the fatty acid composition of pistachio oil extracted by two conventional procedures, Soxhlet extraction and maceration, analyzed by a gas chromatography-flame ionization detector (GC-FID). Four solvents with different polarities were tested: n-hexane (Hx), dichloromethane (DCM), ethyl acetate (EtAc) and ethanol (EtOH). The highest unsaturated fatty acid content (88.493 %) was obtained by Soxhlet extraction with EtAc. The Soxhlet method extracted the most oleic and linolenic acids (51.99 % and 0.385 %, respectively) although a higher concentration (36.32 %) of linoleic acid was extracted by maceration.

  15. Effect of acidic pH on flow cytometric detection of bacteria stained with SYBR Green I and their distinction from background

    NASA Astrophysics Data System (ADS)

    Baldock, Daniel; Nebe-von-Caron, Gerhard; Bongaerts, Roy; Nocker, Andreas

    2013-12-01

    Unspecific background caused by biotic or abiotic particles, cellular debris, or autofluorescence is a well-known interfering parameter when applying flow cytometry to the detection of microorganisms in combination with fluorescent dyes. We present here an attempt to suppress the background signal intensity and thus to improve the detection of microorganisms using the nucleic acid stain SYBR® Green I. It has been observed that the fluorescent signals from SYBR Green I are greatly reduced at acidic pH. When lowering the pH of pre-stained samples directly prior to flow cytometric analysis, we hypothesized that the signals from particles and cells with membrane damage might therefore be reduced. Signals from intact cells, temporarily maintaining a neutral cytosolic pH, should not be affected. We show here that this principle holds true for lowering background interference, whereas the signals of membrane-compromised dead cells are only affected weakly. Signals from intact live cells at low pH were mostly comparable to signals without acidification. Although this study was solely performed with SYBR® Green I, the principle of low pH flow cytometry (low pH-FCM) might hold promise when analyzing complex matrices with an abundance of non-cellular matter, especially when expanded to non-DNA binding dyes with a stronger pH dependence of fluorescence than SYBR Green I and a higher pKa value.

  16. Fatty acid composition and desaturase gene expression in flax (Linum usitatissimum L.).

    PubMed

    Thambugala, Dinushika; Cloutier, Sylvie

    2014-11-01

    Little is known about the relationship between expression levels of fatty acid desaturase genes during seed development and fatty acid (FA) composition in flax. In the present study, we looked at promoter structural variations of six FA desaturase genes and their relative expression throughout seed development. Computational analysis of the nucleotide sequences of the sad1, sad2, fad2a, fad2b, fad3a and fad3b promoters showed several basic transcriptional elements including CAAT and TATA boxes, and several putative target-binding sites for transcription factors, which have been reported to be involved in the regulation of lipid metabolism. Using semi-quantitative reverse transcriptase PCR, the expression patterns throughout seed development of the six FA desaturase genes were measured in six flax genotypes that differed for FA composition but that carried the same desaturase isoforms. FA composition data were determined by phenotyping the field grown genotypes over four years in two environments. All six genes displayed a bell-shaped pattern of expression peaking at 20 or 24 days after anthesis. Sad2 was the most highly expressed. The expression of all six desaturase genes did not differ significantly between genotypes (P = 0.1400), hence there were no correlations between FA desaturase gene expression and variations in FA composition in relatively low, intermediate and high linolenic acid genotypes expressing identical isoforms for all six desaturases. These results provide further clues towards understanding the genetic factors responsible for FA composition in flax.

  17. Polyaniline/poly acid acrylic thin film composites: a new gamma radiation detector

    SciTech Connect

    Lima Pacheco, Ana P.; Araujo, Elmo S.; Azevedo, Walter M. de

    2003-03-15

    In this paper, we present a new and straightforward route to prepare polyaniline/poly acid acrylic (PAA) thin film composites in large areas and on almost any surface. This method was developed to improve the mechanical and adherence properties of polyaniline devices used as ionization radiation sensors. The route consists of the combination of the metal oxidant with polymer acid to form a highly homogeneous and viscous paste, which can be easily spread over any surface. In the second step, an aniline acid solution is brought in contact with the dried paste where polymerization occurs, yielding a high homogeneous and conducting polymer composite. The UV-visible absorption and infrared analysis confirm that a polyaniline/PAA complex is obtained. The four-point conductivity measurements show that the composite conductivity {rho} is the order of 5 {omega}{sup -1} cm{sup -1}. Preliminary gamma radiation interaction with the composite shows that the doped composite exhibits a linear response that can be used in the development of real-time radiation sensors for the dose range from 0 to 5000 Gy.

  18. Effect of ocean acidification on the fatty acid composition of a natural plankton community

    NASA Astrophysics Data System (ADS)

    Leu, E.; Daase, M.; Schulz, K. G.; Stuhr, A.; Riebesell, U.

    2012-07-01

    The effect of ocean acidification on the fatty acid composition of a natural plankton community in the Arctic was studied in a large-scale mesocosm experiment, carried out in Kongsfjorden (Svalbard, Norway) at 79° N. Nine mesocosms of ~50 cbm each were exposed to different pCO2 levels (from natural background conditions to ~1420 μatm), yielding pH values (on the total scale) from ~8.3 to 7.5. Inorganic nutrients were added on day 13. The phytoplankton development during this 30 days experiment passed three distinct phases: (1) prior to the addition of inorganic nutrients, (2) first bloom after nutrient addition, and (3) second bloom after nutrient addition. The fatty acid composition of the natural plankton community was analysed and showed, in general, high percentages of polyunsaturated fatty acids (PUFAs): 44-60% of total fatty acids. Positive correlations with pCO2 were found for most PUFAs during phases 2 and/or 3, with the exception of 20:5n3 (eicosapentaenoic acid, EPA), an important diatom marker. There are strong indications for these correlations being mediated indirectly through taxonomic changes and the natural development of the communities in the mesocosms exposed to different pCO2 levels. While diatoms increased during phase 3 mainly in the low and intermediate pCO2 treatments, dinoflagellates were favoured by high CO2 concentrations during the same time period. This is reflected in the development of group-specific fatty acid trophic markers. No indications were found for a generally detrimental effect of ocean acidification on the planktonic food quality in terms of essential fatty acids. The significant positive correlations between most PUFAs and pCO2 reflected treatment-dependent differences in the community composition between the mesocosms rather than a direct positive effect of pCO2 on specific fatty acids.

  19. The amino acid composition of the Sutter's Mill CM2 carbonaceous chondrite

    NASA Astrophysics Data System (ADS)

    Burton, Aaron S.; Glavin, Daniel P.; Elsila, Jamie E.; Dworkin, Jason P.; Jenniskens, Peter; Yin, Qing-Zhu

    2014-11-01

    We determined the abundances and enantiomeric compositions of amino acids in Sutter's Mill fragment #2 (designated SM2) recovered prior to heavy rains that fell April 25-26, 2012, and two other meteorite fragments, SM12 and SM51, that were recovered postrain. We also determined the abundance, enantiomeric, and isotopic compositions of amino acids in soil from the recovery site of fragment SM51. The three meteorite stones experienced terrestrial amino acid contamination, as evidenced by the low D/L ratios of several proteinogenic amino acids. The D/L ratios were higher in SM2 than in SM12 and SM51, consistent with rain introducing additional L-amino acid contaminants to SM12 and SM51. Higher percentages of glycine, β-alanine, and γ-amino-n-butyric acid were observed in free form in SM2 and SM51 compared with the soil, suggesting that these free amino acids may be indigenous. Trace levels of D+L-β-aminoisobutyric acid (β-AIB) observed in all three meteorites are not easily explained as terrestrial contamination, as β-AIB is rare on Earth and was not detected in the soil. Bulk carbon and nitrogen and isotopic ratios of the SM samples and the soil also indicate terrestrial contamination, as does compound-specific isotopic analysis of the amino acids in the soil. The amino acid abundances in SM2, the most pristine SM meteorite analyzed here, are approximately 20-fold lower than in the Murchison CM2 carbonaceous chondrite. This may be due to thermal metamorphism in the Sutter's Mill parent body at temperatures greater than observed for other aqueously altered CM2 meteorites.

  20. Polymorphisms in lipogenic genes and milk fatty acid composition in Holstein dairy cattle.

    PubMed

    Nafikov, Rafael A; Schoonmaker, Jon P; Korn, Kathleen T; Noack, Kristin; Garrick, Dorian J; Koehler, Kenneth J; Minick-Bormann, Jennifer; Reecy, James M; Spurlock, Diane E; Beitz, Donald C

    2014-12-01

    Changing bovine milk fatty acid (FA) composition through selection can decrease saturated FA (SFA) consumption, improve human health and provide a means for manipulating processing properties of milk. Our study determined associations between milk FA composition and genes from triacylglycerol (TAG) biosynthesis pathway. The GC dinucleotide allele of diacylglycerol O-acyltransferase 1:g.10433-10434AA >GC was associated with lower palmitic acid (16:0) concentration but higher oleic (18:1 cis-9), linoleic (18:2 cis-9, cis-12) acid concentrations, and elongation index. Accordingly, the GC dinucleotide allele was associated with lower milk fat percentage and SFA concentrations but higher monounsaturated FA and polyunsaturated FA (PUFA) concentrations. The glycerol-3-phosphate acyltransferase, mitochondrial haplotypes were associated with higher myristoleic acid (14:1 cis-9) concentration and C14 desaturation index. The 1-acylglycerol-3-phosphate acyltransferase 1 haplotypes were associated with higher PUFA and linoleic acid concentrations. The results of this study provide information for developing genetic tools to modify milk FA composition in dairy cattle.

  1. Use of super acids to digest chrysotile and amosite asbestos in simple mixtures or matrices found in building materials compositions

    SciTech Connect

    Sugama, T.; Petrakis, L.; Webster, R.P.

    1999-12-21

    A composition for converting asbestos-containing material to environmentally benign components is provided. The composition comprises a fluoro acid decomposing agent which can be applied to either amosite-containing thermal insulation or chrysotile-containing fire-proof material or to any asbestos-containing material which includes of chrysotile and amosite asbestos. The fluoro acid decomposing agent includes FP{sub 0}(OH){sub 2}, hexafluorophosphoric acid, a mixture of hydrofluoric and phosphoric acid and a mixture of hexafluorophosphoric acid and phosphoric acid. A method for converting asbestos-containing material to environmentally benign components is also provided.

  2. Synthesis and characterization of hydrolysed starch-g-poly(methacrylic acid) composite.

    PubMed

    Zahran, Magdy K; Ahmed, Enas M; El-Rafie, Mohamed H

    2016-06-01

    A novel method for the synthesis of starch-g-poly(methacrylic acid) composite was adopted by graft polymerization of hydrolysed starch (HS) and methacrylic acid (MAA) in aqueous medium using an efficient sodium perborate (SPB)-thiourea (TU) redox initiation system. The parameters influencing the redox system efficiency and thence the polymerization method were considered. These parameters comprehended the concentrations of MAA, SPB, TU and SPB/TU molar ratio as well as the polymerization temperature. The polymerization reaction was scrutinized through calculation of the MAA total conversion percent (TC%). The resultant poly(MAA-HS) composite was assessed by evaluating the polymer criteria (the graft yield, GY%; the grafting efficiency, GE%; the homopolymer, HP%; and the total conversion). The comportment of the apparent viscosity of the cooked poly(MAA)-starch composite paste, obtained under diverse polymerization conditions, was examined. Tentative mechanisms, which depict all occasions that happen amid the entire course of the polymerization reaction, have been proffered. PMID:26968925

  3. Feeding oleamide to lactating Jersey cows 1. Effects on lactation performance and milk fatty acid composition.

    PubMed

    Jenkins, T C

    2000-02-01

    Oleamide was previously reported to resist ruminal biohydrogenation and elevate milk oleic acid concentration when fed to lactating Holstein cows. To determine if Jersey cows responded similarly to oleamide, four lactating Jersey cows (mean 417 kg of body weight and 64 days in milk) were fed four diets in a 4x4 Latin square with 2-wk periods. Diets were total mixed ration containing 47% corn silage and 53% concentrate (dry matter basis) and were supplemented with no added fat (control), or with 3.5% added fat from either higholeic canola oil, a commercial source of oleamide, or oleamide synthesized from oleic acid and urea. The canola oil supplement had no effect on milk yield or composition. Compared to canola oil, the oleamide supplements reduced milk yield, dry matter intake, and milk fat and protein contents. Milk oleic acid concentration increased from 17.4% of total fatty acids for the control diet to 22.1% for the canola oil diet. Both oleamides further increased milk oleic acid to 30.0 and 27.1% of total fatty acids for the commercial and synthesized oleamides, respectively. Milk palmitic acid was reduced and stearic acid was increased by all fat supplements but more so by the oleamides than by the canola oil. Consistent with previous reports that fatty acyl amides resist ruminal biohydrogenation, feeding oleamide to Jersey cows in this study increased milk oleic acid concentration but had negative effects on feed intake and milk yield.

  4. Origin of the Apollo 15 very low Ti green glass. A perspective from the compositional diversity in the very low Ti glasses

    NASA Technical Reports Server (NTRS)

    Shearer, C. K.; Papike, J. J.

    1993-01-01

    The very low Ti green glasses from the Apollo 15 site have intrigued scientists for over 20 years. Their primitive composition has been used to understand magmatic processes and the structure of the moon. The compositional variability observed in the Apollo 15 glass population has long been a point of debate. Initial studies did not recognize the compositional diversity in the glasses. Stolper et al. documented the major element variability and concluded it could not be produced by magmatic processes and therefore concluded that these glasses must be of impact origin. Subsequent studies confirmed a volcanic origin for the glass population and attempted to elucidate magmatic processes to account for its compositional variability. Models that have been proposed for these glasses include the following: (1) the crystallization of single or multiple phases (olivine, pyroxene, Fe metal, immiscible sulfide); (2) the incompatible behavior of Ni and Co during multiple phase crystallization at extremely low fO2; and (3) magma or source mixing. All of these models have problems. Type (1) models appear not to be consistent with recent trace element studies on the glasses; model (2) is dependent on the debatable incompatible behavior of Ni and Co, and, in models of type (3), the origin and nature of mixing models are somewhat unconstrained. This study compares the Apollo 15 green glasses with the very low Ti picritic glasses from other landing sites.

