Sample records for additional mass transfer

  1. Examination of the Mass Transfer of Additive Elements in Barium Titanate Ceramics during Sintering Process by Laser Ablation ICP-MS.

    PubMed

    Sakate, Daisuke; Iwazaki, Yoshiki; Kon, Yoshiaki; Yokoyama, Takaomi; Ohata, Masaki

    2018-01-01

    The mass transfer of additive elements during the sintering of barium titanate (BaTiO 3 ) ceramic was examined by laser ablation inductively coupled plasma mass spectrometry (LA-ICP-MS) in the present study. An analytical sample consisting of two pellets of BaTiO 3 with different concentrations of additive elements of manganese (Mn) and holmium (Ho) as well as silicon (Si) as a sintering reagent was prepared and measured by LA-ICP-MS with small laser irradiated diameter of 10 μm to evaluate the distributions and concentrations of additive elements in order to examine their mass transfers. As results, enrichments of Mn and Si as an additive element and a sintering reagent, respectively, were observed on the adhesive surface between two BaTiO 3 pellets, even though Ho did not show a similar phenomenon. The mass transfers of additive elements of Mn and Ho were also examined, and Mn seemed to show a larger mass transfer than that of Ho during the sintering process for BaTiO 3 ceramics. The results obtained in this study shows the effectives of LA-ICP-MS for the future improvement of MLCCs.

  2. Electric propulsion for geostationary orbit insertion

    NASA Technical Reports Server (NTRS)

    Oleson, Steven R.; Curran, Francis M.; Myers, Roger M.

    1995-01-01

    Solar electric propulsion (SEP) technology is already being used for geostationary satellite stationkeeping to increase payload mass. By using this same technology to perform part of the orbit transfer additional increases in payload mass can be achieved. Advanced chemical and N2H4 arcjet systems are used to increase the payload mass by performing stationkeeping and part of the orbit transfer. Four mission options are analyzed which show the impact of either sharing the orbit transfer between chemical and SEP systems or having either complete the transfer alone. Results show that for an Atlas 2AS payload increases in net mass (geostationary satellite mass less wet propulsion system mass) of up to 100 kg can be achieved using advanced chemical for the transfer and advanced N2H4 arcjets for stationkeeping. An additional 100 kg can be added using advanced N2H4 arcjets for part of a 40 day orbit transfer.

  3. Ice Generation and the Heat and Mass Transfer Phenomena of Introducing Water to a Cold Bath of Brine.

    PubMed

    Yun, Xiao; Quarini, Giuseppe L

    2017-03-13

    We demonstrate a method for the study of the heat and mass transfer and of the freezing phenomena in a subcooled brine environment. Our experiment showed that, under the proper conditions, ice can be produced when water is introduced to a bath of cold brine. To make ice form, in addition to having the brine and water mix, the rate of heat transfer must bypass that of mass transfer. When water is introduced in the form of tiny droplets to the brine surface, the mode of heat and mass transfer is by diffusion. The buoyancy stops water from mixing with the brine underneath, but as the ice grows thicker, it slows down the rate of heat transfer, making ice more difficult to grow as a result. When water is introduced inside the brine in the form of a flow, a number of factors are found to influence how much ice can form. Brine temperature and concentration, which are the driving forces of heat and mass transfer, respectively, can affect the water-to-ice conversion ratio; lower bath temperatures and brine concentrations encourage more ice to form. The flow rheology, which can directly affect both the heat and mass transfer coefficients, is also a key factor. In addition, the flow rheology changes the area of contact of the flow with the bulk fluid.

  4. Formation of black hole x-ray binaries in globular clusters

    NASA Astrophysics Data System (ADS)

    Kremer, Kyle; Chatterjee, Sourav; Rodriguez, Carl; Rasio, Frederic

    2018-01-01

    We explore the formation of mass-transferring binary systems containing black holes within globular clusters. We show that it is possible to form mass-transferring binaries with main sequence, giant, and white dwarf companions with a variety of orbital parameters in globular clusters spanning a large range in present-day properties. We show that the presence of mass-transferring black hole systems has little correlation with the total number of black holes within the cluster at any time. In addition to mass-transferring binaries retained within their host clusters at late times, we also examine the black hole and neutron star binaries that are ejected from their host clusters. These ejected systems may contribute to the low-mass x-ray binary population in the galactic field.

  5. Investigation of mass transfer intensification under power ultrasound irradiation using 3D computational simulation: A comparative analysis.

    PubMed

    Sajjadi, Baharak; Asgharzadehahmadi, Seyedali; Asaithambi, Perumal; Raman, Abdul Aziz Abdul; Parthasarathy, Rajarathinam

    2017-01-01

    This paper aims at investigating the influence of acoustic streaming induced by low-frequency (24kHz) ultrasound irradiation on mass transfer in a two-phase system. The main objective is to discuss the possible mass transfer improvements under ultrasound irradiation. Three analyses were conducted: i) experimental analysis of mass transfer under ultrasound irradiation; ii) comparative analysis between the results of the ultrasound assisted mass transfer with that obtained from mechanically stirring; and iii) computational analysis of the systems using 3D CFD simulation. In the experimental part, the interactive effects of liquid rheological properties, ultrasound power and superficial gas velocity on mass transfer were investigated in two different sonicators. The results were then compared with that of mechanical stirring. In the computational part, the results were illustrated as a function of acoustic streaming behaviour, fluid flow pattern, gas/liquid volume fraction and turbulence in the two-phase system and finally the mass transfer coefficient was specified. It was found that additional turbulence created by ultrasound played the most important role on intensifying the mass transfer phenomena compared to that in stirred vessel. Furthermore, long residence time which depends on geometrical parameters is another key for mass transfer. The results obtained in the present study would help researchers understand the role of ultrasound as an energy source and acoustic streaming as one of the most important of ultrasound waves on intensifying gas-liquid mass transfer in a two-phase system and can be a breakthrough in the design procedure as no similar studies were found in the existing literature. Copyright © 2016. Published by Elsevier B.V.

  6. Influence of Wind Pressure on the Carbonation of Concrete

    PubMed Central

    Zou, Dujian; Liu, Tiejun; Du, Chengcheng; Teng, Jun

    2015-01-01

    Carbonation is one of the major deteriorations that accelerate steel corrosion in reinforced concrete structures. Many mathematical/numerical models of the carbonation process, primarily diffusion-reaction models, have been established to predict the carbonation depth. However, the mass transfer of carbon dioxide in porous concrete includes molecular diffusion and convection mass transfer. In particular, the convection mass transfer induced by pressure difference is called penetration mass transfer. This paper presents the influence of penetration mass transfer on the carbonation. A penetration-reaction carbonation model was constructed and validated by accelerated test results under high pressure. Then the characteristics of wind pressure on the carbonation were investigated through finite element analysis considering steady and fluctuating wind flows. The results indicate that the wind pressure on the surface of concrete buildings results in deeper carbonation depth than that just considering the diffusion of carbon dioxide. In addition, the influence of wind pressure on carbonation tends to increase significantly with carbonation depth. PMID:28793462

  7. Influence of Wind Pressure on the Carbonation of Concrete.

    PubMed

    Zou, Dujian; Liu, Tiejun; Du, Chengcheng; Teng, Jun

    2015-07-24

    Carbonation is one of the major deteriorations that accelerate steel corrosion in reinforced concrete structures. Many mathematical/numerical models of the carbonation process, primarily diffusion-reaction models, have been established to predict the carbonation depth. However, the mass transfer of carbon dioxide in porous concrete includes molecular diffusion and convection mass transfer. In particular, the convection mass transfer induced by pressure difference is called penetration mass transfer. This paper presents the influence of penetration mass transfer on the carbonation. A penetration-reaction carbonation model was constructed and validated by accelerated test results under high pressure. Then the characteristics of wind pressure on the carbonation were investigated through finite element analysis considering steady and fluctuating wind flows. The results indicate that the wind pressure on the surface of concrete buildings results in deeper carbonation depth than that just considering the diffusion of carbon dioxide. In addition, the influence of wind pressure on carbonation tends to increase significantly with carbonation depth.

  8. Effects of partial slip boundary condition and radiation on the heat and mass transfer of MHD-nanofluid flow

    NASA Astrophysics Data System (ADS)

    Abd Elazem, Nader Y.; Ebaid, Abdelhalim

    2017-12-01

    In this paper, the effect of partial slip boundary condition on the heat and mass transfer of the Cu-water and Ag-water nanofluids over a stretching sheet in the presence of magnetic field and radiation. Such partial slip boundary condition has attracted much attention due to its wide applications in industry and chemical engineering. The flow is basically governing by a system of partial differential equations which are reduced to a system of ordinary differential equations. This system has been exactly solved, where exact analytical expression has been obtained for the fluid velocity in terms of exponential function, while the temperature distribution, and the nanoparticles concentration are expressed in terms of the generalized incomplete gamma function. In addition, explicit formulae are also derived from the rates of heat transfer and mass transfer. The effects of the permanent parameters on the skin friction, heat transfer coefficient, rate of mass transfer, velocity, the temperature profile, and concentration profile have been discussed through tables and graphs.

  9. Incomplete mass transfer processes in 28Si +93Nb reaction

    NASA Astrophysics Data System (ADS)

    Tripathi, R.; Sodaye, S.; Ramachandran, K.; Sharma, S. K.; Pujari, P. K.

    Cross sections of reaction products were measured in 28Si +93Nb reaction using recoil catcher technique involving by off-line gamma-ray spectrometry at beam energies of 105 and 155MeV. At Elab = 155MeV, the contribution from different incomplete mass transfer processes is investigated. Results of the present studies show the contribution from deep inelastic collision (DIC), massive transfer or incomplete fusion (ICF) and quasi-elastic transfer (QET). The contribution from massive transfer reactions was confirmed from the fractional yield of the reaction products in the forward catcher foil. The present results are different from those from the reactions with comparatively higher entrance channel mass asymmetry with lighter projectiles, for which dominant transfer processes are ICF and QET which involve mass transfer predominantly from projectile to target. The N/Z values of the products close to the target mass were observed to be in a wide range, starting from N/Z of the target (93Nb) and extending slightly below the N/Z of the composite system, consistent with the contribution from DIC and QET reactions. At Elab = 105MeV, a small contribution from QET was observed in addition to complete fusion.

  10. Mass transfer effects in a gasification riser

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Breault, Ronald W.; Li, Tingwen; Nicoletti, Phillip

    2013-07-01

    In the development of multiphase reacting computational fluid dynamics (CFD) codes, a number of simplifications were incorporated into the codes and models. One of these simplifications was the use of a simplistic mass transfer correlation for the faster reactions and omission of mass transfer effects completely on the moderate speed and slow speed reactions such as those in a fluidized bed gasifier. Another problem that has propagated is that the mass transfer correlation used in the codes is not universal and is being used far from its developed bubbling fluidized bed regime when applied to circulating fluidized bed (CFB) risermore » reactors. These problems are true for the major CFD codes. To alleviate this problem, a mechanistic based mass transfer coefficient algorithm has been developed based upon an earlier work by Breault et al. This fundamental approach uses the local hydrodynamics to predict a local, time varying mass transfer coefficient. The predicted mass transfer coefficients and the corresponding Sherwood numbers agree well with literature data and are typically about an order of magnitude lower than the correlation noted above. The incorporation of the new mass transfer model gives the expected behavior for all the gasification reactions evaluated in the paper. At the expected and typical design values for the solid flow rate in a CFB riser gasifier an ANOVA analysis has shown the predictions from the new code to be significantly different from the original code predictions. The new algorithm should be used such that the conversions are not over predicted. Additionally, its behaviors with changes in solid flow rate are consistent with the changes in the hydrodynamics.« less

  11. Advanced Propulsion for Geostationary Orbit Insertion and North-South Station Keeping

    NASA Technical Reports Server (NTRS)

    Oleson, Steven R.; Myers, Roger M.; Kluever, Craig A.; Riehl, John P.; Curran, Francis M.

    1995-01-01

    Solar electric propulsion (SEP) technology is currently being used for geostationary satellite station keeping to increase payload mass. Analyses show that advanced electric propulsion technologies can be used to obtain additional increases in payload mass by using these same technologies to perform part of the orbit transfer. In this work three electric propulsion technologies are examined at two power levels for an Atlas 2AS class spacecraft. The on-board chemical propulsion apogee engine fuel is reduced to allow the use of electric propulsion. A numerical optimizer is used to determine the chemical burns which will minimize the electric propulsion transfer time. Results show that for a 1550 kg Atlas 2AS class payload, increases in net mass (geostationary satellite mass less wet propulsion system mass) of 150 to 800 kg are possible using electric propulsion for station keeping, advanced chemical engines for part of the transfer, and electric propulsion for the remainder of the transfer. Trip times are between one and four months.

  12. Bioturbation and dissolved organic matter enhance contaminant fluxes from sediment treated with powdered and granular activated carbon.

    PubMed

    Kupryianchyk, D; Noori, A; Rakowska, M I; Grotenhuis, J T C; Koelmans, A A

    2013-05-21

    Sediment amendment with activated carbon (AC) is a promising technique for in situ sediment remediation. To date it is not clear whether this technique sufficiently reduces sediment-to-water fluxes of sediment-bound hydrophobic organic chemicals (HOCs) in the presence of bioturbators. Here, we report polychlorobiphenyl (PCB) pore water concentrations, fluxes, mass transfer coefficients, and survival data of two benthic species, for four treatments: no AC addition (control), powdered AC addition, granular AC addition and addition and subsequent removal of GAC (sediment stripping). AC addition decreased mass fluxes but increased apparent mass transfer coefficients because of dissolved organic carbon (DOC) facilitated transport across the benthic boundary layer (BBL). In turn, DOC concentrations depended on bioturbator activity which was high for the PAC tolerant species Asellus aquaticus and low for AC sensitive species Lumbriculus variegatus. A dual BBL resistance model combining AC effects on gradients, DOC facilitated transport and biodiffusion was evaluated against the data and showed how the type of resistance differs with treatment and chemical hydrophobicity. Data and simulations illustrate the complex interplay between AC and contaminant toxicity to benthic organisms and how differences in species tolerance affect mass fluxes from sediment to the water column.

  13. Dynamic Mass Transfer of Hemoglobin at the Aqueous/Ionic-Liquid Interface Monitored with Liquid Core Optical Waveguide.

    PubMed

    Chen, Xuwei; Yang, Xu; Zeng, Wanying; Wang, Jianhua

    2015-08-04

    Protein transfer from aqueous medium into ionic liquid is an important approach for the isolation of proteins of interest from complex biological samples. We hereby report a solid-cladding/liquid-core/liquid-cladding sandwich optical waveguide system for the purpose of monitoring the dynamic mass-transfer behaviors of hemoglobin (Hb) at the aqueous/ionic liquid interface. The optical waveguide system is fabricated by using a hydrophobic IL (1,3-dibutylimidazolium hexafluorophosphate, BBimPF6) as the core, and protein solution as one of the cladding layer. UV-vis spectra are recorded with a CCD spectrophotometer via optical fibers. The recorded spectra suggest that the mass transfer of Hb molecules between the aqueous and ionic liquid media involve accumulation of Hb on the aqueous/IL interface followed by dynamic extraction/transfer of Hb into the ionic liquid phase. A part of Hb molecules remain at the interface even after the accomplishment of the extraction/transfer process. Further investigations indicate that the mass transfer of Hb from aqueous medium into the ionic liquid phase is mainly driven by the coordination interaction between heme group of Hb and the cationic moiety of ionic liquid, for example, imidazolium cation in this particular case. In addition, hydrophobic interactions also contribute to the transfer of Hb.

  14. Energy transfer and energy absorption in photon interactions with matter revisited: A step-by-step illustrated approach

    NASA Astrophysics Data System (ADS)

    Abdel-Rahman, W.; Podgorsak, E. B.

    2010-05-01

    A clear understanding of energy transfer and energy absorption in photon interactions with matter is essential for the understanding of radiation dosimetry and development of new dosimetry techniques. The concepts behind the two quantities have been enunciated many years ago and described in many scientific papers, review articles, and textbooks. Data dealing with energy transfer and energy absorption as well as the associated mass energy transfer coefficient and the mass energy absorption coefficient are readily available in web-based tabular forms. However, tables, even when available in detailed and easy to access form, do not lend themselves to serve as visual aid to promote better understanding of the dosimetric quantities related to energy transfer and energy absorption as well as their relationship to the photon energy and absorber atomic number. This paper uses graphs and illustrations, in addition to well-known mathematical relationships, to guide the reader in a systematic manner through the various stages involved in the derivation of energy absorbed in medium and its associated quantity, the mass energy absorption coefficient, from the mass attenuation coefficient.

  15. Blue straggler stars: lessons from open clusters.

    NASA Astrophysics Data System (ADS)

    Geller, Aaron M.

    Open clusters enable a deep dive into blue straggler characteristics. Recent work shows that the binary properties (frequency, orbital elements and companion masses and evolutionary states) of the blue stragglers are the most important diagnostic for determining their origins. To date the multi-epoch radial-velocity observations necessary for characterizing these blue straggler binaries have only been carried out in open clusters. In this paper, I highlight recent results in the open clusters NGC 188, NGC 2682 (M67) and NGC 6819. The characteristics of many of the blue stragglers in these open clusters point directly to origins through mass transfer from an evolved donor star. Additionally, a handful of blue stragglers show clear signatures of past dynamical encounters. These comprehensive, diverse and detailed observations also reveal important challenges for blue straggler formation models (and particularly the mass-transfer channel), which we must overcome to fully understand the origins of blue straggler stars and other mass-transfer products.

  16. Optimal orbit transfer suitable for large flexible structures

    NASA Technical Reports Server (NTRS)

    Chatterjee, Alok K.

    1989-01-01

    The problem of continuous low-thrust planar orbit transfer of large flexible structures is formulated as an optimal control problem with terminal state constraints. The dynamics of the spacecraft motion are treated as a point-mass central force field problem; the thrust-acceleration magnitude is treated as an additional state variable; and the rate of change of thrust-acceleration is treated as a control variable. To ensure smooth transfer, essential for flexible structures, an additional quadratic term is appended to the time cost functional. This term penalizes any abrupt change in acceleration. Numerical results are presented for the special case of a planar transfer.

  17. Irradiation and Enhanced Magnetic Braking in Cataclysmic Variables

    NASA Astrophysics Data System (ADS)

    McCormick, P. J.; Frank, J.

    1998-12-01

    In previous work we have shown that irradiation driven mass transfer cycles can occur in cataclysmic variables at all orbital periods if an additional angular momentum loss mechanism is assumed. Earlier models simply postulated that the enhanced angular momentum loss was proportional to the mass transfer rate without any specific physical model. In this paper we present a simple modification of magnetic braking which seems to have the right properties to sustain irradiation driven cycles at all orbital periods. We assume that the wind mass loss from the irradiated companion consists of two parts: an intrinsic stellar wind term plus an enhancement that is proportional to the irradiation. The increase in mass flow reduces the specific angular momentum carried away by the flow but nevertheless yields an enhanced rate of magnetic braking. The secular evolution of the binary is then computed numerically with a suitably modified double polytropic code (McCormick & Frank 1998). With the above model and under certain conditions, mass transfer oscillations occur at all orbital periods.

  18. Additive Manufacturing of Catalyst Substrates for Steam-Methane Reforming

    NASA Astrophysics Data System (ADS)

    Kramer, Michelle; McKelvie, Millie; Watson, Matthew

    2018-01-01

    Steam-methane reforming is a highly endothermic reaction, which is carried out at temperatures up to 1100 °C and pressures up to 3000 kPa, typically with a Ni-based catalyst distributed over a substrate of discrete alumina pellets or beads. Standard pellet geometries (spheres, hollow cylinders) limit the degree of mass transfer between gaseous reactants and catalyst. Further, heat is supplied to the exterior of the reactor wall, and heat transfer is limited due to the nature of point contacts between the reactor wall and the substrate pellets. This limits the degree to which the process can be intensified, as well as limiting the diameter of the reactor wall. Additive manufacturing now gives us the capability to design structures with tailored heat and mass transfer properties, not only within the packed bed of the reactor, but also at the interface between the reactor wall and the packed bed. In this work, the use of additive manufacturing to produce monolithic-structured catalyst substrate models, made from acrylonitrile-butadiene-styrene, with enhanced conductive heat transfer is described. By integrating the reactor wall into the catalyst substrate structure, the effective thermal conductivity increased by 34% from 0.122 to 0.164 W/(m K).

  19. Boeing Low-Thrust Geosynchronous Transfer Mission Experience

    NASA Technical Reports Server (NTRS)

    Poole, Mark; Ho, Monte

    2007-01-01

    Since 2000, Boeing 702 satellites have used electric propulsion for transfer to geostationary orbits. The use of the 25cm Xenon Ion Propulsion System (25cm XIPS) results in more than a tenfold increase in specific impulse with the corresponding decrease in propellant mass needed to complete the mission when compared to chemical propulsion[1]. In addition to more favorable mass properties, with the use of XIPS, the 702 has been able to achieve orbit insertions with higher accuracy than it would have been possible with the use of chemical thrusters. This paper describes the experience attained by using the 702 XIPS ascent strategy to transfer satellite to geosynchronous orbits.

  20. Modeling CO2 mass transfer in amine mixtures: PZ-AMP and PZ-MDEA.

    PubMed

    Puxty, Graeme; Rowland, Robert

    2011-03-15

    The most common method of carbon dioxide (CO(2)) capture is the absorption of CO(2) into a falling thin film of an aqueous amine solution. Modeling of mass transfer during CO(2) absorption is an important way to gain insight and understanding about the underlying processes that are occurring. In this work a new software tool has been used to model CO(2) absorption into aqueous piperazine (PZ) and binary mixtures of PZ with 2-amino-2-methyl-1-propanol (AMP) or methyldiethanolamine (MDEA). The tool solves partial differential and simultaneous equations describing diffusion and chemical reaction automatically derived from reactions written using chemical notation. It has been demonstrated that by using reactions that are chemically plausible the mass transfer in binary mixtures can be fully described by combining the chemical reactions and their associated parameters determined for single amines. The observed enhanced mass transfer in binary mixtures can be explained through chemical interactions occurring in the mixture without need to resort to using additional reactions or unusual transport phenomena such as the "shuttle mechanism".

  1. Simultaneous estimation of local-scale and flow path-scale dual-domain mass transfer parameters using geoelectrical monitoring

    USGS Publications Warehouse

    Briggs, Martin A.; Day-Lewis, Frederick D.; Ong, John B.; Curtis, Gary P.; Lane, John W.

    2013-01-01

    Anomalous solute transport, modeled as rate-limited mass transfer, has an observable geoelectrical signature that can be exploited to infer the controlling parameters. Previous experiments indicate the combination of time-lapse geoelectrical and fluid conductivity measurements collected during ionic tracer experiments provides valuable insight into the exchange of solute between mobile and immobile porosity. Here, we use geoelectrical measurements to monitor tracer experiments at a former uranium mill tailings site in Naturita, Colorado. We use nonlinear regression to calibrate dual-domain mass transfer solute-transport models to field data. This method differs from previous approaches by calibrating the model simultaneously to observed fluid conductivity and geoelectrical tracer signals using two parameter scales: effective parameters for the flow path upgradient of the monitoring point and the parameters local to the monitoring point. We use regression statistics to rigorously evaluate the information content and sensitivity of fluid conductivity and geophysical data, demonstrating multiple scales of mass transfer parameters can simultaneously be estimated. Our results show, for the first time, field-scale spatial variability of mass transfer parameters (i.e., exchange-rate coefficient, porosity) between local and upgradient effective parameters; hence our approach provides insight into spatial variability and scaling behavior. Additional synthetic modeling is used to evaluate the scope of applicability of our approach, indicating greater range than earlier work using temporal moments and a Lagrangian-based Damköhler number. The introduced Eulerian-based Damköhler is useful for estimating tracer injection duration needed to evaluate mass transfer exchange rates that range over several orders of magnitude.

  2. Analysis of mass transfer characteristics in a tubular membrane using CFD modeling.

    PubMed

    Yang, Jixiang; Vedantam, Sreepriya; Spanjers, Henri; Nopens, Ingmar; van Lier, Jules B

    2012-10-01

    In contrast to the large amount of research into aerobic membrane bioreactors, little work has been reported on anaerobic membrane bioreactors (AMBRs). As to the application of membrane bioreactors, membrane fouling is a key issue. Membrane fouling generally occurs more seriously in AMBRs than in aerobic membrane bioreactors. However, membrane fouling could be managed through the application of suitable shear stress that can be introduced by the application of a two-phase flow. When the two-phase flow is applied in AMBRs, little is known about the mass transfer characteristics, which is of particular importance, in tubular membranes of AMBRs. In our present work, we have employed fluid dynamic modeling to analyze the mass transfer characteristics in the tubular membrane of a side stream AMBR in which, gas-lift two-phase flow was applied. The modeling indicated that the mass transfer capacity at the membrane surface at the noses of gas bubbles was higher than the mass transfer capacity at the tails of the bubbles, which is in contrast to the results when water instead of sludge is applied. At the given mass transfer rate, the filterability of the sludge was found to have a strong influence on the transmembrane pressure at a steady flux. In addition, the model also showed that the shear stress in the internal space of the tubular membrane was mainly around 20 Pa but could be as high as about 40 Pa due to gas bubble movements. Nonetheless, at these shear stresses a stable particle size distribution was found for sludge particles. Copyright © 2012 Elsevier Ltd. All rights reserved.

  3. Gas diffusion electrodes improve hydrogen gas mass transfer for a hydrogen oxidizing bioanode

    PubMed Central

    Rodenas, Pau; Zhu, Fangqi; Sleutels, Tom; Saakes, Michel; Buisman, Cees

    2017-01-01

    Abstract Background Bioelectrochemical systems (BESs) are capable of recovery of metals at a cathode through oxidation of organic substrate at an anode. Recently, also hydrogen gas was used as an electron donor for recovery of copper in BESs. Oxidation of hydrogen gas produced a current density of 0.8 A m‐2 and combined with Cu2+ reduction at the cathode, produced 0.25 W m‐2. The main factor limiting current production was the mass transfer of hydrogen to the biofilm due to the low solubility of hydrogen in the anolyte. Here, the mass transfer of hydrogen gas to the bioanode was improved by use of a gas diffusion electrode (GDE). Results With the GDE, hydrogen was oxidized to produce a current density of 2.9 A m‐2 at an anode potential of –0.2 V. Addition of bicarbonate to the influent led to production of acetate, in addition to current. At a bicarbonate concentration of 50 mmol L‐1, current density increased to 10.7 A m‐2 at an anode potential of –0.2 V. This increase in current density could be due to oxidation of formed acetate in addition to oxidation of hydrogen, or enhanced growth of hydrogen oxidizing bacteria due to the availability of acetate as carbon source. The effect of mass transfer was further assessed through enhanced mixing and in combination with the addition of bicarbonate (50 mmol L‐1) current density increased further to 17.1 A m‐2. Conclusion Hydrogen gas may offer opportunities as electron donor for bioanodes, with acetate as potential intermediate, at locations where excess hydrogen and no organics are available. © 2017 The Authors. Journal of Chemical Technology & Biotechnology published by John Wiley & Sons Ltd on behalf of Society of Chemical Industry. PMID:29200586

  4. Prediction of Heat and Mass Transfer in a Rotating Ribbed Coolant Passage With a 180 Degree Turn

    NASA Technical Reports Server (NTRS)

    Rigby, David L.

    1999-01-01

    Numerical results are presented for flow in a rotating internal passage with a 180 degree turn and ribbed walls. Reynolds numbers ranging from 5200 to 7900, and Rotation numbers of 0.0 and 0.24 were considered. The straight sections of the channel have a square cross section, with square ribs spaced one hydraulic diameter (D) apart on two opposite sides. The ribs have a height of 0.1D and are not staggered from one side to the other. The full three dimensional Reynolds Averaged Navier-Stokes equations are solved combined with the Wilcox k-omega turbulence model. By solving an additional equation for mass transfer, it is possible to isolate the effect of buoyancy in the presence of rotation. That is, heat transfer induced buoyancy effects can be eliminated as in naphthalene sublimation experiments. Heat transfer, mass transfer and flow field results are presented with favorable agreement with available experimental data. It is shown that numerically predicting the reattachment between ribs is essential to achieving an accurate prediction of heat/mass transfer. For the low Reynolds numbers considered, the standard turbulence model did not produce reattachment between ribs. By modifying the wall boundary condition on omega, the turbulent specific dissipation rate, much better agreement with the flow structure and heat/ mass transfer was achieved. It is beyond the scope of the present work to make a general recommendation on the omega wall boundary condition. However, the present results suggest that the omega boundary condition should take into account the proximity to abrupt changes in geometry.

  5. Sorption-induced effects of humic substances on mass transfer of organic pollutants through aqueous diffusion boundary layers: the example of water/air exchange.

    PubMed

    Ramus, Ksenia; Kopinke, Frank-Dieter; Georgi, Anett

    2012-02-21

    This study examines the effect of dissolved humic substances (DHS) on the rate of water-gas exchange of organic compounds under conditions where diffusion through the aqueous boundary layer is rate-determining. A synthetic surfactant was applied for comparison. Mass-transfer coefficients were determined from the rate of depletion of the model compounds by means of an apparatus containing a stirred aqueous solution with continuous purging of the headspace above the solution. In addition, experiments with continuous passive dosing of analytes into the water phase were conducted to simulate a system where thermodynamic activity of the chemical in the aqueous phase is identical in the presence and absence of DHS. The experimental results show that DHS and surfactants can affect water-gas exchange rates by the superposition of two mechanisms: (1) hydrodynamic effects due to surface film formation ("surface smoothing"), and (2) sorption-induced effects. Whether sorption accelerates or retards mass transfer depends on its effect on the thermodynamic activity of the pollutant in the aqueous phase. Mass transfer will be retarded if the activity (or freely dissolved concentration) of the pollutant is decreased due to sorption. If it remains unchanged (e.g., due to fast equilibration with a sediment acting as a large source phase), then DHS and surfactant micelles can act as an additional shuttle for the pollutants, enhancing the flux through the boundary layer.

  6. Sidestream superoxygenation for wastewater treatment: Oxygen transfer in clean water and mixed liquor.

    PubMed

    Barreto, Carlos M; Ochoa, Ivania M; Garcia, Hector A; Hooijmans, Christine M; Livingston, Dennis; Herrera, Aridai; Brdjanovic, Damir

    2018-08-01

    The performance of a pilot-scale superoxygenation system was evaluated in clean water and mixed liquor. A mass balance was applied over the pilot-scale system to determine the overall oxygen mass transfer rate coefficient (K L a, h -1 ), the standard oxygen transfer rate (SOTR, kg O 2 d -1 ), and the standard oxygen transfer efficiency (SOTE, %). Additionally, the alpha factor (α) was determined at a mixed liquor suspend solids (MLSS) concentration of approximately 5 g L -1 . SOTEs of nearly 100% were obtained in clean water and mixed liquor. The results showed that at higher oxygen flowrates, higher transfer rates could be achieved; this however, at expenses of the transfer efficiency. As expected, lower transfer efficiencies were observed in mixed liquor compared to clean water. Alpha factors varied between 0.6 and 1.0. However, values of approximately 1.0 can be obtained in all cases by fine tuning the oxygen flowrate delivered to the system. Copyright © 2018 Elsevier Ltd. All rights reserved.

  7. Numerical study for peristalsis of Carreau-Yasuda nanomaterial with convective and zero mass flux condition

    NASA Astrophysics Data System (ADS)

    Hayat, T.; Ahmed, Bilal; Alsaedi, A.; Abbasi, F. M.

    2018-03-01

    The present communication investigates flow of Carreau-Yasuda nanofluid in presence of mixed convection and Hall current. Effects of viscous dissipation, Ohmic heating and convective conditions are addressed. In addition zero nanoparticle mass flux condition is imposed. Wave frame analysis is carried out. Coupled differential systems after long wavelength and low Reynolds number are numerically solved. Effects of different parameters on velocity, temperature and concentration are studied. Heat and mass transfer rates are analyzed through tabular values. It is observed that concentration for thermophoresis and Brownian motion parameters has opposite effect. Further heat and mass transfer rates at the upper wall enhances significantly when Hartman number increases and reverse situation is noticed for Hall parameter.

  8. A model for allometric scaling of mammalian metabolism with ambient heat loss.

    PubMed

    Kwak, Ho Sang; Im, Hong G; Shim, Eun Bo

    2016-03-01

    Allometric scaling, which represents the dependence of biological traits or processes on body size, is a long-standing subject in biological science. However, there has been no study to consider heat loss to the ambient and an insulation layer representing mammalian skin and fur for the derivation of the scaling law of metabolism. A simple heat transfer model is proposed to analyze the allometry of mammalian metabolism. The present model extends existing studies by incorporating various external heat transfer parameters and additional insulation layers. The model equations were solved numerically and by an analytic heat balance approach. A general observation is that the present heat transfer model predicted the 2/3 surface scaling law, which is primarily attributed to the dependence of the surface area on the body mass. External heat transfer effects introduced deviations in the scaling law, mainly due to natural convection heat transfer, which becomes more prominent at smaller mass. These deviations resulted in a slight modification of the scaling exponent to a value < 2/3. The finding that additional radiative heat loss and the consideration of an outer insulation fur layer attenuate these deviation effects and render the scaling law closer to 2/3 provides in silico evidence for a functional impact of heat transfer mode on the allometric scaling law in mammalian metabolism.

  9. Study on stabilities, thermophysical properties and natural convective heat transfer characteristics of TiO2-water nanofluids

    NASA Astrophysics Data System (ADS)

    Qi, Cong; Wan, Yong Liang; Wang, Gui Qing; Han, Dong Tai

    2018-04-01

    TiO2-water nanofluids with different mass fractions ( ω = 0.1 wt%, ω = 0.3 wt% and ω = 0.5 wt%) are prepared respectively, and the stabilities are studied by scanning electron microscope, transmission electron microscope, dynamic analysis method and settlement observation method. Additionally, thermophysical properties of nanofluids are discussed, and models of thermophysical properties are deduced. Then, an experimental installation and a two-phase lattice Boltzmann model for natural convection heat transfer are established in this paper and the effects of cavity ratio, heating power and nanoparticle mass fraction on heat transfer are discussed respectively. It can be obtained that the thermal conductivities of TiO2-water nanofluids can be improved by 5.23% to the utmost extent. However, the heat transfer can be enhanced by 34.2% in the maximum with the increase of nanoparticle mass fraction at the lowest heating power and the largest cavity ratio.