  5. Hydrogen Isotopic Composition of Particulate-Bound Fatty Acids From the California Borderland Basins

    NASA Astrophysics Data System (ADS)

    Jones, A. A.; Sessions, A. L.; Campbell, B. J.; Valentine, D. L.

    2006-12-01

    We examined the hydrogen-isotopic composition of fatty acids associated with particulate organic matter (POM) from depth transects in three California Borderland stations. Our goals were to determine (1) the natural variability of δD values in POM-associated fatty acids and (2) the magnitude of isotopic fractionations associated with fatty acid degradation in the marine environment. Some differences in molecular abundance were observed between completely ventilated and occasionally suboxic sites, but no corresponding shifts in δD values were measured. Values of δD for specific fatty acids were generally consistent between stations. Saturated fatty acids (C14, C16, and C18) yielded δD values ranging from -230‰ to -132‰, with δD values generally decreasing with chain length. We found no evidence of extreme D-enrichment of the C18 fatty acid as has been observed in studies of isolated macroalgae (Chikaraishi, et al, 2004). The unsaturated C16 and C18 fatty acids showed a similar trend while the polyunsaturated fatty acid 22:6 was somewhat enriched in D (δD values ranging from -186‰ to -68‰) relative to 20:5 (-208‰ to -93‰). Unsaturated fatty acids tended to have more positive δD values than their saturated counterparts, opposite the trend observed in sediments from the same location. The bacterial fatty acid C15 showed even greater deuterium enrichment with δD values ranging from - 145‰ to -88‰. This offset can likely be attributed to differences in biosynthetic fractionation between bacteria and eukaryotes, to differences in hydrogen isotopic composition of the food sources of these organisms, or some combination of these two factors. Within the surface waters, fatty acids become enriched with depth by an average of 25‰. The C18:0 acid is a significant exception, becoming depleted by 48‰ over that same interval. Below 100 meters depth, all fatty acids tend to become slightly depleted in D with increasing depth. The difference in δD values

  6. A Collection of Chemical, Mineralogical, and Stable Isotopic Compositional Data for Green River Oil Shale from Depositional Center Cores in Colorado, Utah, and Wyoming

    USGS Publications Warehouse

    Tuttle, Michele L.W.

    2009-01-01

    For over half a century, the U.S. Geological Survey and collaborators have conducted stratigraphic and geochemical studies on the Eocene Green River Formation, which is known to contain large oil shale resources. Many of the studies were undertaken in the 1970s during the last oil shale boom. One such study analyzed the chemistry, mineralogy, and stable isotopy of the Green River Formation in the three major depositional basins: Piceance basin, Colo.; Uinta basin, Utah; and the Green River basin, Wyo. One depositional-center core from each basin was sampled and analyzed for major, minor, and trace chemistry; mineral composition and sulfide-mineral morphology; sulfur, nitrogen, and carbon forms; and stable isotopic composition (delta34S, delta15N, delta13C, and delta18O). Many of these data were published and used to support interpretative papers (see references herein). Some bulk-chemical and carbonate-isotopic data were never published and may be useful to studies that are currently exploring topics such as future oil shale development and the climate, geography, and weathering in the Eocene Epoch. These unpublished data, together with most of the U.S. Geological Survey data already published on these samples, are tabulated in this report.

  7. Composite biodegradable biopolymer coatings of silk fibroin - Poly(3-hydroxybutyric-acid-co-3-hydroxyvaleric-acid) for biomedical applications

    NASA Astrophysics Data System (ADS)

    Miroiu, Floralice Marimona; Stefan, Nicolaie; Visan, Anita Ioana; Nita, Cristina; Luculescu, Catalin Romeo; Rasoga, Oana; Socol, Marcela; Zgura, Irina; Cristescu, Rodica; Craciun, Doina; Socol, Gabriel

    2015-11-01

    Composite silk fibroin-poly(3-hydroxybutyric-acid-co-3-hydroxyvaleric-acid) (SF-PHBV) biodegradable coatings were grown by Matrix Assisted Pulsed Laser Evaporation on titanium substrates. Their physico-chemical properties and particularly the degradation behavior in simulated body fluid at 37 °C were studied as first step of applicability in local controlled release for tissue regeneration applications. SF and PHBV, natural biopolymers with excellent biocompatibility, but different biodegradability and tensile strength properties, were combined in a composite to improve their properties as coatings for biomedical uses. FTIR analyses showed the stoichiometric transfer from targets to coatings by the presence in the spectra of the main absorption maxima characteristic of both polymers. XRD investigations confirmed the FTIR results showing differences in crystallization behavior with respect to the SF and PHBV content. Contact angle values obtained through wettability measurements indicated the MAPLE deposited coatings were highly hydrophilic; surfaces turning hydrophobic with the increase of the PHBV component. Degradation assays proved that higher PHBV contents resulted in enhanced resistance and a slower degradation rate of composite coatings in SBF. Distinct drug-release schemes could be obtained by adjusting the SF:PHBV ratio to controllably tuning the coatings degradation rate, from rapid-release formulas, where SF predominates, to prolonged sustained ones, for larger PHBV content.

  8. Effect of organic acids in dental biofilm on microhardness of a silorane-based composite

    PubMed Central

    Pourhashemi, Seyed Jalal; Talebi, Mohammad; Kiomarsi, Nazanin; Kharazifard, Mohammad Javad

    2015-01-01

    Objectives This study evaluated the effect of lactic acid and acetic acid on the microhardness of a silorane-based composite compared to two methacrylate-based composite resins. Materials and Methods Thirty disc-shaped specimens each were fabricated of Filtek P90, Filtek Z250 and Filtek Z350XT. After measuring of Vickers microhardness, they were randomly divided into 3 subgroups (n = 10) and immersed in lactic acid, acetic acid or distilled water. Microhardness was measured after 48 hr and 7 day of immersion. Data were analyzed using repeated measures ANOVA (p < 0.05). The surfaces of two additional specimens were evaluated using a scanning electron microscope (SEM) before and after immersion. Results All groups showed a reduction in microhardness after 7 day of immersion (p < 0.001). At baseline and 7 day, the microhardness of Z250 was the greatest, followed by Z350 and P90 (p < 0.001). At 48 hr, the microhardness values of Z250 and Z350 were greater than P90 (p < 0.001 for both), but those of Z250 and Z350 were not significantly different (p = 0.095). Also, the effect of storage media on microhardness was not significant at baseline, but significant at 48 hr and after 7 day (p = 0.001 and p < 0.001, respectively). Lactic acid had the greatest effect. Conclusions The microhardness of composites decreased after 7 day of immersion. The microhardness of P90 was lower than that of other composites. Lactic acid caused a greater reduction in microhardness compared to other solutions. PMID:26295021

  9. Overexpression of the olive acyl carrier protein gene (OeACP1) produces alterations in fatty acid composition of tobacco leaves.

    PubMed

    De Marchis, Francesca; Valeri, Maria Cristina; Pompa, Andrea; Bouveret, Emmanuelle; Alagna, Fiammetta; Grisan, Simone; Stanzione, Vitale; Mariotti, Roberto; Cultrera, Nicolò; Baldoni, Luciana; Bellucci, Michele

    2016-02-01

    Taking into account that fatty acid (FA) biosynthesis plays a crucial role in lipid accumulation in olive (Olea europaea L.) mesocarp, we investigated the effect of olive acyl carrier protein (ACP) on FA composition by overexpressing an olive ACP cDNA in tobacco plants. The OeACP1.1A cDNA was inserted in the nucleus or in the chloroplast DNA of different tobacco plants, resulting in extensive transcription of the transgenes. The transplastomic plants accumulated lower olive ACP levels in comparison to nuclear-transformed plants. Moreover, the phenotype of the former plants was characterized by pale green/white cotyledons with abnormal chloroplasts, delayed germination and reduced growth. We suggest that the transplastomic phenotype was likely caused by inefficient olive ACP mRNA translation in chloroplast stroma. Conversely, total lipids from leaves of nuclear transformants expressing high olive ACP levels showed a significant increase in oleic acid (18:1) and linolenic acid (18:3), and a concomitant significant reduction of hexadecadienoic acid (16:2) and hexadecatrienoic acid (16:3). This implies that in leaves of tobacco transformants, as likely in the mesocarp of olive fruit, olive ACP not only plays a general role in FA synthesis, but seems to be specifically involved in chain length regulation forwarding the elongation to C18 FAs and the subsequent desaturation to 18:1 and 18:3. PMID:26560313

  10. Comparison of fatty acid contents and composition in major lipid classes of larvae and adults of mosquitoes (Diptera: Culicidae) from a steppe region.

    PubMed

    Sushchik, Nadezhda N; Yurchenko, Yuri A; Gladyshev, Michail I; Belevich, Olga E; Kalachova, Galina S; Kolmakova, Angelika A

    2013-10-01

    Emerging aquatic insects, including mosquitoes, are known to transfer to terrestrial ecosystems specific essential biochemicals, such as polyunsaturated fatty acids (PUFA). We studied fatty acid (FA) composition and contents of dominant mosquito populations (Diptera: Culicidae), that is, Anopheles messeae, Ochlerotatus caspius, Oc. flavescens, Oc. euedes, Oc. subdiversus, Oc. cataphylla, and Aedes cinereus, inhabited a steppe wetland of a temperate climate zone to fill up the gap in their lipid knowledge. The polar lipid and triacylglycerol fractions of larvae and adults were compared. In most studied mosquito species, we first found and identified a number of short-chain PUFA, for example, prominent 14:2n-6 and 14:3n-3, which were not earlier documented in living organisms. These PUFA, although occurred in low levels in adult mosquitoes, can be potentially used as markers of mosquito biomass in terrestrial food webs. We hypothesize that these acids might be synthesized (or retroconverted) by the mosquitoes. Using FA trophic markers accumulated in triacylglycerols, trophic relations of the mosquitoes were accessed. The larval diet comprised green algae, cryptophytes, and dinoflagellates and provided the mosquitoes with essential n-3 PUFA, linolenic, and eicosapentaenoic acids. As a result, both larvae and adults of the studied mosquitoes had comparatively high content of the essential PUFA. Comparison of FA proportions in polar lipids versus storage lipids shown that during mosquito metamorphosis transfer of essential eicosapentaenoic and arachidonic acids from the reserve in storage lipids of larvae to functional polar lipids in adults occurred.

  11. Dietary n-3 polyunsaturated fatty acids modify fatty acid composition in hepatic and abdominal adipose tissue of sucrose-induced obese rats.

    PubMed

    Alexander-Aguilera, Alfonso; Berruezo, Silvia; Hernández-Diaz, Guillermo; Angulo, Ofelia; Oliart-Ros, Rosamaria

    2011-12-01

    The fatty acid profile of hepatocytes and adipocytes is determined by the composition of the dietary lipids. It remains unclear which fatty acid components contribute to the development or reduction of insulin resistance. The present work examined the fatty acid composition of both tissues in sucrose-induced obese rats receiving fish oil to determine whether the effect of dietary (n-3) polyunsaturated fatty acids (PUFAs) on the reversion of metabolic syndrome in these rats is associated to changes in the fatty acid composition of hepatocyte and adipocyte membrane lipids. Animals with metabolic syndrome were divided into a corn-canola oil diet group and a fish oil diet group, and tissues fatty acids composition were analyzed after 6 weeks of dietary treatment. Fatty acid profiles of the total membrane lipids were modified by the fatty acid composition of the diets fed to rats. N-3 PUFAs levels in animals receiving the fish oil diet plus sucrose in drinking water were significantly higher than in animals under corn-canola oil diets. It is concluded that in sucrose-induced obese rats, consumption of dietary fish oil had beneficial effects on the metabolic syndrome and that such effects would be conditioned by the changes in the n-3 PUFAs composition in hepatic and adipose tissues because they alter membrane properties and modify the type of substrates available for the production of active lipid metabolites acting on insulin resistance and obesity. PMID:21695545

  12. Habitual Diets Rich in Dark-Green Vegetables Are Associated with an Increased Response to ω-3 Fatty Acid Supplementation in Americans of African Ancestry123

    PubMed Central

    O’Sullivan, Aifric; Armstrong, Patrice; Schuster, Gertrud U.; Pedersen, Theresa L.; Allayee, Hooman; Stephensen, Charles B.; Newman, John W.

    2014-01-01

    Although substantial variation exists in individual responses to omega-3 (ω-3) (n–3) fatty acid supplementation, the causes for differences in response are largely unknown. Here we investigated the associations between the efficacy of ω-3 fatty acid supplementation and a broad range of nutritional and clinical factors collected during a double-blind, placebo-controlled trial in participants of African ancestry, randomly assigned to receive either 2 g eicosapentaenoic acid (EPA) + 1 g docosahexaenoic acid (n = 41) or corn/soybean oil placebo (n = 42) supplements for 6 wk. Food-frequency questionnaires were administered, and changes in erythrocyte lipids, lipoproteins, and monocyte 5-lipoxygenase–dependent metabolism were measured before and after supplementation. Mixed-mode linear regression modeling identified high (n = 28) and low (n = 13) ω-3 fatty acid response groups on the basis of changes in erythrocyte EPA abundance (P < 0.001). Compliance was equivalent (∼88%), whereas decreases in plasma triglycerides and VLDL particle sizes and reductions in stimulated monocyte leukotriene B4 production were larger in the high-response group. Although total diet quality scores were similar, the low-response group showed lower estimated 2005 Healthy Eating Index subscores for dark-green and orange vegetables and legumes (P = 0.01) and a lower intake of vegetables (P = 0.02), particularly dark-green vegetables (P = 0.002). Because the findings reported here are associative in nature, prospective studies are needed to determine if dietary dark-green vegetables or nutrients contained in these foods can enhance the efficacy of ω-3 fatty acid supplements. This trial was registered at clinicaltrials.gov as NCT00536185. PMID:24259553

  13. Habitual diets rich in dark-green vegetables are associated with an increased response to ω-3 fatty acid supplementation in Americans of African ancestry.

    PubMed

    O'Sullivan, Aifric; Armstrong, Patrice; Schuster, Gertrud U; Pedersen, Theresa L; Allayee, Hooman; Stephensen, Charles B; Newman, John W

    2014-02-01

    Although substantial variation exists in individual responses to omega-3 (ω-3) (n-3) fatty acid supplementation, the causes for differences in response are largely unknown. Here we investigated the associations between the efficacy of ω-3 fatty acid supplementation and a broad range of nutritional and clinical factors collected during a double-blind, placebo-controlled trial in participants of African ancestry, randomly assigned to receive either 2 g eicosapentaenoic acid (EPA) + 1 g docosahexaenoic acid (n = 41) or corn/soybean oil placebo (n = 42) supplements for 6 wk. Food-frequency questionnaires were administered, and changes in erythrocyte lipids, lipoproteins, and monocyte 5-lipoxygenase-dependent metabolism were measured before and after supplementation. Mixed-mode linear regression modeling identified high (n = 28) and low (n = 13) ω-3 fatty acid response groups on the basis of changes in erythrocyte EPA abundance (P < 0.001). Compliance was equivalent (∼88%), whereas decreases in plasma triglycerides and VLDL particle sizes and reductions in stimulated monocyte leukotriene B4 production were larger in the high-response group. Although total diet quality scores were similar, the low-response group showed lower estimated 2005 Healthy Eating Index subscores for dark-green and orange vegetables and legumes (P = 0.01) and a lower intake of vegetables (P = 0.02), particularly dark-green vegetables (P = 0.002). Because the findings reported here are associative in nature, prospective studies are needed to determine if dietary dark-green vegetables or nutrients contained in these foods can enhance the efficacy of ω-3 fatty acid supplements. This trial was registered at clinicaltrials.gov as NCT00536185.

  14. Fatty acid composition of Juniperus species (Juniperus section) native to Turkey.

    PubMed

    Güvenç, Aysegül; Küçükboyaci, Nurgün; Gören, Ahmet Ceyhan

    2012-07-01

    Fatty acid compositions of seeds of five taxa of the Juniperus section of the genus Juniperus L. (Cupressaceae), i. e. J. drupacea Lab., J. communis L. var. communis, J. communis var. saxatilis Pall., J. oxycedrus L. subsp. oxycedrus, and J. oxycedrus subsp. macrocarpa (Sibth. & Sm.) Ball, were investigated. Methyl ester derivatized fatty acids of the lipophylic extracts of the five species were comparatively analyzed by capillary gas chromatography-mass spectrometry (GC-MS). Juniperus taxa showed uniform fatty acid patterns, among which linoleic (25.8 - 32.5%), pinolenic (11.9 - 24.1%) and oleic acids (12.4 - 17.2%) were determined to be the main fractions in the seed oils. Juniperonic acid was found to be remarkably high in J. communis var. saxatilis (11.4%), J. oxycedrus subsp. oxycedrus (10.4%), and J. communis var. communis (10.1%). To the best of our knowledge, the present work discloses the first report on the fatty acid compositions of seeds of this Juniperus section grown in Turkey.

  15. Fatty acid composition of symbiotic zooxanthellae in relation to their hosts.

    PubMed

    Bishop, D G; Kenrick, J R

    1980-10-01

    Gymnodinoid dinoflagellate symbionts, commonly referred to as zooxanthellae, are widely distributed among marine invertebrates. It has been assumed that they represent only one species,Gymnodinium microadriaticum. The fatty acid composition of total lipids and galactolipids of zooxanthellae isolated from 8 species of corals, 3 species of clams and a foraminiferan have been analyzed and found to vary according to the host. For example, the content of eicosapentaenoic acid in clam zooxanthellae monogalactosyldiacylglycerol was less than 2%, whereas in the same lipid from coral zooxanthellae, the content ranged from 9 to 22%. Corresponding values for the acid in digalactosyl-diacylglycerol were 1-8% from clam zooxanthellae and 23-40% from coral zooxanthellae. Coral zooxanthellae monogalactosyldiacylglycerol contain higher levels of octadecatetraenoic acid than are found in digalactosyldiacylglycerol, whereas the reverse is true in clam zooxanthellae. The fatty acid composition of the lipids of an axenic culture of zooxanthellae isolated from the clamTridacna maxima are similar to those of cells freshly isolated from the host. The results suggest either that the host is capable of affecting the fatty acid metabolism of the symbiont or that different strains of zooxanthellae occur in corals and clams.

  16. Cellular fatty acid composition of cyanobacteria assigned to subsection II, order Pleurocapsales.

    PubMed

    Caudales, R; Wells, J M; Butterfield, J E

    2000-05-01

    The cellular fatty acid composition of five of the six genera of unicellular cyanobacteria in subsection II, Pleurocapsales (Dermocarpa, Xenococcus, Dermocarpella, Myxosarcina and the Pleurocapsa assemblage) contained high proportions of saturated straight-chain fatty acids (26-41% of the total) and unsaturated straight chains (40-67%). Isomers of 16:1 were the main monounsaturated acid component (11-59%). Polyunsaturated acids were present at trace levels (0-1% or less) in Xenococcus and Myxosarcina, at concentrations of less than 7% in Dermocarpa, Dermocarpella, Pleurocapsa and CCMP 1489, and at high concentrations (35% or more) in Chroococcidiopsis. Chroococcidiopsis was also different in terms of the percentage of 16:1 isomers (10-12%) compared to other genera (30-59%), and in terms of total 16-carbon and 18-carbon fatty acids. In general, the composition and heterogeneity of fatty acids in the order Pleurocapsales was similar to that reported for the unicellular cyanobacteria of subsection I, order Chroococcales. PMID:10843042

  17. Possible effects of diagenesis on the stable isotope composition of amino acids in carbonaceous meteorites

    NASA Astrophysics Data System (ADS)

    Engel, Michael H.

    2015-09-01

    The initial report of indigenous, non-racemic protein amino acids (L-enantiomer excess) in the Murchison meteorite was based on the fact that only eight of the twenty amino acids characteristic of all life on Earth was present in this stone1. The absence of the other protein amino acids indicated that contamination subsequent to impact was highly unlikely. The development of new techniques for determining the stable isotope composition of individual amino acid enantiomers in the Murchison meteorite further documented the extraterrestrial origins of these compounds2,3. The stable isotope approach continues to be used to document the occurrence of an extraterrestrial L-enantiomer excess of protein amino acids in other carbonaceous meteorites4. It has been suggested that this L-enantiomer excess may result from aqueous reprocessing on meteorite parent bodies4,5. Preliminary results of simulation experiments are presented that are used to determine the extent to which the stable isotope compositions of amino acid constituents of carbonaceous meteorites may have been altered by these types of diagenetic processes subsequent to synthesis.

  18. Evaluation on Thermal Behavior of a Green Roof Retrofit System Installed on Experimental Building in Composite Climate of Roorkee, India

    NASA Astrophysics Data System (ADS)

    Kumar, Ashok; Deoliya, Rajesh; Chani, P. S.

    2015-12-01

    Green roofs not only provide cooling by shading, but also by transpiration of water through the stomata. However, the evidence for green roofs providing significant air cooling remains limited. No literature investigates the thermal performance of prefab brick panel roofing technology with green roof. Hence, the aim of this research is to investigate the thermal behavior of an experimental room, built at CSIR-Central Building Research Institute (CBRI) campus, Roorkee, India using such roofing technology during May 2013. The study also explores the feasibility of green roof with grass carpets that require minimum irrigation, to assess the expected indoor thermal comfort improvements by doing real-time experimental studies. The results show that the proposed green roof system is suitable for reducing the energy demand for space cooling during hot summer, without worsening the winter energy performance. The cost of proposed retrofit system is about Rs. 1075 per m2. Therefore, green roofs can be used efficiently in retrofitting existing buildings in India to improve the micro-climate on building roofs and roof insulation, where the additional load carrying capacity of buildings is about 100-130 kg/m2.

  19. Effects of dietary conjugated linoleic acid on fatty acid composition and cholesterol content of hen egg yolks.

    PubMed

    Szymczyk, Beata; Pisulewski, Paweł M

    2003-07-01

    The main objectives of the present study were to determine the effect of dietary conjugated linoleic acid (CLA) isomers on the fatty acid composition and cholesterol content of egg-yolk lipids. Forty-five 25-week-old laying hens were randomly distributed into five groups of nine hens each and maintained in individual laying cages, throughout 12 weeks of the experiment. They were assigned to the five treatments that consisted of commercial layer diets containing 0, 5, 10, 15 or 20 g pure CLA/kg. Feed intake of hens varied little and insignificantly. Egg mass was uniformly lower (P<0.05) in the hens fed the CLA-enriched diets. Feed conversion efficiency, when expressed per kg eggs, was impaired (P<0.05), although without obvious relation to the dietary CLA concentration. Feeding the CLA-enriched diets resulted in gradually increasing deposition of CLA isomers (P<0.01) in egg-yolk lipids. Saturated fatty acids were increased (P<0.01) and monounsaturated fatty acids decreased (P<0.01). Polyunsaturated fatty acids (PUFA), when expressed as non-CLA PUFA, were also significantly decreased (P<0.01). The most striking effects (P<0.01) were observed for palmitic (16 : 0) and stearic (18 : 0) acids, which increased from 23.6 to 34 % and from 7.8 to 18 %, respectively. On the other hand, oleic acid (18 : 1n-9) decreased from 45.8 to 24.3 %. Among non-CLA PUFA, linoleic (18 : 2n-6) and alpha-linolenic (18 : 3n-3) acids were strongly (P<0.01) decreased, from 14.2 to 7.7 % and from 1.3 to 0.3 %, respectively. The same was true for arachidonic (20:4n-6) and docosahexaenoic (22 : 6n-3) acids. The cholesterol content of egg yolks, when expressed in mg/g yolk, was not affected by the dietary CLA concentrations. In conclusion, unless the adverse effects of CLA feeding to laying hens on the fatty acid profile of egg yolks are eliminated, the CLA-enriched eggs cannot be considered functional food products. PMID:12844380

  20. Response of milk fatty acid composition to dietary supplementation of soy oil, conjugated linoleic acid, or both.

    PubMed

    Huang, Y; Schoonmaker, J P; Bradford, B J; Beitz, D C

    2008-01-01

    Thirty-six Holstein cows were blocked by parity and allotted by stage of lactation to 6 treatments to evaluate the effects of dietary soy oil, conjugated linoleic acid (CLA; free acid or calcium salt), or both, on CLA content of milk. Diets were fed for 4 wk and are as follows: (1) control, (2) control + 5% soy oil, (3) control + 1% CLA, (4) control + 1% Ca(CLA)2, (5) control + 1% CLA + 4% soy oil, and (6) control + 1% Ca(CLA)2 + 4% soy oil. Rumen volatile fatty acid concentrations, blood fatty acid concentrations, milk yield, and milk composition were measured weekly or biweekly. Dry matter intake and milk yield were recorded daily. Dietary supplementation of soy oil or CLA had no effect on daily milk yield, milk protein concentration and production, or milk lactose concentration and production. Supplementation of unsaturated fatty acids as soy oil, CLA, or Ca(CLA)2 increased total fatty acid concentration in plasma, decreased milk fat concentration and production, and had no effect on rumen volatile fatty acid concentrations. The weight percentage of CLA in milk was increased from 0.4 to 0.7% with supplementation of 1% CLA, to 1.2% with supplementation of soy oil, and to 1.3% with supplementation of 1% CLA plus soy oil. Supplementation with Ca(CLA)2 or Ca(CLA)2 + soy oil increased the CLA content of milk fat to 0.9 and 1.4%, respectively. In summary, adding 5% soy oil was as effective as supplementing CLA, Ca(CLA)2, or a combination of 1% CLA (free acid or calcium salt) + 4% soy oil at increasing CLA concentrations in milk fat. Feeding CLA as the calcium salt resulted in greater concentrations of CLA in milk fat than did feeding CLA as the free acid. Dietary supplementation of 5% soy oil or 4% soy oil + 1% CLA as the free acid or the calcium salt increased the yield of CLA in milk.

  1. Effect of ocean acidification on the fatty acid composition of a natural plankton community

    NASA Astrophysics Data System (ADS)

    Leu, E.; Daase, M.; Schulz, K. G.; Stuhr, A.; Riebesell, U.

    2013-02-01

    The effect of ocean acidification on the fatty acid composition of a natural plankton community in the Arctic was studied in a large-scale mesocosm experiment, carried out in Kongsfjorden (Svalbard, Norway) at 79° N. Nine mesocosms of ~50 m3 each were exposed to 8 different pCO2 levels (from natural background conditions to ~1420 μatm), yielding pH values (on the total scale) from ~8.3 to 7.5. Inorganic nutrients were added on day 13. The phytoplankton development during this 30-day experiment passed three distinct phases: (1) prior to the addition of inorganic nutrients, (2) first bloom after nutrient addition, and (3) second bloom after nutrient addition. The fatty acid composition of the natural plankton community was analysed and showed, in general, high percentages of polyunsaturated fatty acids (PUFAs): 44-60% of total fatty acids. Positive correlations with pCO2 were found for most PUFAs during phases 2 and/or 3, with the exception of 20:5n3 (eicosapentaenoic acid, EPA), an important diatom marker. These correlations are probably linked to changes in taxonomic composition in response to pCO2. While diatoms (together with prasinophytes and haptophytes) increased during phase 3 mainly in the low and intermediate pCO2 treatments, dinoflagellates were favoured by high CO2 concentrations during the same time period. This is reflected in the development of group-specific fatty acid trophic markers. No indications were found for a generally detrimental effect of ocean acidification on the planktonic food quality in terms of essential fatty acids.

  2. The impact of enhanced atmospheric carbon dioxide on yield, proximate composition, elemental concentration, fatty acid and vitamin C contents of tomato (Lycopersicon esculentum).

    PubMed

    Khan, Ikhtiar; Azam, Andaleeb; Mahmood, Abid

    2013-01-01

    The global average temperature has witnessed a steady increase during the second half of the twentieth century and the trend is continuing. Carbon dioxide, a major green house gas is piling up in the atmosphere and besides causing global warming, is expected to alter the physico-chemical composition of plants. The objective of this work was to evaluate the hypothesis that increased CO(2) in the air is causing undesirable changes in the nutritional composition of tomato fruits. Two varieties of tomato (Lycopersicon esculentum) were grown in ambient (400 μmol mol(-1)) and elevated (1,000 μmol mol(-1)) concentration of CO(2) under controlled conditions. The fruits were harvested at premature and fully matured stages and analyzed for yield, proximate composition, elemental concentration, fatty acid, and vitamin C contents. The amount of carbohydrates increased significantly under the enhanced CO(2) conditions. The amount of crude protein and vitamin C, two important nutritional parameters, decreased substantially. Fatty acid content showed a mild decrease with a slight increase in crude fiber. Understandably, the effect of enhanced atmospheric CO(2) was more pronounced at the fully matured stage. Mineral contents of the fruit samples changed in an irregular fashion. Tomato fruit has been traditionally a source of vitamin C, under the experimental conditions, a negative impact of enhanced CO(2) on this source of vitamin C was observed. The nutritional quality of both varieties of tomato has altered under the CO(2) enriched atmosphere. PMID:22382378

  3. The impact of enhanced atmospheric carbon dioxide on yield, proximate composition, elemental concentration, fatty acid and vitamin C contents of tomato (Lycopersicon esculentum).