  10. About Mass Transfer in Capillaries of Biological Systems under Influence of Vibrations

    NASA Astrophysics Data System (ADS)

    Prisniakov, K.

    Vibrations accompany the flight of the manned spacecraft both at a stage of a orbital injection to an orbit, and during long flights (as noise), rendering undesirable physiological influence on crew, reducing serviceability and creating constant discomfort. The report represents attempt to predict a state of the cosmonaut in conditions of influence of vibrations for the period of start and stay in Space, being based on researches of mass transfer processes in capillary systems. For this purpose the original researches on heat and mass transfer processes with evaporation of liquids in capillary - porous structures in conditions of vibration actions and changes of a direction of action of gravitation are generalized. Report demonstrates the existence of modes at which increased or lowered mass transfer is achieved on border of separation "liquid - gas". The possible mechanism of influence of vibrations on evaporation of a liquid in capillaries is examined. The magnitudes of frequencies and amplitudes are submitted at which minimax characteristics are observed. The opportunity of application of the developed mathematical model of heat and mass transfer in capillary - porous structures to forecasting influence of vibrations for biological processes in capillaries of alive essences is analyzed. Such approach is justified on the mechanical nature of harmful influence of vibrations on an organism of the person. In addition the range of vibration frequencies which arise during space flights, corresponds to own resonant frequencies of a human body and his separate organs. Comparison of these resonant frequencies of a body of the person (5-80 Hertz) with vibration frequencies of optimum modes of heat and mass transfer in capillary - porous structures (20-40 Hertz) is shown their ranges of coverage. It gives the basis to assume existence of similar effects in capillaries of human body. It is supposed, that the difficulty of breath, change of a rhythm of breath, the subsequent weariness under vibration action are attributable to infringements of normal mass transfer between the inhaled air and blood. The opportunity of use of the received laws is discussed for assessment of influence of gravitational fields on intensity mass transfer in capillaries of biosystems also.

  11. Lunar Surface-to-Surface Power Transfer

    NASA Technical Reports Server (NTRS)

    Kerslake, Thomas W.

    2007-01-01

    A human lunar outpost, under NASA study for construction in the 2020's, has potential requirements to transfer electric power up to 50-kW across the lunar surface from 0.1 to 10-km distances. This power would be used to operate surface payloads located remotely from the outpost and/or outpost primary power grid. This paper describes concept designs for state-of-the-art technology power transfer subsystems including AC or DC power via cables, beamed radio frequency power and beamed laser power. Power transfer subsystem mass and performance are calculated and compared for each option. A simplified qualitative assessment of option operations, hazards, costs and technology needs is also described. Based on these concept designs and performance analyses, a DC power cabling subsystem is recommended to minimize subsystem mass and to minimize mission and programmatic costs and risks. Avenues for additional power transfer subsystem studies are recommended.

  12. Road deicing salt irreversibly disrupts osmoregulation of salamander egg clutches.

    PubMed

    Karraker, Nancy E; Gibbs, James P

    2011-03-01

    It has been postulated that road deicing salts are sufficiently diluted by spring rains to ameliorate any physiological impacts to amphibians breeding in wetlands near roads. We tested this conjecture by exposing clutches of the spotted salamander (Ambystoma maculatum) to three chloride concentrations (1 mg/L, 145 mg/L, 945 mg/L) for nine days, then transferred clutches to control water for nine days, and measured change in mass at three-day intervals. We measured mass change because water uptake by clutches reduces risks to embryos associated with freezing, predation, and disease. Clutches in controls sequestered water asymptotically. Those in the moderate concentrations lost 18% mass initially and regained 14% after transfer to control water. Clutches in high concentration lost 33% mass and then lost an additional 8% after transfer. Our results suggest that spring rains do not ameliorate the effects of deicing salts in wetlands with extremely high chloride concentrations. Copyright © 2010 Elsevier Ltd. All rights reserved.

  13. Effect of surfactant on single drop mass transfer for extraction of aromatics from lubricating oils

    NASA Astrophysics Data System (ADS)

    Izza, H.; Ben Abdessalam, S.; Korichi, M.

    2018-03-01

    Solvent extraction is an effective method for the reduction of the content of aromatic of lubricating oil. Frequently, with phenol, furfural, the NMP (out of N-methyl pyrrolidone). The power solvent and the selectivity can be still to increase while using surfactant as additive which facilitates the separation of phase and increases the yeild in raffinat. Liquid-liquid mass transfer coefficients for single freely rising drops in the presence of surfactant in an extraction column have been investigated. The surfactant used in this study was sodium lauryl ether sulfate (SLES). The experiments were performed by bubbling a solvent as a series of individual drops from the top of the column containing furfural-SLES solution. The column used in this experiment was made from glass with 17 mm inner diameter and a capacity of 125ml. The effects of the concentration of surfactant on the overall coefficient of mass transfer was investigated.

  14. Period Variations of the Eclipsing Binary Systems T LMi and VX Lac

    NASA Astrophysics Data System (ADS)

    Yılmaz, M.; İzci, D. D.; Gümüş, D.; Özavci, İ.; Selam, S. O.

    2015-07-01

    We present a period analysis of the two Algol-type eclipsing binary systems T LMi and VX Lac using all available times of minimum in the literature, as well as new minima obtained at the Ankara University Kreiken Observatory. The period analysis of T LMi suggests mass transfer between the components and also a third body that is dynamically bound to the binary system. The analysis of VX Lac also suggests mass transfer between the components, and the presence of a third and a fourth body under the assumption of a Light-Time Effect. In addition, the periodic variation of VX Lac was examined under the hypothesis of magnetic activity, and the corresponding parameters were derived. We report here the orbital parameters for both systems, along with the ones related to mass transfer, and those for the third and fourth bodies.

  15. Growth and substrate consumption of Nitrobacter agilis cells immobilized in carrageenan: part 1. Dynamic modeling.

    PubMed

    de Gooijer, C D; Wijffels, R H; Tramper, J

    1991-07-01

    The modeling of the growth of Nitrobacter agilis cell immobilized in kappa-carrageenan is presented. A detailed description is given of the modeling of internal diffusion and growth of cells in the support matrix in addition to external mass transfer resistance. The model predicts the substrate and biomass profiles in the support as well as the macroscopic oxygen consumption rate of the immobilized biocatalyst in time. The model is tested by experiments with continuously operated airlift loop reactors containing cells immobilized in kappa-carrageenan. The model describes experimental data very well. It is clearly shown that external mass transfer may not be neglected. Furthermore, a sensitivity analysis of the parameters at their values during the experiments revealed that apart from the radius of the spheres and the substrate bulk concentration, the external mass transfer resistance coefficient is the most sensitive parameter for our case.

  16. Bulk refrigeration of fruits and vegetables. Part 2: Computer algorithm for heat loads and moisture loss

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Becker, B.; Misra, A.; Fricke, B.A.

    1997-12-31

    A computer algorithm was developed that estimates the latent and sensible heat loads due to the bulk refrigeration of fruits and vegetables. The algorithm also predicts the commodity moisture loss and temperature distribution which occurs during refrigeration. Part 1 focused upon the thermophysical properties of commodities and the flowfield parameters which govern the heat and mass transfer from fresh fruits and vegetables. This paper, Part 2, discusses the modeling methodology utilized in the current computer algorithm and describes the development of the heat and mass transfer models. Part 2 also compares the results of the computer algorithm to experimental datamore » taken from the literature and describes a parametric study which was performed with the algorithm. In addition, this paper also reviews existing numerical models for determining the heat and mass transfer in bulk loads of fruits and vegetables.« less

  17. Long-term mass transfer and mixing-controlled reactions of a DNAPL plume from persistent residuals

    NASA Astrophysics Data System (ADS)

    Liu, Yuan; Illangasekare, Tissa H.; Kitanidis, Peter K.

    2014-02-01

    Understanding and being able to predict the long-term behavior of DNAPL (i.e., PCE and TCE) residuals after active remediation has ceased have become increasingly important as attention at many sites turns from aggressive remediation to monitored natural attenuation and long-term stewardship. However, plume behavior due to mass loading and reactions during these later phases is less studied as they involve large spatial and temporal scales. We apply both theoretical analysis and pore-scale simulations to investigate mass transfer from DNAPL residuals and subsequent reactions within the generated plume, and, in particular, to show the differences between early- and late-time behaviors of the plume. In the zone of entry of the DNAPL entrapment zone where the concentration boundary layer in the flowing groundwater has not fully developed, the pore-scale simulations confirm the past findings based on laboratory studies that the mass transfer increases as a power-law function of the Peclét number, and is enhanced due to reactions in the plume. Away from the entry zone and further down gradient, the long-term reactions are limited by the available additive and mixing in the porous medium, thereby behave considerably differently from the entry zone. For the reaction between the contaminant and an additive with intrinsic second-order bimolecular kinetics, the late-time reaction demonstrates a first-order decay macroscopically with respect to the mass of the limiting additive, not with respect to that of the contaminant. The late-time decay rate only depends on the intrinsic reaction rate and the solubility of the entrapped DNAPL. At the intermediate time, the additive decays exponentially with the square of time (t2), instead of time (t). Moreover, the intermediate decay rate also depends on the initial conditions, the spatial distribution of DNAPL residuals, and the effective dispersion coefficient.

  18. Use of magnetic nanoparticles to enhance bioethanol production in syngas fermentation.

    PubMed

    Kim, Young-Kee; Lee, Haryeong

    2016-03-01

    The effect of two types of nanoparticles on the enhancement of bioethanol production in syngas fermentation by Clostridium ljungdahlii was examined. Methyl-functionalized silica and methyl-functionalized cobalt ferrite-silica (CoFe2O4@SiO2-CH3) nanoparticles were used to improve syngas-water mass transfer. Of these, CoFe2O4@SiO2-CH3 nanoparticles showed better enhancement of syngas mass transfer. The nanoparticles were recovered using a magnet and reused five times to evaluate reusability, and it was confirmed that their capability for mass transfer enhancement was maintained. Both types of nanoparticles were applied to syngas fermentation, and production of biomass, ethanol, and acetic acid was enhanced. CoFe2O4@SiO2-CH3 nanoparticles were more efficient for the productivity of syngas fermentation due to improved syngas mass transfer. The biomass, ethanol, and acetic acid production compared to a control were increased by 227.6%, 213.5%, and 59.6%, respectively by addition of CoFe2O4@SiO2-CH3 nanoparticles. The reusability of the nanoparticles was confirmed by reuse of recovered nanoparticles for fermentation. Copyright © 2016 Elsevier Ltd. All rights reserved.

  19. Bubble coalescence suppression driven carbon monoxide (CO)-water mass transfer increase by electrolyte addition in a hollow fiber membrane bioreactor (HFMBR) for microbial CO conversion to ethanol.

    PubMed

    Jang, Nulee; Yasin, Muhammad; Kang, Hyunsoo; Lee, Yeubin; Park, Gwon Woo; Park, Shinyoung; Chang, In Seop

    2018-05-04

    This study investigated the effects of electrolytes (CaCl 2 , K 2 HPO 4 , MgSO 4 , NaCl, and NH 4 Cl) on CO mass transfer and ethanol production in a HFMBR. The hollow fiber membranes (HFM) were found to generate tiny gas bubbles; the bubble coalescence was significantly suppressed in electrolyte solution. The volumetric gas-liquid mass transfer coefficients (k L a) increased up to 414% compared to the control. Saturated CO (C ∗ ) decreased as electrolyte concentrations increased. Overall, the maximum mass transfer rate (R max ) in electrolyte solution ranged from 106% to 339% of the value obtained in water. The electrolyte toxicity on cell growth was tested using Clostridium autoethanogenum. Most electrolytes, except for MgSO 4 , inhibited cell growth. The HFMBR operation using a medium containing 1% MgSO 4 achieved 119% ethanol production compared to that without electrolytes. Finally, a kinetic simulation using the parameters got from the 1% MgSO 4 medium predicted a higher ethanol production compared to the control. Copyright © 2018 Elsevier Ltd. All rights reserved.

  20. A comparative study on heat and mass transfer of the Blasius and Falkner-Skan flow of a bio-convective Casson fluid past a wedge

    NASA Astrophysics Data System (ADS)

    Raju, C. S. K.; Sandeep, N.

    2016-11-01

    Nowadays, many theoretical models are available for analyzing the heat and mass transfer of flows through different geometries. Nevertheless, it is challenging for researchers to choose among these models, the most suitable for a particular geometry. In addition to this, the extrinsic magnetic field is capable to set the thermal and physical properties of magnetic fluids and regulate the flow and heat transfer characteristics. The strength of the applied magnetic field affects the thermal conductivity of the fluids and makes it anisotropic. With this incentive, we attempt to study the thermophoresis and Brownian motion effects on the magnetohydrodynamic radiative Casson fluid flow over a wedge filled with gyrotactic microorganisms by considering the Blasius and Falkner-Skan models. Numerical solutions are offered graphically as well as in tabular form with the aid of Runge-Kutta and Newton's methods. Results for Blasius and Falkner-Skan flow cases are exhibited through plots for the parameters of concern. For real life applications, we also calculated the heat and mass transfer rates. It is observed that thermal and concentration boundary layers are not uniform for Falkner-Skan and Blasius flow cases. It is also observed that the heat and mass transfer rate is high in Falkner-Skan flow when compared with Blasius flow.

  1. Effects of radiobiological uncertainty on shield design for a 60-day lunar mission

    NASA Technical Reports Server (NTRS)

    Wilson, John W.; Nealy, John E.; Schimmerling, Walter

    1993-01-01

    Some consequences of uncertainties in radiobiological risk due to galactic cosmic ray exposure are analyzed to determine their effect on engineering designs for a first lunar outpost - a 60-day mission. Quantitative estimates of shield mass requirements as a function of a radiobiological uncertainty factor are given for a simplified vehicle structure. The additional shield mass required for compensation is calculated as a function of the uncertainty in galactic cosmic ray exposure, and this mass is found to be as large as a factor of 3 for a lunar transfer vehicle. The additional cost resulting from this mass is also calculated. These cost estimates are then used to exemplify the cost-effectiveness of research.

  2. Influences of Altered River Geomorphology on Channel-Floodplain Mass and Momentum Transfer

    NASA Astrophysics Data System (ADS)

    Byrne, C. F.; Stone, M. C.

    2017-12-01

    River management strategies, including both river engineering and restoration, have altered river geomorphology and associated lateral channel-floodplain connectivity throughout the world. This altered connectivity is known to drive changes in ecologic and geomorphic processes during floods, however, quantification of altered connectivity is difficult due to the highly dynamic spatial and temporal nature of flood wave conditions. The objective of this research was to quantify the physical processes of lateral mass and momentum transfer at the channel-floodplain interface. The objective was achieved with the implementation of novel scripting and high-resolution, two-dimensional hydrodynamic modeling techniques under unsteady flow conditions. The process-based analysis focused on three geomorphic feature types within the Middle Rio Grande, New Mexico, USA: (1) historical floodplain surfaces, (2) inset floodplain surfaces formed as a result of channel training and hydrologic alteration, and (3) mechanically restored floodplain surfaces. Results suggest that inset floodplain feature types are not only subject to greater mass and momentum transfer magnitudes, but those connections are also more heterogeneous in nature compared with historical feature types. While restored floodplain feature types exhibit transfer magnitudes and heterogeneity comparable to inset feature types, the surfaces are not of great enough spatial extent to substantially influence total channel-floodplain mass and momentum transfer. Mass and momentum transfer also displayed differing characteristic changes as a result of increased flood magnitude, indicating that linked hydrodynamic processes can be altered differently as a result of geomorphic and hydrologic change. The results display the potential of high-resolution modeling strategies in capturing the spatial and temporal complexities of river processes. In addition, the results have implications for other fields of river science including biogeochemical exchange at the channel-floodplain interface and quantification of process associated with environmental flow and river restoration strategies.

  3. Molecular dynamics and charge transport in organic semiconductors: a classical approach to modeling electron transfer† †Electronic supplementary information (ESI) available. See DOI: 10.1039/c6sc04547b Click here for additional data file.

    PubMed Central

    Vázquez-Mayagoitia, Álvaro; Ratcliff, Laura E.; Tretiak, Sergei; Bair, Raymond A.; Gray, Stephen K.; Van Voorhis, Troy; Larsen, Ross E.; Darling, Seth B.

    2017-01-01

    Organic photovoltaics (OPVs) are a promising carbon-neutral energy conversion technology, with recent improvements pushing power conversion efficiencies over 10%. A major factor limiting OPV performance is inefficiency of charge transport in organic semiconducting materials (OSCs). Due to strong coupling with lattice degrees of freedom, the charges form polarons, localized quasi-particles comprised of charges dressed with phonons. These polarons can be conceptualized as pseudo-atoms with a greater effective mass than a bare charge. We propose that due to this increased mass, polarons can be modeled with Langevin molecular dynamics (LMD), a classical approach with a computational cost much lower than most quantum mechanical methods. Here we present LMD simulations of charge transfer between a pair of fullerene molecules, which commonly serve as electron acceptors in OSCs. We find transfer rates consistent with experimental measurements of charge mobility, suggesting that this method may provide quantitative predictions of efficiency when used to simulate materials on the device scale. Our approach also offers information that is not captured in the overall transfer rate or mobility: in the simulation data, we observe exactly when and why intermolecular transfer events occur. In addition, we demonstrate that these simulations can shed light on the properties of polarons in OSCs. Much remains to be learned about these quasi-particles, and there are no widely accepted methods for calculating properties such as effective mass and friction. Our model offers a promising approach to exploring mass and friction as well as providing insight into the details of polaron transport in OSCs. PMID:28553494

  4. Compatibility of materials with liquid metal targets for SNS

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    DiStefano, J.R.; Pawel, S.J.; DeVan, J.H.

    1996-06-01

    Several heavy liquid metals are candidates as the target in a spallation neutron source: Hg, Pb, Bi, and Pb-Bi eutectic. Systems with these liquid metals have been used in the past and a data-base on compatibility already exists. Two major compatibility issues have been identified when selecting a container material for these liquid metals: temperature gradient mass transfer and liquid metal embrittlement or LME. Temperature gradient mass transfer refers to dissolution of material from the high temperature portions of a system and its deposition in the lower temperature areas. Solution and deposition rate constants along with temperature, {Delta}T, and velocitymore » are usually the most important parameters. For most candidate materials mass transfer corrosion has been found to be proportionately worse in Bi compared with Hg and Pb. For temperatures to {approx}550{degrees}C, ferritic/martensitic steels have been satisfactory in Pb or Hg systems and the maximum temperature can be extended to {approx}650{degrees}C with additions of inhibitors to the liquid metal, e.g. Mg, Ti, Zr. Above {approx}600{degrees}C, austenitic stainless steels have been reported to be unsatisfactory, largely because of the mass transfer of nickel. Blockage of flow from deposition of material is usually the life-limiting effect of this type of corrosion. However, mass transfer corrosion at lower temperatures has not been studied. At low temperatures (usually < 150{degrees}C), LME has been reported for some liquid metal/container alloy combinations. Liquid metal embrittlement, like hydrogen embrittlement, results in brittle fracture of a normally ductile material.« less

  5. Perforated fins effect on the heat transfer rate from a circular tube by using wind tunnel: An experimental view

    NASA Astrophysics Data System (ADS)

    Ahmadi Nadooshan, Afshin; Kalbasi, Rasool; Afrand, Masoud

    2018-04-01

    Perforated fins effects on the heat transfer rate of a circular tube are examined experimentally. An experimental system is set up through the wind tunnel and equipped with necessary measurement tools. Hot water passes through the finned tube and heat transfers to the fin-side air created using the wind tunnel with different velocities. Two fin sets of identical weight are installed on a circular tube with different outer diameters of 22 and 26 mm. The experiments are conducted at two different mass flow rates of the hot water and six Reynolds number of external air flow. Considering the four finned tubes and one no finned tube, a total of 60 tests are conducted. Results showed that with increasing the internal or external flow rates, the effect of larger cross-sectional area is greater. By opening holes on the fins, in addition to weight loss, the maximum heat transfer rate for perforated fins increases by 8.78% and 9.23% respectively for mass flow rates of 0.05 and 0.1 kg/s at low external Reynolds number. While, at high external Reynolds number, the holes reduces heat transfer by 8.4% and 10.6% for mass flow rates of 0.05 and 0.1 kg/s, respectively.

  6. Effects of mass transfer on MHD three dimensional flow of a Prandtl liquid over a flat plate in the presence of chemical reaction

    NASA Astrophysics Data System (ADS)

    Ganesh Kumar, K.; Rizwan-ul-Haq; Rudraswamy, N. G.; Gireesha, B. J.

    The present study addresses the three-dimensional flow of a Prandtl fluid over a Riga plate in the presence of chemical reaction and convective condition. The converted set of boundary layer equations are solved numerically by RKF four-fifth method. Obtained numerical results for flow and mass transfer characteristics are discussed for various physical parameters. Additionally, the skin friction coefficient and Sherwood number are also presented. It is found that, the momentum boundary layer thickness is dominant for higher values of α and solutal boundary layer is low for higher Schmidt number and chemical reaction parameter.

  7. Influence of mass transfer on bubble plume hydrodynamics.

    PubMed

    Lima Neto, Iran E; Parente, Priscila A B

    2016-03-01

    This paper presents an integral model to evaluate the impact of gas transfer on the hydrodynamics of bubble plumes. The model is based on the Gaussian type self-similarity and functional relationships for the entrainment coefficient and factor of momentum amplification due to turbulence. The impact of mass transfer on bubble plume hydrodynamics is investigated considering different bubble sizes, gas flow rates and water depths. The results revealed a relevant impact when fine bubbles are considered, even for moderate water depths. Additionally, model simulations indicate that for weak bubble plumes (i.e., with relatively low flow rates and large depths and slip velocities), both dissolution and turbulence can affect plume hydrodynamics, which demonstrates the importance of taking the momentum amplification factor relationship into account. For deeper water conditions, simulations of bubble dissolution/decompression using the present model and classical models available in the literature resulted in a very good agreement for both aeration and oxygenation processes. Sensitivity analysis showed that the water depth, followed by the bubble size and the flow rate are the most important parameters that affect plume hydrodynamics. Lastly, dimensionless correlations are proposed to assess the impact of mass transfer on plume hydrodynamics, including both the aeration and oxygenation modes.

  8. Mathematical modeling heat and mass transfer processes in porous media

    NASA Astrophysics Data System (ADS)

    Akhmed-Zaki, Darkhan

    2013-11-01

    On late development stages of oil-fields appears a complex problem of oil-recovery reduction. One of solution approaches is injecting of surfactant together with water in the form of active impurities into the productive layer - for decreasing oil viscosity and capillary forces between ``oil-water'' phases system. In fluids flow the surfactant can be in three states: dissolved in water, dissolved in oil and adsorbed on pore channels' walls. The surfactant's invasion into the reservoir is tracked by its diffusion with reservoir liquid and mass-exchange with two phase (liquid and solid) components of porous structure. Additionally, in this case heat exchange between fluids (injected, residual) and framework of porous medium has practical importance for evaluating of temperature influences on enhancing oil recovery. Now, the problem of designing an adequate mathematical model for describing a simultaneous flowing heat and mass transfer processes in anisotropic heterogeneous porous medium -surfactant injection during at various temperature regimes has not been fully researched. In this work is presents a 2D mathematical model of surfactant injections into the oil reservoir. Description of heat- and mass transfer processes in a porous media is done through differential and kinetic equations. For designing a computational algorithm is used modify version of IMPES method. The sequential and parallel computational algorithms are developed using an adaptive curvilinear meshes which into account heterogeneous porous structures. In this case we can evaluate the boundaries of our process flows - fronts (``invasion'', ``heat'' and ``mass'' transfers), according to the pressure, temperature, and concentration gradient changes.

  9. Using White Dwarf Companions of Blue Stragglers to Constrain Mass Transfer Physics

    NASA Astrophysics Data System (ADS)

    Gosnell, Natalie M.; Leiner, Emily; Geller, Aaron M.; Knigge, Christian; Mathieu, Robert D.; Sills, Alison; Leigh, Nathan

    2018-06-01

    Complete membership studies of old open clusters reveal that 25% of the evolved stars follow pathways in stellar evolution that are impacted by binary evolution. Recent studies show that the majority of blue straggler stars, traditionally defined to be stars brighter and bluer than the corresponding main sequence turnoff, are formed through mass transfer from a giant star onto a main sequence companion, resulting in a white dwarf in a binary system with a blue straggler. We will present constraints on the histories and mass transfer efficiencies for two blue straggler-white dwarf binaries in open cluster NGC 188. The constraints are a result of measuring white dwarf cooling temperatures and surface gravities with HST COS far-ultraviolet spectroscopy. This information sets both the timeline for mass transfer and the stellar masses in the pre-mass transfer binary, allowing us to constrain aspects of the mass transfer physics. One system is formed through Case C mass transfer, leaving a CO-core white dwarf, and provides an interesting test case for mass transfer from an asymptotic giant branch star in an eccentric system. The other system formed through Case B mass transfer, leaving a He-core white dwarf, and challenges our current understanding of the expected regimes for stable mass transfer from red giant branch stars.

  10. The Influence of Oscillatory Fractions on Mass Transfer of Non-Newtonian Fluid in Wavy-Walled Tubes for Pulsatile Flow

    NASA Astrophysics Data System (ADS)

    Zhu, Donghui; Bian, Yongning

    2018-03-01

    The shape of pipeline structure, fluid medium and flow state have important influence on the heat transfer and mass effect of fluid. In this paper, we investigated the mass transfer behavior of Non-Newtonian fluid CMC solution with 700ppm concentration in five different-sized axisymmetric wave-walled tubes for pulsatile flow. It is revealed that the effect of mass transfer is enhanced with the increase of oscillatory fractions P based on the PIV measurements. Besides, mass transfer rate was measured by the electrochemical method in the larger oscillatory points rate range. It is observed that mass transfer rate increases with the increase in P and reached the maximum mass transfer rate at the most optimal oscillatory fractions P opt. After reaching the optimal oscillatory fractions P opt, the mass transfer rate decreases with increasing P.

  11. Case A and B evolution towards electron capture supernova

    NASA Astrophysics Data System (ADS)

    Siess, L.; Lebreuilly, U.

    2018-06-01

    Context. Most super-asymptotic giant branch (SAGB) stars are expected to end their life as oxygen-neon white dwarfs rather than electron capture supernovae (ECSN). The reason is ascribed to the ability of the second dredge-up to significantly reduce the mass of the He core and of the efficient AGB winds to remove the stellar envelope before the degenerate core reaches the critical mass for the activation of electron capture reactions. Aims: In this study, we investigate the formation of ECSN through case A and case B mass transfer. In these scenarios, when Roche lobe overflow stops, the primary has become a helium star. With a small envelope left, the second dredge-up is prevented, potentially opening new paths to ECSN. Methods: We compute binary models using our stellar evolution code BINSTAR. We consider three different secondary masses of 8, 9, and 10 M⊙ and explore the parameter space, varying the companion mass, orbital period, and input physics. Results: Assuming conservative mass transfer, with our choice of secondary masses all case A systems enter contact either during the main sequence or as a consequence of reversed mass transfer when the secondary overtakes its companion during core helium burning. Case B systems are able to produce ECSN progenitors in a relatively small range of periods (3 ≲ P(d) ≤ 30) and primary masses (10.9 ≤ M/M⊙≤ 11.5). Changing the companion mass has little impact on the primary's fate as long as the mass ratio M1/M2 remains less than 1.4-1.5, above which evolution to contact becomes unavoidable. We also find that allowing for systemic mass loss substantially increases the period interval over which ECSN can occur. This change in the binary physics does not however affect the primary mass range. We finally stress that the formation of ECSN progenitors through case A and B mass transfer is very sensitive to adopted binary and stellar physics. Conclusions: Close binaries provide additional channels for ECSN but the parameter space is rather constrained likely making ECSN a rare event.

  12. Operational parameters and their influence on particle-side mass transfer resistance in a packed bed bioreactor.

    PubMed

    Hussain, Amir; Kangwa, Martin; Yumnam, Nivedita; Fernandez-Lahore, Marcelo

    2015-12-01

    The influence of internal mass transfer on productivity as well as the performance of packed bed bioreactor was determined by varying a number of parameters; chitosan coating, flow rate, glucose concentration and particle size. Saccharomyces cerevisiae cells were immobilized in chitosan and non-chitosan coated alginate beads to demonstrate the effect on particle side mass transfer on substrate consumption time, lag phase and ethanol production. The results indicate that chitosan coating, beads size, glucose concentration and flow rate have a significant effect on lag phase duration. The duration of lag phase for different size of beads (0.8, 2 and 4 mm) decreases by increasing flow rate and by decreasing the size of beads. Moreover, longer lag phase were found at higher glucose medium concentration and also with chitosan coated beads. It was observed that by increasing flow rates; lag phase and glucose consumption time decreased. The reason is due to the reduction of external (fluid side) mass transfer as a result of increase in flow rate as glucose is easily transported to the surface of the beads. Varying the size of beads is an additional factor: as it reduces the internal (particle side) mass transfer by reducing the size of beads. The reason behind this is the distance for reactants to reach active site of catalyst (cells) and the thickness of fluid created layer around alginate beads is reduced. The optimum combination of parameters consisting of smaller beads size (0.8 mm), higher flow rate of 90 ml/min and glucose concentration of 10 g/l were found to be the maximum condition for ethanol production.

  13. Overcoming the Gas-Liquid Mass Transfer of Oxygen by Coupling Photosynthetic Water Oxidation with Biocatalytic Oxyfunctionalization.

    PubMed

    Hoschek, Anna; Bühler, Bruno; Schmid, Andreas

    2017-11-20

    Gas-liquid mass transfer of gaseous reactants is a major limitation for high space-time yields, especially for O 2 -dependent (bio)catalytic reactions in aqueous solutions. Herein, oxygenic photosynthesis was used for homogeneous O 2 supply via in situ generation in the liquid phase to overcome this limitation. The phototrophic cyanobacterium Synechocystis sp. PCC6803 was engineered to synthesize the alkane monooxygenase AlkBGT from Pseudomonas putida GPo1. With light, but without external addition of O 2 , the chemo- and regioselective hydroxylation of nonanoic acid methyl ester to ω-hydroxynonanoic acid methyl ester was driven by O 2 generated through photosynthetic water oxidation. Photosynthesis also delivered the necessary reduction equivalents to regenerate the Fe 2+ center in AlkB for oxygen transfer to the terminal methyl group. The in situ coupling of oxygenic photosynthesis to O 2 -transferring enzymes now enables the design of fast hydrocarbon oxyfunctionalization reactions. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  14. Trampoline-related injuries in children: a preliminary biomechanical model of multiple users.

    PubMed

    Menelaws, Simon; Bogacz, Andrew R; Drew, Tim; Paterson, Brodie C

    2011-07-01

    The recent popularity of domestic trampolines has seen a corresponding increase in injured children. Most injuries happen on the trampoline mat when there are multiple users present. This study sought to examine and simulate the forces and energy transferred to a child's limbs when trampolining with another person of greater mass. The study used a computational biomechanical model. The simulation demonstrated that when two masses bounce out of phase on a trampoline, a transfer of kinetic energy from the larger mass to the smaller mass is likely to occur. It predicted that when an 80 kg adult is on a trampoline with a 25 kg child, the energy transfer is equivalent to the child falling 2.8 m onto a solid surface. Additionally, the rate of loading on the child's bones and ligaments is greater than that on the accompanying adult. Current guidelines are clear that more than one user on a trampoline at a time is a risk factor for serious injury; however, the majority of injuries happen in this scenario. The model predicted that there are high energy transfers resulting in serious fracture and ligamentous injuries to children and that this could be equated to equivalent fall heights. This provides a clear take-home message, which can be conveyed to parents to reduce the incidence of trampoline-related injuries.

  15. Mass Transfer with Chemical Reaction.

    ERIC Educational Resources Information Center

    DeCoursey, W. J.

    1987-01-01

    Describes the organization of a graduate course dealing with mass transfer, particularly as it relates to chemical reactions. Discusses the course outline, including mathematics models of mass transfer, enhancement of mass transfer rates by homogeneous chemical reaction, and gas-liquid systems with chemical reaction. (TW)

  16. Thermal-Flow Code for Modeling Gas Dynamics and Heat Transfer in Space Shuttle Solid Rocket Motor Joints

    NASA Technical Reports Server (NTRS)

    Wang, Qunzhen; Mathias, Edward C.; Heman, Joe R.; Smith, Cory W.

    2000-01-01

    A new, thermal-flow simulation code, called SFLOW. has been developed to model the gas dynamics, heat transfer, as well as O-ring and flow path erosion inside the space shuttle solid rocket motor joints by combining SINDA/Glo, a commercial thermal analyzer. and SHARPO, a general-purpose CFD code developed at Thiokol Propulsion. SHARP was modified so that friction, heat transfer, mass addition, as well as minor losses in one-dimensional flow can be taken into account. The pressure, temperature and velocity of the combustion gas in the leak paths are calculated in SHARP by solving the time-dependent Navier-Stokes equations while the heat conduction in the solid is modeled by SINDA/G. The two codes are coupled by the heat flux at the solid-gas interface. A few test cases are presented and the results from SFLOW agree very well with the exact solutions or experimental data. These cases include Fanno flow where friction is important, Rayleigh flow where heat transfer between gas and solid is important, flow with mass addition due to the erosion of the solid wall, a transient volume venting process, as well as some transient one-dimensional flows with analytical solutions. In addition, SFLOW is applied to model the RSRM nozzle joint 4 subscale hot-flow tests and the predicted pressures, temperatures (both gas and solid), and O-ring erosions agree well with the experimental data. It was also found that the heat transfer between gas and solid has a major effect on the pressures and temperatures of the fill bottles in the RSRM nozzle joint 4 configuration No. 8 test.

  17. Aeration and mass transfer optimization in a rectangular airlift loop photobioreactor for the production of microalgae.

    PubMed

    Guo, Xin; Yao, Lishan; Huang, Qingshan

    2015-08-01

    Effects of superficial gas velocity and top clearance on gas holdup, liquid circulation velocity, mixing time, and mass transfer coefficient are investigated in a new airlift loop photobioreactor (PBR), and empirical models for its rational control and scale-up are proposed. In addition, the impact of top clearance on hydrodynamics, especially on the gas holdup in the internal airlift loop reactor, is clarified; a novel volume expansion technique is developed to determine the low gas holdup in the PBR. Moreover, a model strain of Chlorella vulgaris is cultivated in the PBR and the volumetric power is analyzed with a classic model, and then the aeration is optimized. It shows that the designed PBR, a cost-effective reactor, is promising for the mass cultivation of microalgae. Copyright © 2015 Elsevier Ltd. All rights reserved.

  18. Energy transfer of highly vibrationally excited phenanthrene and diphenylacetylene.

    PubMed

    Hsu, Hsu Chen; Tsai, Ming-Tsang; Dyakov, Yuri; Ni, Chi-Kung

    2011-05-14

    The energy transfer between Kr atoms and highly vibrationally excited, rotationally cold phenanthrene and diphenylacetylene in the triplet state was investigated using crossed-beam/time-of-flight mass spectrometer/time-sliced velocity map ion imaging techniques. Compared to the energy transfer between naphthalene and Kr, energy transfer between phenanthrene and Kr shows a larger cross-section for vibrational to translational (V → T) energy transfer, a smaller cross-section for translational to vibrational and rotational (T → VR) energy transfer, and more energy transferred from vibration to translation. These differences are further enlarged in the comparison between naphthalene and diphenylacetylene. In addition, less complex formation and significant increases in the large V → T energy transfer probabilities, termed supercollisions in diphenylacetylene and Kr collisions were observed. The differences in the energy transfer between these highly vibrationally excited molecules are attributed to the low-frequency vibrational modes, especially those vibrations with rotation-like wide-angle motions.

  19. 43 CFR 3106.4-3 - Mass transfers.

    Code of Federal Regulations, 2011 CFR

    2011-10-01

    ... 43 Public Lands: Interior 2 2011-10-01 2011-10-01 false Mass transfers. 3106.4-3 Section 3106.4-3... or Otherwise § 3106.4-3 Mass transfers. (a) A mass transfer may be utilized in lieu of the provisions... large number of Federal leases to the same transferee. (b) Three originally executed copies of the mass...

  20. Molecular dynamics modeling of bonding two materials by atomic scale friction stir welding at different process parameters

    NASA Astrophysics Data System (ADS)

    Konovalenko S., Iv.; Psakhie, S. G.

    2017-12-01

    Using the molecular dynamics method, we simulated the atomic scale butt friction stir welding on two crystallites and varied the onset FSW tool plunge depth. The effects of the plunge depth value on the thermomechanical evolution of nanosized crystallites and mass transfer in the course of FSW have been studied. The increase of plunge depth values resulted in more intense heating and reducing the plasticized metal resistance to the tool movement. The mass transfer intensity was hardly dependent on the plunge depth value. The plunge depth was recommended to be used as a FSW process control parameter in addition to the commonly used ones.

  1. Fuel Reforming Technologies (BRIEFING SLIDES)

    DTIC Science & Technology

    2009-09-01

    Heat and Mass Transfer , Catalysis...Gallons Of Fuel/Day/1100men Deployment  To Reduce Noise/Thermal Signature And 4 Environmental Emissions Advanced Heat and Mass Transfer 5 Advanced... Heat and Mass & Transfer Technologies Objective Identify And Develop New Technologies To Enhance Heat And Mass Transfer In Deployed Energy

  2. Local measurement and numerical modeling of mass/heat transfer from a turbine blade in a linear cascade with tip clearance

    NASA Astrophysics Data System (ADS)

    Jin, Peitong

    2000-11-01

    Local mass/heat transfer measurements from the turbine blade near-tip and the tip surfaces are performed using the naphthalene sublimation technique. The experiments are conducted in a linear cascade consisting of five high-pressure blades with a central test-blade configuration. The incoming flow conditions are close to those of the gas turbine engine environment (boundary layer displacement thickness is about 0.01 of chord) with an exit Reynolds number of 6.2 x 105. The effects of tip clearance level (0.86%--6.90% of chord), mainstream Reynolds number and turbulence intensity (0.2 and 12.0%) are investigated. Two methods of flow visualization---oil and lampblack, laser light sheet smoke wire---as well as static pressure measurement on the blade surface are used to study the tip leakage flow and vortex in the cascade. In addition, numerical modeling of the flow and heat transfer processes in the linear cascade with different tip clearances is conducted using commercial software incorporating advanced turbulence models. The present study confirms many important results on the tip leakage flow and vortex from the literature, contributes to the current understanding in the effects of tip leakage flow and vortex on local heat transfer from the blade near-tip and the tip surfaces, and provides detailed local and average heat/mass transfer data applicable to turbine blade tip cooling design.

  3. Molecular dynamics and charge transport in organic semiconductors: a classical approach to modeling electron transfer

    DOE PAGES

    Pelzer, Kenley M.; Vázquez-Mayagoitia, Álvaro; Ratcliff, Laura E.; ...

    2017-01-01

    Organic photovoltaics (OPVs) are a promising carbon-neutral energy conversion technology, with recent improvements pushing power conversion efficiencies over 10%. A major factor limiting OPV performance is inefficiency of charge transport in organic semiconducting materials (OSCs). Due to strong coupling with lattice degrees of freedom, the charges form polarons, localized quasi-particles comprised of charges dressed with phonons. These polarons can be conceptualized as pseudo-atoms with a greater effective mass than a bare charge. Here we propose that due to this increased mass, polarons can be modeled with Langevin molecular dynamics (LMD), a classical approach with a computational cost much lower thanmore » most quantum mechanical methods. Here we present LMD simulations of charge transfer between a pair of fullerene molecules, which commonly serve as electron acceptors in OSCs. We find transfer rates consistent with experimental measurements of charge mobility, suggesting that this method may provide quantitative predictions of efficiency when used to simulate materials on the device scale. Our approach also offers information that is not captured in the overall transfer rate or mobility: in the simulation data, we observe exactly when and why intermolecular transfer events occur. In addition, we demonstrate that these simulations can shed light on the properties of polarons in OSCs. In conclusion, much remains to be learned about these quasi-particles, and there are no widely accepted methods for calculating properties such as effective mass and friction. Lastly, our model offers a promising approach to exploring mass and friction as well as providing insight into the details of polaron transport in OSCs.« less

  4. Conceptual models governing leaching behavior and their long-term predictive capability

    USGS Publications Warehouse

    Claassen, Hans C.

    1981-01-01

    Six models that may be used to describe the interaction of radioactive waste solids with aqueous solutions are as follows:Simple linear mass transfer;Simple parabolic mass transfer;Parabolic mass transfer with the formation of a diffusion-limiting surface layer at an arbitrary time;Initial parabolic mass transfer followed by linear mass transfer at an arbitrary time;Parabolic (or linear) mass transfer and concomitant surface sorption; andParabolic (or linear) mass transfer and concomitant chemical precipitation.Some of these models lead to either illogical or unrealistic predictions when published data are extrapolated to long times. These predictions result because most data result from short-term experimentation. Probably for longer times, processes will occur that have not been observed in the shorter experiments. This hypothesis has been verified by mass-transfer data from laboratory experiments using natural volcanic glass to predict the composition of groundwater. That such rate-limiting mechanisms do occur is reassuring, although now it is not possible to deduce a single mass-transfer limiting mechanism that could control the solution concentration of all components of all waste forms being investigated. Probably the most reasonable mechanisms are surface sorption and chemical precipitation of the species of interest. Another is limiting of mass transfer by chemical precipitation on the waste form surface of a substance not containing the species of interest, that is, presence of a diffusion-limiting layer. The presence of sorption and chemical precipitation as factors limiting mass transfer has been verified in natural groundwater systems, whereas the diffusion-limiting mechanism has not been verified yet.

  5. Single-drop reactive extraction/extractive reaction with forced convective diffusion and interphase mass transfer

    NASA Technical Reports Server (NTRS)

    Kleinman, Leonid S.; Red, X. B., Jr.

    1995-01-01

    An algorithm has been developed for time-dependent forced convective diffusion-reaction having convection by a recirculating flow field within the drop that is hydrodynamically coupled at the interface with a convective external flow field that at infinity becomes a uniform free-streaming flow. The concentration field inside the droplet is likewise coupled with that outside by boundary conditions at the interface. A chemical reaction can take place either inside or outside the droplet, or reactions can take place in both phases. The algorithm has been implemented, and for comparison results are shown here for the case of no reaction in either phase and for the case of an external first order reaction, both for unsteady behavior. For pure interphase mass transfer, concentration isocontours, local and average Sherwood numbers, and average droplet concentrations have been obtained as a function of the physical properties and external flow field. For mass transfer enhanced by an external reaction, in addition to the above forms of results, we present the enhancement factor, with the results now also depending upon the (dimensionless) rate of reaction.

  6. Single-drop reactive extraction/extractive reaction with forced convective diffusion and interphase mass transfer

    NASA Technical Reports Server (NTRS)

    Kleinman, Leonid S.; Reed, X. B., Jr.

    1995-01-01

    An algorithm has been developed for the forced convective diffusion-reaction problem for convection inside and outside a droplet by a recirculating flow field hydrodynamically coupled at the droplet interface with an external flow field that at infinity becomes a uniform streaming flow. The concentration field inside the droplet is likewise coupled with that outside by boundary conditions at the interface. A chemical reaction can take place either inside or outside the droplet or reactions can take place in both phases. The algorithm has been implemented and results are shown here for the case of no reaction and for the case of an external first order reaction, both for unsteady behavior. For pure interphase mass transfer, concentration isocontours, local and average Sherwood numbers, and average droplet concentrations have been obtained as a function of the physical properties and external flow field. For mass transfer enhanced by an external reaction, in addition to the above forms of results, we present the enhancement factor, with the results now also depending upon the (dimensionless) rate of reaction.

  7. Heat and Mass Transfer Measurements for Tray-Fermented Fungal Products

    NASA Astrophysics Data System (ADS)

    Jou, R.-Y.; Lo, C.-T.

    2011-01-01

    In this study, heat and mass transfer in static tray fermentation, which is widely used in solid-state fermentation (SSF) to produce fungal products, such as enzymes or koji, is investigated. Specifically, kinetic models of transport phenomena in the whole-tray chamber are emphasized. The effects of temperature, moisture, and humidity on microbial growth in large-scale static tray fermentation are essential to scale-up SSF and achieve uniform fermentation. In addition, heat and mass transfer of static tray fermentation of Trichoderma fungi with two tray setups—traditional linen coverings and stacks in a temperature-humidity chamber is examined. In both these setups, the following factors of fermentation were measured: air velocity, air temperature, illumination, pH, carbon dioxide (CO2) concentration, and substrate temperature, and the effects of bed height, moisture of substrate, and relative humidity of air are studied. A thin (1 cm) bed at 28 °C and 95 % relative humidity is found to be optimum. Furthermore, mixing was essential for achieving uniform fermentation of Trichoderma fungi. This study has important applications in large-scale static tray fermentation of fungi.

  8. Characterization of VOC Sources during the Texas Air Quality Study 2000 Using Proton-Transfer-Reaction Mass Spectrometry

    NASA Astrophysics Data System (ADS)

    Karl, T.; Jobson, T.; William, K.; Williams, E.; Stutz, J.; Goldan, P.; Fall, R.; Fehsenfeld, F.; Lindinger, W.

    2002-12-01

    We used Proton-Transfer-Reaction Mass Spectrometry (PTR-MS) for continuous real-time monitoring of volatile organic compounds (VOCs) at a site near the Houston Ship Channel during the Texas Air Quality Study 2000. Anthropogenic aromatics, alkenes, methanol, acetaldehyde, formaldehyde, acetone/propanal, a C7-Ketone, HCN and acrylonitrile were the most prominent compounds observed. Propene was the most abundant light-weight hydrocarbon detected by this technique, and was highly correlated with its oxidation products, formaldehyde and acetaldehyde, with typical propene-acetaldehyde ratios close to 1 in propene-dominated plumes. In the case of aromatic species the high time resolution of the obtained dataset helped in identifying different anthropogenic sources (e.g. industrial from urban emissions) and testing current emission inventories. In addition, a comparison with results from complimentary techniques (gas chromatography, differential optical absorption spectroscopy) was used to assess the selectivity of this on-line technique in a complex urban and industrial VOC matrix and give an interpretation of mass scans obtained by `soft' chemical ionization using proton-transfer via H3O+.

  9. Modeling of Non-Isothermal Cryogenic Fluid Sloshing

    NASA Technical Reports Server (NTRS)

    Agui, Juan H.; Moder, Jeffrey P.

    2015-01-01

    A computational fluid dynamic model was used to simulate the thermal destratification in an upright self-pressurized cryostat approximately half-filled with liquid nitrogen and subjected to forced sinusoidal lateral shaking. A full three-dimensional computational grid was used to model the tank dynamics, fluid flow and thermodynamics using the ANSYS Fluent code. A non-inertial grid was used which required the addition of momentum and energy source terms to account for the inertial forces, energy transfer and wall reaction forces produced by the shaken tank. The kinetics-based Schrage mass transfer model provided the interfacial mass transfer due to evaporation and condensation at the sloshing interface. The dynamic behavior of the sloshing interface, its amplitude and transition to different wave modes, provided insight into the fluid process at the interface. The tank pressure evolution and temperature profiles compared relatively well with the shaken cryostat experimental test data provided by the Centre National D'Etudes Spatiales.

  10. Impact of kinetic mass transfer on free convection in a porous medium

    NASA Astrophysics Data System (ADS)

    Lu, Chunhui; Shi, Liangsheng; Chen, Yiming; Xie, Yueqing; Simmons, Craig T.

    2016-05-01

    We investigate kinetic mass transfer effects on unstable density-driven flow and transport processes by numerical simulations of a modified Elder problem. The first-order dual-domain mass transfer model coupled with a variable-density-flow model is employed to describe transport behavior in porous media. Results show that in comparison to the no-mass-transfer case, a higher degree of instability and more unstable system is developed in the mass transfer case due to the reduced effective porosity and correspondingly a larger Rayleigh number (assuming permeability is independent on the mobile porosity). Given a constant total porosity, the magnitude of capacity ratio (i.e., immobile porosity/mobile porosity) controls the macroscopic plume profile in the mobile domain, while the magnitude of mass transfer timescale (i.e., the reciprocal of the mass transfer rate coefficient) dominates its evolution rate. The magnitude of capacity ratio plays an important role on the mechanism driving the mass flux into the aquifer system. Specifically, for a small capacity ratio, solute loading is dominated by the density-driven transport, while with increasing capacity ratio local mass transfer dominated solute loading may occur at later times. At significantly large times, however, both mechanisms contribute comparably to solute loading. Sherwood Number could be a nonmonotonic function of mass transfer timescale due to complicated interactions of solute between source zone, mobile zone and immobile zone in the top boundary layer, resulting in accordingly a similar behavior of the total mass. The initial assessment provides important insights into unstable density-driven flow and transport in the presence of kinetic mass transfer.

  11. Solution-Based 3D Printing of Polymers of Intrinsic Microporosity.

    PubMed

    Zhang, Fengyi; Ma, Yao; Liao, Jianshan; Breedveld, Victor; Lively, Ryan P

    2018-05-28

    Current additive manufacturing methods have significant limitations in the classes of compatible polymers. Many polymers of significant technological interest cannot currently be 3D printed. Here, a generalizable method for 3D printing of viscous tenary polymer solutions (polymer/solvent/nonsolvent) is applied to both "intrinsically porous" (a polymer of intrinsic microporosity, PIM-1) and "intrinsically nonporous" (cellulose acetate) polymers. Successful ternary ink formulations require balancing of solution thermodynamics (phase separation), mass transfer (solvent evaporation), and rheology. As a demonstration, a microporous polymer (PIM-1) incompatible with current additive manufacturing technologies is 3D printed into a high-efficiency mass transfer contactor exhibiting hierarchical porosity ranging from sub-nanometer to millimeter pores. Short contactors (1.27 cm) can fully purify (<1 ppm) toluene vapor (1000 ppm) in N 2 gas for 1.7 h, which is six times longer than PIM-1 in traditional structures, and more than 4000 times the residence time of gas in the contactor. This solution-based additive manufacturing approach greatly extends the range of 3D-printable materials. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  12. Prediction of mass transfer coefficient in rotating bed contactor (Higee) using artificial neural network

    NASA Astrophysics Data System (ADS)

    Saha, Dipendu

    2009-02-01

    The feasibility of drastically reducing the contactor size in mass transfer processes utilizing centrifugal field has generated a lot of interest in rotating packed bed (Higee). Various investigators have proposed correlations to predict mass transfer coefficients in Higee, but, none of the correlations was more than 20-30% accurate. In this work, artificial neural network (ANN) is employed for predicting mass transfer coefficient data. Results show that ANN provides better estimation of mass transfer coefficient with accuracy 5-15%.

  13. Application of the two-film model to the volatilization of acetone and t-butyl alcohol from water as a function of temperature

    USGS Publications Warehouse

    Rathbun, R.E.; Tai, D.Y.

    1988-01-01

    The two-film model is often used to describe the volatilization of organic substances from water. This model assumes uniformly mixed water and air phases separated by thin films of water and air in which mass transfer is by molecular diffusion. Mass-transfer coefficients for the films, commonly called film coefficients, are related through the Henry's law constant and the model equation to the overall mass-transfer coefficient for volatilization. The films are modeled as two resistances in series, resulting in additive resistances. The two-film model and the concept of additivity of resistances were applied to experimental data for acetone and t-butyl alcohol. Overall mass-transfer coefficients for the volatilization of acetone and t-butyl alcohol from water were measured in the laboratory in a stirred constant-temperature bath. Measurements were completed for six water temperatures, each at three water mixing conditions. Wind-speed was constant at about 0.1 meter per second for all experiments. Oxygen absorption coefficients were measured simultaneously with the measurement of the acetone and t-butyl alcohol mass-transfer coefficients. Gas-film coefficients for acetone, t-butyl alcohol, and water were determined by measuring the volatilization fluxes of the pure substances over a range of temperatures. Henry's law constants were estimated from data from the literature. The combination of high resistance in the gas film for solutes with low values of the Henry's law constants has not been studied previously. Calculation of the liquid-film coefficients for acetone and t-butyl alcohol from measured overall mass-transfer and gas-film coefficients, estimated Henry's law constants, and the two-film model equation resulted in physically unrealistic, negative liquid-film coefficients for most of the experiments at the medium and high water mixing conditions. An analysis of the two-film model equation showed that when the percentage resistance in the gas film is large and the gas-film resistance approaches the overall resistance in value, the calculated liquid-film coefficient becomes extremely sensitive to errors in the Henry's law constant. The negative coefficients were attributed to this sensitivity and to errors in the estimated Henry's law constants. Liquid-film coefficients for the absorption of oxygen were correlated with the stirrer Reynolds number and the Schmidt number. Application of this correlation with the experimental conditions and a molecular-diffusion coefficient adjustment resulted in values of the liquid-film coefficients for both acetone and t-butyl alcohol within the range expected for all three mixing conditions. Comparison of Henry's law constants calculated from these film coefficients and the experimental data with the constants calculated from literature data showed that the differences were small relative to the errors reported in the literature as typical for the measurement or estimation of Henry's law constants for hydrophilic compounds such as ketones and alcohols. Temperature dependence of the mass-transfer coefficients was expressed in two forms. The first, based on thermodynamics, assumed the coefficients varied as the exponential of the reciprocal absolute temperature. The second empirical approach assumed the coefficients varied as the exponential of the absolute temperature. Both of these forms predicted the temperature dependence of the experimental mass-transfer coefficients with little error for most of the water temperature range likely to be found in streams and rivers. Liquid-film and gas-film coefficients for acetone and t-butyl alcohol were similar in value. However, depending on water mixing conditions, overall mass-transfer coefficients for acetone were from two to four times larger than the coefficients for t-butyl alcohol. This difference in behavior of the coefficients resulted because the Henry's law constant for acetone was about three times larger than that of

  14. Devices with extended area structures for mass transfer processing of fluids

    DOEpatents

    TeGrotenhuis, Ward E.; Wegeng, Robert S.; Whyatt, Greg A.; King, David L.; Brooks, Kriston P.; Stenkamp, Victoria S.

    2009-04-21

    A microchannel device includes several mass transfer microchannels to receive a fluid media for processing at least one heat transfer microchannel in fluid communication with a heat transfer fluid defined by a thermally conductive wall, and at several thermally conductive fins each connected to the wall and extending therefrom to separate the mass transfer microchannels from one another. In one form, the device may optionally include another heat transfer microchannel and corresponding wall that is positioned opposite the first wall and has the fins and the mass transfer microchannels extending therebetween.

  15. Minimum Energy of Multicomponent Distillation Systems Using Minimum Additional Heat and Mass Integration Sections

    DOE PAGES

    Jiang, Zheyu; Ramapriya, Gautham Madenoor; Tawarmalani, Mohit; ...

    2018-04-20

    Heat and mass integration to consolidate distillation columns in a multicomponent distillation configuration can lead to a number of new energy efficient and cost effective configurations. In this paper, we identify a powerful and simple-to-use fact about heat and mass integration. The newly developed heat and mass integrated configurations, which we call as HMP configurations, involve first introducing thermal couplings to all intermediate transfer streams, followed by consolidating columns associated with a lighter pure product reboiler and a heavier pure product condenser. A systematic method of enumerating all HMP configurations is introduced. We compare the energy savings of HMP configurationsmore » with the well-known fully thermally coupled (FTC) configurations. We demonstrate that HMP configurations can have very similar and sometimes even the same minimum total vapor duty requirement as the FTC configuration, while using far less number of column sections, intermediate transfer streams, and thermal couplings than the FTC configurations.« less

  16. DOE Office of Scientific and Technical Information (OSTI.GOV)

    Watson, Thomas B.

    The Proton Transfer Reaction Mass Spectrometer (PTRMS) measures gas-phase compounds in ambient air and headspace samples before using chemical ionization to produce positively charged molecules, which are detected with a time-of-flight (TOF) mass spectrometer. This ionization method uses a gentle proton transfer reaction method between the molecule of interest and protonated water, or hydronium ion (H 3O +), to produce limited fragmentation of the parent molecule. The ions produced are primarily positively charged with the mass of the parent ion, plus an additional proton. Ion concentration is determined by adding the number of ions counted at the molecular ion’s mass-to-chargemore » ratio to the number of air molecules in the reaction chamber, which can be identified according to the pressure levels in the reaction chamber. The PTRMS allows many volatile organic compounds in ambient air to be detected at levels from 10–100 parts per trillion by volume (pptv). The response time is 1 to 10 seconds.« less

  17. Minimum Energy of Multicomponent Distillation Systems Using Minimum Additional Heat and Mass Integration Sections

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Jiang, Zheyu; Ramapriya, Gautham Madenoor; Tawarmalani, Mohit

    Heat and mass integration to consolidate distillation columns in a multicomponent distillation configuration can lead to a number of new energy efficient and cost effective configurations. In this paper, we identify a powerful and simple-to-use fact about heat and mass integration. The newly developed heat and mass integrated configurations, which we call as HMP configurations, involve first introducing thermal couplings to all intermediate transfer streams, followed by consolidating columns associated with a lighter pure product reboiler and a heavier pure product condenser. A systematic method of enumerating all HMP configurations is introduced. We compare the energy savings of HMP configurationsmore » with the well-known fully thermally coupled (FTC) configurations. We demonstrate that HMP configurations can have very similar and sometimes even the same minimum total vapor duty requirement as the FTC configuration, while using far less number of column sections, intermediate transfer streams, and thermal couplings than the FTC configurations.« less

  18. An advanced model of heat and mass transfer in the protective clothing - verification

    NASA Astrophysics Data System (ADS)

    Łapka, P.; Furmański, P.

    2016-09-01

    The paper presents an advanced mathematical and numerical models of heat and mass transfer in the multi-layers protective clothing and in elements of the experimental stand subjected to either high surroundings temperature or high radiative heat flux emitted by hot objects. The model included conductive-radiative heat transfer in the hygroscopic porous fabrics and air gaps as well as conductive heat transfer in components of the stand. Additionally, water vapour diffusion in the pores and air spaces as well as phase transition of the bound water in the fabric fibres (sorption and desorption) were accounted for. The thermal radiation was treated in the rigorous way e.g.: semi-transparent absorbing, emitting and scattering fabrics were assumed a non-grey and all optical phenomena at internal or external walls were modelled. The air was assumed transparent. Complex energy and mass balance as well as optical conditions at internal or external interfaces were formulated in order to find exact values of temperatures, vapour densities and radiation intensities at these interfaces. The obtained highly non-linear coupled system of discrete equation was solve by the in-house iterative algorithm which was based on the Finite Volume Method. The model was then successfully partially verified against the results obtained from commercial software for simplified cases.

  19. Tower reactors for bioconversion of lignocellulosic material

    DOEpatents

    Nguyen, Quang A.

    1999-01-01

    An apparatus for enzymatic hydrolysis and fermentation of pretreated lignocellulosic material, in the form of a tower bioreactor, having mixers to achieve intermittent mixing of the material. Precise mixing of the material is important for effective heat and mass transfer requirements without damaging or denaturing the enzymes or fermenting microorganisms. The pretreated material, generally in the form of a slurry, is pumped through the bioreactor, either upwards or downwards, and is mixed periodically as it passes through the mixing zones where the mixers are located. For a thin slurry, alternate mixing can be achieved by a pumping loop which also serves as a heat transfer device. Additional heat transfer takes place through the reactor heat transfer jackets.

  20. Tower reactors for bioconversion of lignocellulosic material

    DOEpatents

    Nguyen, Quang A.

    1998-01-01

    An apparatus for enzymatic hydrolysis and fermentation of pretreated lignocellulosic material, in the form of a tower bioreactor, having mixers to achieve intermittent mixing of the material. Precise mixing of the material is important for effective heat and mass transfer requirements without damaging or denaturing the enzymes or fermenting microorganisms. The pretreated material, generally in the form of a slurry, is pumped through the bioreactor, either upwards of downwards, and is mixed periodically as it passes through the mixing zones where the mixers are located. For a thin slurry, alternate mixing can be achieved by a pumping loop which also serves as a heat transfer device. Additional heat transfer takes place through the reactor heat transfer jackets.

  1. Non-perturbative reheating and Nnaturalness

    NASA Astrophysics Data System (ADS)

    Hardy, Edward

    2017-11-01

    We study models in which reheating happens only through non-perturbative processes. The energy transferred can be exponentially suppressed unless the inflaton is coupled to a particle with a parametrically small mass. Additionally, in some models a light scalar with a negative mass squared parameter leads to much more efficient reheating than one with a positive mass squared of the same magnitude. If a theory contains many sectors similar to the Standard Model coupled to the inflaton via their Higgses, such dynamics can realise the Nnaturalness solution to the hierarchy problem. A sector containing a light Higgs with a non-zero vacuum expectation value is dominantly reheated and there is little energy transferred to the other sectors, consistent with cosmological constraints. The inflaton must decouple from other particles and have a flat potential at large field values, in which case the visible sector UV cutoff can be raised to 10 TeV in a simple model.

  2. Volatilization of organic compounds from streams

    USGS Publications Warehouse

    Rathburn, R.E.; Tai, D.Y.

    1982-01-01

    Mass-transfer coefficients for the volatilization of ethylene and propane were correlated with the hydraulic and geometric properties of seven streams, and predictive equations were developed. The equations were evaluated using a normalized root-mean-square error as the criterion of comparison. The two best equations were a two-variable equation containing the energy dissipated per unit mass per unit time and the average depth of flow and a three-variable equation containing the average velocity, the average depth of flow, and the slope of the stream. Procedures for adjusting the ethylene and propane coefficients for other organic compounds were evaluated. These procedures are based on molecular diffusivity, molecular diameter, or molecular weight. Because of limited data, none of these procedures have been extensively verified. Therefore, until additional data become available, it is suggested that the mass-transfer coefficient be assumed to be inversely proportional to the square root of the molecular weight.

  3. Corrosion and Heat Transfer Characteristics of Water Dispersed with Carboxylate Additives and Multi Walled Carbon Nano Tubes

    NASA Astrophysics Data System (ADS)

    Moorthy, Chellapilla V. K. N. S. N.; Srinivas, Vadapalli

    2016-10-01

    This paper summarizes a recent work on anti-corrosive properties and enhanced heat transfer properties of carboxylated water based nanofluids. Water mixed with sebacic acid as carboxylate additive found to be resistant to corrosion and suitable for automotive environment. The carboxylated water is dispersed with very low mass concentration of carbon nano tubes at 0.025, 0.05 and 0.1 %. The stability of nanofluids in terms of zeta potential is found to be good with carboxylated water compared to normal water. The heat transfer performance of nanofluids is carried out on an air cooled heat exchanger similar to an automotive radiator with incoming air velocities across radiator at 5, 10 and 15 m/s. The flow Reynolds number of water is in the range of 2500-6000 indicating developing flow regime. The corrosion resistance of nanofluids is found to be good indicating its suitability to automotive environment. There is a slight increase in viscosity and marginal decrease in the specific heat of nanofluids with addition of carboxylate as well as CNTs. Significant improvement is observed in the thermal conductivity of nanofluids dispersed with CNTs. During heat transfer experimentation, the inside heat transfer coefficient and overall heat transfer coefficient has also improved markedly. It is also found that the velocity of air and flow rate of coolant plays an important role in enhancement of the heat transfer coefficient and overall heat transfer coefficient.

  4. Practice schedules for surgical skills: the role of task characteristics and proactive interference on psychomotor skills acquisition.

    PubMed

    Willis, Ross E; Curry, Eileen; Gomez, Pedro Pablo

    2013-01-01

    Although break periods during training sessions are desirable, it is unclear what learners should do during these breaks. Some educators recommend that learners abstain from all task-related practice; however, it is possible that switching to an alternate exercise during break periods can also be effective. The construct of proactive interference (PI) posits that new learning is disrupted by prior learning. PI can be "released" when the nature of the task is changed after several practice trials. In this study, we examined the existence of PI in motor learning under 5 training conditions that differed in contrast to a target exercise. Preclinical medical students (n = 75) performed 1 trial of peg transfer as a pretest. Participants were then randomly assigned to 1 of 5 training conditions: mass practice, similar exercise (laparoscopic bean transfer), dissimilar exercise (open suturing), observation, or rest. Participants in the mass practice condition practiced peg transfer in 3 training blocks of 15 minutes, each separated by a 5-minute break. Participants in the other conditions performed 3 training blocks consisting of 15 minutes of peg transfer followed by an interspersed alternate exercise. On completion of 3 training blocks, participants performed 1 additional peg transfer trial as a posttest. Despite having trained for the same amount of time on the target task, Analysis of Covariance on posttest scores using pretest scores as the covariate indicated a significant main effect for training condition (p = 0.009). Participants engaging in mass practice performed significantly worse than participants in the dissimilar (p = 0.012), observation (p = 0.022), and rest (p < 0.001) conditions. Additionally, participants in the similar exercise condition performed worse than participants in the rest condition (p = 0.03). When learning a laparoscopic task, a break comprised of dissimilar practice or unrelated activities is effective in releasing PI and improving performance. © 2013 Association of Program Directors in Surgery. Published by Elsevier Inc. All rights reserved.

  5. A Near-Infrared Surface Compositional Analysis of Blue Straggler Stars in Open Cluster M67

    NASA Astrophysics Data System (ADS)

    Seifert, Richard; Gosnell, Natalie M.; Sneden, Chris

    2017-06-01

    Blue straggler stars (BSSs) are stars whose evolutions have been directly impacted by binary system interactions. By obtaining additional mass from a companion, BSSs are able to live prolonged lives on the main sequence. BSSs bring confusions to studies that rely on a standard stellar evolutionary track when modeling stellar populations, since the presence of BSSs can make a population appear younger than it actually is. It is important to have a better understanding of the mechanisms that drive BSS formation so that BSSs may be correctly accounted for in future studies.Blue stagglers in clusters primarily form in one of two ways; either from a close binary system in which one star accretes mass from its companion star or from a hierarchical trinary system in which a close inner binary merges as a result of perturbations from a farther-orbiting third star. In order to investigate the nature of this mass transfer, We obtained IGRINS H-band high resolution spectra of 6 BSSs and 12 red giant stars in open cluster M67. Using a grid of synthetic spectra obtained from the line analysis code MOOG, we identified and fit abundances for absorption lines of iron, silicon, and carbon. Depending on the evolutionary stage of the donor star, the abundance of carbon in the resulting BSS can be affected by mixing during the mass transfer. By analyzing the abundance of carbon in our targets, we find that [Fe/H] ~= 0 and [C/H] ~= 0. We see no evidence of depletion of carbon from RGB-phase mass transfer or enhancement of carbon from AGB-phase mass transfer, implying that the mass transfer occured earlier in the donar star's evolution.Funding for this research comes from the John W. Cox endowment for the Advanced Studies in Astronomy. For support of this work we acknowledge NSF grants AST-1211585 and AST-1616040 to CS. The successful development of the IGRINS spectrograph has resulted from the combined efforts of teams at the University of Texas at Austin and the Korea Astronomy and Space Science Institute; their work is gratefully acknowledged.

  6. Sensorimotor memory of object weight distribution during multidigit grasp.

    PubMed

    Albert, Frederic; Santello, Marco; Gordon, Andrew M

    2009-10-09

    We studied the ability to transfer three-digit force sharing patterns learned through consecutive lifts of an object with an asymmetric center of mass (CM). After several object lifts, we asked subjects to rotate and translate the object to the contralateral hand and perform one additional lift. This task was performed under two weight conditions (550 and 950 g) to determine the extent to which subjects would be able to transfer weight and CM information. Learning transfer was quantified by measuring the extent to which force sharing patterns and peak object roll on the first post-translation trial resembled those measured on the pre-translation trial with the same CM. We found that the overall gain of fingertip forces was transferred following object rotation, but that the scaling of individual digit forces was specific to the learned digit-object configuration, and thus was not transferred following rotation. As a result, on the first post-translation trial there was a significantly larger object roll following object lift-off than on the pre-translation trial. This suggests that sensorimotor memories for weight, requiring scaling of fingertip force gain, may differ from memories for mass distribution.