    PubMed

    Khan, Ikhtiar; Azam, Andaleeb; Mahmood, Abid

    2013-01-01

    The global average temperature has witnessed a steady increase during the second half of the twentieth century and the trend is continuing. Carbon dioxide, a major green house gas is piling up in the atmosphere and besides causing global warming, is expected to alter the physico-chemical composition of plants. The objective of this work was to evaluate the hypothesis that increased CO(2) in the air is causing undesirable changes in the nutritional composition of tomato fruits. Two varieties of tomato (Lycopersicon esculentum) were grown in ambient (400 μmol mol(-1)) and elevated (1,000 μmol mol(-1)) concentration of CO(2) under controlled conditions. The fruits were harvested at premature and fully matured stages and analyzed for yield, proximate composition, elemental concentration, fatty acid, and vitamin C contents. The amount of carbohydrates increased significantly under the enhanced CO(2) conditions. The amount of crude protein and vitamin C, two important nutritional parameters, decreased substantially. Fatty acid content showed a mild decrease with a slight increase in crude fiber. Understandably, the effect of enhanced atmospheric CO(2) was more pronounced at the fully matured stage. Mineral contents of the fruit samples changed in an irregular fashion. Tomato fruit has been traditionally a source of vitamin C, under the experimental conditions, a negative impact of enhanced CO(2) on this source of vitamin C was observed. The nutritional quality of both varieties of tomato has altered under the CO(2) enriched atmosphere.

  4. Reagentless D-sorbitol biosensor based on D-sorbitol dehydrogenase immobilized in a sol-gel carbon nanotubes-poly(methylene green) composite.

    PubMed

    Wang, Zhijie; Etienne, Mathieu; Urbanova, Veronika; Kohring, Gert-Wieland; Walcarius, Alain

    2013-04-01

    A reagentless D-sorbitol biosensor based on NAD-dependent D-sorbitol dehydrogenase (DSDH) immobilized in a sol-gel carbon nanotubes-poly(methylene green) composite has been developed. It was prepared by durably immobilizing the NAD(+) cofactor with DSDH in a sol-gel thin film on the surface of carbon nanotubes functionalized with poly(methylene green). This device enables selective determination of D-sorbitol at 0.2 V with a sensitivity of 8.7 μA mmol(-1) L cm(-2) and a detection limit of 0.11 mmol L(-1). Moreover, this biosensor has excellent operational stability upon continuous use in hydrodynamic conditions.

  5. Manganese dioxide graphite composite electrodes: application to the electroanalysis of hydrogen peroxide, ascorbic acid and nitrite.

    PubMed

    Langley, Cathryn E; Sljukić, Biljana; Banks, Craig E; Compton, Richard G

    2007-02-01

    The modification of carbon powder with manganese dioxide using a wet impregnation procedure with electrochemical characterisation of the modified powder is described. The process involves saturation of the carbon powder with manganese(II) nitrate followed by thermal treatment at ca. 773 K leading to formation of manganese(IV) oxide on the surface of the carbon powder. The construction of composite electrodes based on manganese dioxide modified carbon powder and epoxy resin is also described, including optimisation of the percentage of the modified carbon powder. Composite electrodes showed attractive performances for electroanalytical applications, proving to be suitable for the electrochemical detection of hydrogen peroxide, ascorbic acid and nitrite ions with limits of detection comparable to the detection limits achieved by other analytical techniques. The results obtained for detection of these analytes, together with composite electrodes flexible design and low cost offers potential application of composite electrodes in biosensors.

  6. New insight into the SSC8 genetic determination of fatty acid composition in pigs

    PubMed Central

    2014-01-01

    Background Fat content and fatty acid composition in swine are becoming increasingly studied because of their effect on sensory and nutritional quality of meat. A QTL (quantitative trait locus) for fatty acid composition in backfat was previously detected on porcine chromosome 8 (SSC8) in an Iberian x Landrace F2 intercross. More recently, a genome-wide association study detected the same genomic region for muscle fatty acid composition in an Iberian x Landrace backcross population. ELOVL6, a strong positional candidate gene for this QTL, contains a polymorphism in its promoter region (ELOVL6:c.-533C < T), which is associated with percentage of palmitic and palmitoleic acids in muscle and adipose tissues. Here, a combination of single-marker association and the haplotype-based approach was used to analyze backfat fatty acid composition in 470 animals of an Iberian x Landrace F2 intercross genotyped with 144 SNPs (single nucleotide polymorphisms) distributed along SSC8. Results Two trait-associated SNP regions were identified at 93 Mb and 119 Mb on SSC8. The strongest statistical signals of both regions were observed for palmitoleic acid (C16:1(n-7)) content and C18:0/C16:0 and C18:1(n-7)/C16:1(n-7) elongation ratios. MAML3 and SETD7 are positional candidate genes in the 93 Mb region and two novel microsatellites in MAML3 and nine SNPs in SETD7 were identified. No significant association for the MAML3 microsatellite genotypes was detected. The SETD7:c.700G > T SNP, although statistically significant, was not the strongest signal in this region. In addition, the expression of MAML3 and SETD7 in liver and adipose tissue varied among animals, but no association was detected with the polymorphisms in these genes. In the 119 Mb region, the ELOVL6:c.-533C > T polymorphism showed a strong association with percentage of palmitic and palmitoleic fatty acids and elongation ratios in backfat. Conclusions Our results suggest that the polymorphisms studied in

  7. Fatty acids composition of Caenorhabditis elegans using accurate mass GCMS-QTOF.

    PubMed

    Henry, Parise; Owopetu, Olufunmilayo; Adisa, Demilade; Nguyen, Thao; Anthony, Kevin; Ijoni-Animadu, David; Jamadar, Sakha; Abdel-Rahman, Fawzia; Saleh, Mahmoud A

    2016-08-01

    The free living nematode Caenorhabditis elegans is a proven model organism for lipid metabolism research. Total lipids of C. elegans were extracted using chloroform and methanol in 2:1 ratio (v/v). Fatty acids composition of the extracted total lipids was converted to their corresponding fatty acids methyl esters (FAMEs) and analyzed by gas chromatography/accurate mass quadrupole time of flight mass spectrometry using both electron ionization and chemical ionization techniques. Twenty-eight fatty acids consisting of 12 to 22 carbon atoms were identified, 65% of them were unsaturated. Fatty acids containing 12 to17 carbons were mostly saturated with stearic acid (18:0) as the major constituent. Several branched-chain fatty acids were identified. Methyl-14-methylhexadecanoate (iso- 17:0) was the major identified branched fatty acid. This is the first report to detect the intact molecular parent ions of the identified fatty acids in C. elegans using chemical ionization compared to electron ionization which produced fragmentations of the FAMEs.

  8. Use of milk fatty acids composition to discriminate area of origin of bulk milk.

    PubMed

    Gaspardo, B; Lavrencic, A; Levart, A; Del Zotto, S; Stefanon, B

    2010-08-01

    The fatty acid composition of cow milk, collected in a survey from 19 dairy farms in the border area between Italy and Slovenia, was investigated for 2 consecutive years (2005 and 2006) to assess the possibility of discriminating the area of the origin of the milk. Farms were selected based on diet, animal breed, and farm management to represent the local variability of the systems. In Slovenian farms, grass silage and hay prevailed over corn silage and concentrate feeds, whereas in Italian farms, hay and concentrates were the predominant components of the diet. Fifty-three fatty acids were separated and quantified in Italian and Slovenian milks. Saturated fatty acids represented the most abundant class, followed by monounsaturated and polyunsaturated fatty acids. Significant differences were observed between Italian and Slovenian milks for the concentration of 40 fatty acids, whereas significant differences were observed between years of production for 15 fatty acids. Discriminant analysis was used to identify a classification criterion of milk, using country and year of production as grouping variables. Considering statistical results and the scatter plot of the scores of the first 2 functions, the best discriminant criteria were those based on unsaturated fatty acids and on fatty acids with several carbon atoms >or=18.

  9. Fatty acids composition of Caenorhabditis elegans using accurate mass GCMS-QTOF.

    PubMed

    Henry, Parise; Owopetu, Olufunmilayo; Adisa, Demilade; Nguyen, Thao; Anthony, Kevin; Ijoni-Animadu, David; Jamadar, Sakha; Abdel-Rahman, Fawzia; Saleh, Mahmoud A

    2016-08-01

    The free living nematode Caenorhabditis elegans is a proven model organism for lipid metabolism research. Total lipids of C. elegans were extracted using chloroform and methanol in 2:1 ratio (v/v). Fatty acids composition of the extracted total lipids was converted to their corresponding fatty acids methyl esters (FAMEs) and analyzed by gas chromatography/accurate mass quadrupole time of flight mass spectrometry using both electron ionization and chemical ionization techniques. Twenty-eight fatty acids consisting of 12 to 22 carbon atoms were identified, 65% of them were unsaturated. Fatty acids containing 12 to17 carbons were mostly saturated with stearic acid (18:0) as the major constituent. Several branched-chain fatty acids were identified. Methyl-14-methylhexadecanoate (iso- 17:0) was the major identified branched fatty acid. This is the first report to detect the intact molecular parent ions of the identified fatty acids in C. elegans using chemical ionization compared to electron ionization which produced fragmentations of the FAMEs. PMID:27166662

  10. Pu-erh tea, green tea, and black tea suppresses hyperlipidemia, hyperleptinemia and fatty acid synthase through activating AMPK in rats fed a high-fructose diet.

    PubMed

    Huang, Hsiu-Chen; Lin, Jen-Kun

    2012-02-01

    Although green tea extract has been reported to suppress hyperlipidemia, it is unclear how tea extracts prepared from green, oolong, black and pu-erh teas modulate fatty acid synthase expression in rats fed on a high-fructose diet. In this animal study, we evaluated the hypolipidemic and hypoleptinemia effect of these four different tea leaves fed to male Wistar rats for 12 weeks. The results showed that a fructose-rich diet significantly elevated serum triacylglycerols, cholesterol, insulin, and leptin concentrations, as compared with those in the control group. Interestingly, consuming tea leaves for 12 weeks almost normalized the serum triacylglycerols concentrations. Again, rats fed with fructose/green tea and fructose/pu-erh tea showed the greatest reduction in serum TG, cholesterol, insulin and leptin levels. In contrast, serum cholesterol and insulin concentrations of the fructose/oolong tea-fed rats did not normalize. The relative epididymal adipose tissue weight was lower in all rats supplemented with tea leaves than those fed with fructose alone. There was molecular evidence of improved lipid homeostasis according to fatty acid synthase (FAS) protein expression. Furthermore, supplementation of green, black, and pu-erh tea leaves significantly decreased hepatic FAS mRNA and protein levels, and increased AMPK phosphorylation, compared with those of rats fed with fructose only. These findings suggest that the intake of green, black, and pu-erh tea leaves ameliorated the fructose-induced hyperlipidemia and hyperleptinemia state in part through the suppression of FAS protein levels and increased AMPK phosphorylation.

  11. Food composition and acid-base balance: alimentary alkali depletion and acid load in herbivores.

    PubMed

    Kiwull-Schöne, Heidrun; Kiwull, Peter; Manz, Friedrich; Kalhoff, Hermann

    2008-02-01

    Alkali-enriched diets are recommended for humans to diminish the net acid load of their usual diet. In contrast, herbivores have to deal with a high dietary alkali impact on acid-base balance. Here we explore the role of nutritional alkali in experimentally induced chronic metabolic acidosis. Data were collected from healthy male adult rabbits kept in metabolism cages to obtain 24-h urine and arterial blood samples. Randomized groups consumed rabbit diets ad libitum, providing sufficient energy but variable alkali load. One subgroup (n = 10) received high-alkali food and approximately 15 mEq/kg ammonium chloride (NH4Cl) with its drinking water for 5 d. Another group (n = 14) was fed low-alkali food for 5 d and given approximately 4 mEq/kg NH4Cl daily for the last 2 d. The wide range of alimentary acid-base load was significantly reflected by renal base excretion, but normal acid-base conditions were maintained in the arterial blood. In rabbits fed a high-alkali diet, the excreted alkaline urine (pH(u) > 8.0) typically contained a large amount of precipitated carbonate, whereas in rabbits fed a low-alkali diet, both pH(u) and precipitate decreased considerably. During high-alkali feeding, application of NH4Cl likewise decreased pH(u), but arterial pH was still maintained with no indication of metabolic acidosis. During low-alkali feeding, a comparably small amount of added NH4Cl further lowered pH(u) and was accompanied by a significant systemic metabolic acidosis. We conclude that exhausted renal base-saving function by dietary alkali depletion is a prerequisite for growing susceptibility to NH4Cl-induced chronic metabolic acidosis in the herbivore rabbit.

  12. Preparation and characterization of dry method esterified starch/polylactic acid composite materials.

    PubMed

    Zuo, Yingfeng; Gu, Jiyou; Yang, Long; Qiao, Zhibang; Tan, Haiyan; Zhang, Yanhua

    2014-03-01

    Corn starch and maleic anhydride were synthesized from a maleic anhydride esterified starch by dry method. Fourier transform infrared spectroscopy (FTIR) was used for the qualitative analysis of the esterified starches. The reaction efficiency of dry method esterified starch reached 92.34%. The dry method esterified starch was blended with polylactic acid (PLA), and the mixture was melted and extruded to produce the esterified starch/polylactic acid (ES/PLA) composites. The degree of crystallinity of the ES/PLA was lower than that of the NS/PLA, indicating that the relative dependence between these two components of starch and polylactic acid was enhanced. Scanning electron microscopy (SEM) indicated that the dry method esterified starch increased the two-phase interface compatibility of the composites, thereby improving the tensile strength, bending strength, and elongation at break of the ES/PLA composite. The introduction of a hydrophobic ester bond and increase in interface compatibility led to an increase in ES/PLA water resistance. Melt index determination results showed that starch esterification modification had improved the melt flow properties of starch/PLA composite material. Strain scanning also showed that the compatibility of ES/PLA was increased. While frequency scanning showed that the storage modulus and complex viscosity of ES/PLA was less than that of NS/PLA.