  7. Binary progenitors of supernovae

    NASA Astrophysics Data System (ADS)

    Trimble, V.

    1984-12-01

    Among the massive stars that are expected to produce Type II, hydrogen-rich supernovae, the presence of a close companion can increase the main sequence mass needed to yield a collapsing core. In addition, due to mass transfer from the primary to the secondary, the companion enhances the stripping of the stellar hydrogen envelope produced by single star winds and thereby makes it harder for the star to give rise to a typical SN II light curve. Among the less massive stars that may be the basis for Type I, hydrogen-free supernovae, a close companion could be an innocent bystander to carbon detonation/deflagration in the primary. It may alternatively be a vital participant which transfers material to a white dwarf primary and drives it to explosive conditions.

  8. On the hydrophilicity of polyzwitterion poly (N,N-dimethyl-N-(3-(methacrylamido)propyl)ammoniopropane sulfonate) in water, deuterated water, and aqueous salt solutions.

    PubMed

    Hildebrand, Viet; Laschewsky, André; Zehm, Daniel

    2014-01-01

    A series of zwitterionic model polymers with defined molar masses up to 150,000 Da and defined end groups are prepared from sulfobetaine monomer N,N-dimethyl-N-(3-(methacrylamido)propyl)ammoniopropanesulfonate (SPP). Polymers are synthesized by reversible addition-fragmentation chain transfer polymerization (RAFT) using a functional chain transfer agent labeled with a fluorescent probe. Their upper critical solution temperature-type coil-to-globule phase transition in water, deuterated water, and various salt solutions is studied by turbidimetry. Cloud points increase with polyzwitterion concentration and molar mass, being considerably higher in D2O than in H2O. Moreover, cloud points are strongly affected by the amount and nature of added salts. Typically, they increase with increasing salt concentration up to a maximum value, whereas further addition of salt lowers the cloud points again, mostly down to below freezing point. The different salting-in and salting-out effects of the studied anions can be correlated with the Hofmeister series. In physiological sodium chloride solution and in phosphate buffered saline (PBS), the cloud point is suppressed even for high molar mass samples. Accordingly, SPP-polymers behave strongly hydrophilic under most conditions encountered in biomedical applications. However, the direct transfer of results from model studies in D2O, using, e.g. (1)H NMR or neutron scattering techniques, to 'normal' systems in H2O is not obvious.

  9. Compression of deep convolutional neural network for computer-aided diagnosis of masses in digital breast tomosynthesis

    NASA Astrophysics Data System (ADS)

    Samala, Ravi K.; Chan, Heang-Ping; Hadjiiski, Lubomir; Helvie, Mark A.; Richter, Caleb; Cha, Kenny

    2018-02-01

    Deep-learning models are highly parameterized, causing difficulty in inference and transfer learning. We propose a layered pathway evolution method to compress a deep convolutional neural network (DCNN) for classification of masses in DBT while maintaining the classification accuracy. Two-stage transfer learning was used to adapt the ImageNet-trained DCNN to mammography and then to DBT. In the first-stage transfer learning, transfer learning from ImageNet trained DCNN was performed using mammography data. In the second-stage transfer learning, the mammography-trained DCNN was trained on the DBT data using feature extraction from fully connected layer, recursive feature elimination and random forest classification. The layered pathway evolution encapsulates the feature extraction to the classification stages to compress the DCNN. Genetic algorithm was used in an iterative approach with tournament selection driven by count-preserving crossover and mutation to identify the necessary nodes in each convolution layer while eliminating the redundant nodes. The DCNN was reduced by 99% in the number of parameters and 95% in mathematical operations in the convolutional layers. The lesion-based area under the receiver operating characteristic curve on an independent DBT test set from the original and the compressed network resulted in 0.88+/-0.05 and 0.90+/-0.04, respectively. The difference did not reach statistical significance. We demonstrated a DCNN compression approach without additional fine-tuning or loss of performance for classification of masses in DBT. The approach can be extended to other DCNNs and transfer learning tasks. An ensemble of these smaller and focused DCNNs has the potential to be used in multi-target transfer learning.

  10. Mass transfer in white dwarf-neutron star binaries

    NASA Astrophysics Data System (ADS)

    Bobrick, Alexey; Davies, Melvyn B.; Church, Ross P.

    2017-05-01

    We perform hydrodynamic simulations of mass transfer in binaries that contain a white dwarf and a neutron star (WD-NS binaries), and measure the specific angular momentum of material lost from the binary in disc winds. By incorporating our results within a long-term evolution model, we measure the long-term stability of mass transfer in these binaries. We find that only binaries containing helium white dwarfs (WDs) with masses less than a critical mass of MWD, crit = 0.2 M⊙ undergo stable mass transfer and evolve into ultracompact X-ray binaries. Systems with higher mass WDs experience unstable mass transfer, which leads to tidal disruption of the WD. Our low critical mass compared to the standard jet-only model of mass-loss arises from the efficient removal of angular momentum in the mechanical disc winds, which develop at highly super-Eddington mass-transfer rates. We find that the eccentricities expected for WD-NS binaries when they come into contact do not affect the loss of angular momentum, and can only affect the long-term evolution if they change on shorter time-scales than the mass-transfer rate. Our results are broadly consistent with the observed numbers of both ultracompact X-ray binaries and radio pulsars with WD companions. The observed calcium-rich gap transients are consistent with the merger rate of unstable systems with higher mass WDs.

  11. The effects of dual-domain mass transfer on the tritium-helium-3 dating method.

    PubMed

    Neumann, Rebecca B; Labolle, Eric M; Harvey, Charles F

    2008-07-01

    Diffusion of tritiated water (referred to as tritium) and helium-3 between mobile and immobile regions in aquifers (mass transfer) can affect tritium and helium-3 concentrations and hence tritium-helium-3 (3H/3He) ages that are used to estimate aquifer recharge and groundwater residence times. Tritium and helium-3 chromatographically separate during transport because their molecular diffusion coefficients differ. Simulations of tritium and helium-3 transport and diffusive mass transfer along stream tubes show that mass transfer can shift the 3H/3He age of the tritium and helium-3 concentration ([3H + 3He]) peak to dates much younger than the 1963 peak in atmospheric tritium. Furthermore, diffusive mass-transfer can cause the 3H/3He age to become younger downstream along a stream tube, even as the mean water-age must increase. Simulated patterns of [3H + 3He] versus 3H/3He age using a mass transfer model appear consistent with a variety of field data. These results suggest that diffusive mass transfer should be considered, especially when the [3H + 3He] peak is not well defined or appears younger than the atmospheric peak. 3H/3He data provide information about upstream mass-transfer processes that could be used to constrain mass-transfer models; however, uncritical acceptance of 3H/3He dates from aquifers with immobile regions could be misleading.

  12. New jet-aeration system using 'Supercavitation'.

    PubMed

    Schmid, Andreas

    2010-03-01

    A newly developed fine bubble aeration system, by which air is transferred under supercavitation conditions, shows a clearly better performance than traditional, well-known aerators that rely on the jet-pump principle and its performance can be compared to oxygen transfer rates achieved in membrane and foil plate aerators. A prototype supercavitation aerator installed at a sewage treatment plant revealed an air input rate, which was about one third lower than that of the jet-pump system, which it replaced. In spite of this low air input rate, the daily demand of pure oxygen for the additionally installed membrane aeration system went down by approximately 49%, from the original level of about 1,200 m(3)/day to about 600 m(3)/day-and this over a test period of more than 7 months. The observed high oxygen transfer rates cannot be explained by traditional mass transfer mechanisms. It is assumed that a large amount of water being transferred into the gas phase by supercavitation contacting directly oxygen also in the gas phase and thereby overcoming mass transfer hindrances which might be favoured by hydroxyl radicals. With this new aerator, during the first 3 months of test phase, already more than 10,000 Euros had been saved because of the reduced pure oxygen demand.

  13. Structural Mass Saving Potential of a 5-MW Direct-Drive Generator Designed for Additive Manufacturing

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Sethuraman, Latha; Fingersh, Lee J; Dykes, Katherine L

    As wind turbine blade diameters and tower height increase to capture more energy in the wind, higher structural loads results in more structural support material increasing the cost of scaling. Weight reductions in the generator transfer to overall cost savings of the system. Additive manufacturing facilitates a design-for-functionality approach, thereby removing traditional manufacturing constraints and labor costs. The most feasible additive manufacturing technology identified for large, direct-drive generators in this study is powder-binder jetting of a sand cast mold. A parametric finite element analysis optimization study is performed, optimizing for mass and deformation. Also, topology optimization is employed for eachmore » parameter-optimized design.The optimized U-beam spoked web design results in a 24 percent reduction in structural mass of the rotor and 60 percent reduction in radial deflection.« less

  14. Influence of the boundary conditions on heat and mass transfer in spacer-filled channels

    NASA Astrophysics Data System (ADS)

    Ciofalo, M.; La Cerva, M. F.; Di Liberto, M.; Tamburini, A.

    2017-11-01

    The purpose of this study is to discuss some problems which arise in heat or mass transfer in complex channels, with special reference to the spacer-filled channels adopted in membrane processes. Among the issues addressed are the consistent definition of local and mean heat or mass transfer coefficients; the influence of the wall boundary conditions; the influence of one-side versus two-side heat/mass transfer. Most of the results discussed were obtained by finite volume CFD simulations concerning heat transfer in Membrane Distillation or mass transfer in Electrodialysis and Reverse Electrodialysis, but many of the conclusions apply also to different processes involving geometrically complex channels

  15. Investigation of Ion Transmission Effects on Intact Protein Quantification in a Triple Quadrupole Mass Spectrometer

    NASA Astrophysics Data System (ADS)

    Wang, Evelyn H.; Appulage, Dananjaya Kalu; McAllister, Erin A.; Schug, Kevin A.

    2017-09-01

    Recently, direct intact protein quantitation using triple quadrupole mass spectrometry (QqQ-MS) and multiple reaction monitoring (MRM) was demonstrated (J. Am. Soc. Mass Spectrom. 27, 886-896 (2016)). Even though QqQ-MS is known to provide extraordinary detection sensitivity for quantitative analysis, we found that intact proteins exhibited a less than 5% ion transmission from the first quadrupole to the third quadrupole mass analyzer in the presence of zero collision energy (ZCE). With the goal to enhance intact protein quantitation sensitivity, ion scattering effects, proton transfer effects, and mass filter resolution widths were examined for their contributions to the lost signal. Protein standards myoglobin and ubiquitin along with small molecules reserpine and vancomycin were analyzed together with various collision induced dissociation (CID) gases (N2, He, and Ar) at different gas pressures. Mass resolution settings played a significant role in reducing ion transmission signal. By narrowing the mass resolution window by 0.35 m/z on each side, roughly 75%-90% of the ion signal was lost. The multiply charged proteins experienced additional proton transfer effects, corresponding to 10-fold signal reduction. A study of increased sensitivity of the method was also conducted with various MRM summation techniques. Although the degree of enhancement was analyte-dependent, an up to 17-fold increase in sensitivity was observed for ubiquitin using a summation of multiple MRM transitions. Biological matrix, human urine, and equine plasma were spiked with proteins to demonstrate the specificity of the method. This study provides additional insight into optimizing the use and sensitivity of QqQ-MS for intact protein quantification. [Figure not available: see fulltext.

  16. Suitability of the first-order mass transfer concept for describing cyclic diffusive mass transfer in stagnant zones

    NASA Astrophysics Data System (ADS)

    Griffioen, Jasper

    1998-10-01

    The concept of first-order mass transfer between mobile and immobile regions, which mathematically simplifies the concept of Fickian diffusion in stagnant areas, has often been used to describe physical nonequilibrium transport of solutes into natural porous media. This study compares the two concepts, using analytical expressions describing cyclic mass transfer into and out of stagnant layers. The results show that the first-order mass transfer concept cannot describe continuous diffusion into the immobile zone during period of net outward diffusion if the immobile zone has not filled completely during the period of net inward diffusion. This sets phenomenological limitations to the first-order mass transfer concept when short periods of relative time are involved; these limitations have to be compared with the practical limitations to the Fickian diffusion concept.

  17. Tower reactors for bioconversion of lignocellulosic material

    DOEpatents

    Nguyen, Q.A.

    1998-03-31

    An apparatus is disclosed for enzymatic hydrolysis and fermentation of pretreated lignocellulosic material. The apparatus consists of a tower bioreactor which has mixers to achieve intermittent mixing of the material. Precise mixing of the material is important for effective heat and mass transfer requirements without damaging or denaturing the enzymes or fermenting microorganisms. The pretreated material, generally in the form of a slurry, is pumped through the bioreactor, either upwards or downwards, and is mixed periodically as it passes through the mixing zones where the mixers are located. For a thin slurry, alternate mixing can be achieved by a pumping loop which also serves as a heat transfer device. Additional heat transfer takes place through the reactor heat transfer jackets. 5 figs.

  18. Tower reactors for bioconversion of lignocellulosic material

    DOEpatents

    Nguyen, Q.A.

    1999-03-30

    An apparatus is described for enzymatic hydrolysis and fermentation of pretreated lignocellulosic material, in the form of a tower bioreactor, having mixers to achieve intermittent mixing of the material. Precise mixing of the material is important for effective heat and mass transfer requirements without damaging or denaturing the enzymes or fermenting microorganisms. The pretreated material, generally in the form of a slurry, is pumped through the bioreactor, either upwards or downwards, and is mixed periodically as it passes through the mixing zones where the mixers are located. For a thin slurry, alternate mixing can be achieved by a pumping loop which also serves as a heat transfer device. Additional heat transfer takes place through the reactor heat transfer jackets. 5 figs.

  19. A nonequilibrium model for reactive contaminant transport through fractured porous media: Model development and semianalytical solution

    NASA Astrophysics Data System (ADS)

    Joshi, Nitin; Ojha, C. S. P.; Sharma, P. K.

    2012-10-01

    In this study a conceptual model that accounts for the effects of nonequilibrium contaminant transport in a fractured porous media is developed. Present model accounts for both physical and sorption nonequilibrium. Analytical solution was developed using the Laplace transform technique, which was then numerically inverted to obtain solute concentration in the fracture matrix system. The semianalytical solution developed here can incorporate both semi-infinite and finite fracture matrix extent. In addition, the model can account for flexible boundary conditions and nonzero initial condition in the fracture matrix system. The present semianalytical solution was validated against the existing analytical solutions for the fracture matrix system. In order to differentiate between various sorption/transport mechanism different cases of sorption and mass transfer were analyzed by comparing the breakthrough curves and temporal moments. It was found that significant differences in the signature of sorption and mass transfer exists. Applicability of the developed model was evaluated by simulating the published experimental data of Calcium and Strontium transport in a single fracture. The present model simulated the experimental data reasonably well in comparison to the model based on equilibrium sorption assumption in fracture matrix system, and multi rate mass transfer model.

  20. The long-term dissolution characteristics of a residually trapped BTX mixture in soil

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Rixey, W.G.

    1996-12-31

    A mass transfer limited model is presented to describe the long-term dissolution of organic compounds from a benzene, toluene, and xylenes (BTX) mixture residually trapped in a sandy soil. The model is an extension of a previously presented equilibrium dissolution model which takes into consideration mass transfer limitations that develop later in the leaching process and is similar to that presented by Borden and Kao for modeling BTX dissolution from residually trapped gasoline. The residual nonaqueous phase liquid (NAPL) is divided into multiple regions: one region which undergoes equilibrium dissolution and additional regions in which mass transfer is progressively limited.more » Application of the model to BTX column effluent data indicates that the initial dissolution (exponential decay region) of BTX can be effectively described by equilibrium dissolution. When applied to later dissolution times (Asymptotic region) a multiple-region model is required to rationalize the data for all three components. This explanation of the observed tailing in leaching experiments form residually trapped hydrocarbons if offered as an alternative to the explanation of tailing due to rate-limited desorption from soils. 16 refs., 5 figs., 2 tabs.« less

  1. Monitoring the variations of the oxygen transfer rate in a full scale membrane bioreactor using daily mass balances.

    PubMed

    Racault, Y; Stricker, A-E; Husson, A; Gillot, S

    2011-01-01

    Oxygen transfer in biological wastewater treatment processes with high sludge concentration, such as membrane bioreactor (MBR), is an important issue. The variation of alpha-factor versus mixed liquor suspended solids (MLSS) concentration was investigated in a full scale MBR plant under process conditions, using mass balances. Exhaustive data from the Supervisory Control And Data Acquisition (SCADA) and from additional online sensors (COD, DO, MLSS) were used to calculate the daily oxygen consumption (OC) using a non-steady state mass balance for COD and total N on a 24-h basis. To close the oxygen balance, OC has to match the total oxygen transfer rate (OTRtot) of the system, which is provided by fine bubble (FB) diffusers in the aeration tank and coarse bubbles (CB) in separate membrane tanks. First assessing OTR(CB) then closing the balance OC = OTRtot allowed to calculate OTR(FB) and to fit an exponential relationship between OTR(FB) and MLSS. A comparison of the alpha-factor obtained by this balance method and by direct measurements with the off-gas method on the same plant is presented and discussed.

  2. Multi-task transfer learning deep convolutional neural network: application to computer-aided diagnosis of breast cancer on mammograms

    NASA Astrophysics Data System (ADS)

    Samala, Ravi K.; Chan, Heang-Ping; Hadjiiski, Lubomir M.; Helvie, Mark A.; Cha, Kenny H.; Richter, Caleb D.

    2017-12-01

    Transfer learning in deep convolutional neural networks (DCNNs) is an important step in its application to medical imaging tasks. We propose a multi-task transfer learning DCNN with the aim of translating the ‘knowledge’ learned from non-medical images to medical diagnostic tasks through supervised training and increasing the generalization capabilities of DCNNs by simultaneously learning auxiliary tasks. We studied this approach in an important application: classification of malignant and benign breast masses. With Institutional Review Board (IRB) approval, digitized screen-film mammograms (SFMs) and digital mammograms (DMs) were collected from our patient files and additional SFMs were obtained from the Digital Database for Screening Mammography. The data set consisted of 2242 views with 2454 masses (1057 malignant, 1397 benign). In single-task transfer learning, the DCNN was trained and tested on SFMs. In multi-task transfer learning, SFMs and DMs were used to train the DCNN, which was then tested on SFMs. N-fold cross-validation with the training set was used for training and parameter optimization. On the independent test set, the multi-task transfer learning DCNN was found to have significantly (p  =  0.007) higher performance compared to the single-task transfer learning DCNN. This study demonstrates that multi-task transfer learning may be an effective approach for training DCNN in medical imaging applications when training samples from a single modality are limited.

  3. Microfluidic droplet-based liquid-liquid extraction.

    PubMed

    Mary, Pascaline; Studer, Vincent; Tabeling, Patrick

    2008-04-15

    We study microfluidic systems in which mass exchanges take place between moving water droplets, formed on-chip, and an external phase (octanol). Here, no chemical reaction takes place, and the mass exchanges are driven by a contrast in chemical potential between the dispersed and continuous phases. We analyze the case where the microfluidic droplets, occupying the entire width of the channel, extract a solute-fluorescein-from the external phase (extraction) and the opposite case, where droplets reject a solute-rhodamine-into the external phase (purification). Four flow configurations are investigated, based on straight or zigzag microchannels. Additionally to the experimental work, we performed two-dimensional numerical simulations. In the experiments, we analyze the influence of different parameters on the process (channel dimensions, fluid viscosities, flow rates, drop size, droplet spacing, ...). Several regimes are singled out. In agreement with the mass transfer theory of Young et al. (Young, W.; Pumir, A.; Pomeau, Y. Phys. Fluids A 1989, 1, 462), we find that, after a short transient, the amount of matter transferred across the droplet interface grows as the square root of time and the time it takes for the transfer process to be completed decreases as Pe-2/3, where Pe is the Peclet number based on droplet velocity and radius. The numerical simulation is found in excellent consistency with the experiment. In practice, the transfer time ranges between a fraction and a few seconds, which is much faster than conventional systems.

  4. A mass-balance model to separate and quantify colloidal and solute redistributions in soil

    USGS Publications Warehouse

    Bern, C.R.; Chadwick, O.A.; Hartshorn, A.S.; Khomo, L.M.; Chorover, J.

    2011-01-01

    Studies of weathering and pedogenesis have long used calculations based upon low solubility index elements to determine mass gains and losses in open systems. One of the questions currently unanswered in these settings is the degree to which mass is transferred in solution (solutes) versus suspension (colloids). Here we show that differential mobility of the low solubility, high field strength (HFS) elements Ti and Zr can trace colloidal redistribution, and we present a model for distinguishing between mass transfer in suspension and solution. The model is tested on a well-differentiated granitic catena located in Kruger National Park, South Africa. Ti and Zr ratios from parent material, soil and colloidal material are substituted into a mixing equation to quantify colloidal movement. The results show zones of both colloid removal and augmentation along the catena. Colloidal losses of 110kgm-2 (-5% relative to parent material) are calculated for one eluviated soil profile. A downslope illuviated profile has gained 169kgm-2 (10%) colloidal material. Elemental losses by mobilization in true solution are ubiquitous across the catena, even in zones of colloidal accumulation, and range from 1418kgm-2 (-46%) for an eluviated profile to 195kgm-2 (-23%) at the bottom of the catena. Quantification of simultaneous mass transfers in solution and suspension provide greater specificity on processes within soils and across hillslopes. Additionally, because colloids include both HFS and other elements, the ability to quantify their redistribution has implications for standard calculations of soil mass balances using such index elements. ?? 2011.

  5. Investigating Mass Transport Limitations on Xylan Hydrolysis During Dilute Acid Pretreatment of Poplar

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Mittal, Ashutosh; Pilath, Heid M.; Parent, Yves

    2014-04-28

    Mass transport limitations could be an impediment to achieving high sugar yields during biomass pretreatment and thus be a critical factor in the economics of biofuels production. The objective of this work was to study the mass transfer restrictions imposed by the structure of biomass on the hydrolysis of xylan during dilute acid pretreatment of biomass. Mass transfer effects were studied by pretreating poplar wood at particle sizes ranging from 10 micrometers to 10 mm. This work showed a significant reduction in the rate of xylan hydrolysis in poplar when compared to the intrinsic rate of hydrolysis for isolated xylanmore » that is possible in the absence of mass transfer. In poplar samples we observed no significant difference in the rates of xylan hydrolysis over more than two orders of magnitude in particle size. It appears that no additional mass transport restrictions are introduced by increasing particle size from 10 micrometers to 10 mm. This work suggests that the rates of xylan hydrolysis in biomass particles are limited primarily by the diffusion of hydrolysis products out of plant cell walls. A mathematical description is presented to describe the kinetics of xylan hydrolysis that includes transport of the hydrolysis products through biomass into the bulk solution. The modeling results show that the effective diffusion coefficient of the hydrolysis products in the cell wall is several orders of magnitude smaller than typical values in other applications signifying the role of plant cell walls in offering resistance to diffusion of the hydrolysis products.« less

  6. Mass and heat transfer in crushed oil shale

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Carley, J.F.; Straub, J.S.; Ott, L.L.

    1984-04-01

    Heat and mass transfer between gases and oil-shale particles are both important for all proposed retorting processes. Past studies of transfer in packed beds, which have disagreed substantially in their results, have nearly all been done with beds of regular particles of uniform size, whereas oil-shale retorting involves particles of diverse shapes and widely ranging sizes. To resolve these questions, we have made 349 runs in which we measured mass-transfer rates from naphthalene particles of diverse shapes buried in packed beds through which air was passed at room temperature. This technique permits calculation of the mass-transfer coefficient for each activemore » particle in the bed rather than, as in most past studies, for the bed as a whole. The data were analyzed in two ways: (1) by the traditional correlation of Colburn j/sub D/ vs Reynolds number and (2) by multiple regression of the mass-transfer coefficient on air rate, traditional correlation of Colburn j/sub D/ vs Reynolds number and (3) by multiple regression of the mass-transfer coefficient on air rate, sizes of active and inert particles, void fraction, and temperature. Principal findings are: (1) local Reynolds number should be based on active particle size rather than average size for the bed; (2) no appreciable differences were seen between shallow beds and deep ones; (3) mass transfer was 26% faster for spheres and lozenges buried in shale than for all-sphere beds; (4) orientation of lozenges in shale beds has little effect on mass-transfer rate; (5) a useful summarizing equation for either mass or heat transfer in shale beds is log j.epsilon = -.0747 - .6344 log Re + .0592 log/sup 2/Re where j = either j/sub D/ or j/sub H/, the Chilton-Colburn j-factors for mass and heat transfer, Re = the Reynolds number defined for packed beds, and epsilon = the void fraction in the bed. 12 references, 15 figures.« less

  7. Vented Chill / No-Vent Fill of Cryogenic Propellant Tanks

    NASA Technical Reports Server (NTRS)

    Rhys, Noah O.; Foster, Lee W.; Martin, Adam K.; Stephens, Jonathan R.

    2016-01-01

    Architectures for extended duration missions often include an on-orbit replenishment of the space vehicle's cryogenic liquid propellants. Such a replenishment could be accomplished via a tank-to-tank transfer from a dedicated tanker or a more permanent propellant depot storage tank. Minimizing the propellant loss associated with transfer line and receiver propellant tank thermal conditioning is essential for mass savings. A new methodology for conducting tank-to-tank transfer while minimizing such losses has been demonstrated. Charge-Hold-Vent is the traditional methodology for conducting a tank-to-tank propellant transfer. A small amount of cryogenic liquid is introduced to chill the transfer line and propellant tank. As the propellant absorbs heat and undergoes a phase change, the tank internal pressure increases. The tank is then vented to relieve pressure prior to another charge of cryogenic liquid being introduced. This cycle is repeated until the transfer lines and tank are sufficiently chilled and the replenishment of the propellant tank is complete. This method suffers inefficiencies due to multiple chill and vent cycles within the transfer lines and associated feed system components. Additionally, this system requires precise measuring of cryogenic fluid delivery for each transfer, multiple valve cycling events, and other complexities associated with cycled operations. To minimize propellant loss and greatly simplify on-orbit operations, an alternate methodology has been designed and demonstrated. The Vented Chill / No Vent Fill method is a simpler, constant flow approach in which the propellant tank and transfer lines are only chilled once. The receiver tank is continuously vented as cryogenic liquid chills the transfer lines, tank mass and ullage space. Once chilled sufficiently, the receiver tank valve is closed and the tank is completely filled. Interestingly, the vent valve can be closed prior to receiver tank components reaching liquid saturation temperature. An incomplete fill results if insufficient energy is removed from the tank's thermal mass and ullage space. The key to successfully conducting the no vent fill is to assure that sufficient energy is removed from the system prior to closing the receiver tank vent valve. This paper will provide a description of the transfer methodology and test article, and will provide a discussion of test results.

  8. Experimental Research on Optimizing Inlet Airflow of Wet Cooling Towers under Crosswind Conditions

    NASA Astrophysics Data System (ADS)

    Chen, You Liang; Shi, Yong Feng; Hao, Jian Gang; Chang, Hao; Sun, Feng Zhong

    2018-01-01

    A new approach of installing air deflectors around tower inlet circumferentially was proposed to optimize the inlet airflow and reduce the adverse effect of crosswinds on the thermal performance of natural draft wet cooling towers (NDWCT). And inlet airflow uniformity coefficient was defined to analyze the uniformity of circumferential inlet airflow quantitatively. Then the effect of air deflectors on the NDWCT performance was investigated experimentally. By contrast between inlet air flow rate and cooling efficiency, it has been found that crosswinds not only decrease the inlet air flow rate, but also reduce the uniformity of inlet airflow, which reduce NDWCT performance jointly. After installing air deflectors, the inlet air flow rate and uniformity coefficient increase, the uniformity of heat and mass transfer increases correspondingly, which improve the cooling performance. In addition, analysis on Lewis factor demonstrates that the inlet airflow optimization has more enhancement of heat transfer than mass transfer, but leads to more water evaporation loss.

  9. Condensation heat transfer and pressure drop of R-410A in a 7.0 mm O.D. microfin tube at low mass fluxes

    NASA Astrophysics Data System (ADS)

    Kim, Nae-Hyun

    2016-12-01

    R-410A condensation heat transfer and pressure drop data are provided for a 7.0 mm O.D. microfin tube at low mass fluxes (50-250 kg/m2 s). The heat transfer coefficient of the microfin tube shows a minimum behavior with the mass flux. At a low mass flux, where flow pattern is stratified, condensation induced by surface tension by microfins overwhelms condensation induced by shear, and the heat transfer coefficient decreases as mass flux increases. At a high mass flux, where flow pattern is annular, condensation induced by shear governs the heat transfer, and the heat transfer coefficient increases as mass flux increases. The pressure drop of the microfin tube is larger than that of the smooth tube at the annular flow regime. On the contrary, the pressure drop of the smooth tube is larger than that of the microfin tube at the stratified flow regime.

  10. Effects of variable properties on MHD heat and mass transfer flow near a stagnation point towards a stretching sheet in a porous medium with thermal radiation

    NASA Astrophysics Data System (ADS)

    M. Salem, A.; Rania, Fathy

    2012-05-01

    The effect of variable viscosity and thermal conductivity on steady magnetohydrodynamic (MHD) heat and mass transfer flow of viscous and incompressible fluid near a stagnation point towards a permeable stretching sheet embedded in a porous medium are presented, taking into account thermal radiation and internal heat genberation/absorbtion. The stretching velocity and the ambient fluid velocity are assumed to vary linearly with the distance from the stagnation point. The Rosseland approximation is used to describe the radiative heat flux in the energy equation. The governing fundamental equations are first transformed into a system of ordinary differential equations using a scaling group of transformations and are solved numerically by using the fourth-order Rung—Kutta method with the shooting technique. A comparison with previously published work has been carried out and the results are found to be in good agreement. The results are analyzed for the effect of different physical parameters, such as the variable viscosity and thermal conductivity, the ratio of free stream velocity to stretching velocity, the magnetic field, the porosity, the radiation and suction/injection on the flow, and the heat and mass transfer characteristics. The results indicate that the inclusion of variable viscosity and thermal conductivity into the fluids of light and medium molecular weight is able to change the boundary-layer behavior for all values of the velocity ratio parameter λ except for λ = 1. In addition, the imposition of fluid suction increases both the rate of heat and mass transfer, whereas fluid injection shows the opposite effect.

  11. Hierarchical calibration and validation framework of bench-scale computational fluid dynamics simulations for solvent-based carbon capture. Part 2: Chemical absorption across a wetted wall column: Original Research Article: Hierarchical calibration and validation framework of bench-scale computational fluid dynamics simulations

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Wang, Chao; Xu, Zhijie; Lai, Kevin

    Part 1 of this paper presents a numerical model for non-reactive physical mass transfer across a wetted wall column (WWC). In Part 2, we improved the existing computational fluid dynamics (CFD) model to simulate chemical absorption occurring in a WWC as a bench-scale study of solvent-based carbon dioxide (CO2) capture. To generate data for WWC model validation, CO2 mass transfer across a monoethanolamine (MEA) solvent was first measured on a WWC experimental apparatus. The numerical model developed in this work can account for both chemical absorption and desorption of CO2 in MEA. In addition, the overall mass transfer coefficient predictedmore » using traditional/empirical correlations is conducted and compared with CFD prediction results for both steady and wavy falling films. A Bayesian statistical calibration algorithm is adopted to calibrate the reaction rate constants in chemical absorption/desorption of CO2 across a falling film of MEA. The posterior distributions of the two transport properties, i.e., Henry's constant and gas diffusivity in the non-reacting nitrous oxide (N2O)/MEA system obtained from Part 1 of this study, serves as priors for the calibration of CO2 reaction rate constants after using the N2O/CO2 analogy method. The calibrated model can be used to predict the CO2 mass transfer in a WWC for a wider range of operating conditions.« less

  12. Hierarchical calibration and validation framework of bench-scale computational fluid dynamics simulations for solvent-based carbon capture. Part 2: Chemical absorption across a wetted wall column: Original Research Article: Hierarchical calibration and validation framework of bench-scale computational fluid dynamics simulations

    DOE PAGES

    Wang, Chao; Xu, Zhijie; Lai, Kevin; ...

    2017-10-24

    Part 1 of this paper presents a numerical model for non-reactive physical mass transfer across a wetted wall column (WWC). In Part 2, we improved the existing computational fluid dynamics (CFD) model to simulate chemical absorption occurring in a WWC as a bench-scale study of solvent-based carbon dioxide (CO2) capture. To generate data for WWC model validation, CO2 mass transfer across a monoethanolamine (MEA) solvent was first measured on a WWC experimental apparatus. The numerical model developed in this work can account for both chemical absorption and desorption of CO2 in MEA. In addition, the overall mass transfer coefficient predictedmore » using traditional/empirical correlations is conducted and compared with CFD prediction results for both steady and wavy falling films. A Bayesian statistical calibration algorithm is adopted to calibrate the reaction rate constants in chemical absorption/desorption of CO2 across a falling film of MEA. The posterior distributions of the two transport properties, i.e., Henry's constant and gas diffusivity in the non-reacting nitrous oxide (N2O)/MEA system obtained from Part 1 of this study, serves as priors for the calibration of CO2 reaction rate constants after using the N2O/CO2 analogy method. The calibrated model can be used to predict the CO2 mass transfer in a WWC for a wider range of operating conditions.« less

  13. Influence of indoor environmental factors on mass transfer parameters and concentrations of semi-volatile organic compounds.

    PubMed

    Wei, Wenjuan; Mandin, Corinne; Ramalho, Olivier

    2018-03-01

    Semi-volatile organic compounds (SVOCs) in indoor environments can partition among the gas phase, airborne particles, settled dust, and available surfaces. The mass transfer parameters of SVOCs, such as the mass transfer coefficient and the partition coefficient, are influenced by indoor environmental factors. Subsequently, indoor SVOC concentrations and thus occupant exposure can vary depending on environmental factors. In this review, the influence of six environmental factors, i.e., indoor temperature, humidity, ventilation, airborne particle concentration, source loading factor, and reactive chemistry, on the mass transfer parameters and indoor concentrations of SVOCs was analyzed and tentatively quantified. The results show that all mass transfer parameters vary depending on environmental factors. These variations are mostly characterized by empirical equations, particularly for humidity. Theoretical calculations of these parameters based on mass transfer mechanisms are available only for the emission of SVOCs from source surfaces when airborne particles are not present. All mass transfer parameters depend on the temperature. Humidity influences the partition of SVOCs among different phases and is associated with phthalate hydrolysis. Ventilation has a combined effect with the airborne particle concentration on SVOC emission and their mass transfer among different phases. Indoor chemical reactions can produce or eliminate SVOCs slowly. To better model the dynamic SVOC concentration indoors, the present review suggests studying the combined effect of environmental factors in real indoor environments. Moreover, interactions between indoor environmental factors and human activities and their influence on SVOC mass transfer processes should be considered. Copyright © 2017 Elsevier Ltd. All rights reserved.

  14. Short communication: Evaluation of MALDI-TOF mass spectrometry and a custom reference spectra expanded database for the identification of bovine-associated coagulase-negative staphylococci.

    PubMed

    Cameron, M; Perry, J; Middleton, J R; Chaffer, M; Lewis, J; Keefe, G P

    2018-01-01

    This study evaluated MALDI-TOF mass spectrometry and a custom reference spectra expanded database for the identification of bovine-associated coagulase-negative staphylococci (CNS). A total of 861 CNS isolates were used in the study, covering 21 different CNS species. The majority of the isolates were previously identified by rpoB gene sequencing (n = 804) and the remainder were identified by sequencing of hsp60 (n = 56) and tuf (n = 1). The genotypic identification was considered the gold standard identification. Using a direct transfer protocol and the existing commercial database, MALDI-TOF mass spectrometry showed a typeability of 96.5% (831/861) and an accuracy of 99.2% (824/831). Using a custom reference spectra expanded database, which included an additional 13 in-house created reference spectra, isolates were identified by MALDI-TOF mass spectrometry with 99.2% (854/861) typeability and 99.4% (849/854) accuracy. Overall, MALDI-TOF mass spectrometry using the direct transfer method was shown to be a highly reliable tool for the identification of bovine-associated CNS. Copyright © 2018 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

  15. Quantifying solute transport processes: are chemically "conservative" tracers electrically conservative?

    USGS Publications Warehouse

    Singha, Kamini; Li, Li; Day-Lewis, Frederick D.; Regberg, Aaron B.

    2012-01-01

    The concept of a nonreactive or conservative tracer, commonly invoked in investigations of solute transport, requires additional study in the context of electrical geophysical monitoring. Tracers that are commonly considered conservative may undergo reactive processes, such as ion exchange, thus changing the aqueous composition of the system. As a result, the measured electrical conductivity may reflect not only solute transport but also reactive processes. We have evaluated the impacts of ion exchange reactions, rate-limited mass transfer, and surface conduction on quantifying tracer mass, mean arrival time, and temporal variance in laboratory-scale column experiments. Numerical examples showed that (1) ion exchange can lead to resistivity-estimated tracer mass, velocity, and dispersivity that may be inaccurate; (2) mass transfer leads to an overestimate in the mobile tracer mass and an underestimate in velocity when using electrical methods; and (3) surface conductance does not notably affect estimated moments when high-concentration tracers are used, although this phenomenon may be important at low concentrations or in sediments with high and/or spatially variable cation-exchange capacity. In all cases, colocated groundwater concentration measurements are of high importance for interpreting geophysical data with respect to the controlling transport processes of interest.

  16. Low tritium partial pressure permeation system for mass transport measurement in lead lithium eutectic

    DOE PAGES

    Pawelko, R. J.; Shimada, M.; Katayama, K.; ...

    2015-11-28

    This paper describes a new experimental system designed to investigate tritium mass transfer properties in materials important to fusion technology. Experimental activities were carried out at the Safety and Tritium Applied Research (STAR) facility located at the Idaho National Laboratory (INL). The tritium permeation measurement system was developed as part of the Japan/US TITAN collaboration to investigate tritium mass transfer properties in liquid lead lithium eutectic (LLE) alloy. The experimental system is configured to measure tritium mass transfer properties at low tritium partial pressures. Initial tritium permeation scoping tests were conducted on a 1 mm thick α-Fe plate to determinemore » operating parameters and to validate the experimental technique. A second series of permeation tests was then conducted with the α-Fe plate covered with an approximately 8.5 mm layer of liquid lead lithium eutectic alloy (α-Fe/LLE). We present preliminary tritium permeation data for α-Fe and α-Fe/LLE at temperatures between 400 and 600°C and at tritium partial pressures between 1.7E-3 and 2.5 Pa in helium. Preliminary results for the α-Fe plate and α-Fe/LLE indicate that the data spans a transition region between the diffusion-limited regime and the surface-limited regime. In conclusion, additional data is required to determine the existence and range of a surface-limited regime.« less

  17. Determination of the mass transfer limiting step of dye adsorption onto commercial adsorbent by using mathematical models.

    PubMed

    Marin, Pricila; Borba, Carlos Eduardo; Módenes, Aparecido Nivaldo; Espinoza-Quiñones, Fernando R; de Oliveira, Silvia Priscila Dias; Kroumov, Alexander Dimitrov

    2014-01-01

    Reactive blue 5G dye removal in a fixed-bed column packed with Dowex Optipore SD-2 adsorbent was modelled. Three mathematical models were tested in order to determine the limiting step of the mass transfer of the dye adsorption process onto the adsorbent. The mass transfer resistance was considered to be a criterion for the determination of the difference between models. The models contained information about the external, internal, or surface adsorption limiting step. In the model development procedure, two hypotheses were applied to describe the internal mass transfer resistance. First, the mass transfer coefficient constant was considered. Second, the mass transfer coefficient was considered as a function of the dye concentration in the adsorbent. The experimental breakthrough curves were obtained for different particle diameters of the adsorbent, flow rates, and feed dye concentrations in order to evaluate the predictive power of the models. The values of the mass transfer parameters of the mathematical models were estimated by using the downhill simplex optimization method. The results showed that the model that considered internal resistance with a variable mass transfer coefficient was more flexible than the other ones and this model described the dynamics of the adsorption process of the dye in the fixed-bed column better. Hence, this model can be used for optimization and column design purposes for the investigated systems and similar ones.

  18. Carbon monoxide mass transfer for syngas fermentation in a stirred tank reactor with dual impeller configurations.

    PubMed

    Ungerman, Andrew J; Heindel, Theodore J

    2007-01-01

    This study compares the power demand and gas-liquid volumetric mass transfer coefficient, kLa, in a stirred tank reactor (STR) (T = 0.211 m) using different impeller designs and schemes in a carbon monoxide-water system, which is applicable to synthesis gas (syngas) fermentation. Eleven different impeller schemes were tested over a range of operating conditions typically associated with the "after large cavity" region (ALC) of a Rushton-type turbine (D/T = 0.35). It is found that the dual Rushton-type impeller scheme exhibits the highest volumetric mass transfer rates for all operating conditions; however, it also displays the lowest mass transfer performance (defined as the volumetric mass transfer coefficient per unit power input) for all conditions due to its high power consumption. Dual impeller schemes with an axial flow impeller as the top impeller show improved mass transfer rates without dramatic increases in power draw. At high gas flow rates, dual impeller schemes with a lower concave impeller have kLa values similar to those of the Rushton-type dual impeller schemes but show improved mass transfer performance. It is believed that the mass transfer performance can be further enhanced for the bottom concave impeller schemes by operating at conditions beyond the ALC region defined for Rushton-type impellers because the concave impeller can handle higher gas flow rates prior to flooding.

  19. Migration of antioxidants from polylactic acid films: A parameter estimation approach and an overview of the current mass transfer models.

    PubMed

    Samsudin, Hayati; Auras, Rafael; Mishra, Dharmendra; Dolan, Kirk; Burgess, Gary; Rubino, Maria; Selke, Susan; Soto-Valdez, Herlinda

    2018-01-01

    Migration studies of chemicals from contact materials have been widely conducted due to their importance in determining the safety and shelf life of a food product in their packages. The US Food and Drug Administration (FDA) and the European Food Safety Authority (EFSA) require this safety assessment for food contact materials. So, migration experiments are theoretically designed and experimentally conducted to obtain data that can be used to assess the kinetics of chemical release. In this work, a parameter estimation approach was used to review and to determine the mass transfer partition and diffusion coefficients governing the migration process of eight antioxidants from poly(lactic acid), PLA, based films into water/ethanol solutions at temperatures between 20 and 50°C. Scaled sensitivity coefficients were calculated to assess simultaneously estimation of a number of mass transfer parameters. An optimal experimental design approach was performed to show the importance of properly designing a migration experiment. Additional parameters also provide better insights on migration of the antioxidants. For example, the partition coefficients could be better estimated using data from the early part of the experiment instead at the end. Experiments could be conducted for shorter periods of time saving time and resources. Diffusion coefficients of the eight antioxidants from PLA films were between 0.2 and 19×10 -14 m 2 /s at ~40°C. The use of parameter estimation approach provided additional and useful insights about the migration of antioxidants from PLA films. Copyright © 2017 Elsevier Ltd. All rights reserved.

  20. Acyl transfer from membrane lipids to peptides is a generic process.

    PubMed

    Dods, Robert H; Bechinger, Burkhard; Mosely, Jackie A; Sanderson, John M

    2013-11-15

    The generality of acyl transfer from phospholipids to membrane-active peptides has been probed using liquid chromatography-mass spectrometry analysis of peptide-lipid mixtures. The peptides examined include melittin, magainin II, PGLa, LAK1, LAK3 and penetratin. Peptides were added to liposomes with membrane lipid compositions ranging from pure phosphatidylcholine (PC) to mixtures of PC with phosphatidylethanolamine, phosphatidylserine or phosphatidylglycerol. Experiments were typically conducted at pH7.4 at modest salt concentrations (90 mM NaCl). In favorable cases, lipidated peptides were further characterized by tandem mass spectrometry methods to determine the sites of acylation. Melittin and magainin II were the most reactive peptides, with significant acyl transfer detected under all conditions and membrane compositions. Both peptides were lipidated at the N-terminus by transfer from PC, phosphatidylethanolamine, phosphatidylserine or phosphatidylglycerol, as well as at internal sites: lysine for melittin; serine and lysine for magainin II. Acyl transfer could be detected within 3h of melittin addition to negatively charged membranes. The other peptides were less reactive, but for each peptide, acylation was found to occur in at least one of the conditions examined. The data demonstrate that acyl transfer is a generic process for peptides bound to membranes composed of diacylglycerophospholipids. Phospholipid membranes cannot therefore be considered as chemically inert toward peptides and by extension proteins. © 2013. Published by Elsevier Ltd. All rights reserved.

  1. Mass and heat transfer in crushed oil shale

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Carley, J.F.; Ott, L.L.; Swecker, J.L.

    1995-03-01

    Studies of heat and mass transfer in packed beds, which disagree substantially in their findings, have nearly all been done with beds of regular particles of uniform size, whereas oil-shale retorting involves particles of diverse irregular shapes and sizes. The authors, in 349 runs, measured mass-transfer rates front naphthalene particles buried in packed beds by passing through air at room temperature. An exact catalog between convection of heat and mass makes it possible to infer heat-transfer coefficients from measured mass-transfer coefficients and fluid properties. Some beds consisted of spheres, naphthalene and inert, of the same, contrasting or distributed sizes. Inmore » some runs, naphthalene spheres were buried in beds of crushed shale, some in narrow screen ranges and others with a wide size range. In others, naphthalene lozenges of different shapes were buried in beds of crushed shale in various bed axis orientations. This technique permits calculation of the mass-transfer coefficient for each active particle in the bed rather than, as in most past studies, for the bed as a whole. The data are analyzed by the traditional correlation of Colburn j{sub D} vs. Reynolds number and by multiple regression of the mass-transfer coefficient on air rate, sizes of active and inert particles, void fraction, and temperature. Principal findings are: local Reynolds number should be based on the active-particle size, not the average for the whole bed; differences between shallow and deep beds are not appreciable; mass transfer is 26% faster for spheres and lozenges buried in shale than in all-sphere beds; orientation of lozenges in shale beds has little or no effect on mass-transfer rate; and for mass or heat transfer in shale beds, log(j{center_dot}{epsilon}) = {minus}0.0747 - 0.6344 log N{sub Re} + 0. 0592 log {sup 2} N{sub Re}.« less

  2. Effect of operating temperature on styrene mass transfer characteristics in a biotrickling filter.

    PubMed

    Parnian, Parham; Zamir, Seyed Morteza; Shojaosadati, Seyed Abbas

    2017-05-01

    To study the effect of operating temperature on styrene mass transfer from gas to liquid phase in biotrickling filters (BTFs), overall mass transfer coefficient (K L a) was calculated through fitting test data to a general mass balance model under abiotic conditions. Styrene was used as the volatile organic compound and the BTF was packed with a mixture of pall rings and pumice. Operating temperature was set at 30°C and 50°C for mesophilic and thermophilic conditions, respectively. K L a values increased from 54 to 70 h -1 at 30°C and from 60 to 90 h -1 at 50°C, respectively, depending on the countercurrent gas to liquid flow ratio that varied in the range of 7.5-32. Evaluation of styrene mass transfer capacity (MTC) showed that liquid-phase mass transfer resistance decreased as the flow ratio increased at constant temperature. MTC also decreased with an increase in operating temperature. Both gas-liquid partition coefficient and K L a increased with increasing temperature; however the effect on gas-liquid partition coefficient was more significant and served to increase mass transfer limitations. Thermophilic biofiltration on the one hand increases mass transfer limitations, but on the other hand may enhance the biodegradation rate in favor of enhancing BTFs' performance.

  3. Ozone mass transfer behaviors on physical and chemical absorption for hollow fiber membrane contactors.

    PubMed

    Zhang, Yong; Li, Kuiling; Wang, Jun; Hou, Deyin; Liu, Huijuan

    2017-09-01

    To understand the mass transfer behaviors in hollow fiber membrane contactors, ozone fluxes affected by various conditions and membranes were investigated. For physical absorption, mass transfer rate increased with liquid velocity and the ozone concentration in the gas. Gas flow rate was little affected when the velocity was larger than the critical value, which was 6.1 × 10 -3 m/s in this study. For chemical absorption, the flux was determined by the reaction rate between ozone and the absorbent. Therefore, concentration, species, and pH affected the mass transfer process markedly. For different absorbents, the order of mass transfer rate was the same as the reaction rate constant, which was phenol, sodium nitrite, hydrogen peroxide, and oxalate. Five hydrophobic membranes with various properties were employed and the mass transfer behavior can be described by the Graetz-Lévèque equation for the physical absorption process. The results showed the process was controlled by liquid film and the gas phase conditions, and membrane properties did not affect the ozone flux. For the chemical absorption, gas film, membrane and liquid film affected the mass transfer together, and none of them were negligible.

  4. Local Mass and Heat Transfer on a Turbine Blade Tip

    DOE PAGES

    Jin, P.; Goldstein, R. J.

    2003-01-01

    Locmore » al mass and heat transfer measurements on a simulated high-pressure turbine blade-tip surface are conducted in a linear cascade with a nonmoving tip endwall, using a naphthalene sublimation technique. The effects of tip clearance (0.86–6.90% of chord) are investigated at various exit Reynolds numbers (4–7 × 10 5 ) and turbulence intensities (0.2 and 12.0%). The mass transfer on the tip surface is significant along its pressure edge at the smallest tip clearance. At the two largest tip clearances, the separation bubble on the tip surface can cover the whole width of the tip on the second half of the tip surface. The average mass-transfer rate is highest at a tip clearance of 1.72% of chord. The average mass-transfer rate on the tip surface is four and six times as high as on the suction and the pressure surface, respectively. A high mainstream turbulence level of 12.0% reduces average mass-transfer rates on the tip surface, while the higher mainstream Reynolds number generates higher local and average mass-transfer rates on the tip surface.« less

  5. Direct sampling of sub-µm atmospheric particulate organic matter in sub-ng m-3 mass concentrations by proton-transfer-reaction mass spectrometry

    NASA Astrophysics Data System (ADS)

    Armin, W.; Mueller, M.; Klinger, A.; Striednig, M.

    2017-12-01

    A quantitative characterization of the organic fraction of atmospheric particulate matter is still challenging. Herein we present the novel modular "Chemical Analysis of Aerosol Online" (CHARON) particle inlet system coupled to a new-generation proton-transfer-reaction time-of-flight mass spectrometer (PTR-TOF 6000 X2, Ionicon Analytik, Austria) that quantitatively detects organic analytes in real-time and sub-pptV levels by chemical ionization with hydronium reagent ions. CHARON consists of a gas-phase denuder for stripping off gas-phase analytes (efficiency > 99.999%), an aerodynamic lens for particle collimation combined with an inertial sampler for the particle-enriched flow and a thermodesorption unit for particle volatilization prior to chemical analysis. With typical particle enrichment factors of around 30 for particle diameters (DP) between 120 nm and 1000 nm (somewhat reduced enrichment for 60 nm < DP < 120 nm) we boost the already excellent limits of detection of the PTR-TOF 6000 X2 system to unprecedented levels. We demonstrate that particulate organic analytes of mass concentrations down to 100 pg m-3 can be detected on-line and in single-minute time-resolutions. In addition, PTR-MS allows for a quantitative detection of almost the full range of particulate organics of intermediate to low volatility. With the high mass resolution (R > 6000) and excellent mass accuracies (< 10 ppm) chemical compositions can be assigned and included in further analyses. In addition to a detailed characterization of the CHARON PTR-TOF 6000 X2 we will present first results on the chemical composition of sub-µm particulate organic matter in the urban atmosphere in Innsbruck (Austria).

  6. VizieR Online Data Catalog: Adiabatic mass loss in binary stars. II. (Ge+, 2015)

    NASA Astrophysics Data System (ADS)

    Ge, H.; Webbink, R. F.; Chen, X.; Han, Z.

    2016-02-01

    In the limit of extremely rapid mass transfer, the response of a donor star in an interacting binary becomes asymptotically one of adiabatic expansion. We survey here adiabatic mass loss from Population I stars (Z=0.02) of mass 0.10M⊙-100M⊙ from the zero-age main sequence to the base of the giant branch, or to central hydrogen exhaustion for lower main sequence stars. The logarithmic derivatives of radius with respect to mass along adiabatic mass-loss sequences translate into critical mass ratios for runaway (dynamical timescale) mass transfer, evaluated here under the assumption of conservative mass transfer. For intermediate- and high-mass stars, dynamical mass transfer is preceded by an extended phase of thermal timescale mass transfer as the star is stripped of most of its envelope mass. The critical mass ratio qad (throughout this paper, we follow the convention of defining the binary mass ratio as q{equiv}Mdonor/Maccretor) above which this delayed dynamical instability occurs increases with advancing evolutionary age of the donor star, by ever-increasing factors for more massive donors. Most intermediate- or high-mass binaries with nondegenerate accretors probably evolve into contact before manifesting this instability. As they approach the base of the giant branch, however, and begin developing a convective envelope, qad plummets dramatically among intermediate-mass stars, to values of order unity, and a prompt dynamical instability occurs. Among low-mass stars, the prompt instability prevails throughout main sequence evolution, with qad declining with decreasing mass, and asymptotically approaching qad=2/3, appropriate to a classical isentropic n=3/2 polytrope. Our calculated qad values agree well with the behavior of time-dependent models by Chen & Han (2003MNRAS.341..662C) of intermediate-mass stars initiating mass transfer in the Hertzsprung gap. Application of our results to cataclysmic variables, as systems that must be stable against rapid mass transfer, nicely circumscribes the range in qad as a function of the orbital period in which they are found. These results are intended to advance the verisimilitude of population synthesis models of close binary evolution. (3 data files).

  7. Prediction and rational correlation of thermophoretically reduced particle mass transfer to hot surfaces across laminar or turbulent forced-convection gas boundary layers

    NASA Technical Reports Server (NTRS)

    Gokoglu, Suleyman A.; Rosner, Daniel E.

    1986-01-01

    A formulation previously developed to predict and correlate the thermophoretically-augmented submicron particle mass transfer rate to cold surfaces is found to account for the thermophoretically reduced particle mass transfer rate to overheated surfaces such that thermophoresis brings about a 10-decade reduction below the convective mass transfer rate expected by pure Brownian diffusion and convection alone. Thermophoretic blowing is shown to produce effects on particle concentration boundary-layer (BL) structure and wall mass transfer rates similar to those produced by real blowing through a porous wall. The applicability of the correlations to developing BL-situations is demonstrated by a numerical example relevant to wet-steam technology.

  8. Irradiation-driven Mass Transfer Cycles in Compact Binaries

    NASA Astrophysics Data System (ADS)

    Büning, A.; Ritter, H.

    2005-08-01

    We elaborate on the analytical model of Ritter, Zhang, & Kolb (2000) which describes the basic physics of irradiation-driven mass transfer cycles in semi-detached compact binary systems. In particular, we take into account a contribution to the thermal relaxation of the donor star which is unrelated to irradiation and which was neglected in previous studies. We present results of simulations of the evolution of compact binaries undergoing mass transfer cycles, in particular also of systems with a nuclear evolved donor star. These computations have been carried out with a stellar evolution code which computes mass transfer implicitly and models irradiation of the donor star in a point source approximation, thereby allowing for much more realistic simulations than were hitherto possible. We find that low-mass X-ray binaries (LMXBs) and cataclysmic variables (CVs) with orbital periods ⪉ 6hr can undergo mass transfer cycles only for low angular momentum loss rates. CVs containing a giant donor or one near the terminal age main sequence are more stable than previously thought, but can possibly also undergo mass transfer cycles.

  9. Simultaneous Heat and Mass Transfer Model for Convective Drying of Building Material

    NASA Astrophysics Data System (ADS)

    Upadhyay, Ashwani; Chandramohan, V. P.

    2018-04-01

    A mathematical model of simultaneous heat and moisture transfer is developed for convective drying of building material. A rectangular brick is considered for sample object. Finite-difference method with semi-implicit scheme is used for solving the transient governing heat and mass transfer equation. Convective boundary condition is used, as the product is exposed in hot air. The heat and mass transfer equations are coupled through diffusion coefficient which is assumed as the function of temperature of the product. Set of algebraic equations are generated through space and time discretization. The discretized algebraic equations are solved by Gauss-Siedel method via iteration. Grid and time independent studies are performed for finding the optimum number of nodal points and time steps respectively. A MATLAB computer code is developed to solve the heat and mass transfer equations simultaneously. Transient heat and mass transfer simulations are performed to find the temperature and moisture distribution inside the brick.

  10. Jason Woods | NREL

    Science.gov Websites

    doctoral student since 2007. Jason's area of expertise is heat and mass transfer, including the design , analysis, and testing of heat and mass transfer devices and processes. Research Interests Membrane Thermal energy storage Heat and mass transfer enhancements Combined cooling, heat, and power (CCHP

  11. Modeling 3D conjugate heat and mass transfer for turbulent air drying of Chilean papaya in a direct contact dryer

    NASA Astrophysics Data System (ADS)

    Lemus-Mondaca, Roberto A.; Vega-Gálvez, Antonio; Zambra, Carlos E.; Moraga, Nelson O.

    2017-01-01

    A 3D model considering heat and mass transfer for food dehydration inside a direct contact dryer is studied. The k- ɛ model is used to describe turbulent air flow. The samples thermophysical properties as density, specific heat, and thermal conductivity are assumed to vary non-linearly with temperature. FVM, SIMPLE algorithm based on a FORTRAN code are used. Results unsteady velocity, temperature, moisture, kinetic energy and dissipation rate for the air flow are presented, whilst temperature and moisture values for the food also are presented. The validation procedure includes a comparison with experimental and numerical temperature and moisture content results obtained from experimental data, reaching a deviation 7-10 %. In addition, this turbulent k- ɛ model provided a better understanding of the transport phenomenon inside the dryer and sample.

  12. Investigation of the Ignition and Burning of Materials in Space Cabin Atmospheres. Part 2: Ignition of a Combustible Mixture by a Hot Body with the Effects of Gravity

    NASA Technical Reports Server (NTRS)

    Lew, H. G.

    1972-01-01

    The ignition of a combustible gas mixture by a hot cylinder under the effect of a gravity field for steady state conditions is examined. For this purpose a horizontal cylinder is considered with gravity as a parameter together with a finite chemical reacting flow generated by free convection with the additional effect of diffusion. Both mass transfer and zero mass transfer cases are considered. By defining an ignition criterion the surface temperature and species are obtained from the analysis as a function of the gravity field. It is supposed that at the point of ignition the heat evolved in the gas is sufficiently high to attain a sustained combustion without any energy from the hot cylinder.

  13. The role of intra-NAPL diffusion on mass transfer from MGP residuals

    NASA Astrophysics Data System (ADS)

    Shafieiyoun, Saeid; Thomson, Neil R.

    2018-06-01

    An experimental and computational study was performed to investigate the role of multi-component intra-NAPL diffusion on NAPL-water mass transfer. Molecular weight and the NAPL component concentrations were determined to be the most important parameters affecting intra-NAPL diffusion coefficients. Four NAPLs with different viscosities but the same quantified mass were simulated. For a spherical NAPL body, a combination of NAPL properties and interphase mass transfer rate can result in internal diffusion limitations. When the main intra-NAPL diffusion coefficients are in the range of self-diffusion coefficients (10-5 to 10-6 cm2/s), dissolution is not limited by internal diffusion except for high mass transfer rate coefficients (>180 cm/day). For a complex and relatively high viscous NAPL (>50 g/(cm s)), smaller intra-NAPL diffusion coefficients (<10-8) are expected and even low mass transfer rate coefficients ( 6 cm/day) can result in diffusion-limited dissolution.

  14. International Space Station (ISS) Water Transfer Hardware Logistics

    NASA Technical Reports Server (NTRS)

    Shkedi, Brienne D.

    2006-01-01

    Water transferred from the Space Shuttle to the International Space Station (ISS) is generated as a by-product from the Shuttle fuel cells, and is generally preferred over the Progress which has to launch water from the ground. However, launch mass and volume are still required for the transfer and storage hardware. Some of these up-mass requirements have been reduced since ISS assembly began due to changes in the storage hardware (CWC). This paper analyzes the launch mass and volume required to transfer water from the Shuttle and analyzes the up-mass savings due to modifications in the CWC. Suggestions for improving the launch mass and volume are also provided.

  15. Mass transfer processes in a post eruption hydrothermal system: Parameterisation of microgravity changes at Te Maari craters, New Zealand

    NASA Astrophysics Data System (ADS)

    Miller, Craig A.; Currenti, Gilda; Hamling, Ian; Williams-Jones, Glyn

    2018-05-01

    Fluid transfer and ground deformation at hydrothermal systems occur both as a precursor to, or as a result of, an eruption. Typically studies focus on pre-eruption changes to understand the likelihood of unrest leading to eruption; however, monitoring post-eruption changes is important for tracking the return of the system towards background activity. Here we describe processes occurring in a hydrothermal system following the 2012 eruption of Upper Te Maari crater on Mt Tongariro, New Zealand, from observations of microgravity change and deformation. Our aim is to assess the post-eruption recovery of the system, to provide a baseline for long-term monitoring. Residual microgravity anomalies of up to 92 ± 11 μGal per year are accompanied by up to 0.037 ± 0.01 m subsidence. We model microgravity changes using analytic solutions to determine the most likely geometry and source location. A multiobjective inversion tests whether the gravity change models are consistent with the observed deformation. We conclude that the source of subsidence is separate from the location of mass addition. From this unusual combination of observations, we develop a conceptual model of fluid transfer within a condensate layer, occurring in response to eruption-driven pressure changes. We find that depressurisation drives the evacuation of pore fluid, either exiting the system completely as vapour through newly created vents and fumaroles, or migrating to shallower levels where it accumulates in empty pore space, resulting in positive gravity changes. Evacuated pores then collapse, causing subsidence. In addition we find that significant mass addition occurs from influx of meteoric fluids through the fractured hydrothermal seal. Long-term combined microgravity and deformation monitoring will allow us to track the resealing and re-pressurisation of the hydrothermal system and assess what hazard it presents to thousands of hikers who annually traverse the volcano, within 2 km of the eruption site.

  16. Heat and Mass Transfer in an L Shaped Porous Medium

    NASA Astrophysics Data System (ADS)

    Salman Ahmed, N. J.; Azeem; Yunus Khan, T. M.

    2017-08-01

    This article is an extension to the heat transfer in L-shaped porous medium by including the mass diffusion. The heat and mass transfer in the porous domain is represented by three coupled partial differential equations representing the fluid movement, energy transport and mass transport. The equations are converted into algebraic form of equations by the application of finite element method that can be conveniently solved by matrix method. An iterative approach is adopted to solve the coupled equations by setting suitable convergence criterion. The results are discussed in terms of heat transfer characteristics influenced by physical parameters such as buoyancy ratio, Lewis number, Rayleigh number etc. It is found that these physical parameters have significant effect on heat and mass transfer behavior of L-shaped porous medium.

  17. Electrical characterization of non‐Fickian transport in groundwater and hyporheic systems

    USGS Publications Warehouse

    Singha, Kamini; Pidlisecky, Adam; Day-Lewis, Frederick D.; Gooseff, Michael N.

    2008-01-01

    Recent work indicates that processes controlling solute mass transfer between mobile and less mobile domains in porous media may be quantified by combining electrical geophysical methods and electrically conductive tracers. Whereas direct geochemical measurements of solute preferentially sample the mobile domain, electrical geophysical methods are sensitive to changes in bulk electrical conductivity (bulk EC) and therefore sample EC in both the mobile and immobile domains. Consequently, the conductivity difference between direct geochemical samples and remotely sensed electrical geophysical measurements may provide an indication of mass transfer rates and mobile and immobile porosities in situ. Here we present (1) an overview of a theoretical framework for determining parameters controlling mass transfer with electrical resistivity in situ; (2) a review of a case study estimating mass transfer processes in a pilot‐scale aquifer storage recovery test; and (3) an example application of this method for estimating mass transfer in watershed settings between streams and the hyporheic corridor. We demonstrate that numerical simulations of electrical resistivity studies of the stream/hyporheic boundary can help constrain volumes and rates of mobile‐immobile mass transfer. We conclude with directions for future research applying electrical geophysics to understand field‐scale transport in aquifer and fluvial systems subject to rate‐limited mass transfer.

  18. Air sparging: Air-water mass transfer coefficients

    NASA Astrophysics Data System (ADS)

    Braida, Washington J.; Ong, Say Kee

    1998-12-01

    Experiments investigating the mass transfer of several dissolved volatile organic compounds (VOCs) across the air-water interface were conducted using a single-air- channel air-sparging system. Three different porous media were used in the study. Air velocities ranged from 0.2 cm s-1 to 2.5 cm s-1. The tortuosity factor for each porous medium and the air-water mass transfer coefficients were estimated by fitting experimental data to a one-dimensional diffusion model. The estimated mass transfer coefficients KG ranged from 1.79 × 10-3 cm min-1 to 3.85 × 10-2 cm min-1. The estimated lumped gas phase mass transfer coefficients KGa were found to be directly related to the air diffusivity of the VOC, air velocity, and particle size, and inversely related to the Henry's law constant of the VOCs. Of the four parameters investigated, the parameter that controlled or had a dominant effect on the lumped gas phase mass transfer coefficient was the air diffusivity of the VOC. Two empirical models were developed by correlating the Damkohler and the modified air phase Sherwood numbers with the air phase Peclet number, Henry's law constant, and the reduced mean particle size of porous media. The correlation developed in this study may be used to obtain better predictions of mass transfer fluxes for field conditions.

  19. Investigations of effect of phase change mass transfer rate on cavitation process with homogeneous relaxation model

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    He, Zhixia; Zhang, Liang; Saha, Kaushik

    The super high fuel injection pressure and micro size of nozzle orifice has been an important development trend for the fuel injection system. Accordingly, cavitation transient process, fuel compressibility, amount of noncondensable gas in the fuel and cavitation erosion have attracted more attention. Based on the fact of cavitation in itself is a kind of thermodynamic phase change process, this paper takes the perspective of the cavitation phase change mass transfer process to analyze above mentioned phenomenon. The two-phase cavitating turbulent flow simulations with VOF approach coupled with HRM cavitation model and U-RANS of standard k-ε turbulence model were performedmore » for investigations of cavitation phase change mass transfer process. It is concluded the mass transfer time scale coefficient in the Homogenous Relaxation Model (HRM) representing mass transfer rate should tend to be as small as possible in a condition that ensured the solver stable. At very fast mass transfer rate, the phase change occurs at very thin interface between liquid and vapor phase and condensation occurs more focused and then will contribute predictably to a more serious cavitation erosion. Both the initial non-condensable gas in fuel and the fuel compressibility can accelerate the cavitation mass transfer process.« less

  20. Hierarchical calibration and validation framework of bench-scale computational fluid dynamics simulations for solvent-based carbon capture. Part 2: Chemical absorption across a wetted wall column: Original Research Article: Hierarchical calibration and validation framework of bench-scale computational fluid dynamics simulations

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Wang, Chao; Xu, Zhijie; Lai, Kevin

    The first part of this paper (Part 1) presents a numerical model for non-reactive physical mass transfer across a wetted wall column (WWC). In Part 2, we improved the existing computational fluid dynamics (CFD) model to simulate chemical absorption occurring in a WWC as a bench-scale study of solvent-based carbon dioxide (CO2) capture. To generate data for WWC model validation, CO2 mass transfer across a monoethanolamine (MEA) solvent was first measured on a WWC experimental apparatus. The numerical model developed in this work has the ability to account for both chemical absorption and desorption of CO2 in MEA. In addition,more » the overall mass transfer coefficient predicted using traditional/empirical correlations is conducted and compared with CFD prediction results for both steady and wavy falling films. A Bayesian statistical calibration algorithm is adopted to calibrate the reaction rate constants in chemical absorption/desorption of CO2 across a falling film of MEA. The posterior distributions of the two transport properties, i.e., Henry’s constant and gas diffusivity in the non-reacting nitrous oxide (N2O)/MEA system obtained from Part 1 of this study, serves as priors for the calibration of CO2 reaction rate constants after using the N2O/CO2 analogy method. The calibrated model can be used to predict the CO2 mass transfer in a WWC for a wider range of operating conditions.« less

  1. Hierarchical calibration and validation framework of bench-scale computational fluid dynamics simulations for solvent-based carbon capture. Part 2: Chemical absorption across a wetted wall column: Original Research Article: Hierarchical calibration and validation framework of bench-scale computational fluid dynamics simulations

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Wang, Chao; Xu, Zhijie; Lai, Kevin

    Part 1 of this paper presents a numerical model for non-reactive physical mass transfer across a wetted wall column (WWC). In Part 2, we improved the existing computational fluid dynamics (CFD) model to simulate chemical absorption occurring in a WWC as a bench-scale study of solvent-based carbon dioxide (CO 2) capture. In this study, to generate data for WWC model validation, CO 2 mass transfer across a monoethanolamine (MEA) solvent was first measured on a WWC experimental apparatus. The numerical model developed in this work can account for both chemical absorption and desorption of CO 2 in MEA. In addition,more » the overall mass transfer coefficient predicted using traditional/empirical correlations is conducted and compared with CFD prediction results for both steady and wavy falling films. A Bayesian statistical calibration algorithm is adopted to calibrate the reaction rate constants in chemical absorption/desorption of CO 2 across a falling film of MEA. The posterior distributions of the two transport properties, i.e., Henry's constant and gas diffusivity in the non-reacting nitrous oxide (N 2O)/MEA system obtained from Part 1 of this study, serves as priors for the calibration of CO 2 reaction rate constants after using the N 2O/CO 2 analogy method. Finally, the calibrated model can be used to predict the CO 2 mass transfer in a WWC for a wider range of operating conditions.« less

  2. Hierarchical calibration and validation framework of bench-scale computational fluid dynamics simulations for solvent-based carbon capture. Part 2: Chemical absorption across a wetted wall column: Original Research Article: Hierarchical calibration and validation framework of bench-scale computational fluid dynamics simulations

    DOE PAGES

    Wang, Chao; Xu, Zhijie; Lai, Kevin; ...