  13. Preparation and characterization of dry method esterified starch/polylactic acid composite materials.

    PubMed

    Zuo, Yingfeng; Gu, Jiyou; Yang, Long; Qiao, Zhibang; Tan, Haiyan; Zhang, Yanhua

    2014-03-01

    Corn starch and maleic anhydride were synthesized from a maleic anhydride esterified starch by dry method. Fourier transform infrared spectroscopy (FTIR) was used for the qualitative analysis of the esterified starches. The reaction efficiency of dry method esterified starch reached 92.34%. The dry method esterified starch was blended with polylactic acid (PLA), and the mixture was melted and extruded to produce the esterified starch/polylactic acid (ES/PLA) composites. The degree of crystallinity of the ES/PLA was lower than that of the NS/PLA, indicating that the relative dependence between these two components of starch and polylactic acid was enhanced. Scanning electron microscopy (SEM) indicated that the dry method esterified starch increased the two-phase interface compatibility of the composites, thereby improving the tensile strength, bending strength, and elongation at break of the ES/PLA composite. The introduction of a hydrophobic ester bond and increase in interface compatibility led to an increase in ES/PLA water resistance. Melt index determination results showed that starch esterification modification had improved the melt flow properties of starch/PLA composite material. Strain scanning also showed that the compatibility of ES/PLA was increased. While frequency scanning showed that the storage modulus and complex viscosity of ES/PLA was less than that of NS/PLA. PMID:24315947

  14. Identification of thermophilic proteins by incorporating evolutionary and acid dissociation information into Chou's general pseudo amino acid composition.

    PubMed

    Fan, Guo-Liang; Liu, Yan-Ling; Wang, Hui

    2016-10-21

    Thermophilic proteins can thrive stalely at the high temperatures. Identification of thermophilic protein could be helpful to learn the function of protein. Automated prediction of thermophilic protein is an important tool for genome annotation. In this work, a powerful predictor is proposed by combining amino acid composition, evolutionary information, and acid dissociation constant. The overall prediction accuracy of 93.53% was obtained for using the algorithm of support vector machine. In order to check the performance of our method, two low-similarity independent testing datasets are used to test the proposed method. Comparisons with other methods show that the prediction results were better than other existing methods in literature. This indicates that our approach was effective to predict thermophilic proteins. PMID:27396359

  15. Dietary long-chain polyunsaturated fatty acids modify heart, kidney, and lung fatty acid composition in weanling rats.

    PubMed

    Suárez, A; Faus, M J; Gil, A

    1996-03-01

    The fatty acid composition of heart, kidney, and lung was studied in weanling rats fed three diets differing in their polyunsaturated fatty acid content for 0, 2, and 4 wk. The first group had a 10% w/w fat semipurified diet which consisted of a mixture of olive oil (62.5%), soybean oil (11.1%), and refined coconut oil (26.4%) and provided 18:1n-9, 18:2n-6, and 18:3n-3 in similar amounts to a maternal human milk (diet HO). The second group received 7% of HO fat and 3% fish oil (0.4% 20:4n-6 and 5% 22:6n-3 of total fatty acids) (diet FO), and the third group was fed 7% HO fat, 1.5% of the same fish oil, and 1.5% of a purified pig brain phospholipid concentrate (0.6% 20:4n-6 and 3.5% 22:6n-3 of total fatty acids) (diet FO + BPL). The experimental diets increased tissue monounsaturated fatty acids in comparison with rats at weaning. Tissue lipid content of 20:4n-6 was increased and 22:6n-3 decreased in Group HO compared with weanling rats, whereas opposite changes were observed in Group FO. Feeding diet FO + BPL increased 22:6n:3 in tissue lipids compared with diet HO, and increased 20:4n-6 content in relation to diet FO. Our results indicate that rat heart, kidney, and lung are highly responsive to dietary n-3 and n-6 long-chain polyunsaturated fatty acids during postnatal life. PMID:8900466

  16. Isolation, characterization, and amino acid sequences of auracyanins, blue copper proteins from the green photosynthetic bacterium Chloroflexus aurantiacus

    NASA Technical Reports Server (NTRS)

    McManus, J. D.; Brune, D. C.; Han, J.; Sanders-Loehr, J.; Meyer, T. E.; Cusanovich, M. A.; Tollin, G.; Blankenship, R. E.

    1992-01-01

    Three small blue copper proteins designated auracyanin A, auracyanin B-1, and auracyanin B-2 have been isolated from the thermophilic green gliding photosynthetic bacterium Chloroflexus aurantiacus. All three auracyanins are peripheral membrane proteins. Auracyanin A was described previously (Trost, J. T., McManus, J. D., Freeman, J. C., Ramakrishna, B. L., and Blankenship, R. E. (1988) Biochemistry 27, 7858-7863) and is not glycosylated. The two B forms are glycoproteins and have almost identical properties to each other, but are distinct from the A form. The sodium dodecyl sulfate-polyacrylamide gel electrophoresis apparent monomer molecular masses are 14 (A), 18 (B-2), and 22 (B-1) kDa. The amino acid sequences of the B forms are presented. All three proteins have similar absorbance, circular dichroism, and resonance Raman spectra, but the electron spin resonance signals are quite different. Laser flash photolysis kinetic analysis of the reactions of the three forms of auracyanin with lumiflavin and flavin mononucleotide semiquinones indicates that the site of electron transfer is negatively charged and has an accessibility similar to that found in other blue copper proteins. Copper analysis indicates that all three proteins contain 1 mol of copper per mol of protein. All three auracyanins exhibit a midpoint redox potential of +240 mV. Light-induced absorbance changes and electron spin resonance signals suggest that auracyanin A may play a role in photosynthetic electron transfer. Kinetic data indicate that all three proteins can donate electrons to cytochrome c-554, the electron donor to the photosynthetic reaction center.

  17. GC constituents and relative codon expressed amino acid composition in cyanobacterial phycobiliproteins.

    PubMed

    Kannaujiya, Vinod K; Rastogi, Rajesh P; Sinha, Rajeshwar P

    2014-08-10

    The genomic as well as structural relationship of phycobiliproteins (PBPs) in different cyanobacterial species are determined by nucleotides as well as amino acid composition. The genomic GC constituents influence the amino acid variability and codon usage of particular subunit of PBPs. We have analyzed 11 cyanobacterial species to explore the variation of amino acids and causal relationship between GC constituents and codon usage. The study at the first, second and third levels of GC content showed relatively more amino acid variability on the levels of G3+C3 position in comparison to the first and second positions. The amino acid encoded GC rich level including G rich and C rich or both correlate the codon variability and amino acid availability. The fluctuation in amino acids such as Arg, Ala, His, Asp, Gly, Leu and Glu in α and β subunits was observed at G1C1 position; however, fluctuation in other amino acids such as Ser, Thr, Cys and Trp was observed at G2C2 position. The coding selection pressure of amino acids such as Ala, Thr, Tyr, Asp, Gly, Ile, Leu, Asn, and Ser in α and β subunits of PBPs was more elaborated at G3C3 position. In this study, we observed that each subunit of PBPs is codon specific for particular amino acid. These results suggest that genomic constraint linked with GC constituents selects the codon for particular amino acids and furthermore, the codon level study may be a novel approach to explore many problems associated with genomics and proteomics of cyanobacteria.

  18. Chemical composition and amino acid profiles of goose muscles from native Polish breeds.

    PubMed

    Okruszek, A; Woloszyn, J; Haraf, G; Orkusz, A; Werenska, M

    2013-04-01

    The aim of the study was to compare the chemical and amino acid composition of breast (pectoralis major) and thigh (biceps femoris) muscles in 17-wk-old geese from 2 Polish conservative flocks: Rypińska (Ry, n = 20) and Garbonosa (Ga, n = 20). The geese were fed ad libitum during the experimental period on the same complete feed. Genotypes affected the moisture and fat content of breast and thigh meat. The Ga geese were characterized by higher moisture as well as lower fat lipid content compared with the Ry breast and thigh muscles. The amino acid proportions of meat proteins depended on the goose flock and type of muscles, where significant differences were found. The proteins of Ga breast muscles contained more glutamic acid, glycine, lysine, tryptophan, histidine, and methionine, and less aspartic acid, proline, serine, leucine, valine, phenyloalanine, tyrosine, and threonine than the Ry geese (P ≤ 0.05). The proteins of Ry thigh muscles were characterized by higher content of proline, serine, and essential amino acids (without lysine and methionine) and lower glutamic and asparagine acid, alanine, and glycine compared with the Ga flock. According to the Food and Agriculture Organization of the United Nations/World Health Organization (1991) standard, tryptophan was the amino acid limiting the nutritional value of meat proteins of Ry breast muscles (amino acid score for tryptophan = 90%). Except for tryptophan, the meat proteins of the investigated raw materials contained more essential amino acids than the standard. The total content of essential amino acids for all investigated muscles was also higher (52.51 to 55.54%) than the standard (33.90%). It is evident that muscle protein from both flocks of geese have been characterized by high nutritional value. The values of the essential amino acid index of breast muscle proteins were similar in both flocks.

  19. Fatty acid composition analyses of the DCMU resistant mutants of Nannochloropsis oculata (eustigmatophyceae)

    NASA Astrophysics Data System (ADS)

    Jimin, Zhang; Shuang, Liu; Xue, Sun; Guanpin, Yang; Xuecheng, Zhang; Zhenhui, Gao

    2003-04-01

    Ultraviolet mutagenesis was applied to Nannochloropsis oculata and three mutants resistant to 3-(3, 4-dichlorophenyl)-1,1-dimethylurea (DCMU) were isolated. The cellular chlorophyll a and total lipid content of the wild are higher in the medium supplemented with DCMU than in the control without DCMU. Without DCMU, the growth rates and chlorophyll a contents of the mutants are similar to those of the wild. Significant changes of fatty acid content and composition have occurred in DCMU-resistant mutants growing in the medium supplemented with DCMU. The total lipid, palmitic acid (16:0), palmitoleic acid (16:1ω9) and oleic (18:1ω9) contents decrease significantly, while the vaccenic acid (18:1ω11) increases significantly and the EPA content of dried powder increases slightly in the mutants. The study may provide a basis to improve EPA content in Nannochloropsis oculata in the future.

  20. Biomass, lipid productivities and fatty acids composition of marine Nannochloropsis gaditana cultured in desalination concentrate.

    PubMed

    Matos, Ângelo Paggi; Feller, Rafael; Moecke, Elisa Helena Siegel; Sant'Anna, Ernani Sebastião

    2015-12-01

    In this study the feasibility of growing marine Nannochloropsis gaditana in desalination concentrate (DC) was explored and the influence of the DC concentration on the biomass growth, lipid productivities and fatty acids composition was assessed. The reuse of the medium with the optimum DC concentration in successive algal cultivation cycles and the additional of a carbon source to the optimized medium were also evaluated. On varying the DC concentration, the maximum biomass concentration (0.96gL(-1)) and lipid content (12.6%) were obtained for N. gaditana in the medium with the optimum DC concentration (75%). Over the course of the reuse of the optimum DC medium, three cultivation cycles were performed, observing that the biomass productivity is directly correlated to lipid productivity. Palmitic acid was the major fatty acid found in N. gaditana cells. The saturated fatty acids content of the algae enhanced significantly on increasing the DC concentration. PMID:26318921

  1. Biomass, lipid productivities and fatty acids composition of marine Nannochloropsis gaditana cultured in desalination concentrate.

    PubMed

    Matos, Ângelo Paggi; Feller, Rafael; Moecke, Elisa Helena Siegel; Sant'Anna, Ernani Sebastião

    2015-12-01

    In this study the feasibility of growing marine Nannochloropsis gaditana in desalination concentrate (DC) was explored and the influence of the DC concentration on the biomass growth, lipid productivities and fatty acids composition was assessed. The reuse of the medium with the optimum DC concentration in successive algal cultivation cycles and the additional of a carbon source to the optimized medium were also evaluated. On varying the DC concentration, the maximum biomass concentration (0.96gL(-1)) and lipid content (12.6%) were obtained for N. gaditana in the medium with the optimum DC concentration (75%). Over the course of the reuse of the optimum DC medium, three cultivation cycles were performed, observing that the biomass productivity is directly correlated to lipid productivity. Palmitic acid was the major fatty acid found in N. gaditana cells. The saturated fatty acids content of the algae enhanced significantly on increasing the DC concentration.

  2. Relationship between cannabinoids content and composition of fatty acids in hempseed oils.

    PubMed

    Petrović, Marinko; Debeljak, Željko; Kezić, Nataša; Džidara, Petra

    2015-03-01

    Hempseed oils acquired on the Croatian markets were characterised by cannabinoid content and fatty acid composition. The new method for determination of cannabinoid content was developed and validated in the range of 0.05-60 mg/kg, and the content of tetrahydrocannabinol varied between 3.23 and 69.5 mg/kg. Large differences among the samples were obtained for phenotype ratio suggesting that not all of analysed hempseed oils were produced from industrial hemp. Sample clustering based on cannabinoid content assigned samples to two groups closely related to the phenotype ratios obtained. The results of this study confirm that hempseed oil is a good source of polyunsaturated fatty acids, especially γ-linolenic and stearidonic acid, but the content varies a lot more than the omega-6/omega-3 ratio. The grouping of samples on fatty acid content assigned samples to two groups which were consistent with the groups obtained based on cannabinoid content clustering. PMID:25306338

  3. Relationship between cannabinoids content and composition of fatty acids in hempseed oils.

    PubMed

    Petrović, Marinko; Debeljak, Željko; Kezić, Nataša; Džidara, Petra

    2015-03-01

    Hempseed oils acquired on the Croatian markets were characterised by cannabinoid content and fatty acid composition. The new method for determination of cannabinoid content was developed and validated in the range of 0.05-60 mg/kg, and the content of tetrahydrocannabinol varied between 3.23 and 69.5 mg/kg. Large differences among the samples were obtained for phenotype ratio suggesting that not all of analysed hempseed oils were produced from industrial hemp. Sample clustering based on cannabinoid content assigned samples to two groups closely related to the phenotype ratios obtained. The results of this study confirm that hempseed oil is a good source of polyunsaturated fatty acids, especially γ-linolenic and stearidonic acid, but the content varies a lot more than the omega-6/omega-3 ratio. The grouping of samples on fatty acid content assigned samples to two groups which were consistent with the groups obtained based on cannabinoid content clustering.