    2017-10-24

    Part 1 of this paper presents a numerical model for non-reactive physical mass transfer across a wetted wall column (WWC). In Part 2, we improved the existing computational fluid dynamics (CFD) model to simulate chemical absorption occurring in a WWC as a bench-scale study of solvent-based carbon dioxide (CO 2) capture. In this study, to generate data for WWC model validation, CO 2 mass transfer across a monoethanolamine (MEA) solvent was first measured on a WWC experimental apparatus. The numerical model developed in this work can account for both chemical absorption and desorption of CO 2 in MEA. In addition,more » the overall mass transfer coefficient predicted using traditional/empirical correlations is conducted and compared with CFD prediction results for both steady and wavy falling films. A Bayesian statistical calibration algorithm is adopted to calibrate the reaction rate constants in chemical absorption/desorption of CO 2 across a falling film of MEA. The posterior distributions of the two transport properties, i.e., Henry's constant and gas diffusivity in the non-reacting nitrous oxide (N 2O)/MEA system obtained from Part 1 of this study, serves as priors for the calibration of CO 2 reaction rate constants after using the N 2O/CO 2 analogy method. Finally, the calibrated model can be used to predict the CO 2 mass transfer in a WWC for a wider range of operating conditions.« less

  3. Comparison of PAH Biodegradation and Desorption Kinetics During Bioremediation of Aged Petroleum Hydrocarbon Contaminated Soils

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Huesemann, Michael H.; Hausmann, Tom S.; Fortman, Timothy J.

    It is commonly assumed that mass-transfer limitations are the cause for slow and incomplete biodegradation of PAHs in aged soils. In order to test this hypothesis, the biodegradation rate and the abiotic release rate were measured and compared for selected PAHs in three different soils. It was found that PAH biodegradation was not mass-transfer limited during slurry bioremediation of an aged loamy soil. By contrast, PAH biodegradation rates were much larger than abiotic release rates in kaolinite clay indicating that sorbed-phase PAHs can apparently be biodegraded directly from mineral surfaces without prior desorption or dissolution into the aqueous phase. Amore » comparison of PAH biodegradation rates and abiotic release rates at termination of the slurry bioremediation treatment revealed that abiotic release rates are much larger than the respective biodegradation rates. In addition, it was found that the number of hydrocarbon degraders decreased by four orders of magnitude during the bioremediation treatment. It can therefore be concluded that the slow and incomplete biodegradation of PAHs is not caused by mass-transfer limitations but rather by microbial factors. Consequently, the residual PAHs that remain after extensive bioremediation treatment are still bioavailable and for that reason could pose a greater risk to environmental receptors than previously thought.« less

  4. Investigation of the kinetic mechanism of the demanganization reaction between carbon-saturated liquid iron and CaF2-CaO-SiO2-based slags

    NASA Astrophysics Data System (ADS)

    Duan, Sheng-chao; Li, Chuang; Guo, Han-jie; Guo, Jing; Han, Shao-wei; Yang, Wen-sheng

    2018-04-01

    The demanganization reaction kinetics of carbon-saturated liquid iron with an eight-component slag consisting of CaO-SiO2-MgO-FeO-MnO-Al2O3-TiO2-CaF2 was investigated at 1553, 1623, and 1673 K in this study. The rate-controlling step (RCS) for the demanganization reaction with regard to the hot metal pretreatment conditions was studied via kinetics analysis based on the fundamental equation of heterogeneous reaction kinetics. From the temperature dependence of the mass transfer coefficient of a transition-metal oxide (MnO), the apparent activation energy of the demanganization reaction was estimated to be 189.46 kJ·mol-1 in the current study, which indicated that the mass transfer of MnO in the molten slag controlled the overall rate of the demanganization reaction. The calculated apparent activation energy was slightly lower than the values reported in the literature for mass transfer in a slag phase. This difference was attributed to an increase in the "specific reaction interface" (SRI) value, either as a result of turbulence at the reaction interface or a decrease of the absolute amount of slag phase during sampling, and to the addition of calcium fluoride to the slag.

  5. Bubble Size Distribution in a Vibrating Bubble Column

    NASA Astrophysics Data System (ADS)

    Mohagheghian, Shahrouz; Wilson, Trevor; Valenzuela, Bret; Hinds, Tyler; Moseni, Kevin; Elbing, Brian

    2016-11-01

    While vibrating bubble columns have increased the mass transfer between phases, a universal scaling law remains elusive. Attempts to predict mass transfer rates in large industrial scale applications by extrapolating laboratory scale models have failed. In a stationary bubble column, mass transfer is a function of phase interfacial area (PIA), while PIA is determined based on the bubble size distribution (BSD). On the other hand, BSD is influenced by the injection characteristics and liquid phase dynamics and properties. Vibration modifies the BSD by impacting the gas and gas-liquid dynamics. This work uses a vibrating cylindrical bubble column to investigate the effect of gas injection and vibration characteristics on the BSD. The bubble column has a 10 cm diameter and was filled with water to a depth of 90 cm above the tip of the orifice tube injector. BSD was measured using high-speed imaging to determine the projected area of individual bubbles, which the nominal bubble diameter was then calculated assuming spherical bubbles. The BSD dependence on the distance from the injector, injector design (1.6 and 0.8 mm ID), air flow rates (0.5 to 5 lit/min), and vibration conditions (stationary and vibration conditions varying amplitude and frequency) will be presented. In addition to mean data, higher order statistics will also be provided.

  6. A guide to the synthesis of block copolymers using reversible-addition fragmentation chain transfer (RAFT) polymerization.

    PubMed

    Keddie, Daniel J

    2014-01-21

    The discovery of reversible-deactivation radical polymerization (RDRP) has provided an avenue for the synthesis of a vast array of polymers with a rich variety of functionality and architecture. The preparation of block copolymers has received significant focus in this burgeoning research field, due to their diverse properties and potential in a wide range of research environments. This tutorial review will address the important concepts behind the design and synthesis of block copolymers using reversible addition-fragmentation chain transfer (RAFT) polymerization. RAFT polymerization is arguably the most versatile of the RDRP methods due to its compatibility with a wide range of functional monomers and reaction media along with its relative ease of use. With an ever increasing array of researchers that possess a variety of backgrounds now turning to RDRP, and RAFT in particular, to prepare their required polymeric materials, it is pertinent to discuss the important points which enable the preparation of high purity functional block copolymers with targeted molar mass and narrow molar mass distribution using RAFT polymerization. The key principles of appropriate RAFT agent selection, the order of monomer addition in block synthesis and potential issues with maintaining high end-group fidelity are addressed. Additionally, techniques which allow block copolymers to be accessed using a combination of RAFT polymerization and complementary techniques are touched upon.

  7. Mass Transfer Limited Enhanced Bioremediation at Dnapl Source Zones: a Numerical Study

    NASA Astrophysics Data System (ADS)

    Kokkinaki, A.; Sleep, B. E.

    2011-12-01

    The success of enhanced bioremediation of dense non-aqueous phase liquids (DNAPLs) relies on accelerating contaminant mass transfer from the organic to the aqueous phase, thus enhancing the depletion of DNAPL source zones compared to natural dissolution. This is achieved by promoting biological activity that reduces the contaminant's aqueous phase concentration. Although laboratory studies have demonstrated that high reaction rates are attainable by specialized microbial cultures in DNAPL source zones, field applications of the technology report lower reaction rates and prolonged remediation times. One possible explanation for this phenomenon is that the reaction rates are limited by the rate at which the contaminant partitions from the DNAPL to the aqueous phase. In such cases, slow mass transfer to the aqueous phase reduces the bioavailability of the contaminant and consequently decreases the potential source zone depletion enhancement. In this work, the effect of rate limited mass transfer on bio-enhanced dissolution of DNAPL chlorinated ethenes is investigated through a numerical study. A multi-phase, multi-component groundwater transport model is employed to simulate DNAPL mass depletion for a range of source zone scenarios. Rate limited mass transfer is modeled by a linear driving force model, employing a thermodynamic approach for the calculation of the DNAPL - water interfacial area. Metabolic reductive dechlorination is modeled by Monod kinetics, considering microbial growth and self-inhibition. The model was utilized to identify conditions in which mass transfer, rather than reaction, is the limiting process, as indicated by the bioavailability number. In such cases, reaction is slower than expected, and further increase in the reaction rate does not enhance mass depletion. Mass transfer rate limitations were shown to affect both dechlorination and microbial growth kinetics. The complex dynamics between mass transfer, DNAPL transport and distribution, and dechlorination kinetics were reflected in a transient, spatially heterogeneous bioavailability number and dissolution enhancement. In agreement with the literature, source zone architecture largely determined the impact of mass transfer on potential dissolution enhancement, with bioavailability decreasing the most at high ganglia to pool ratios. The results of this study suggest that if mass transfer rate limitations are not considered in designing bioremediation applications at DNAPL source zones, the enhancement of DNAPL depletion and the overall effectiveness of enhanced bioremediation may be significantly overestimated.

  8. Photo-induced Mass Transport through Polymer Networks

    NASA Astrophysics Data System (ADS)

    Meng, Yuan; Anthamatten, Mitchell

    2014-03-01

    Among adaptable materials, photo-responsive polymers are especially attractive as they allow for spatiotemporal stimuli and response. We have recently developed a macromolecular network capable of photo-induced mass transport of covalently bound species. The system comprises of crosslinked chains that form an elastic network and photosensitive fluorescent arms that become mobile upon irradiation. We form loosely crosslinked polymer networks by Michael-Addition between multifunctional thiols and small molecule containing acrylate end-groups. The arms are connected to the network by allyl sulfide, that undergoes addition-fragmentation chain transfer (AFCT) in the presence of free radicals, releasing diffusible fluorophore. The networks are loaded with photoinitiator to allow for spatial modulation of the AFCT reactions. FRAP experiments within bulk elastomers are conducted to establish correlations between the fluorophore's diffusion coefficient and experimental variables such as network architecture, temperature and UV intensity. Photo-induced mass transport between two contacted films is demonstrated, and release of fluorophore into a solvent is investigated. Spatial and temporal control of mass transport could benefit drug release, printing, and sensing applications.

  9. Capillary electrophoresis electrospray ionization mass spectrometry interface

    DOEpatents

    Smith, Richard D.; Severs, Joanne C.

    1999-01-01

    The present invention is an interface between a capillary electrophoresis separation capillary end and an electrospray ionization mass spectrometry emitter capillary end, for transporting an anolyte sample from a capillary electrophoresis separation capillary to a electrospray ionization mass spectrometry emitter capillary. The interface of the present invention has: (a) a charge transfer fitting enclosing both of the capillary electrophoresis capillary end and the electrospray ionization mass spectrometry emitter capillary end; (b) a reservoir containing an electrolyte surrounding the charge transfer fitting; and (c) an electrode immersed into the electrolyte, the electrode closing a capillary electrophoresis circuit and providing charge transfer across the charge transfer fitting while avoiding substantial bulk fluid transfer across the charge transfer fitting. Advantages of the present invention have been demonstrated as effective in providing high sensitivity and efficient analyses.

  10. Murt user`s guide: A hybrid Lagrangian-Eulerian finite element model of multiple-pore-region solute transport through subsurface media

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Gwo, J.P.; Jardine, P.M.; Yeh, G.T.

    Matrix diffusion, a diffusive mass transfer process,in the structured soils and geologic units at ORNL, is believe to be an important subsurface mass transfer mechanism; it may affect off-site movement of radioactive wastes and remediation of waste disposal sites by locally exchanging wastes between soil/rock matrix and macropores/fractures. Advective mass transfer also contributes to waste movement but is largely neglected by researchers. This report presents the first documented 2-D multiregion solute transport code (MURT) that incorporates not only diffusive but also advective mass transfer and can be applied to heterogeneous porous media under transient flow conditions. In this report, theoreticalmore » background is reviewed and the derivation of multiregion solute transport equations is presented. Similar to MURF (Gwo et al. 1994), a multiregion subsurface flow code, multiplepore domains as suggested by previous investigators (eg, Wilson and Luxmoore 1988) can be implemented in MURT. Transient or steady-state flow fields of the pore domains can be either calculated by MURF or by modelers. The mass transfer process is briefly discussed through a three-pore-region multiregion solute transport mechanism. Mass transfer equations that describe mass flux across pore region interfaces are also presented and parameters needed to calculate mass transfer coefficients detailed. Three applications of MURT (tracer injection problem, sensitivity analysis of advective and diffusive mass transfer, hillslope ponding infiltration and secondary source problem) were simulated and results discussed. Program structure of MURT and functions of MURT subroutiness are discussed so that users can adapt the code; guides for input data preparation are provided in appendices.« less

  11. Quantification of the Mass Transfer at Fluid Interfaces in Microfluidic Channels

    NASA Astrophysics Data System (ADS)

    Wismeth, Carina; Manhart, Michael; Niessner, Reinhard; Baumann, Thomas

    2017-04-01

    Mass transfer rates at interfaces in a complex porous media are relevant in many environmental applications and control the functions of natural filter systems in subsurface environments. The mass transfer at fluid interfaces is associated with interface convection caused by local inhomogeneities in interface tension and hydrodynamic instabilities at the interface. If there is a surface tension gradient along the surface a shear stress jump is generated that results in fluid motion along the surface that is called Marangoni effect. These spontaneous convection currents can lead to an increased mass transfer of the transition component at the phase boundary and to an increased mixing of the phases. Therefore compensatory currents at the interface can have a significant influence on the subsurface transport of contaminants in the groundwater area, especially in the vadose zone. Using microfluidic channels and advanced experimental techniques it is possible to measure the fluid flow and mass transfer rates directly and to quantify the effect of the Marangoni convection on the mass transfer at interfaces between a non-aqueous liquid and water with high temporal and spatial resolution. The use of fluorescent particles as well as the recording and analysis of their trajectories is intended to visualize interfacial processes and to quantify the mass transfer at fluid phase boundaries. Concentration gradients at the interface are analysed by spectroscopic methods and allow an assessment of the enrichment and depletion at the phase boundaries. Extensive test series provide the experimental basis for quantifying and analysing the impact of the Marangoni effect on the mass transfer rates at interfaces in porous media in subsurface aquatic environments. Within this research project we concentrate on the effect of Marangoni convection on the mass transfer near an 1-octanol-water interface, which serves as a well defined proxy for non-aqueous phase liquids in porous media. Experiments and a numerical simulation are closely coupled to provide a generic data set with high reproducibility and used to obtain highly resolved three-dimensional data of mass transfer in two- and three-phase systems to foster the understanding of subsurface transport, especially in the vadose zone.

  12. Phthalates and alternative plasticizers and potential for contact exposure from children's backpacks and toys.

    PubMed

    Xie, Mingjie; Wu, Yaoxing; Little, John C; Marr, Linsey C

    2016-01-01

    This work focuses on the mass content of plasticizers in children's backpacks and toys, and their mass transfer from product surfaces to cotton wipes. The mass content of plasticizers in six backpacks and seven toys was measured by extracting them in tetrahydrofuran. Bis(2-ethylhexyl) terephthalate (DEHT) was the most common plasticizer, dominating the composition of plasticizers in four backpacks (average mass content in product polyvinyl chloride, 5.38 ± 1.98%-25.5 ± 3.54%) and six plastic toys (8.17 ± 1.85%-21.2 ± 1.11%). The surface of each product was wiped with three dry and three wet (by isopropanol) cotton wipes, so as to evaluate the mass transfer of plasticizers to clothing and human skin, respectively. DEHT was the most common plasticizer detected on wipe samples. There were strong correlations (backpacks r=0.90; plastic toys r=0.96) between average mass transfer of DEHT to wet wipes and its average mass content in the product. The mass transfers of the five dominant plasticizers in one backpack to both dry and wet wipes were also correlated (both r=1.00) with their mass contents. These results suggest that the mass transfer of plasticizers from products to clothing or human skin is strongly associated with their mass content.

  13. Controls and variability of solute and sedimentary fluxes in Arctic and sub-Arctic Environments

    NASA Astrophysics Data System (ADS)

    Dixon, John

    2015-04-01

    Six major factors consistently emerge as controls on the spatial and temporal variability in sediment and solute fluxes in cold climates. They are climatic, geologic, physiographic or relief, biologic, hydrologic, and regolith factors. The impact of these factors on sediment and solute mass transfer in Arctic and sub-Arctic environments is examined. Comparison of non-glacierized Arctic vs. subarctic drainage basins reveals the effects of these controls. All drainage basins exhibit considerable variability in rates of sediment and solute fluxes. For the non-glacierized drainage basins there is a consistent increase in sediment mass transfer by slope processes and fluvial processes as relief increases. Similarly, a consistent increase in sediment mass transfer by slope and fluvial processes is observed as total precipitation increases. Similar patterns are also observed with respect to solute transport and relief and precipitation. Lithologic factors are most strongly observed in the contrast between volcanic vs. plutonic igneous bedrock substrates. Basins underlain by volcanic rocks display greater mass transfers than those underlain by plutonic rocks. Biologic influences are most strongly expressed by variations in extent of vegetation cover and the degree of human interference, with human impacted basins generating greater fluxes. For glacierized basins the fundamental difference to non-glacierized basins is an overall increase in mean annual mass transfers of sediment and a generally smaller magnitude solute transfer. The principal role of geology is observed with respect to lithology. Catchments underlain by limestone demonstrate substantially greater solute mass transfers than sediment transfer. The influence of relief is seen in the contrast in mass transfers between upland and lowland drainage basins with upland basins generating greater sediment and solute transfers than lowland basins. For glacierized basins the effects of biology and regolith appear to be largely overridden by the hydrologic impacts of glacierization.

  14. Beyond the standard two-film theory: Computational fluid dynamics simulations for carbon dioxide capture in a wetted wall column

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Wang, Chao; Xu, Zhijie; Lai, Canhai

    The standard two-film theory (STFT) is a diffusion-based mechanism that can be used to describe gas mass transfer across liquid film. Fundamental assumptions of the STFT impose serious limitations on its ability to predict mass transfer coefficients. To better understand gas absorption across liquid film in practical situations, a multiphase computational fluid dynamics (CFD) model fully equipped with mass transport and chemistry capabilities has been developed for solvent-based carbon dioxide (CO 2) capture to predict the CO 2 mass transfer coefficient in a wetted wall column. The hydrodynamics is modeled using a volume of fluid method, and the diffusive andmore » reactive mass transfer between the two phases is modeled by adopting a one-fluid formulation. We demonstrate that the proposed CFD model can naturally account for the influence of many important factors on the overall mass transfer that cannot be quantitatively explained by the STFT, such as the local variation in fluid velocities and properties, flow instabilities, and complex geometries. The CFD model also can predict the local mass transfer coefficient variation along the column height, which the STFT typically does not consider.« less

  15. Beyond the standard two-film theory: Computational fluid dynamics simulations for carbon dioxide capture in a wetted wall column

    DOE PAGES

    Wang, Chao; Xu, Zhijie; Lai, Canhai; ...

    2018-03-27

    The standard two-film theory (STFT) is a diffusion-based mechanism that can be used to describe gas mass transfer across liquid film. Fundamental assumptions of the STFT impose serious limitations on its ability to predict mass transfer coefficients. To better understand gas absorption across liquid film in practical situations, a multiphase computational fluid dynamics (CFD) model fully equipped with mass transport and chemistry capabilities has been developed for solvent-based carbon dioxide (CO 2) capture to predict the CO 2 mass transfer coefficient in a wetted wall column. The hydrodynamics is modeled using a volume of fluid method, and the diffusive andmore » reactive mass transfer between the two phases is modeled by adopting a one-fluid formulation. We demonstrate that the proposed CFD model can naturally account for the influence of many important factors on the overall mass transfer that cannot be quantitatively explained by the STFT, such as the local variation in fluid velocities and properties, flow instabilities, and complex geometries. The CFD model also can predict the local mass transfer coefficient variation along the column height, which the STFT typically does not consider.« less

  16. Comparison of different bioheat transfer models for assessment of burns injuries

    NASA Astrophysics Data System (ADS)

    Łapka, Piotr; Furmański, Piotr; Wiśniewski, Tomasz S.

    2016-12-01

    Two bioheat transfer models i.e.: the classical Pennes model and a more realistic two-equation model which accounted for blood vessel structure in the skin as well as heat transfer in the tissue and arteria blood were coupled with heat and mass transfer model in the protective multilayer garment. The clothing model included conductive-radiative heat transfer with water vapor diffusion in pores and air gaps as well as sorption and desorption of water in fibers. Thermal radiation was modeled rigorously e.g.: both the tissue and fabrics were assumed non-gray, absorbing, emitting and anisotropically scattering. Additionally different refractive indices of fabrics, air and tissue and resulting optical phenomena at separating interfaces were accounted for. Both bioheat models were applied for predicting skin temperature distributions and possibility of burns for different exposition times and radiative heat fluxes incident on external surface of the protective garment. Performed analyses revealed that heat transfer in the skin subjected to high heat flux is independent of the blood vessel structure.

  17. Heat Transfer from a Horizontal Cylinder Rotating in Oil

    NASA Technical Reports Server (NTRS)

    Seban, R. A.; Johnson, H. A.

    1959-01-01

    Measurements of the heat transfer from a horizontal cylinder rotating about its axis have been made with oil as the surrounding fluid to provide an addition to the heat-transfer results for this system heretofore available only for air. The results embrace a Prandtl number range from about 130 to 660, with Reynolds numbers up to 3 x 10(exp 4), and show an increasing dependence of free-convection heat transfer on rotation as the Prandtl number is increased by reducing the oil temperature. Some correlation of this effect, which agrees with the prior results for air, has been achieved. At higher rotative speeds the flow becomes turbulent, the free- convection effect vanishes, and the results with oil can be correlated generally with those for air and with mass-transfer results for even higher Prandtl numbers. For this system, however, the analogy calculations which have successfully related the heat transfer to the friction for pipe flows at high Prandtl numbers fail.

  18. ADIABATIC MASS LOSS IN BINARY STARS. II. FROM ZERO-AGE MAIN SEQUENCE TO THE BASE OF THE GIANT BRANCH

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Ge, Hongwei; Chen, Xuefei; Han, Zhanwen

    2015-10-10

    In the limit of extremely rapid mass transfer, the response of a donor star in an interacting binary becomes asymptotically one of adiabatic expansion. We survey here adiabatic mass loss from Population I stars (Z = 0.02) of mass 0.10 M{sub ⊙}–100 M{sub ⊙} from the zero-age main sequence to the base of the giant branch, or to central hydrogen exhaustion for lower main sequence stars. The logarithmic derivatives of radius with respect to mass along adiabatic mass-loss sequences translate into critical mass ratios for runaway (dynamical timescale) mass transfer, evaluated here under the assumption of conservative mass transfer. Formore » intermediate- and high-mass stars, dynamical mass transfer is preceded by an extended phase of thermal timescale mass transfer as the star is stripped of most of its envelope mass. The critical mass ratio q{sub ad} (throughout this paper, we follow the convention of defining the binary mass ratio as q ≡ M{sub donor}/M{sub accretor}) above which this delayed dynamical instability occurs increases with advancing evolutionary age of the donor star, by ever-increasing factors for more massive donors. Most intermediate- or high-mass binaries with nondegenerate accretors probably evolve into contact before manifesting this instability. As they approach the base of the giant branch, however, and begin developing a convective envelope, q{sub ad} plummets dramatically among intermediate-mass stars, to values of order unity, and a prompt dynamical instability occurs. Among low-mass stars, the prompt instability prevails throughout main sequence evolution, with q{sub ad} declining with decreasing mass, and asymptotically approaching q{sub ad} = 2/3, appropriate to a classical isentropic n = 3/2 polytrope. Our calculated q{sub ad} values agree well with the behavior of time-dependent models by Chen and Han of intermediate-mass stars initiating mass transfer in the Hertzsprung gap. Application of our results to cataclysmic variables, as systems that must be stable against rapid mass transfer, nicely circumscribes the range in q{sub ad} as a function of the orbital period in which they are found. These results are intended to advance the verisimilitude of population synthesis models of close binary evolution.« less

  19. Membrane-Mediated Extraction and Biodegradation of Volatile Organic Compounds From Air

    DTIC Science & Technology

    2005-01-01

    side boundary-layer mass transfer resistance is a significant fraction of the total mass transfer resistance ( Raghunath , 1992). In some cases where...Sci. 59: 53–72. Raghunath , B., and S.–T. Hwang (1992). “Effect of boundary layer mass transfer resistance in the pervaporation of dilute organics

  20. A comparison of mass transfer coefficients between trickle-bed, hollow fiber membrane and stirred tank reactors.

    PubMed

    Orgill, James J; Atiyeh, Hasan K; Devarapalli, Mamatha; Phillips, John R; Lewis, Randy S; Huhnke, Raymond L

    2013-04-01

    Trickle-bed reactor (TBR), hollow fiber membrane reactor (HFR) and stirred tank reactor (STR) can be used in fermentation of sparingly soluble gasses such as CO and H2 to produce biofuels and bio-based chemicals. Gas fermenting reactors must provide high mass transfer capabilities that match the kinetic requirements of the microorganisms used. The present study compared the volumetric mass transfer coefficient (K(tot)A/V(L)) of three reactor types; the TBR with 3 mm and 6 mm beads, five different modules of HFRs, and the STR. The analysis was performed using O2 as the gaseous mass transfer agent. The non-porous polydimethylsiloxane (PDMS) HFR provided the highest K(tot)A/V(L) (1062 h(-1)), followed by the TBR with 6mm beads (421 h(-1)), and then the STR (114 h(-1)). The mass transfer characteristics in each reactor were affected by agitation speed, and gas and liquid flow rates. Furthermore, issues regarding the comparison of mass transfer coefficients are discussed. Copyright © 2013 Elsevier Ltd. All rights reserved.

  1. Determination of the profile of DO and its mass transferring coefficient in a biofilm reactor packed with semi-suspended bio-carriers.

    PubMed

    Tang, Bing; Song, Haoliang; Bin, Liying; Huang, Shaosong; Zhang, Wenxiang; Fu, Fenglian; Zhao, Yiliang; Chen, Qianyu

    2017-10-01

    The work aims at illustrating the profile of DO and its mass transferring process in a biofilm reactor packed with a novel semi-suspended bio-carrier, and further revealing the main factors that influence the mass transferring coefficient of DO within the biofilm. Results showed that the biofilm was very easy to attach and grow on the semi-suspended bio-carrier, which obviously changed the DO profile inside and outside the biofilm. The semi-suspended bio-carrier caused three different mass transfer zones occurring in the bioreactor, including the zones of bulk solution, boundary layer and biofilm, in which, the boundary layer zone had an obvious higher mass transfer resistance. Increasing the aeration rate might improve the hydrodynamic conditions in the bioreactor and accelerate the mass transfer of DO, but it also detached the biofilm from the surface of bio-carrier, which reduced the consumption of DO, and accordingly, decreased the DO gradient in the bioreactor. Copyright © 2017 Elsevier Ltd. All rights reserved.

  2. [Correlation of molecular weight and nanofiltration mass transfer coefficient of phenolic acid composition from Salvia miltiorrhiza].

    PubMed

    Li, Cun-Yu; Wu, Xin; Gu, Jia-Mei; Li, Hong-Yang; Peng, Guo-Ping

    2018-04-01

    Based on the molecular sieving and solution-diffusion effect in nanofiltration separation, the correlation between initial concentration and mass transfer coefficient of three typical phenolic acids from Salvia miltiorrhiza was fitted to analyze the relationship among mass transfer coefficient, molecular weight and concentration. The experiment showed a linear relationship between operation pressure and membrane flux. Meanwhile, the membrane flux was gradually decayed with the increase of solute concentration. On the basis of the molecular sieving and solution-diffusion effect, the mass transfer coefficient and initial concentration of three phenolic acids showed a power function relationship, and the regression coefficients were all greater than 0.9. The mass transfer coefficient and molecular weight of three phenolic acids were negatively correlated with each other, and the order from high to low is protocatechualdehyde >rosmarinic acid> salvianolic acid B. The separation mechanism of nanofiltration for phenolic acids was further clarified through the analysis of the correlation of molecular weight and nanofiltration mass transfer coefficient. The findings provide references for nanofiltration separation, especially for traditional Chinese medicine with phenolic acids. Copyright© by the Chinese Pharmaceutical Association.

  3. Mass transfer in a 1370 C (2500 F) lithium thermal convection loop

    NASA Technical Reports Server (NTRS)

    Scheuermann, C. M.

    1974-01-01

    Experimental results from a test to evaluate interstitial element mass transfer effects on T-111, ASTAR 811C, and ASTAR 1211C after 5000 hours in flowing lithium at 1370 C (2500 F) are presented. No gross corrosion effects were observed. However, hafnium and nitrogen transfer to cooler regions within the loop were noted. Oxygen was in general removed from test specimens, but there was no evidence to indicate that it was a major factor in the mass transfer process. Carbon and hydrogen transfer were not detected.

  4. Design of passive interconnections in tall buildings subject to earthquake disturbances to suppress inter-storey drifts

    NASA Astrophysics Data System (ADS)

    Yamamoto, K.; Smith, MC

    2016-09-01

    This paper studies the problem of passive control of a multi-storey building subjected to an earthquake disturbance. The building is represented as a homogeneous mass chain model, i.e., a chain of identical masses in which there is an identical passive connection between neighbouring masses and a similar connection to a movable point. The paper considers passive interconnections of the most general type, which may require the use of inerters in addition to springs and dampers. It is shown that the scalar transfer functions from the disturbance to a given inter-storey drift can be represented as complex iterative maps. Using these expressions, two graphical approaches are proposed: one gives a method to achieve a prescribed value for the uniform boundedness of these transfer functions independent of the length of the mass chain, and the other is for a fixed length of the mass chain. A case study is presented to demonstrate the effectiveness of the proposed techniques using a 10-storey building model. The disturbance suppression performance of the designed interconnection is also verified for a 10-storey building model which has a different stiffness distribution but with the same undamped first natural frequency as the homogeneous model.

  5. Coupled bending-torsion steady-state response of pretwisted, nonuniform rotating beams using a transfer-matrix method

    NASA Technical Reports Server (NTRS)

    Gray, Carl E., Jr.

    1988-01-01

    Using the Newtonian method, the equations of motion are developed for the coupled bending-torsion steady-state response of beams rotating at constant angular velocity in a fixed plane. The resulting equations are valid to first order strain-displacement relationships for a long beam with all other nonlinear terms retained. In addition, the equations are valid for beams with the mass centroidal axis offset (eccentric) from the elastic axis, nonuniform mass and section properties, and variable twist. The solution of these coupled, nonlinear, nonhomogeneous, differential equations is obtained by modifying a Hunter linear second-order transfer-matrix solution procedure to solve the nonlinear differential equations and programming the solution for a desk-top personal computer. The modified transfer-matrix method was verified by comparing the solution for a rotating beam with a geometric, nonlinear, finite-element computer code solution; and for a simple rotating beam problem, the modified method demonstrated a significant advantage over the finite-element solution in accuracy, ease of solution, and actual computer processing time required to effect a solution.

  6. Toward a universal mass-momentum transfer relationship for predicting nutrient uptake and metabolite exchange in benthic reef communities

    NASA Astrophysics Data System (ADS)

    Falter, James L.; Lowe, Ryan J.; Zhang, Zhenlin

    2016-09-01

    Here we synthesize data from previous field and laboratory studies describing how rates of nutrient uptake and metabolite exchange (mass transfer) are related to form drag and bottom stresses (momentum transfer). Reanalysis of this data shows that rates of mass transfer are highly correlated (r2 ≥ 0.9) with the root of the bottom stress (τbot0.4) under both waves and currents and only slightly higher under waves (~10%). The amount of mass transfer that can occur per unit bottom stress (or form drag) is influenced by morphological features ranging anywhere from millimeters to meters in scale; however, surface-scale roughness (millimeters) appears to have little effect on actual nutrient uptake by living reef communities. Although field measurements of nutrient uptake by natural reef communities agree reasonably well with predictions based on existing mass-momentum transfer relationships, more work is needed to better constrain these relationships for more rugose and morphologically complex communities.

  7. Influence of drying air parameters on mass transfer characteristics of apple slices

    NASA Astrophysics Data System (ADS)

    Beigi, Mohsen

    2016-10-01

    To efficiently design both new drying process and equipment and/or to improve the existing systems, accurate values of mass transfer characteristics are necessary. The present study aimed to investigate the influence of drying air parameters (i.e. temperature, velocity and relative humidity) on effective diffusivity and convective mass transfer coefficient of apple slices. The Dincer and Dost model was used to determine the mass transfer characteristics. The obtained Biot number indicated that the moisture transfer in the apple slices was controlled by both internal and external resistance. The effective diffusivity and mass transfer coefficient values obtained to be in the ranges of 7.13 × 10-11-7.66 × 10-10 and 1.46 × 10-7-3.39 × 10-7 m s-1, respectively and the both of them increased with increasing drying air temperature and velocity, and decreasing relative humidity. The validation of the model showed that the model predicted the experimental drying curves of the samples with a good accuracy.

  8. Double diffusive conjugate heat transfer: Part I

    NASA Astrophysics Data System (ADS)

    Azeem, Soudagar, Manzoor Elahi M.

    2018-05-01

    The present work is undertaken to investigate the effect of solid wall being placed at left of square cavity filled with porous medium. The presence of a solid wall in the porous medium turns the situation into a conjugate heat transfer problem. The boundary conditions are such that the left vertical surface is maintained at highest temperature and concentration whereas right vertical surface at lowest temperature and concentration in the medium. The top and bottom surfaces are adiabatic. The additional conduction equation along with the regular momentum and energy equations of porous medium are solved in an iterative manner with the help of finite element method. It is seen that the heat and mass transfer rate is lesser due to smaller thermal and concentration gradients.

  9. Volatile organic compound emissions from elephant grass and bamboo cultivars used as potential bioethanol crop

    NASA Astrophysics Data System (ADS)

    Crespo, E.; Graus, M.; Gilman, J. B.; Lerner, B. M.; Fall, R.; Harren, F. J. M.; Warneke, C.

    2013-02-01

    Volatile organic compound (VOC) emissions from elephant grass (Miscanthus gigantus) and black bamboo (Phyllostachys nigra) were measured online in semi-field chamber and plant enclosure experiments during growth and harvest using proton-transfer reaction mass spectrometry (PTR-MS), proton-transfer reaction ion-trap mass spectrometry (PIT-MS) and gas chromatography-mass spectrometry (GC-MS). Both cultivars are being considered for second-generation biofuel production. Before this study, no information was available on their yearly VOC emissions. This exploratory investigation shows that black bamboo is a strong isoprene emitter (daytime 28,516 ng gdwt-1 h-1) and has larger VOC emissions, especially for wound compounds from the hexanal and hexenal families, than elephant grass. Daytime emissions of methanol, acetaldehyde, acetone + propanal and acetic acid of black bamboo were 618, 249, 351, and 1034 ng gdwt-1 h-1, respectively. In addition, it is observed that elephant grass VOC emissions after harvesting strongly depend on the seasonal stage. Not taking VOC emission variations throughout the season for annual and perennial species into account, may lead to an overestimation of the impact on local air quality in dry periods. In addition, our data suggest that the use of perennial grasses for extensive growing for biofuel production have lower emissions than woody species, which might be important for regional atmospheric chemistry.

  10. Transfer of arsenic from poultry feed to poultry litter: A mass balance study.

    PubMed

    Gupta, Sanjay K; Le, X Chris; Kachanosky, Gary; Zuidhof, Martin J; Siddique, Tariq

    2018-07-15

    Roxarsone (rox), an arsenic (As) containing organic compound, is a common feed additive used in poultry production. To determine if As present in rox is excreted into the poultry litter without any retention in chicken meat for safe human consumption, the transference of As from the feed to poultry excreta was assessed using two commercial chicken strains fed with and without dietary rox. The results revealed that both the strains had similar behaviour in growth (chicken weight; 2.17-2.25kg), feed consumption (282-300kgpen -1 initially containing 102 chicken) and poultry litter production (73-81kgpen -1 ) during the growth phase of 35days. Our mass balance calculations showed that chickens ingested 2669-2730mg As with the feed and excreted out 2362-2896mg As in poultry litter during the growth period of 28days when As containing feed was used, yielding As recovery between 86 and 108%. Though our complementary studies show that residual arsenic species in rox-fed chicken meat may have relevance to human exposure, insignificant retention of total As in the chicken meat substantiates our mass balance results. The results are important in evaluating the fate of feed additive used in poultry production and its potential environmental implications if As containing poultry litter is applied to soil for crop production. Copyright © 2018 Elsevier B.V. All rights reserved.

  11. Discrete multi-physics simulations of diffusive and convective mass transfer in boundary layers containing motile cilia in lungs.

    PubMed

    Ariane, Mostapha; Kassinos, Stavros; Velaga, Sitaram; Alexiadis, Alessio

    2018-04-01

    In this paper, the mass transfer coefficient (permeability) of boundary layers containing motile cilia is investigated by means of discrete multi-physics. The idea is to understand the main mechanisms of mass transport occurring in a ciliated-layer; one specific application being inhaled drugs in the respiratory epithelium. The effect of drug diffusivity, cilia beat frequency and cilia flexibility is studied. Our results show the existence of three mass transfer regimes. A low frequency regime, which we called shielding regime, where the presence of the cilia hinders mass transport; an intermediate frequency regime, which we have called diffusive regime, where diffusion is the controlling mechanism; and a high frequency regime, which we have called convective regime, where the degree of bending of the cilia seems to be the most important factor controlling mass transfer in the ciliated-layer. Since the flexibility of the cilia and the frequency of the beat changes with age and health conditions, the knowledge of these three regimes allows prediction of how mass transfer varies with these factors. Copyright © 2018 Elsevier Ltd. All rights reserved.

  12. Flow and heat transfer enhancement in tube heat exchangers

    NASA Astrophysics Data System (ADS)

    Sayed Ahmed, Sayed Ahmed E.; Mesalhy, Osama M.; Abdelatief, Mohamed A.

    2015-11-01

    The performance of heat exchangers can be improved to perform a certain heat-transfer duty by heat transfer enhancement techniques. Enhancement techniques can be divided into two categories: passive and active. Active methods require external power, such as electric or acoustic field, mechanical devices, or surface vibration, whereas passive methods do not require external power but make use of a special surface geometry or fluid additive which cause heat transfer enhancement. The majority of commercially interesting enhancement techniques are passive ones. This paper presents a review of published works on the characteristics of heat transfer and flow in finned tube heat exchangers of the existing patterns. The review considers plain, louvered, slit, wavy, annular, longitudinal, and serrated fins. This review can be indicated by the status of the research in this area which is important. The comparison of finned tubes heat exchangers shows that those with slit, plain, and wavy finned tubes have the highest values of area goodness factor while the heat exchanger with annular fin shows the lowest. A better heat transfer coefficient ha is found for a heat exchanger with louvered finned and thus should be regarded as the most efficient one, at fixed pumping power per heat transfer area. This study points out that although numerous studies have been conducted on the characteristics of flow and heat transfer in round, elliptical, and flat tubes, studies on some types of streamlined-tubes shapes are limited, especially on wing-shaped tubes (Sayed Ahmed et al. in Heat Mass Transf 50: 1091-1102, 2014; in Heat Mass Transf 51: 1001-1016, 2015). It is recommended that further detailed studies via numerical simulations and/or experimental investigations should be carried out, in the future, to put further insight to these fin designs.

  13. Shift in Mass Transfer of Wastewater Contaminants from Microplastics in the Presence of Dissolved Substances.

    PubMed

    Seidensticker, Sven; Zarfl, Christiane; Cirpka, Olaf A; Fellenberg, Greta; Grathwohl, Peter

    2017-11-07

    In aqueous environments, hydrophobic organic contaminants are often associated with particles. Besides natural particles, microplastics have raised public concern. The release of pollutants from such particles depends on mass transfer, either in an aqueous boundary layer or by intraparticle diffusion. Which of these mechanisms controls the mass-transfer kinetics depends on partition coefficients, particle size, boundary conditions, and time. We have developed a semianalytical model accounting for both processes and performed batch experiments on the desorption kinetics of typical wastewater pollutants (phenanthrene, tonalide, and benzophenone) at different dissolved-organic-matter concentrations, which change the overall partitioning between microplastics and water. Initially, mass transfer is externally dominated, while finally, intraparticle diffusion controls release kinetics. Under boundary conditions typical for batch experiments (finite bath), desorption accelerates with increasing partition coefficients for intraparticle diffusion, while it becomes independent of partition coefficients if film diffusion prevails. On the contrary, under field conditions (infinite bath), the pollutant release controlled by intraparticle diffusion is not affected by partitioning of the compound while external mass transfer slows down with increasing sorption. Our results clearly demonstrate that sorption/desorption time scales observed in batch experiments may not be transferred to field conditions without an appropriate model accounting for both the mass-transfer mechanisms and the specific boundary conditions at hand.

  14. On the importance of the heat and mass transfer resistances in internally-cooled liquid desiccant dehumidifiers and regenerators

    DOE PAGES

    Woods, Jason; Kozubal, Eric

    2018-02-06

    Liquid desiccant heat and mass exchangers are a promising technology for efficient humidity control in buildings. Many researchers have investigated these exchangers, often using numerical models to predict their performance. However, there is a lack of information in the literature on the magnitude of the heat and mass transfer resistances, both for the dehumidifier (which absorbs moisture from the air) and the regenerator (which heats the liquid desiccant to re-concentrate it). This article focuses on internally-cooled, 3-fluid exchangers in a parallel plate geometry. Water heats or cools a desiccant across a plate, and the desiccant absorbs or releases water intomore » an airstream through a membrane. A sensitivity analysis was used to estimate the importance of each of the heat and mass transfer resistances (air, membrane, desiccant, plate, water), and how it changes with different design geometries. The results show that, for most designs, the latent and sensible heat transfer of the dehumidifier is dominated by the air mass transfer resistance and air heat transfer resistance, respectively. The air mass transfer resistance is also important for the regenerator, but much less so; the change in the desiccant equilibrium humidity ratio due to a change in either temperature or desiccant mass fraction is much higher at the regenerator's higher temperatures. This increases the importance of (1) getting heat from the water to the desiccant/membrane interface, and (2) diffusing salt ions quickly away from the desiccant/membrane interface. The membrane heat transfer and water heat transfer resistances were found to be the least important. These results can help inform decisions about what simplifying assumptions to make in numerical models, and can also help in designing these exchangers by understanding which resistances are most important.« less

  15. On the importance of the heat and mass transfer resistances in internally-cooled liquid desiccant dehumidifiers and regenerators

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Woods, Jason; Kozubal, Eric

    Liquid desiccant heat and mass exchangers are a promising technology for efficient humidity control in buildings. Many researchers have investigated these exchangers, often using numerical models to predict their performance. However, there is a lack of information in the literature on the magnitude of the heat and mass transfer resistances, both for the dehumidifier (which absorbs moisture from the air) and the regenerator (which heats the liquid desiccant to re-concentrate it). This article focuses on internally-cooled, 3-fluid exchangers in a parallel plate geometry. Water heats or cools a desiccant across a plate, and the desiccant absorbs or releases water intomore » an airstream through a membrane. A sensitivity analysis was used to estimate the importance of each of the heat and mass transfer resistances (air, membrane, desiccant, plate, water), and how it changes with different design geometries. The results show that, for most designs, the latent and sensible heat transfer of the dehumidifier is dominated by the air mass transfer resistance and air heat transfer resistance, respectively. The air mass transfer resistance is also important for the regenerator, but much less so; the change in the desiccant equilibrium humidity ratio due to a change in either temperature or desiccant mass fraction is much higher at the regenerator's higher temperatures. This increases the importance of (1) getting heat from the water to the desiccant/membrane interface, and (2) diffusing salt ions quickly away from the desiccant/membrane interface. The membrane heat transfer and water heat transfer resistances were found to be the least important. These results can help inform decisions about what simplifying assumptions to make in numerical models, and can also help in designing these exchangers by understanding which resistances are most important.« less

  16. Mass transfer dynamics of ammonia in high rate biomethanation of poultry litter leachate.

    PubMed

    Gangagni Rao, A; Gandu, Bharath; Swamy, Y V

    2012-04-01

    In the present study possibility of coupling biofilter to arrest ammonia (NH(3)) emission to the atmosphere from the integrated UASB and stripper (UASB+ST) system treating poultry litter leachate was studied. UASB+ST with biofilter (UASB+ST+BF) exhibited removal efficiency (RE) of NH(3) in the range of 98-99% (below 28 ppmV (parts per million by volume)) with low cost agricultural residue as a bedding material. Mass transfer dynamics of TAN in the system revealed that TAN loss to atmosphere was below 1% in UASB+ST+BF where as it was in the range of 70-90% in UASB+ST. Cost estimates revealed that financial implications due to the addition of biofilter were below 10% of total capital cost. TAN retained in the bedding material of biofilter could also be utilized as soil conditioner upon saturation. Copyright © 2012 Elsevier Ltd. All rights reserved.

  17. Imaging charge transfer in a cation-π system: velocity-map imaging of Ag(+)(benzene) photodissociation.

    PubMed

    Maner, Jonathon A; Mauney, Daniel T; Duncan, Michael A

    2015-11-19

    Ag(+)(benzene) complexes are generated in the gas phase by laser vaporization and mass selected in a time-of-flight spectrometer. UV laser excitation at either 355 or 266 nm results in dissociative charge transfer (DCT), leading to neutral silver atom and benzene cation products. Kinetic energy release in translationally hot benzene cations is detected using a new instrument designed for photofragment imaging of mass-selected ions. Velocity-map imaging and slice imaging techniques are employed. In addition to the expected translational energy release, DCT of Ag(+)(benzene) produces a distribution of internally hot benzene cations. Compared with experiments at 355 nm, 266 nm excitation produces only slightly higher translational excitation and a much greater fraction of internally hot benzene ions. The maximum kinetic energy release in the photodissociation sets an upper limit on the Ag(+)(benzene) dissociation energy of 32.8 (+1.4/-1.5) kcal/mol.

  18. Methods to control phase inversions and enhance mass transfer in liquid-liquid dispersions

    DOEpatents

    Tsouris, Constantinos; Dong, Junhang

    2002-01-01

    The present invention is directed to the effects of applied electric fields on liquid-liquid dispersions. In general, the present invention is directed to the control of phase inversions in liquid-liquid dispersions. Because of polarization and deformation effects, coalescence of aqueous drops is facilitated by the application of electric fields. As a result, with an increase in the applied voltage, the ambivalence region is narrowed and shifted toward higher volume fractions of the dispersed phase. This permits the invention to be used to ensure that the aqueous phase remains continuous, even at a high volume fraction of the organic phase. Additionally, the volume fraction of the organic phase may be increased without causing phase inversion, and may be used to correct a phase inversion which has already occurred. Finally, the invention may be used to enhance mass transfer rates from one phase to another through the use of phase inversions.

  19. Dispersed bubble reactor for enhanced gas-liquid-solids contact and mass transfer

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Vimalchand, Pannalal; Liu, Guohai; Peng, WanWang

    An apparatus to promote gas-liquid contact and facilitate enhanced mass transfer. The dispersed bubble reactor (DBR) operates in the dispersed bubble flow regime to selectively absorb gas phase constituents into the liquid phase. The dispersion is achieved by shearing the large inlet gas bubbles into fine bubbles with circulating liquid and additional pumped liquid solvent when necessary. The DBR is capable of handling precipitates that may form during absorption or fine catalysts that may be necessary to promote liquid phase reactions. The DBR can be configured with multistage counter current flow sections by inserting concentric cylindrical sections into the risermore » to facilitate annular flow. While the DBR can absorb CO.sub.2 in liquid solvents that may lead to precipitates at high loadings, it is equally capable of handling many different types of chemical processes involving solids (precipitates/catalysts) along with gas and liquid phases.« less

  20. Effects of heat and mass transfer on unsteady boundary layer flow of a chemical reacting Casson fluid

    NASA Astrophysics Data System (ADS)

    Khan, Kashif Ali; Butt, Asma Rashid; Raza, Nauman

    2018-03-01

    In this study, an endeavor is to observe the unsteady two-dimensional boundary layer flow with heat and mass transfer behavior of Casson fluid past a stretching sheet in presence of wall mass transfer by ignoring the effects of viscous dissipation. Chemical reaction of linear order is also invoked here. Similarity transformation have been applied to reduce the governing equations of momentum, energy and mass into non-linear ordinary differential equations; then Homotopy analysis method (HAM) is applied to solve these equations. Numerical work is done carefully with a well-known software MATHEMATICA for the examination of non-dimensional velocity, temperature, and concentration profiles, and then results are presented graphically. The skin friction (viscous drag), local Nusselt number (rate of heat transfer) and Sherwood number (rate of mass transfer) are discussed and presented in tabular form for several factors which are monitoring the flow model.

  1. Improving mass transfer to soften tissues by pulsed electric fields: fundamentals and applications.

    PubMed

    Puértolas, E; Luengo, E; Álvarez, I; Raso, J

    2012-01-01

    The mass transfer phenomenon occurs in many operations of the food industry with the purpose of obtaining a given substance of interest, removing water from foods, or introducing a given substance into the food matrix. Pretreatments that modify the permeability of the cell membranes, such as grinding, heating, or enzymatic treatment, enhance the mass transfer. However, these techniques may require a significant amount of energy and can cause losses of valuable food compounds. Pulsed electric field (PEF) technology is a nonthermal processing method that causes permeabilization of cell membranes using low energy requirements and minimizing quality deterioration of the food compounds. Many practical applications of PEF for enhancing mass transfer in the food industry have been investigated. The purpose of this chapter is to give an overview of the state of the art of application of PEF for improving mass transfer in the food industry.

  2. Multi-Scale Mass Transfer Processes Controlling Natural Attenuation and Engineered Remediation: An IFRC Focused on Hanford’s 300 Area Uranium Plume

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Zachara, John M.; Bjornstad, Bruce N.; Christensen, John N.

    2010-02-01

    The Integrated Field-Scale Subsurface Research Challenge (IFRC) at the Hanford Site 300 Area uranium (U) plume addresses multi-scale mass transfer processes in a complex hydrogeologic setting where groundwater and riverwater interact. A series of forefront science questions on mass transfer are posed for research which relate to the effect of spatial heterogeneities; the importance of scale; coupled interactions between biogeochemical, hydrologic, and mass transfer processes; and measurements and approaches needed to characterize and model a mass-transfer dominated system. The project was initiated in February 2007, with CY 2007 and CY 2008 progress summarized in preceding reports. The site has 35more » instrumented wells, and an extensive monitoring system. It includes a deep borehole for microbiologic and biogeochemical research that sampled the entire thickness of the unconfined 300 A aquifer. Significant, impactful progress has been made in CY 2009 with completion of extensive laboratory measurements on field sediments, field hydrologic and geophysical characterization, four field experiments, and modeling. The laboratory characterization results are being subjected to geostatistical analyses to develop spatial heterogeneity models of U concentration and chemical, physical, and hydrologic properties needed for reactive transport modeling. The field experiments focused on: (1) physical characterization of the groundwater flow field during a period of stable hydrologic conditions in early spring, (2) comprehensive groundwater monitoring during spring to characterize the release of U(VI) from the lower vadose zone to the aquifer during water table rise and fall, (3) dynamic geophysical monitoring of salt-plume migration during summer, and (4) a U reactive tracer experiment (desorption) during the fall. Geophysical characterization of the well field was completed using the down-well Electrical Resistance Tomography (ERT) array, with results subjected to robust, geostatistically constrained inversion analyses. These measurements along with hydrologic characterization have yielded 3D distributions of hydraulic properties that have been incorporated into an updated and increasingly robust hydrologic model. Based on significant findings from the microbiologic characterization of deep borehole sediments in CY 2008, down-hole biogeochemistry studies were initiated where colonization substrates and spatially discrete water and gas samplers were deployed to select wells. The increasingly comprehensive field experimental results, along with the field and laboratory characterization, are leading to a new conceptual model of U(VI) flow and transport in the IFRC footprint and the 300 Area in general, and insights on the microbiological community and associated biogeochemical processes. A significant issue related to vertical flow in the IFRC wells was identified and evaluated during the spring and fall field experimental campaigns. Both upward and downward flows were observed in response to dynamic Columbia River stage. The vertical flows are caused by the interaction of pressure gradients with our heterogeneous hydraulic conductivity field. These impacts are being evaluated with additional modeling and field activities to facilitate interpretation and mitigation. The project moves into CY 2010 with ambitious plans for a drilling additional wells for the IFRC well field, additional experiments, and modeling. This research is part of the ERSP Hanford IFRC at Pacific Northwest National Laboratory.« less

  3. An Adaptable Multiple Power Source for Mass Spectrometry and other Scientific Instruments

    DOE PAGES

    Lin, Tzu-Yung; Anderson, Gordon A.; Norheim, Randolph V.; ...

    2015-09-18

    Power supplies are commonly used in the operation of many types of scientific equipment, including mass spectrometers and ancillary instrumentation. A generic modern mass spectrometer comprises an ionization source, such as electrospray ionization (ESI), ion transfer devices such as ion funnels and multipole ion guides, and ion signal detection apparatus. Very often such platforms include, or are interfaced with ancillary elements in order to manipulate samples before or after ionization. In order to operate such scientific instruments, numerous direct current (DC) channels and radio frequency (RF) signals are required, along with other controls such as temperature regulation. In particular, DCmore » voltages in the range of ±400 V, along with MHz range RF signals with peak-to-peak amplitudes in the hundreds of volts range are commonly used to transfer ionized samples under vacuum. Additionally, an ESI source requires a high voltage (HV) DC source capable of producing several thousand volts and heaters capable of generating temperatures up to 300°C. All of these signals must be properly synchronized and managed in order to carry out ion trapping, accumulation and detection.« less

  4. Beyond the standard two-film theory: Computational fluid dynamics simulations for carbon dioxide capture in a wetted wall column

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Wang, Chao; Xu, Zhijie; Lai, Canhai

    The standard two-film theory (STFT) is a diffusion-based mechanism that can be used to describe gas mass transfer across liquid film. Fundamental assumptions of the STFT impose serious limitations on its ability to predict mass transfer coefficients. To better understand gas absorption across liquid film in practical situations, a multiphase computational fluid dynamics (CFD) model fully equipped with mass transport and chemistry capabilities has been developed for solvent-based carbon dioxide (CO2) capture to predict the CO2 mass transfer coefficient in a wetted wall column. The hydrodynamics is modeled using a volume of fluid method, and the diffusive and reactive massmore » transfer between the two phases is modeled by adopting a one-fluid formulation. We demonstrate that the proposed CFD model can naturally account for the influence of many important factors on the overall mass transfer that cannot be quantitatively explained by the STFT, such as the local variation in fluid velocities and properties, flow instabilities, and complex geometries. The CFD model also can predict the local mass transfer coefficient variation along the column height, which the STFT typically does not consider.« less

  5. Effect of Schmidt number on mass transfer across a sheared gas-liquid interface in a wind-driven turbulence.

    PubMed

    Takagaki, Naohisa; Kurose, Ryoichi; Kimura, Atsushi; Komori, Satoru

    2016-11-14

    The mass transfer across a sheared gas-liquid interface strongly depends on the Schmidt number. Here we investigate the relationship between mass transfer coefficient on the liquid side, k L , and Schmidt number, Sc, in the wide range of 0.7 ≤ Sc ≤ 1000. We apply a three-dimensional semi direct numerical simulation (SEMI-DNS), in which the mass transfer is solved based on an approximated deconvolution model (ADM) scheme, to wind-driven turbulence with mass transfer across a sheared wind-driven wavy gas-liquid interface. In order to capture the deforming gas-liquid interface, an arbitrary Lagrangian-Eulerian (ALE) method is employed. Our results show that similar to the case for flat gas-liquid interfaces, k L for the wind-driven wavy gas-liquid interface is generally proportional to Sc -0.5 , and can be roughly estimated by the surface divergence model. This trend is endorsed by the fact that the mass transfer across the gas-liquid interface is controlled mainly by streamwise vortices on the liquid side even for the wind-driven turbulence under the conditions of low wind velocities without wave breaking.

  6. Effect of Schmidt number on mass transfer across a sheared gas-liquid interface in a wind-driven turbulence

    PubMed Central

    Takagaki, Naohisa; Kurose, Ryoichi; Kimura, Atsushi; Komori, Satoru

    2016-01-01

    The mass transfer across a sheared gas-liquid interface strongly depends on the Schmidt number. Here we investigate the relationship between mass transfer coefficient on the liquid side, kL, and Schmidt number, Sc, in the wide range of 0.7 ≤ Sc ≤ 1000. We apply a three-dimensional semi direct numerical simulation (SEMI-DNS), in which the mass transfer is solved based on an approximated deconvolution model (ADM) scheme, to wind-driven turbulence with mass transfer across a sheared wind-driven wavy gas-liquid interface. In order to capture the deforming gas-liquid interface, an arbitrary Lagrangian-Eulerian (ALE) method is employed. Our results show that similar to the case for flat gas-liquid interfaces, kL for the wind-driven wavy gas-liquid interface is generally proportional to Sc−0.5, and can be roughly estimated by the surface divergence model. This trend is endorsed by the fact that the mass transfer across the gas-liquid interface is controlled mainly by streamwise vortices on the liquid side even for the wind-driven turbulence under the conditions of low wind velocities without wave breaking. PMID:27841325

  7. Mass transfer study on the electrochemical removal of copper ions from synthetic effluents using reticulated vitreous carbon.

    PubMed

    Britto-Costa, Pedro H; Ruotolo, Luís Augusto M

    2013-01-01

    Porous electrodes have been successfully used for metal electrodeposition from diluted aqueous solution due to their high porosity and specific surface area, which lead to high mass transfer rates. This work studies the mass transfer of copper electrodeposition on reticulated vitreous carbon in a flow reactor without membrane. The flow configuration, otherwise the filter-press electrochemical reactors, was designed in order to minimize the pressure drop. The mass transfer coefficient was determined by voltammetric and galvanostatic electrodeposition. In the voltammetric experiments a Luggin capillary was used to measure the current-potential curves and to determine the limiting current (and, consequently, the mass transfer coefficient). In the galvanostatic experiments the concentration-time curves were obtained and considering a limiting current kinetics model, the mass transfer coefficient (k(m)) was determined for different flow velocities. The results showed that both methods give similar values of k(m), thus the voltammetric method can be recommended because it is faster and simpler. Finally, the reactor performance was compared with others from literature, and it was observed that the proposed reactor design has high Sherwood numbers similar to other reactor configurations using membranes and reticulated vitreous carbon electrodes.

  8. Convection Heat and Mass Transfer in a Power Law Fluid with Non Constant Relaxation Time Past a Vertical Porous Plate in the Presence of Thermo and Thermal Diffusion

    NASA Astrophysics Data System (ADS)

    Olajuwon, B. I.; Oyelakin, I. S.

    2012-12-01

    The paper investigates convection heat and mass transfer in power law fluid flow with non relaxation time past a vertical porous plate in presence of a chemical reaction, heat generation, thermo diffu- sion and thermal diffusion. The non - linear partial differential equations governing the flow are transformed into ordinary differential equations using the usual similarity method. The resulting similarity equations are solved numerically using Runge-Kutta shooting method. The results are presented as velocity, temperature and concentration profiles for pseudo plastic fluids and for different values of parameters governing the prob- lem. The skin friction, heat transfer and mass transfer rates are presented numerically in tabular form. The results show that these parameters have significant effects on the flow, heat transfer and mass transfer.

  9. Mathematical model and calculation of water-cooling efficiency in a film-filled cooling tower

    NASA Astrophysics Data System (ADS)

    Laptev, A. G.; Lapteva, E. A.

    2016-10-01

    Different approaches to simulation of momentum, mass, and energy transfer in packed beds are considered. The mathematical model of heat and mass transfer in a wetted packed bed for turbulent gas flow and laminar wave counter flow of the fluid film in sprinkler units of a water-cooling tower is presented. The packed bed is represented as the set of equivalent channels with correction to twisting. The idea put forward by P. Kapitsa on representation of waves on the interphase film surface as elements of the surface roughness in interaction with the gas flow is used. The temperature and moisture content profiles are found from the solution of differential equations of heat and mass transfer written for the equivalent channel with the volume heat and mass source. The equations for calculation of the average coefficients of heat emission and mass exchange in regular and irregular beds with different contact elements, as well as the expression for calculation of the average turbulent exchange coefficient are presented. The given formulas determine these coefficients for the known hydraulic resistance of the packed bed element. The results of solution of the system of equations are presented, and the water temperature profiles are shown for different sprinkler units in industrial water-cooling towers. The comparison with experimental data on thermal efficiency of the cooling tower is made; this allows one to determine the temperature of the cooled water at the output. The technical solutions on increasing the cooling tower performance by equalization of the air velocity profile at the input and creation of an additional phase contact region using irregular elements "Inzhekhim" are considered.

  10. Heat and Mass Transfer Processes in Scrubber of Flue Gas Heat Recovery Device

    NASA Astrophysics Data System (ADS)

    Veidenbergs, Ivars; Blumberga, Dagnija; Vigants, Edgars; Kozuhars, Grigorijs

    2010-01-01

    The paper deals with the heat and mass transfer process research in a flue gas heat recovery device, where complicated cooling, evaporation and condensation processes are taking place simultaneously. The analogy between heat and mass transfer is used during the process of analysis. In order to prepare a detailed process analysis based on heat and mass process descriptive equations, as well as the correlation for wet gas parameter calculation, software in the Microsoft Office Excel environment is being developed.

  11. Post-staining electroblotting for efficient and reliable peptide blotting.

    PubMed

    Lee, Der-Yen; Chang, Geen-Dong

    2015-01-01

    Post-staining electroblotting has been previously described to transfer Coomassie blue-stained proteins from polyacrylamide gel onto polyvinylidene difluoride (PVDF) membranes. Actually, stained peptides can also be efficiently and reliably transferred. Because of selective staining procedures for peptides and increased retention of stained peptides on the membrane, even peptides with molecular masses less than 2 kDa such as bacitracin and granuliberin R are transferred with satisfactory results. For comparison, post-staining electroblotting is about 16-fold more sensitive than the conventional electroblotting for visualization of insulin on the membrane. Therefore, the peptide blots become practicable and more accessible to further applications, e.g., blot overlay detection or immunoblotting analysis. In addition, the efficiency of peptide transfer is favorable for N-terminal sequence analysis. With this method, peptide blotting can be normalized for further analysis such as blot overlay assay, immunoblotting, and N-terminal sequencing for identification of peptide in crude or partially purified samples.

  12. Mass transfer resistance in ASFF reactors for waste water treatment.

    PubMed

    Ettouney, H M; Al-Haddad, A A; Abu-Irhayem, T M

    1996-01-01

    Analysis of mass transfer resistances was performed for an aerated submerged fixed-film reactor (ASFF) for the treatment of waste water containing a mixture of sucrose and ammonia. Both external and internal mass transfer resistances were considered in the analysis, and characterized as a function of feed flow-rate and concentration. Results show that, over a certain operating regime, external mass transfer resistance in the system was greater for sucrose removal than ammonia. This is because the reaction rates for carbon removal were much larger than those of nitrogen. As a result, existence of any form of mass transfer resistance caused by inadequate mixing or diffusion limitations, strongly affects the overall removal rates of carbon more than nitrogen. Effects of the internal måss transfer resistance were virtually non-existent for ammonia removal. This behaviour was found over two orders of magnitude range for the effective diffusivity for ammonia, and one order of magnitude for the film specific surface area. However, over the same parameters' range, it is found that sucrose removal was strongly affected upon lowering its effective diffusivity and increasing the film specific surface area.

  13. Migration of antioxidants from polylactic acid films, a parameter estimation approach: Part I - A model including convective mass transfer coefficient.

    PubMed

    Samsudin, Hayati; Auras, Rafael; Burgess, Gary; Dolan, Kirk; Soto-Valdez, Herlinda

    2018-03-01

    A two-step solution based on the boundary conditions of Crank's equations for mass transfer in a film was developed. Three driving factors, the diffusion (D), partition (K p,f ) and convective mass transfer coefficients (h), govern the sorption and/or desorption kinetics of migrants from polymer films. These three parameters were simultaneously estimated. They provide in-depth insight into the physics of a migration process. The first step was used to find the combination of D, K p,f and h that minimized the sums of squared errors (SSE) between the predicted and actual results. In step 2, an ordinary least square (OLS) estimation was performed by using the proposed analytical solution containing D, K p,f and h. Three selected migration studies of PLA/antioxidant-based films were used to demonstrate the use of this two-step solution. Additional parameter estimation approaches such as sequential and bootstrap were also performed to acquire a better knowledge about the kinetics of migration. The proposed model successfully provided the initial guesses for D, K p,f and h. The h value was determined without performing a specific experiment for it. By determining h together with D, under or overestimation issues pertaining to a migration process can be avoided since these two parameters are correlated. Copyright © 2017 Elsevier Ltd. All rights reserved.

  14. Of Magic Carpets, Rolling Snowballs, and Sleeping Dragons: an Energetics-based Classification for Hillslope/channel Interactions

    NASA Astrophysics Data System (ADS)

    Grant, G.; Cashman, K.; O'Connor, J.

    2007-12-01

    Interactions between hillslopes and channels can include a diverse range of geophysical processes, including debris flows, landslides, water floods, and volcanic flows. Each has its own characteristic time-energy trajectory. In some cases the energy of an event increases as it propagates through a landscape, primarily through the addition of mass and momentum; examples of these"rolling snowball" include the initiation and runout phases of volcanic lahars, avalanches, and debris flows. In other cases, loss of both mass and momentum from a moving body or fluid causes the energy of an event to dissipate with distance, similar to the unwinding of a rug; examples of these "magic carpets" include the depositional phases of lahars, pyroclastic flows, lava flows, and debris flows. Both snowballs and carpets leave distinctive imprints or tracks on the landscape that reflect the resultant mass flux from hill slope to channel. The efficiency of this mass transfer depends on the width and slope of the receiving channel and the rheological properties of the transported material. At one extreme, the channel easily accommodates mass flux from the slope, sometimes accompanied by fractionation into constituent phases. At the other extreme, mass from the hill slope can inundate and block the channel; these "sleeping dragons" modulate subsequent mass transfer down channel by changing the channel profile and bed properties. They also have the potential to "wake up" suddenly as mass failure and/or outbreak floods. Hazard prediction requires that the time-energy trajectory of each type of event be assessed; here we suggest some first order controls.