  4. Eggshell composition of squamate reptiles: relationship between eggshell permeability and amino acid distribution.

    PubMed

    Sexton, Owen J; Bramble, Judith E; Heisler, I Lorraine; Phillips, Christopher A; Cox, David L

    2005-10-01

    Most snakes and lizards produce eggs with flexible shells that interact with the environment to maintain water balance. Geckos produce rigid eggshells that are independent of an external source of water and can be oviposited in more open, dryer locations. In this study, we analyzed and compared the amino acid composition of 24 lizard species, six snake species, and four outgroups (including avian and reptilian elastin and chicken eggshell). Rigid Gecko eggshells had significantly lower levels of seven of the 17 amino acids evaluated. Multivariate analysis showed that proline was the most important amino acid in distinguishing between these two groups of eggshells, occurring at significantly higher levels in flexible eggshells. High levels of proline have also been observed in the eggshells of other species. Proline and other amino acids are associated with the alleviation of water and salt stress in plants. PMID:16195850

  5. Stimulation of proliferation of an essential fatty acid-deficient fish cell line by C20 and C22 polyunsaturated fatty acids and effects on fatty acid composition.

    PubMed

    Tocher, D R; Dick, J R; Sargent, J R

    1996-11-01

    Recently we reported the development of a fish cell line, EPC-EFAD, derived from the carp (Cyprinus carpio) epithelial papilloma line, EPC, that could survive and proliferate in essential fatty acid-deficient (EFAD) medium. The EPC-EFAD cell line may be a useful model system in which to study the cellular biochemical effects of EFA deficiency and has advantages in studies of polyunsaturated fatty acid (PUFA) and eicosanoid metabolism in fish in that the complications introduced by culture in relatively n-6 PUFA-rich mammalian sera are removed. In the present study, the effects on cell proliferation rate of supplementing EPC-EFAD cells with various n-3 and n-6 PUFA were investigated to determine the possible role(s) of PUFA in cell growth and division. The selectivity of incorporation of specific PUFA into individual glycerophospholipid classes and the feasibility of reproducing in vivo fatty acid compositions in vitro were also investigated. Proliferation of the EPC-EFAD cell line was stimulated by arachidonic (20:4 n-6), eicosapentaenoic (20:5 n-3) and docosahexaenoic (22:6 n-3) fatty acids but not by 18:2 n-6 or 18:3 n-3. The differential effects of PUFA on cellular proliferation may be related to the lack of significant delta 5 desaturase activity in the cells at 22 degrees C and may implicate a role for eicosanoids in the mechanism of stimulation of proliferation. PUFA supplementation increased the cytotoxic effects of longer term culture, an effect that was partly alleviated by inclusion of vitamin E in the culture medium. The cells could generally be supplemented with PUFA to produce cellular fatty acid compositions in vitro that were similar to in vivo compositions. PMID:8981632

  6. A novel basalt fiber-reinforced polylactic acid composite for hard tissue repair.

    PubMed

    Chen, Xi; Li, Yan; Gu, Ning

    2010-08-01

    A basalt fiber (BF) was, for the first time, introduced into a poly(l-lactic acid) (PLLA) matrix as innovative reinforcement to fabricate composite materials for hard tissue repair. Firstly, BF/PLLA composites and pure PLLA were produced by the methods of solution blending and freeze drying. The results showed that basalt fibers can be uniformly dispersed in the PLLA matrix and significantly improve the mechanical properties and hydrophilicity of the PLLA matrix. The presence of basalt fibers may retard the polymer degradation rate and neutralize the acid degradation from PLLA. Osteoblasts were cultured in vitro to evaluate the cytocompatibility of the composite. An MTT assay revealed that osteoblasts proliferated well for 7 days and there was little difference found in their viability on both PLLA and BF/PLLA films, which was consistent with the alkaline phosphatase (ALP) activity results. A fluorescent staining observation showed that osteoblasts grew well on the composites. SEM images displayed that osteoblasts tended to grow along the fiber axis. The formation of mineralized nodules was observed on the films by Alizarin red S staining. These results suggest that the presence of basalt fibers does not noticeably affect osteoblastic behavior and the designed composites are osteoblast compatible. It is concluded that basalt fibers, as reinforcing fibers, may have promising applications in hard tissue repair.

  7. Adsorption of Acid Red 57 from aqueous solutions onto polyacrylonitrile/activated carbon composite.

    PubMed

    El-Bindary, Ashraf A; Diab, Mostafa A; Hussien, Mostafa A; El-Sonbati, Adel Z; Eessa, Ahmed M

    2014-04-24

    The adsorption of Acid Red 57 (AR57) onto Polyacrylonitrile/activated carbon (PAN/AC) composite was investigated in aqueous solution in a batch system with respect to contact time, pH and temperature. Physical characteristics of (PAN/AC) composite such as fourier transform infrared (FTIR) spectroscopy and scanning electron microscopy (SEM) were obtained. Langmuir and Freundlich adsorption models were applied to describe the equilibrium isotherms and the isotherm constants were determined. The activation energy of adsorption was also evaluated for the adsorption of AR57 onto (PAN/AC) composite. The pseudo-first-order and pseudo-second-order kinetic models were used to describe the kinetic data. The dynamic data fitted the pseudo-second-order kinetic model well. The activation energy, change of free energy, enthalpy and entropy of adsorption were also evaluated for the adsorption of AR57 onto (PAN/AC) composite. The thermodynamics of the adsorption indicated spontaneous and exothermic nature of the process. The results indicate that (PAN/AC) composite could be employed as low-cost material for the removal of acid dyes from textile effluents. PMID:24463242

  8. Fatty Acid Composition and Community Structure of Plankton from the San Lorenzo Channel, Gulf of California

    NASA Astrophysics Data System (ADS)

    Lavaniegos, B. E.; López-Cortés, D.

    1997-12-01

    The structure of the plankton community and fatty acid composition of nano-, micro- and zooplankton are described during four seasons of 1994 from the San Lorenzo Channel. During August, the warmest temperature in the surface water was observed and a thermocline developed between 20 and 30 m. In the remaining months, a well-mixed layer occurred in the upper 30 m. The chlorophyllacontent of the nanoplankton fraction (<38 μm) was higher than the microplanktonic fraction (38-200 μm) year round. Maximal chlorophyll values (1·5-3 μ l-1) occurred in January, which may be associated with organic matter, since phytoplankton was lower than at other seasons. The relative abundance of diatoms increased from January (57% of phytoplankton) to November (99%). The increment was mainly due toNitzschiaandChaetoceros. Dinoflagellates were always low (0·03-1·36 cells ml-1). Copepods (mainlyEucalanus) dominated the zooplankton in winter and fall, while in spring and summer, the abundance of doliolids was similar to the copepods (Nannocalanus minordominated). Four fatty acids (16:0, 16:1, 18:0, 18:1) were the most conspicuous in the plankton, representing usually between 40 and 80% of the total fatty acids throughout the water column. In winter, higher fatty acid content and higher relative amounts of 16:0 and 16:1 were observed than in the warm months. Stearic acid (18:0) peaked during fall. The major seasonal differences occurred in the nanoplankton, which had peaks of 20:5 during January, and 16:4 in April. A strong decrease in polyunsaturated fatty acids (PUFA) occurred during the warm months. The fatty acid composition of microplankton and larger zooplankton was similar in winter-spring. Individual copepods of selected species (Eucalanus sewelli,Rhincalanus nasutus,Centropages furcatusandLabidocera acuta) showed fatty acid profiles similar to the mixed zooplankton, with some differences in content of PUFA.

  9. Composition, assimilation and degradation of Phaeocystis globosa-derived fatty acids in the North Sea

    NASA Astrophysics Data System (ADS)

    Hamm, Christian E.; Rousseau, Veronique

    2003-12-01

    The fate of a Phaeocystis globosa bloom in the southern North Sea off Belgium, the Netherlands and Germany in May 1995 was investigated during a cruise with RV 'Belgica'. We used fatty acids as biomarkers to follow the fate of Phaeocystis-derived biomass of a Phaeocystis-dominated spring bloom. The bloom, in which up to >99% of the biomass was contributed by Phaeocystis, showed a fatty acid composition with a characteristically high abundance of polyunsaturated C 18-fatty acids, which increased in concentration with number of double bonds up to 18:5 (n-3), and high concentrations of 20:5 (n-3) and 22:6 (n-3). In contrast to most previous studies, fatty acid analysis of the mesozooplankton community (mainly calanoid copepods) and meroplankton ( Carcinus maenas megalope) indicated that P. globosa was a major component (ca. 70% and 50%, respectively) in the diet of these organisms. Massive accumulations of amorphous grey aggregates, in which Phaeocystis colonies were major components, were dominated by saturated fatty acids and contained only few of the polyunsaturated C 18-fatty acids. A hydrophobic surface slick that covered the water surface during the bloom showed very similar patterns. Foam patches contained few Phaeocystis-typical fatty acids, but increased amounts of diatom-typical compounds such as 16:1 (n-7) and 20:5 (n-3), and 38% fatty alcohols, indicating that wax esters dominated the lipid fraction in the foam with ca. 76% (w/w). The fatty acid compositions of surface sediment showed that no sedimentation of fresh Phaeocystis occurred during the study. The results indicate that Phaeocystis-derived organic matter degraded while floating or in suspension, and had not reached the sediment in substantial amounts.

  10. Effect of dietary selenium and omega-3 fatty acids on muscle composition and quality in broilers

    PubMed Central

    Haug, Anna; Eich-Greatorex, Susanne; Bernhoft, Aksel; Wold, Jens P; Hetland, Harald; Christophersen, Olav A; Sogn, Trine

    2007-01-01

    Background Human health may be improved if dietary intakes of selenium and omega-3 fatty acids are increased. Consumption of broiler meat is increasing, and the meat content of selenium and omega-3 fatty acids are affected by the composition of broiler feed. A two-way analyses of variance was used to study the effect of feed containing omega-3 rich plant oils and selenium enriched yeast on broiler meat composition, antioxidation- and sensory parameters. Four different wheat-based dietary treatments supplemented with 5% rapeseed oil or 4% rapeseed oil plus 1% linseed oil, and either 0.50 mg selenium or 0.84 mg selenium (organic form) per kg diet was fed to newly hatched broilers for 22 days. Results The different dietary treatments gave distinct different concentrations of selenium and fatty acids in thigh muscle; one percent linseed oil in the diet increased the concentration of the omega-3 fatty acids 18:3, 20:5 and 22:5, and 0.84 mg selenium per kg diet gave muscle selenium concentration at the same level as is in fish muscle (0.39 mg/kg muscle). The high selenium intake also resulted in increased concentration of the long-chain omega-3 fatty acids EPA (20:5), DPA (22:5) and DHA (22:6), thus it may be speculated if high dietary selenium might have a role in increasing the concentration of EPA, DPA and DHA in tissues after intake of plant oils contning omega-3 fatty acids. Conclusion Moderate modifications of broiler feed may give a healthier broiler meat, having increased content of selenium and omega-3 fatty acids. High intakes of selenium (organic form) may increase the concentration of very long-chain omega-3 fatty acids in muscle. PMID:17967172

  11. Chemical composition of red, brown and green macroalgae from Buarcos bay in Central West Coast of Portugal.

    PubMed

    Rodrigues, Dina; Freitas, Ana C; Pereira, Leonel; Rocha-Santos, Teresa A P; Vasconcelos, Marta W; Roriz, Mariana; Rodríguez-Alcalá, Luís M; Gomes, Ana M P; Duarte, Armando C

    2015-09-15

    Six representative edible seaweeds from the Central West Portuguese Coast, including the less studied Osmundea pinnatifida, were harvested from Buarcos bay, Portugal and their chemical characterization determined. Protein content, total sugar and fat contents ranged between 14.4% and 23.8%, 32.4% and 49.3% and 0.6-3.6%. Highest total phenolic content was observed in Codium tomentosum followed by Sargassum muticum and O. pinnatifida. Fatty acid (FA) composition covered the branched chain C13ai to C22:5 n3 with variable content in n6 and n3 FA; low n6:n3 ratios were observed in O. pinnatifida, Grateloupia turuturu and C. tomentosum. Some seaweed species may be seen as good sources of Ca, K, Mg and Fe, corroborating their good nutritional value. According to FTIR-ATR spectra, G. turuturu was associated with carrageenan seaweed producers whereas Gracilaria gracilis and O. pinnatifida were mostly agar producers. In the brown algae, S. muticum and Saccorhiza polyschides, alginates and fucoidans were the main polysaccharides found. PMID:25863629

  12. [Fractional and amino acid composition of krill proteins and the potential for obtaining protein preparations].

    PubMed

    Orlova, T A; Churina, E E; Kuranova, L K

    1985-01-01

    Studies of the fractional composition of krill proteins demonstrated that the content of protein fractions changes depending on the time of krill catch. The highest amount of water-soluble proteins is contained by krill caught in December (64%), of salt-soluble by krill caught in June (12%), base-soluble by krill caught in May, September and February (34%). Krill protein contains from 50 to 60% of water- and salt-soluble fractions. Analysis of the amino acid composition of krill proteins showed that it does not differ essentially from that of adequate food proteins.

  13. Benzimidazole as corrosion inhibitor for heat treated 6061 Al- SiCp composite in acetic acid

    NASA Astrophysics Data System (ADS)

    Chacko, Melby; Nayak, Jagannath

    2015-06-01

    6061 Al-SiCpcomposite was solutionizedat 350 °C for 30 minutes and water quenched. It was then underaged at 140 °C (T6 treatment). The aging behaviour of the composite was studied using Rockwell B hardness measurement. Corrosion behaviour of the underaged sample was studied in different concentrations of acetic acid and at different temperatures. Benzimidazole at different concentrations was used for the inhibition studies. Inhibition efficiency of benzimidazole was calculated for different experimental conditions. Thermodynamic parameters were found out which suggested benzimidazole is an efficient inhibitor and it adsorbed on to the surface of composite by mixed adsorption where chemisorption is predominant.

  14. Fatty acid composition of plasma lipids and erythrocyte membranes during simulated extravehicular activity

    NASA Astrophysics Data System (ADS)

    Skedina, M. A.; Katuntsev, V. P.; Buravkova, L. B.; Naidina, V. P.

    Ten subjects (from 27 to 41 years) have been participated in 32 experiments. They were decompressed from ground level to 40-35 kPa in altitude chamber when breathed 100% oxygen by mask and performed repeated cycles of exercises (3.0 Kcal/min). The intervals between decompressions were 3-5 days. Plasma lipid and erythrocyte membrane fatty acid composition was evaluated in the fasting venous blood before and immediately after hypobaric exposure. There were 7 cases decompression sickness (DCS). Venous gas bubbles (GB) were detected in 27 cases (84.4%). Any significant changes in the fatty acid composition of erythrocyte membranes and plasma didn't practically induce after the first decompression. However, by the beginning of the second decompression the total lipid level in erythrocyte membranes decreased from 54.6 mg% to 40.4 mg% in group with DCS symptoms and from 51.2 mg% to 35.2 mg% (p < 0.05) without DCS symptoms. In group with DCS symptoms a tendency to increased level of saturated fatty acids in erythrocyte membranes (16:0, 18:0), the level of the polyunsaturated linoleic fatty acid (18:2) and arachidonic acid (20:4) tended to be decreased by the beginning of the second decompression. Insignificant changes in blood plasma fatty acid composition was observed in both groups. The obtained biochemical data that indicated the simulated extravehicular activity (EVA) condition is accompanied by the certain changes in the blood lipid metabolism, structural and functional state of erythrocyte membranes, which are reversible. The most pronounced changes are found in subjects with DCS symptoms.

  15. Lipid and fatty acid compositions of cod ( Gadus morhua), haddock ( Melanogrammus aeglefinus) and halibut ( Hippoglossus hippoglossus)

    NASA Astrophysics Data System (ADS)

    Zeng, Duan; Mai, Kangsen; Ai, Qinghui; Milley, Joyce E.; Lall, Santosh P.

    2010-12-01

    This study was conducted to compare lipid and fatty acid composition of cod, haddock and halibut. Three groups of cod (276 g ± 61 g), haddock (538 g ± 83 g) and halibut (3704 g ± 221 g) were maintained with commercial feeds mainly based on fish meal and marine fish oil for 12 weeks prior to sampling. The fatty acid compositions of muscle and liver were determined by GC/FID after derivatization of extracted lipids into fatty acid methyl esters (FAME). Lipids were also fractionated into neutral and polar lipids using Waters silica Sep-Pak?. The phospholipid fraction was further separated by high-performance thin-layer chromatography (HPTLC) and the FAME profile was obtained. Results of the present study showed that cod and haddock were lean fish and their total muscle lipid contents were 0.8% and 0.7%, respectively, with phospholipid constituting 83.6% and 87.5% of the total muscle lipid, respectively. Halibut was a medium-fat fish and its muscle lipid content was 8%, with 84% of the total muscle lipid being neutral lipid. Total liver lipid contents of cod, haddock and halibut were 36.9%, 67.2% and 30.7%, respectively, of which the neutral lipids accounted for the major fraction (88.1%-97.1%). Polyunsaturated fatty acids were the most abundant in cod and haddock muscle neutral lipid. Monounsaturated fatty acid level was the highest in halibut muscle neutral lipid. Fatty acid compositions of phospholipid were relatively constant. In summary, the liver of cod and haddock as lean fish was the main lipid reserve organ, and structural phospholipid is the major lipid form in flesh. However, as a medium-fat fish, halibut stored lipid in both their liver and muscle.

  16. Fatty acid composition of plasma lipids and erythrocyte membranes during simulated extravehicular activity.

    PubMed

    Skedina, M A; Katuntsev, V P; Buravkova, L B; Naidina, V P

    1998-01-01

    Ten subjects (from 27 to 41 years) have been participated in 32 experiments. They were decompressed from ground level to 40-35 kPa in altitude chamber when breathed 100% oxygen by mask and performed repeated cycles of exercises (3.0 Kcal/min). The intervals between decompressions were 3-5 days. Plasma lipid and erythrocyte membrane fatty acid composition was evaluated in the fasting venous blood before and immediately after hypobaric exposure. There were 7 cases decompression sickness (DCS). Venous gas bubbles (GB) were detected in 27 cases (84.4%). Any significant changes in the fatty acid composition of erythrocyte membranes and plasma didn't practically induce after the first decompression. However, by the beginning of the second decompression the total lipid level in erythrocyte membranes decreased from 54.6 mg% to 40.4 mg% in group with DCS symptoms and from 51.2 mg% to 35.2 mg% (p<0.05) without DCS symptoms. In group with DCS symptoms a tendency to increased level of saturated fatty acids in erythrocyte membranes (16:0, 18:0), the level of the polyunsaturated linoleic fatty acid (18:2) and arachidonic acid (20:4) tended to be decreased by the beginning of the second decompression. Insignificant changes in blood plasma fatty acid composition was observed in both groups. The obtained biochemical data that indicated the simulated extravehicular activity (EVA) condition is accompanied by the certain changes in the blood lipid metabolism, structural and functional state of erythrocyte membranes, which are reversible. The most pronounced changes are found in subjects with DCS symptoms.

  17. Effect of Different Cooking Methods on the Composition of Intramuscular Fatty Acids of Hyla Rabbit

    PubMed Central

    Xue, Shan; Xiao, Xia; He, Zhifei; Li, Hongjun

    2016-01-01

    The influence of three cooking methods (stewing, microwaving and Aluminium (Al) foil-baking) was evaluated on the content of intramuscular lipid and the composition of intramuscular fatty acids of Hyla rabbit. The percentage of intramuscular lipid in cooked-longissimus dorsi (LD) (dry weight %) were in the order mentioned below: microwaving > foil-baking > stewing. All treated samples showed decrease in the proportion of polyunsaturated fatty acids (PUFA) and monounsaturated fatty acids (MUFA), whilst increase in the proportion of saturated (SFA) and n-6/n-3 value during processing. All of the cooked samples had the n-6/n-3 ratio within the recommended range (5-10). By the analysis of partial least squares regression (PLSR), the microwaving treatment was better to keep the stability of unsaturated fatty acids (UFA), whilst the long-time Al foil-baking did the most serious damage to UFA, especially the PUFA. In addition, the heating method showed greater influence on the samples than the processing time. The shorter processing time was better to retain the intramuscular PUFA of Hyla rabbit, especially the LC-PUFAs (C20-22). Considering all the factors, microwaving showed the superiority in reserving the composition of intramuscular fatty acids of Hyla rabbit. PMID:27194925

  18. Effect of Different Cooking Methods on the Composition of Intramuscular Fatty Acids of Hyla Rabbit.

    PubMed

    Xue, Shan; Xiao, Xia; He, Zhifei; Li, Hongjun

    2016-01-01

    The influence of three cooking methods (stewing, microwaving and Aluminium (Al) foil-baking) was evaluated on the content of intramuscular lipid and the composition of intramuscular fatty acids of Hyla rabbit. The percentage of intramuscular lipid in cooked-longissimus dorsi (LD) (dry weight %) were in the order mentioned below: microwaving > foil-baking > stewing. All treated samples showed decrease in the proportion of polyunsaturated fatty acids (PUFA) and monounsaturated fatty acids (MUFA), whilst increase in the proportion of saturated (SFA) and n-6/n-3 value during processing. All of the cooked samples had the n-6/n-3 ratio within the recommended range (5-10). By the analysis of partial least squares regression (PLSR), the microwaving treatment was better to keep the stability of unsaturated fatty acids (UFA), whilst the long-time Al foil-baking did the most serious damage to UFA, especially the PUFA. In addition, the heating method showed greater influence on the samples than the processing time. The shorter processing time was better to retain the intramuscular PUFA of Hyla rabbit, especially the LC-PUFAs (C20-22). Considering all the factors, microwaving showed the superiority in reserving the composition of intramuscular fatty acids of Hyla rabbit. PMID:27194925

  19. Dietary effects on fatty acid composition in muscle tissue of juvenile European eel, Anguilla anguilla (L.)

    NASA Astrophysics Data System (ADS)

    Prigge, Enno; Malzahn, Arne M.; Zumholz, Karsten; Hanel, Reinhold

    2012-03-01

    The role of intracontinental migration patterns of European eel ( Anguilla anguilla) receives more and more recognition in both ecological studies of the European eel and possible management measures, but small-scale patterns proved to be challenging to study. We experimentally investigated the suitability of fatty acid trophic markers to elucidate the utilization of feeding habitats. Eight groups of juvenile European eels were fed on eight different diets in a freshwater recirculation system at 20°C for 56 days. Three groups were fed on freshwater diets ( Rutilus rutilus, Chironomidae larvae, and Gammarus pulex) and four groups were reared on diets of a marine origin ( Clupea harengus, Crangon crangon, Mysis spec., and Euphausia superba) and one on commercial pellets used in eel aquaculture. Fatty acid composition (FAC) of diets differed significantly with habitat. FAC of eel muscle tissue seemed to be rather insensitive to fatty acids supplied with diet, but the general pattern of lower n3:n6 and EPA:ARA ratios in freshwater prey organisms could be traced in the respective eels. Multivariate statistics of the fatty acid composition of the eels resulted in two distinct groups representing freshwater and marine treatments. Results further indicate the capability of selectively restraining certain fatty acids in eel, as e.g. the n3:n6 ratio in all treatments was <4, regardless of dietary n3:n6. In future studies on wild eel, these measures can be used to elucidate the utilization of feeding habitats of individual European eel.

  20. Effect of Different Cooking Methods on the Composition of Intramuscular Fatty Acids of Hyla Rabbit.

    PubMed

    Xue, Shan; Xiao, Xia; He, Zhifei; Li, Hongjun

    2016-01-01

    The influence of three cooking methods (stewing, microwaving and Aluminium (Al) foil-baking) was evaluated on the content of intramuscular lipid and the composition of intramuscular fatty acids of Hyla rabbit. The percentage of intramuscular lipid in cooked-longissimus dorsi (LD) (dry weight %) were in the order mentioned below: microwaving > foil-baking > stewing. All treated samples showed decrease in the proportion of polyunsaturated fatty acids (PUFA) and monounsaturated fatty acids (MUFA), whilst increase in the proportion of saturated (SFA) and n-6/n-3 value during processing. All of the cooked samples had the n-6/n-3 ratio within the recommended range (5-10). By the analysis of partial least squares regression (PLSR), the microwaving treatment was better to keep the stability of unsaturated fatty acids (UFA), whilst the long-time Al foil-baking did the most serious damage to UFA, especially the PUFA. In addition, the heating method showed greater influence on the samples than the processing time. The shorter processing time was better to retain the intramuscular PUFA of Hyla rabbit, especially the LC-PUFAs (C20-22). Considering all the factors, microwaving showed the superiority in reserving the composition of intramuscular fatty acids of Hyla rabbit.

  1. DNA methylation landscape of fat deposits and fatty acid composition in obese and lean pigs

    PubMed Central

    Zhang, Shunhua; Shen, Linyuan; Xia, Yudong; Yang, Qiong; Li, Xuewei; Tang, Guoqing; Jiang, Yanzhi; Wang, Jinyong; Li, Mingzhou; Zhu, Li

    2016-01-01

    Obese and lean type pig breeds exhibit differences in their fat deposits and fatty acid composition. Here, we compared the effect of genome-wide DNA methylation on fatty acid metabolism between Landrace pigs (LP, leaner) and Rongchang pigs (RP, fatty). We found that LP backfat (LBF) had a higher polyunsaturated fatty acid content but a lower adipocyte volume than RP backfat (RBF). LBF exhibited higher global DNA methylation levels at the genome level than RBF. A total of 483 differentially methylated regions (DMRs) were located in promoter regions, mainly affecting olfactory and sensory activity and lipid metabolism. In LBF, the promoters of genes related to ATPase activity had significantly stronger methylation. This fact may suggest lower energy metabolism levels, which may result in less efficient lipid synthesis in LBF. Furthermore, we identified a DMR in the miR-4335 and miR-378 promoters and validated their methylation status by bisulfite sequencing PCR. The hypermethylation of the promoters of miR-4335 and miR-378 in LBF and the resulting silencing of the target genes may result in LBF’s low content in saturated fatty acids and fat deposition capacity. This study provides a solid basis for exploring the epigenetic mechanisms affecting fat deposition and fatty acid composition. PMID:27721392

  2. Effect of different preservation processes on chemical composition and fatty acid profile of anchovy (Engraulis anchoita).

    PubMed

    Czerner, Marina; Agustinelli, Silvina P; Guccione, Silvana; Yeannes, María I

    2015-01-01

    The effects of salting-ripening, canning and marinating processes on chemical composition and fatty acid profile of anchovy (Engraulis anchoita) were evaluated (p = 0.01), with emphasis on long-chain polyunsaturated fatty acids. Fresh anchovy showed a high proportion of PUFAs (∼45 g/100 g total lipid) with an eicosapentaenoic (EPA) + docosahexaenoic (DHA) content of 27.08 g/100 g total lipid. The salting-ripening process led to the largest changes in the chemical composition and the fatty acid profile, which resulted in a reduction of ∼70% on the total EPA and DHA contents (g/100 g edible portion). Contrary, canned and marinated anchovy presented a fatty acid profile similar to that of fresh anchovy. The use of vegetable oil as covering liquid led to final products with increased ω-6 PUFAs content. Despite the modifications observed, the total amount of essential EPA and DHA fatty acids provided by these products remained high compared with values reported in literature for other foods. PMID:26576657

  3. Physicochemical analysis of Psophocarpus tetragonolobus (L.) DC seeds with fatty acids and total lipids compositions.

    PubMed

    Mohanty, Chandra Sekhar; Pradhan, Rama Chandra; Singh, Vinayak; Singh, Neha; Pattanayak, Rojalin; Prakash, Om; Chanotiya, Chandan Singh; Rout, Prasant Kumar

    2015-06-01

    Psophocarpus tetragonolobus (L.) DC. is a tropical legume with potential nutritional properties. In present study, the physical properties and proximate composition of the seeds were evaluated. Besides, the physico-chemical properties of fatty oil from fully mature seeds were also studied. The fatty oil compositions of immature, mature and fully mature seeds were evaluated by GC-FID, GC/MS and (1)H-NMR. The study revealed that, fatty oil from fully mature seeds contained high proportion of unsaturated fatty acids (75.5 %), whereas immature seeds contained higher percentage of saturated fatty acid (61.3 %). In addition, unsaponification matter (0.25 %) of fatty oil was identified as stigmasterol (66.4 %) and β-sitosterol (25.1 %). Total lipids of fully mature seeds were extracted and isolated as neutral, glyco- and phospholipids. Overall, the fatty oil of fully mature seeds was enriched with mono-unsaturated fatty acids (38.6 %) and poly-unsaturated fatty acids (36.9 %) without trans-fatty acids, thus meeting the edible oil standard.

  4. Effect of different preservation processes on chemical composition and fatty acid profile of anchovy (Engraulis anchoita).

    PubMed

    Czerner, Marina; Agustinelli, Silvina P; Guccione, Silvana; Yeannes, María I

    2015-01-01

    The effects of salting-ripening, canning and marinating processes on chemical composition and fatty acid profile of anchovy (Engraulis anchoita) were evaluated (p = 0.01), with emphasis on long-chain polyunsaturated fatty acids. Fresh anchovy showed a high proportion of PUFAs (∼45 g/100 g total lipid) with an eicosapentaenoic (EPA) + docosahexaenoic (DHA) content of 27.08 g/100 g total lipid. The salting-ripening process led to the largest changes in the chemical composition and the fatty acid profile, which resulted in a reduction of ∼70% on the total EPA and DHA contents (g/100 g edible portion). Contrary, canned and marinated anchovy presented a fatty acid profile similar to that of fresh anchovy. The use of vegetable oil as covering liquid led to final products with increased ω-6 PUFAs content. Despite the modifications observed, the total amount of essential EPA and DHA fatty acids provided by these products remained high compared with values reported in literature for other foods.

  5. [Amino acid composition of the rat quadriceps femoris muscle after a flight on the Kosmos-936 biosatellite].

    PubMed

    Vlasova, T F; Miroshnikova, E B; Poliakov, V V; Murugova, T P

    1982-01-01

    The amino acid composition of the quadriceps muscle of rats flown onboard the biosatellite Cosmos-936 and exposed to the ground-based synchronous control experiment was studied. The weightless rats showed changes in the amino acid concentration in the quadriceps muscle. The centrifuged flight and synchronous rats displayed an accumulation of free amino acids in the above muscle.

  6. Effect of fermentation and subsequent pasteurization processes on amino acids composition of orange juice.

    PubMed

    Cerrillo, I; Fernández-Pachón, M S; Collado-González, J; Escudero-López, B; Berná, G; Herrero-Martín, G; Martín, F; Ferreres, F; Gil-Izquierdo, A

    2015-06-01

    The fermentation of fruit produces significant changes in their nutritional composition. An orange beverage has been obtained from the controlled alcoholic fermentation and thermal pasteurization of orange juice. A study was performed to determine the influence of both processes on its amino acid profile. UHPLC-QqQ-MS/MS was used for the first time for analysis of orange juice samples. Out of 29 amino acids and derivatives identified, eight (ethanolamine, ornithine, phosphoethanolamine, α-amino-n-butyric acid, hydroxyproline, methylhistidine, citrulline, and cystathionine) have not previously been detected in orange juice. The amino acid profile of the orange juice was not modified by its processing, but total amino acid content of the juice (8194 mg/L) was significantly increased at 9 days of fermentation (13,324 mg/L). Although the pasteurization process produced partial amino acid degradation, the total amino acid content was higher in the final product (9265 mg/L) than in the original juice, enhancing its nutritional value.

  7. Effect of growth phase on the fatty acid compositions of four species of marine diatoms

    NASA Astrophysics Data System (ADS)

    Liang, Ying; Mai, Kangsen

    2005-04-01

    The fatty acid compositions of four species of marine diatoms ( Chaetoceros gracilis MACC/B13, Cylindrotheca fusiformis MACC/B211, Phaeodactylum tricornutum MACC/B221 and Nitzschia closterium MACC/B222), cultivated at 22°C±1°C with the salinity of 28 in f/2 medium and harvested in the exponential growth phase, the early stationary phase and the late stationary phase, were determined. The results showed that growth phase has significant effect on most fatty acid contents in the four species of marine diatoms. The proportions of 16:0 and 16:1n-7 fatty acids increased while those of 16:3n-4 and eicosapentaenoic acid (EPA) decreased with increasing culture age in all species studied. The subtotal of saturated fatty acids (SFA) increased with the increasing culture age in all species with the exception of B13. The subtotal of monounsaturated fatty acids (MUFA) increased while that of polyunsaturated fatty acids (PUFA) decreased with culture age in the four species of marine diatoms. MUFA reached their lowest value in the exponential growth phase, whereas PUFA reached their highest value in the same phase.

  8. Fatty acid and carotenoid composition of gac (Momordica cochinchinensis Spreng) fruit.

    PubMed

    Ishida, Betty K; Turner, Charlotta; Chapman, Mary H; McKeon, Thomas A

    2004-01-28

    In this study, we analyzed fatty acid and carotenoid composition of fruit tissues, including seed (which are surrounded by a bright red, oily aril) of Momordica cochinchinensis Spreng, known as gac in Vietnam. Carotenoid content was analyzed by reversed-phase HPLC, using a C(30) column and a method separating cis- and trans-isomers of the major carotenoids in this fruit. Mean values obtained in aril tissues were 1342 microg trans-, 204 microg cis-, and 2227 microg total lycopene; 597 microg trans-, 39 microg cis-, and 718 microg total beta-carotene; and 107 microg alpha-carotene/g FW. Mesocarp contained 11 microg trans-, 5 microg cis-beta-carotene/g FW, trace amounts of alpha-carotene, and no lycopene. Gac aril contained 22% fatty acids by weight, composed of 32% oleic, 29% palmitic, and 28% linoleic acids. Seeds contained primarily stearic acid (60.5%), smaller amounts of linoleic (20%), oleic (9%), and palmitic (5-6%) acids, and trace amounts of arachidic, cis-vaccenic, linolenic, and palmitoleic, eicosa-11-enoic acids, and eicosa-13-enoic (in one fruit only) acids. PMID:14733508

  9. Fatty acid and carotenoid composition of gac (Momordica cochinchinensis Spreng) fruit.

    PubMed

    Ishida, Betty K; Turner, Charlotta; Chapman, Mary H; McKeon, Thomas A

    2004-01-28

    In this study, we analyzed fatty acid and carotenoid composition of fruit tissues, including seed (which are surrounded by a bright red, oily aril) of Momordica cochinchinensis Spreng, known as gac in Vietnam. Carotenoid content was analyzed by reversed-phase HPLC, using a C(30) column and a method separating cis- and trans-isomers of the major carotenoids in this fruit. Mean values obtained in aril tissues were 1342 microg trans-, 204 microg cis-, and 2227 microg total lycopene; 597 microg trans-, 39 microg cis-, and 718 microg total beta-carotene; and 107 microg alpha-carotene/g FW. Mesocarp contained 11 microg trans-, 5 microg cis-beta-carotene/g FW, trace amounts of alpha-carotene, and no lycopene. Gac aril contained 22% fatty acids by weight, composed of 32% oleic, 29% palmitic, and 28% linoleic acids. Seeds contained primarily stearic acid (60.5%), smaller amounts of linoleic (20%), oleic (9%), and palmitic (5-6%) acids, and trace amounts of arachidic, cis-vaccenic, linolenic, and palmitoleic, eicosa-11-enoic acids, and eicosa-13-enoic (in one fruit only) acids.

  10. First-order kinetics analysis of monomer composition dependent polyhydroxyalkanoic acid degradation in Pseudomonas spp.

    PubMed

    Choi, Mun Hwan; Rho, Jong Kook; Lee, Ho-Joo; Song, Jae Jun; Yoon, Sung Chul; Lee, Sang Yeol

    2003-01-01

    The intracellular degradation of polyhydroxyalkanoic acid (PHA) in pseudomonads was investigated by first-order kinetics analysis using the initial rate method. One type of PHA was accumulated in five Pseudomonas spp., P. oleovorans, P. aeruginosa, P. fluorescens, P. citronellolis, and P. putida, by growing them on octanoic acid. The monomer compositions of the five PHA were not significantly different from one another: 85-90 mol % 3-hydroxyoctanoic acid (3HO), 7-12 mol % 3-hydorxycaproic acid (3HC), and 3-6 mol % 3-hydroxydecanoic acid (3HD). The first-order degradation rate constants (k(1)) for the octanoate-derived PHA (designated P(3HO)) in the five species were in a similar range between 0.060 and 0.088 h(-1). This may indicate the similar specificities of the five intracellular depolymerases. In addition, the similar k(1) among the different species may correlate with the high degree of amino acid sequence identities (over 85%) among the intracellular PHA depolymerase phaZ genes. Six other chemically different types of PHA were accumulated in P. putida from n-nonanoic acid, n-decanoic acid, 5-phenyvaleric acid, or 11-phenoxyundecanoic acid as a single or a mixed carbon source. The calculated k(1) values were characteristic to each PHA, reflecting their chemical structures. In comparison with P(3HO), an increase in the levels of the two minor monomers 3HC and 3HD as in P(21 mol % 3HC-co-56 mol % 3HO-co-23 mol % 3HD) significantly slowed the rate of intracellular degradation. From the comparison of k(1) values, it is suggested that the P. putida intracellular depolymerase is most active against P(3HO). PMID:12625741

  11. Abnormalities in the fatty-acid composition of the serum phospholipids of stroke patients.

    PubMed Central

    Glew, Robert H.; Okolie, Henry; Huang, Yung-Sheng; Chuang, Lu-Te; Suberu, Ojo; Crossey, Michael; VanderJagt, Dorothy J.

    2004-01-01

    The incidence of cardiovascular diseases, stroke, and myocardial infarction is increasing in sub-Saharan Africa. Since dietary polyunsaturated fatty acids (PUFA) are protective of the cardiovascular system in humans, we were interested in the question of the PUFA status of adults in northern Nigeria who had experienced a recent stroke. We collected blood from 21 consecutive admissions for stroke (15 male patients, mean age 39.3 years and six females, mean age 40.7 years) to the Federal Medical Centre in Gombe, Nigeria and analyzed the fatty-acid composition of the serum phospholipids. Blood was collected from 30 healthy controls for comparison. The contribution palmitic acid made to the fatty-acid total was greatly decreased in the phospholipids of the stroke patients (29.2% versus 37.2 %, p < 0.001). However, the phospholipids of the stroke patients had significantly higher percentages of 20-, 22-, and 24-carbon saturated fatty acids, as well as higher proportions of the omega-6 fatty-acid, arachidonic acid (11.4 versus 8.14%, p < 0.001), and the omega-3 fatty-acid, docosahexaenoic acid (3.21 versus 1.80%, p < 0.001). Using the percentages and melting points of the individual fatty acids, we estimated that the acyl chains of the serum phospholipids of the stroke patients had a lower mean melting point than the controls (27.8 versus 34.6 degrees C, p < 0.001). Assuming that serum phospholipids are surrogates for tissue phospholipids, we conclude that the tissue membranes of the stroke patients may be considerably more fluid than those of the controls. PMID:15233494

  12. Conjugated linoleic acid alters growth performance, tissue lipid deposition, and fatty acid composition of darkbarbel catfish (Pelteobagrus vachelli).

    PubMed

    Dong, Gui-Fang; Liu, Wen-Zuo; Wu, Lin-Zhou; Yu, Deng-Hang; Huang, Feng; Li, Peng-Cheng; Yang, Yan-Ou

    2015-02-01

    Fatty liver syndrome is a prevalent problem of farmed fish. Conjugated linoleic acid (CLA) has received increased attention recently as a fat-reducing fatty acid to control fat deposition in mammals. Therefore, the aim of the present study was to determine whether dietary CLA can reduce tissue lipid content of darkbarbel catfish (Pelteobagrus vachelli) and whether decreased lipid content is partially due to alterations in lipid metabolism enzyme activities and fatty acid profiles. A 76-day feeding trial was conducted to investigate the effect of dietary CLA on the growth, tissue lipid deposition, and fatty acid composition of darkbarbel catfish. Five diets containing 0 % (control), 0.5 % (CLA0.5), 1 % (CLA1), 2 % (CLA2), and 3 % (CLA3) CLA levels were evaluated. Results showed that fish fed with 2-3 % CLA diets showed a significantly lower specific growth rate and feed conversion efficiency than those fed with the control diet. Dietary CLA decreased the lipid contents in the liver and intraperitoneal fat with the CLA levels from 1 to 3 %. Fish fed with 2-3 % CLA diets showed significantly higher lipoprotein lipase and hepatic triacylglycerol lipase activities in liver than those of fish fed with the control, and fish fed with 1-3 % CLA diets had significantly higher pancreatic triacylglycerol lipase activities in liver than those of fish fed with the control. Dietary CLA was incorporated into liver, intraperitoneal fat, and muscle lipids, with higher percentages observed in liver compared with other tissues. Liver CLA deposition was at the expense of monounsaturated fatty acids (MUFA). In contrast, CLA deposition appeared to be primarily at the expense of MUFA and n-3 polyunsaturated fatty acids (PUFA) in the intraperitoneal fat, whereas in muscle it was at the expense of n-3 PUFA. Our results suggested that CLA at a 1 % dose can reduce liver lipid content without eliciting any negative effect on growth rate in darkbarbel catfish. This lipid-lowering effect could

  13. Poly(L-lactic acid)/poly(glycolic acid) microfibrillar polymer-polymer composites: Preparation and viscoelastic properties

    NASA Astrophysics Data System (ADS)

    Kimble, L. D.; Fakirov, S.; Bhattacharyya, D.

    2015-05-01

    Microfibrillar composites (MFCs) from petrochemical-derived polymers have been investigated for several years and the technique can result in significant improvements in mechanical properties when compared with the neat matrix material of the respective composite. The current work applies the technique to biodegradable, biocompatible polymers for potential applications in bioabsorbable medical devices. MFCs were prepared from melt blended poly(L-lactic acid) (PLLA) and poly(glycolic acid) (PGA) via cold drawing then compression molding of extruded yarn. These MFCs were shown to have higher Young's moduli than that of neat PLLA but for load-bearing applications the creep characteristics are of interest. The MFC sheets resulting from compression mo