  15. Characterization of the organic matter in submicron urban aerosols using a Thermo-Desorption Proton-Transfer-Reaction Time-of-Flight Mass Spectrometer (TD-PTR-TOF-MS)

    NASA Astrophysics Data System (ADS)

    Salvador, Christian Mark; Ho, T.-T.; Chou, Charles C.-K.; Chen, M.-J.; Huang, W.-R.; Huang, S.-H.

    2016-09-01

    Organic matter is the most complicated and unresolved major component of atmospheric aerosol particles. Its sources and global budget are still highly uncertain and thereby necessitate further research efforts with state-of-the-art instrument. This study employed a Thermo-Desorption Proton-Transfer-Reaction Time-of-Flight Mass Spectrometer (TD-PTR-TOF-MS) for characterization of ambient organic aerosols. First, five authentic standard substances, which include phthalic acid, levoglucosan, arabitol, cis-pinonic acid and glutaric acid, were utilized to examine the response of the instrument. The results demonstrated the linearity of the TD-PTR-TOF-MS signals against a range of mass loading of specific species on filters. However, it was found that significant fragmentation happened to those challenging compounds, although the proton-transfer-reaction (PTR) was recognized as a soft ionization technique. Consequently, quantitative characterization of aerosols with the TD-PTR-TOF-MS depended on the availability of the fragmentation pattern in mass spectra and the recovery rate with the quantification ion peak(s). The instrument was further deployed to analyze a subset of submicron aerosol samples collected at the TARO (Taipei Aerosol and Radiation Observatory) in Taipei, Taiwan during August 2013. The results were compared with the measurements from a conventional DRI thermo-optical carbon analyzer. The inter-comparison indicated that the TD-PTR-TOF-MS underestimated the mass of total organic matter (TOM) in aerosol samples by 27%. The underestimation was most likely due to the thermo-decomposition during desorption processes and fragmentation in PTR drift tube, where undetectable fragments were formed. Besides, condensation loss of low vapor pressure species in the transfer components was also responsible for the underestimation to a certain degree. Nevertheless, it was showed that the sum of the mass concentrations of the major detected ion peaks correlated strongly with the TOM determined by DRI analyzer (R2 = 0.8578), suggesting that the TD-PTR-TOF-MS measurements explained more than 85% of the variance in the time series of TOM. In addition to identification by comparing with the fragmentation pattern obtained from the mass spectra of the authentic substances, most of the major ions were attributed to protonated or acylium ions of specific parent compounds. Amongst the quantified species with full calibration with authentic standard, phthalic acid was found accounting for 7.0% of the mass loading of TOM. In addition, a high-end estimation of 9.4% was suggested for the mass contribution from glutaric acid, which was made by assuming that the ion with m/z of 73.027 was totally produced from fragmentation of glutaric acid as characterization of authentic standard despite of the formation of protonated methyl-glyoxal ion. Moreover, a substantial contribution from ions corresponding to protonated acetic acid and acetone was measured, which could be produced from fragmentation of larger oxygenated molecules. The TD-PTR-TOF-MS measurements suggested that low molecular weight carboxylic acid (LMWCA), products of photochemical oxidation of gaseous hydrocarbons and fatty acids, constituted a major fraction of secondary organic aerosols in Taipei, Taiwan, a typical subtropical urban area.

  16. Modelling mass transfer during venting/soil vapour extraction: Non-aqueous phase liquid/gas mass transfer coefficient estimation

    NASA Astrophysics Data System (ADS)

    Esrael, D.; Kacem, M.; Benadda, B.

    2017-07-01

    We investigate how the simulation of the venting/soil vapour extraction (SVE) process is affected by the mass transfer coefficient, using a model comprising five partial differential equations describing gas flow and mass conservation of phases and including an expression accounting for soil saturation conditions. In doing so, we test five previously reported quations for estimating the non-aqueous phase liquid (NAPL)/gas initial mass transfer coefficient and evaluate an expression that uses a reference NAPL saturation. Four venting/SVE experiments utilizing a sand column are performed with dry and non-saturated sand at low and high flow rates, and the obtained experimental results are subsequently simulated, revealing that hydrodynamic dispersion cannot be neglected in the estimation of the mass transfer coefficient, particularly in the case of low velocities. Among the tested models, only the analytical solution of a convection-dispersion equation and the equation proposed herein are suitable for correctly modelling the experimental results, with the developed model representing the best choice for correctly simulating the experimental results and the tailing part of the extracted gas concentration curve.

  17. Analysis of transition-metal acetylacetonate complexes by matrix-assisted laser desorption/ionization time-of-flight mass spectrometry.

    PubMed

    Wyatt, Mark F; Havard, Stephen; Stein, Bridget K; Brenton, A Gareth

    2008-01-01

    Transition-metal acetylacetonate complexes of the form Metal(acac)(2), where Metal = Fe(II), Co(II), Ni(II), Cu(II), and Zn(II), and Metal(acac)(3), where Metal = V(III), Cr(III), Mn(III), Fe(III), and Co(III), were investigated by matrix-assisted laser desorption/ionization time-of-flight mass spectrometry (MALDI-TOFMS). The data was acquired using the aprotic, electron transfer matrix, 2-[(2E)-3-(4-tert-butylphenyl)-2-methylprop-2-enylidene]malononitrile (DCTB), and the observation of positive radical ions is shown clearly to depend on the metal element and the oxidation state it occupies. The ionization energy of DCTB was calculated to be 8.08 eV by density functional theory methods, which is notably lower than the experimental value, but within the range of other computational values. This value is very close to those of the analytes, so the existing electron transfer mechanism which is based on the ionization energies of the matrix and analyte, cannot be used predictively. Similarly, the data neither proves nor disproves the validity of the existing electron transfer ionization mechanism, with respect to metal coordination complexes without strong chromophores. In this case, periodic trends may be more useful in explaining the observed species and the prediction of species from sets of similar complexes. The addition of a sodium salt benefits the MALDI-TOFMS characterization of certain compounds studied, but the benefit of the addition of ammonium or silver salts is negligible.

  18. Disentangling oil weathering using GC x GC. 2. Mass transfer calculations.

    PubMed

    Arey, J Samuel; Nelson, Robert K; Plata, Desiree L; Reddy, Christopher M

    2007-08-15

    Hydrocarbon mass transfers to the atmosphere and water column drive the early weathering of oil spills and also control the chemical exposures of many coastal wildlife species. However, in the field, mass transfer rates of individual hydrocarbons to air and water are often uncertain. In the Part 1 companion to this paper, we used comprehensive two-dimensional gas chromatography (GC x GC) to identify distinct signatures of evaporation and dissolution encoded in the compositional evolution of weathered oils. In Part 2, we further investigate patterns of mass removal in GC x GC chromatograms using a mass transfer model. The model was tailored to conditions at a contaminated beach on Buzzards Bay, MA, after the 2003 Bouchard 120 oil spill. The model was applied to all resolved hydrocarbon compounds in the C11-C24 boiling range, based on their GC x GC-estimated vapor pressures and aqueous solubilities. With no fitted parameters, the model successfully predicted GC x GC chromatogram patterns of mass removal associated with evaporation, water-washing, and diffusion-limited transport. This enabled a critical field evaluation of the mass transfer model and also allowed mass apportionment estimates of hundreds of individual hydrocarbon compounds to air and water. Ultimately, this method should improve assessments of wildlife exposures to oil spill hydrocarbons.

  19. Thermal Enhancement of Silicon Carbide (SiC) Power Electronics and Laser Bars: Statistical Design Optimization of a Liquid-Cooled Power Electronic Heat Sink

    DTIC Science & Technology

    2015-08-01

    Forced Convective Heat Transfer Across a Pin Fin Micro Heat Sink”, International Journal of Heat and Mass Transfer 48 (2005) 3615-3627. 3. Cao...from Pin Fins Situated in an Oncoming Longitudinal Flow Which Turns to Crossflow”, International Journal of Heat and Mass Transfer, Vol. 25 No. 5...Flow Forced Convection”, International Journal of Heat and Mass Transfer, Vol. 39, No. 2, pp. 311-317, 1996. 11. Khan, W., Culham, J., and Yovanovich

  20. Smooth information flow in temperature climate network reflects mass transport

    NASA Astrophysics Data System (ADS)

    Hlinka, Jaroslav; Jajcay, Nikola; Hartman, David; Paluš, Milan

    2017-03-01

    A directed climate network is constructed by Granger causality analysis of air temperature time series from a regular grid covering the whole Earth. Using winner-takes-all network thresholding approach, a structure of a smooth information flow is revealed, hidden to previous studies. The relevance of this observation is confirmed by comparison with the air mass transfer defined by the wind field. Their close relation illustrates that although the information transferred due to the causal influence is not a physical quantity, the information transfer is tied to the transfer of mass and energy.

  1. An Assessment of the General Applicability of the Relationship Between Nucleation of CO Bubbles and Mass Transfer of Phosphorus in Liquid Iron Alloys

    NASA Astrophysics Data System (ADS)

    Gu, Kezhuan; Dogan, Neslihan; Coley, Kenneth S.

    2018-06-01

    The current paper seeks to demonstrate the general applicability of the authors' recently developed treatment of surface renewal during decarburization of Fe-C-S alloys and its effect on the mass transport of phosphorus in the metal phase. The proposed model employs a quantitative model of CO bubble nucleation in the metal to predict the rate of surface renewal, which can then in turn be used to predict the mass-transfer coefficient for phosphorus. A model of mixed transport control in the slag and metal phases was employed to investigate the dephosphorization kinetics between a liquid iron alloy and oxidizing slag. Based on previous studies of the mass-transfer coefficient of FeO in the slag, it was possible to separate the mass transfer coefficient of phosphorus in metal phase, km , from the overall mass-transfer coefficient k_{{o}} . Using this approach, km was investigated under a wide range of conditions and shown to be represented reasonably by the mechanism proposed. The mass-transfer model was tested against results from the literature over a wide range of conditions. The analysis showed that the FeO content in the slag, silicon in the metal and the experimental temperature have strong impact on, km , almost entirely because of their effect on decarburization behavior.

  2. An Assessment of the General Applicability of the Relationship Between Nucleation of CO Bubbles and Mass Transfer of Phosphorus in Liquid Iron Alloys

    NASA Astrophysics Data System (ADS)

    Gu, Kezhuan; Dogan, Neslihan; Coley, Kenneth S.

    2018-02-01

    The current paper seeks to demonstrate the general applicability of the authors' recently developed treatment of surface renewal during decarburization of Fe-C-S alloys and its effect on the mass transport of phosphorus in the metal phase. The proposed model employs a quantitative model of CO bubble nucleation in the metal to predict the rate of surface renewal, which can then in turn be used to predict the mass-transfer coefficient for phosphorus. A model of mixed transport control in the slag and metal phases was employed to investigate the dephosphorization kinetics between a liquid iron alloy and oxidizing slag. Based on previous studies of the mass-transfer coefficient of FeO in the slag, it was possible to separate the mass transfer coefficient of phosphorus in metal phase, km , from the overall mass-transfer coefficient k_{{o}} . Using this approach, km was investigated under a wide range of conditions and shown to be represented reasonably by the mechanism proposed. The mass-transfer model was tested against results from the literature over a wide range of conditions. The analysis showed that the FeO content in the slag, silicon in the metal and the experimental temperature have strong impact on, km , almost entirely because of their effect on decarburization behavior.

  3. Magnetically Suspended Linear Pulse Motor for Semiconductor Wafer Transfer in Vacuum Chamber

    NASA Technical Reports Server (NTRS)

    Moriyama, Shin-Ichi; Hiraki, Naoji; Watanabe, Katsuhide; Kanemitsu, Yoichi

    1996-01-01

    This paper describes a magnetically suspended linear pulse motor for a semiconductor wafer transfer robot in a vacuum chamber. The motor can drive a wafer transfer arm horizontally without mechanical contact. In the construction of the magnetic suspension system, four pairs of linear magnetic bearings for the lift control are used for the guidance control as well. This approach allows us to make the whole motor compact in size and light in weight. The tested motor consists of a double-sided stator and a transfer arm with a width of 50 mm and a total length of 700 mm. The arm, like a ladder in shape, is designed as the floating element with a tooth width of 4 mm (a tooth pitch of 8 mm). The mover mass is limited to about 1.6 kg by adopting such an arm structure, and the ratio of thrust to mover mass reaches to 3.2 N/kg under a broad air gap (1 mm) between the stator teeth and the mover teeth. The performance testing was carried out with a transfer distance less than 450 mm and a transfer speed less than 560 mm/s. The attitude of the arm was well controlled by the linear magnetic bearings with a combined use, and consequently the repeatability on the positioning of the arm reached to about 2 micron. In addition, the positioning accuracy was improved up to about 30 micron through a compensation of the 128-step wave current which was used for the micro-step drive with a step increment of 62.5 micron.

  4. CFD Application to Flow-Accelerated Corrosion in Feeder Bends

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Pietralik, John M.; Smith, Bruce A.W.

    2006-07-01

    Feeder piping in CANDU{sup R} plants experiences a thinning degradation mechanism called Flow-Accelerated Corrosion (FAC). The piping is made of carbon steel and has high water flow speeds. Although the water chemistry is highly alkaline with room-temperature pH in a range of 10.0-10.5, the piping has FAC rates exceeding 0.1 mm/year in some locations, e.g., in bends. One of the most important parameters affecting the FAC rate is the mass transfer coefficient for convective mass transport of ferrous ions. The ions are created at the pipe wall as a result of corrosion, diffuse through the oxide layer, and are transportedmore » from the oxide-layer/water interface to the bulk water by mass transport. Consequently, the local flow characteristics contribute to the highly turbulent convective mass transfer. Plant data and laboratory experiments indicate that the mass transfer step dominates FAC under feeder conditions. In this study, the flow and mass transfer in a feeder bend under operating conditions were simulated using the Fluent{sup TM} computer code. Because the flow speed is very high, with the Reynolds numbers in a range of several millions, and because the geometry is complex, experiments in a 1:1 scale were conducted with the main objective to validate flow simulations. The experiments measured pressure at several key locations and visualized the flow. The flow and mass transfer models were validated using available friction-factor and mass transfer correlations and literature experiments on mass transfer in a bend. The validation showed that the turbulence model that best predicts the experiments is the realizable k-{epsilon} model. Other two-equation turbulence models, as well as one-equation models and Reynolds stress models were tried. The near-wall treatment used the non-equilibrium wall functions. The wall functions were modified for surface roughness when necessary. A comparison of the local mass transfer coefficient with measured FAC rate in plant specimens shows very good agreement. Visualization experiments indicate secondary flows in the bends. No boundary layer separation was observed in experiments or in simulations. (authors)« less

  5. The 300 Area Integrated Field Research Challenge Quality Assurance Project Plan

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Fix, N. J.

    Pacific Northwest National Laboratory and a group of expert collaborators are using the U.S. Department of Energy Hanford Site 300 Area uranium plume within the footprint of the 300-FF-5 groundwater operable unit as a site for an Integrated Field-Scale Subsurface Research Challenge (IFRC). The IFRC is entitled Multi-Scale Mass Transfer Processes Controlling Natural Attenuation and Engineered Remediation: An IFRC Focused on the Hanford Site 300 Area Uranium Plume Project. The theme is investigation of multi-scale mass transfer processes. A series of forefront science questions on mass transfer are posed for research that relate to the effect of spatial heterogeneities; themore » importance of scale; coupled interactions between biogeochemical, hydrologic, and mass transfer processes; and measurements/approaches needed to characterize and model a mass transfer-dominated system. This Quality Assurance Project Plan provides the quality assurance requirements and processes that will be followed by the 300 Area IFRC Project. This plan is designed to be used exclusively by project staff.« less

  6. Identifying and overcoming the effect of mass transfer limitation on decreased yield in enzymatic hydrolysis of lignocellulose at high solid concentrations.

    PubMed

    Du, Jian; Cao, Yuan; Liu, Guodong; Zhao, Jian; Li, Xuezhi; Qu, Yinbo

    2017-04-01

    Cellulose conversion decreases significantly with increasing solid concentrations during enzymatic hydrolysis of insoluble lignocellulosic materials. Here, mass transfer limitation was identified as a significant determining factor of this decrease by studying the hydrolysis of delignified corncob residue in shake flask, the most used reaction vessel in bench scale. Two mass transfer efficiency-related factors, mixing speed and flask filling, were shown to correlate closely with cellulose conversion at solid loadings higher than 15% DM. The role of substrate characteristics in mass transfer performance was also significant, which was revealed by the saccharification of two corn stover substrates with different pretreatment methods at the same solid loading. Several approaches including premix, fed-batch operation, and particularly the use of horizontal rotating reactor were shown to be valid in facilitating cellulose conversion via improving mass transfer efficiency at solid concentrations higher than 15% DM. Copyright © 2017 Elsevier Ltd. All rights reserved.

  7. Accreting Black Hole Binaries in Globular Clusters

    NASA Astrophysics Data System (ADS)

    Kremer, Kyle; Chatterjee, Sourav; Rodriguez, Carl L.; Rasio, Frederic A.

    2018-01-01

    We explore the formation of mass-transferring binary systems containing black holes (BHs) within globular clusters (GC). We show that it is possible to form mass-transferring BH binaries with main sequence, giant, and white dwarf companions with a variety of orbital parameters in GCs spanning a large range in present-day properties. All mass-transferring BH binaries found in our models at late times are dynamically created. The BHs in these systems experienced a median of ∼30 dynamical encounters within the cluster before and after acquiring the donor. Furthermore, we show that the presence of mass-transferring BH systems has little correlation with the total number of BHs within the cluster at any time. This is because the net rate of formation of BH–non-BH binaries in a cluster is largely independent of the total number of retained BHs. Our results suggest that the detection of a mass-transferring BH binary in a GC does not necessarily indicate that the host cluster contains a large BH population.

  8. Saponification reaction system: a detailed mass transfer coefficient determination.

    PubMed

    Pečar, Darja; Goršek, Andreja

    2015-01-01

    The saponification of an aromatic ester with an aqueous sodium hydroxide was studied within a heterogeneous reaction medium in order to determine the overall kinetics of the selected system. The extended thermo-kinetic model was developed compared to the previously used simple one. The reaction rate within a heterogeneous liquid-liquid system incorporates a chemical kinetics term as well as mass transfer between both phases. Chemical rate constant was obtained from experiments within a homogeneous medium, whilst the mass-transfer coefficient was determined separately. The measured thermal profiles were then the bases for determining the overall reaction-rate. This study presents the development of an extended kinetic model for considering mass transfer regarding the saponification of ethyl benzoate with sodium hydroxide within a heterogeneous reaction medium. The time-dependences are presented for the mass transfer coefficient and the interfacial areas at different heterogeneous stages and temperatures. The results indicated an important role of reliable kinetic model, as significant difference in k(L)a product was obtained with extended and simple approach.

  9. Direct Numerical Simulation of Fluid Flow and Mass Transfer in Particle Clusters

    PubMed Central

    2018-01-01

    In this paper, an efficient ghost-cell based immersed boundary method is applied to perform direct numerical simulation (DNS) of mass transfer problems in particle clusters. To be specific, a nine-sphere cuboid cluster and a random-generated spherical cluster consisting of 100 spheres are studied. In both cases, the cluster is composed of active catalysts and inert particles, and the mutual influence of particles on their mass transfer performance is studied. To simulate active catalysts the Dirichlet boundary condition is imposed at the external surface of spheres, while the zero-flux Neumann boundary condition is applied for inert particles. Through our studies, clustering is found to have negative influence on the mass transfer performance, which can be then improved by dilution with inert particles and higher Reynolds numbers. The distribution of active/inert particles may lead to large variations of the cluster mass transfer performance, and individual particle deep inside the cluster may possess a high Sherwood number. PMID:29657359

  10. Heat and mass transfer in wooden dowels during a simulated fire: an experimental and analytical study

    Treesearch

    J. A. Mardini; A. S. Lavine; V. K. Dhir

    1996-01-01

    Abstract--An experimental and analytical study of heat and mass transfer in wooden dowels during a simulated fire is presented in this paper. The goal of this study is to understand the processes of heat and mass transfer in wood during wildland fires. A mathematical model is developed to describe the processes of heating, drying and pyrolysis of wood until ignition...

  11. Influence of relative air/water flow velocity on oxygen mass transfer in gravity sewers.

    PubMed

    Carrera, Lucie; Springer, Fanny; Lipeme-Kouyi, Gislain; Buffiere, Pierre

    2017-04-01

    Problems related to hydrogen sulfide may be serious for both network stakeholders and the public in terms of health, sustainability of the sewer structure and urban comfort. H 2 S emission models are generally theoretical and simplified in terms of environmental conditions. Although air transport characteristics in sewers must play a role in the fate of hydrogen sulfide, only a limited number of studies have investigated this issue. The aim of this study was to better understand H 2 S liquid to gas transfer by highlighting the link between the mass transfer coefficient and the turbulence in the air flow and the water flow. For experimental safety reasons, O 2 was taken as a model compound. The oxygen mass transfer coefficients were obtained using a mass balance in plug flow. The mass transfer coefficient was not impacted by the range of the interface air-flow velocity values tested (0.55-2.28 m·s -1 ) or the water velocity values (0.06-0.55 m·s -1 ). Using the ratio between k L,O 2 to k L,H 2 S , the H 2 S mass transfer behavior in a gravity pipe in the same hydraulic conditions can be predicted.

  12. Technical characterization of dialysis fluid flow and mass transfer rate in dialyzers with various filtration coefficients using dimensionless correlation equation.

    PubMed

    Fukuda, Makoto; Yoshimura, Kengo; Namekawa, Koki; Sakai, Kiyotaka

    2017-06-01

    The objective of the present study is to evaluate the effect of filtration coefficient and internal filtration on dialysis fluid flow and mass transfer coefficient in dialyzers using dimensionless mass transfer correlation equations. Aqueous solution of vitamin B 12 clearances were obtained for REXEED-15L as a low flux dialyzer, and APS-15EA and APS-15UA as high flux dialyzers. All the other design specifications were identical for these dialyzers except for filtration coefficient. The overall mass transfer coefficient was calculated, moreover, the exponents of Reynolds number (Re) and film mass transfer coefficient of the dialysis-side fluid (k D ) for each flow rate were derived from the Wilson plot and dimensionless correlation equation. The exponents of Re were 0.4 for the low flux dialyzer whereas 0.5 for the high flux dialyzers. Dialysis fluid of the low flux dialyzer was close to laminar flow because of its low filtration coefficient. On the other hand, dialysis fluid of the high flux dialyzers was assumed to be orthogonal flow. Higher filtration coefficient was associated with higher k D influenced by mass transfer rate through diffusion and internal filtration. Higher filtration coefficient of dialyzers and internal filtration affect orthogonal flow of dialysis fluid.

  13. Numerical Investigation for Strengthening Heat Transfer Mechanism of the Tube-Row Heat Exchanger in a Compact Thermoelectric Generator

    NASA Astrophysics Data System (ADS)

    Zhang, Zheng; Chen, Zijian; Liu, Hongwu; Yue, Hao; Chen, Dongbo; Qin, Delei

    2018-04-01

    According to the basic principle of heat transfer enhancement, a 1-kW compact thermoelectric generator (TEG) is proposed that is suitable for use at high temperatures and high flow speeds. The associated heat exchanger has a tube-row structure with a guide-plate to control the thermal current. The heat exchanger has a volume of 7 L, and the TEG has a mass of 8 kg (excluding the thermoelectric modules (TEMs)). In this paper, the heat transfer process of the tube-row exchanger is modeled and analyzed numerically; and the influences of its structure on the heat transfer and temperature status of the TEMs are investigated. The results show that use of the thin - wall pipes and increase of surface roughness inside the pipes are effective ways to improve the heat transfer efficiency, obtain the rated surface temperature, and make the TEG compact and lightweight. Furthermore, under the same conditions, the calculated results are compared with the data of a fin heat exchanger. The comparison results show that the volume and mass of the tube-row heat exchanger are 19% and 33% lower than those of the fin type unit, and that the pressure drop is reduced by 16%. In addition, the average temperature in the tube-row heat exchanger is increased by 15°C and the average temperature difference is increased by 19°C; the tube-row TEG has a more compact volume and better temperature characteristics.

  14. Numerical Investigation for Strengthening Heat Transfer Mechanism of the Tube-Row Heat Exchanger in a Compact Thermoelectric Generator

    NASA Astrophysics Data System (ADS)

    Zhang, Zheng; Chen, Zijian; Liu, Hongwu; Yue, Hao; Chen, Dongbo; Qin, Delei

    2018-06-01

    According to the basic principle of heat transfer enhancement, a 1-kW compact thermoelectric generator (TEG) is proposed that is suitable for use at high temperatures and high flow speeds. The associated heat exchanger has a tube-row structure with a guide-plate to control the thermal current. The heat exchanger has a volume of 7 L, and the TEG has a mass of 8 kg (excluding the thermoelectric modules (TEMs)). In this paper, the heat transfer process of the tube-row exchanger is modeled and analyzed numerically; and the influences of its structure on the heat transfer and temperature status of the TEMs are investigated. The results show that use of the thin - wall pipes and increase of surface roughness inside the pipes are effective ways to improve the heat transfer efficiency, obtain the rated surface temperature, and make the TEG compact and lightweight. Furthermore, under the same conditions, the calculated results are compared with the data of a fin heat exchanger. The comparison results show that the volume and mass of the tube-row heat exchanger are 19% and 33% lower than those of the fin type unit, and that the pressure drop is reduced by 16%. In addition, the average temperature in the tube-row heat exchanger is increased by 15°C and the average temperature difference is increased by 19°C; the tube-row TEG has a more compact volume and better temperature characteristics.

  15. Heat and mass transfer correlations for liquid droplet of a pure fuel in combustion

    NASA Astrophysics Data System (ADS)

    Dgheim, J.; Chesneau, X.; Pietri, L.; Zeghmati, B.

    The authors report a numerical analysis of heat and mass transfers, which govern the combustion of a fuel droplet assimilated to a sphere. The results are presented in the form of temperature, mass-fraction, Nusselt and Sherwood number profiles. The following heat and mass transfers correlations are developed: ; , which account for the effects of natural convection and the physical properties of the gas phase. These correlations agree with the results of detailed numerical analysis as well as the experimental data involving a single droplet.

  16. Mass Transfer Cooling Near The Stagnation Point

    NASA Technical Reports Server (NTRS)

    Roberts, Leonard

    1959-01-01

    A simplified analysis is made of mass transfer cooling, that is, injection of a foreign gas, near the stagnation point for two-dimensional and axisymmetric bodies. The reduction in heat transfer is given in terms of the properties of the coolant gas and it is shown that the heat transfer may be reduced considerably by the introduction of a gas having appropriate thermal and diffusive properties. The mechanism by which heat transfer is reduced is discussed.

  17. Numerical study of heat and mass transfer in inertial suspensions in pipes.

    NASA Astrophysics Data System (ADS)

    Niazi Ardekani, Mehdi; Brandt, Luca

    2017-11-01

    Controlling heat and mass transfer in particulate suspensions has many important applications such as packed and fluidized bed reactors and industrial dryers. In this work, we study the heat and mass transfer within a suspension of spherical particles in a laminar pipe flow, using the immersed boundary method (IBM) to account for the solid fluid interactions and a volume of fluid (VoF) method to resolve temperature equation both inside and outside of the particles. Tracers that follow the fluid streamlines are considered to investigate mass transfer within the suspension. Different particle volume fractions 5, 15, 30 and 40% are simulated for different pipe to particle diameter ratios: 5, 10 and 15. The preliminary results quantify the heat and mass transfer enhancement with respect to a single-phase laminar pipe flow. We show in particular that the heat transfer from the wall saturates for volume fractions more than 30%, however at high particle Reynolds numbers (small diameter ratios) the heat transfer continues to increase. Regarding the dispersion of tracer particles we show that the diffusivity of tracers increases with volume fraction in radial and stream-wise directions however it goes through a peak at 15% in the azimuthal direction. European Research Council, Grant No. ERC-2013-CoG- 616186, TRITOS; SNIC (the Swedish National Infrastructure for Computing).

  18. Heat and Mass Transfer of Ammonia Gas Absorption into Falling Liquid Film on a Horizontal Tube

    NASA Astrophysics Data System (ADS)

    Inoue, Norihiro; Yabuuchi, Hironori; Goto, Masao; Koyama, Shigeru

    Heat and mass transfer coefficients during ammonia gas absorption into a falling liquid film formed by distilled water on a horizontal tube were obtained experimentally. The test absorber consists of 200 mm i.d., 600 mm long stainless steel shell, a 1 7.3 mm o.d., 14.9 mm i.d. stainless steel test tube with 600 mm working length mounted along the axis of shell, and a 12.7 mm o.d. pipe manifold of supplying the absorbent. In this paper, it was clear that heat and mass transfer coefficient could be enhanced by increasing the flow rate of absorbent and temperature difference between inlet absorbent and ammonia gas, also heat driven by the temperature difference have an effect on heat transfer of the fa1ling liquid film and mass transfer of vapor side. And the new correlation of heat transfer in dimensionless form was proposed by the temperature difference which was considered heat driven of vapor and liquid film side using a interface temperature of vapor and liquid phase. The new correlations of mass transfer on a interface of vapor and liquid phase in dimensionless form were proposed by using effect factors could be suppose from absorption phenomena.

  19. The Effect of Detonation Wave Incidence Angle on the Acceleration of Flyers by Explosives Heavily Laden with Inert Additives

    NASA Astrophysics Data System (ADS)

    Loiseau, Jason; Georges, William; Frost, David; Higgins, Andrew

    2015-06-01

    The incidence angle of a detonation wave is often assumed to weakly influence the terminal velocity of an explosively driven flyer. For explosives heavily loaded with dense additives, this may not be true due to differences in momentum and energy transfer between detonation products, additive particles, and the flyer. For tangential incidence the particles are first accelerated against the flyer via an expansion fan, whereas they are first accelerated by the detonation wave in the normal case. In the current study we evaluate the effect of normal versus tangential incidence on the acceleration of flyers by nitromethane heavily loaded with a variety of additives. Normal detonation was initiated via an explosively driven slapper. Flyer acceleration was measured with heterodyne laser interferometry (PDV). The influence of wave angle is evaluated by comparing the terminal velocity in the two cases (i.e., normal and grazing) for the heavily loaded mixtures. The decrement in flyer velocity correlated primarily with additive volume fraction and had a weak dependence on additive density or particle size. The Gurney energy of the heterogeneous explosive was observed to increase with flyer mass, presumably due to the timescale over which impinging particles could transfer momentum.

  20. Evaporation heat transfer of carbon dioxide at low temperature inside a horizontal smooth tube

    NASA Astrophysics Data System (ADS)

    Yoon, Jung-In; Son, Chang-Hyo; Jung, Suk-Ho; Jeon, Min-Ju; Yang, Dong-Il

    2017-05-01

    In this paper, the evaporation heat transfer coefficient of carbon dioxide at low temperature of -30 to -20 °C in a horizontal smooth tube was investigated experimentally. The test devices consist of mass flowmeter, pre-heater, magnetic gear pump, test section (evaporator), condenser and liquid receiver. Test section is made of cooper tube. Inner and outer diameter of the test section is 8 and 9.52 mm, respectively. The experiment is conducted at mass fluxes from 100 to 300 kg/m2 s, saturation temperature from -30 to -20 °C. The main results are summarized as follows: In case that the mass flux of carbon dioxide is 100 kg/m2 s, the evaporation heat transfer coefficient is almost constant regardless of vapor quality. In case of 200 and 300 kg/m2 s, the evaporation heat transfer coefficient increases steadily with increasing vapor quality. For the same mass flux, the evaporation heat transfer coefficient increases as the evaporation temperature of the refrigerant decreases. In comparison of heat transfer correlations with the experimental result, the evaporation heat transfer correlations do not predict them exactly. Therefore, more accurate heat transfer correlation than the previous one is required.

  1. Development of a general equation to determine the transfer factor feed-to-meat for radiocesium on the basis of the body mass of domestic animals

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Nalezinski, S.; Ruehm, W.; Wirth, E.

    1996-05-01

    Transfer factors from feed to meat (5{sub {integral}}), taken from literature for monogastric animals and ruminants have been correlated to their corresponding animal body mass (m{sub b}). Taking all data into account, a close relationship between both transfer factor and body mass becomes evident, yielding a regression function of (T{sub {integral}} = 8.0 x m{sub b}{sup {minus}0.91}) (r = -0.97). For monogastric animals (including poultry), the corresponding relationships are T{sub {integral}} = 1.9 x m{sub b}{sup {minus}0.72} (r = 0.78). The equations offer the opportunity to estimate the transfer factor for individual animals more precisely taking individual body masses intomore » account. They are of interest for animals, on which no or only poor data concerning radiocesium transfer factors are available. The determination of radiocesium transfer factors are reduced to a simple weighing process. 17 refs., 1 fig., 2 tabs.« less

  2. Mass transfer parameters of celeriac during vacuum drying

    NASA Astrophysics Data System (ADS)

    Beigi, Mohsen

    2017-04-01

    An accurate prediction of moisture transfer parameters is very important for efficient mass transfer analysis, accurate modelling of drying process, and better designing of new dryers and optimization of existing drying process. The present study aimed to investigate the influence of temperature (e.g., 55, 65 and 75 °C) and chamber pressure (e.g., 0.1, 3, 7, 10, 13 and 17 kPa) on effective diffusivity and convective mass transfer coefficient of celeriac slices during vacuum drying. The obtained Biot number indicated that the moisture transfer in the celeriac slices was controlled by both internal and external resistance. The effective diffusivity obtained to be in the ranges of 7.5231 × 10-10-3.8015 × 10-9 m2 s-1. The results showed that the diffusivity increased with increasing temperature and decreasing pressure. The mass transfer coefficient values varied from 4.6789 × 10-7 to 1.0059 × 10-6 m s-1, and any increment in drying temperature and pressure caused an increment in the coefficient.

  3. Fluid mechanics of additive manufacturing of metal objects by accretion of droplets - a survey

    NASA Astrophysics Data System (ADS)

    Tesař, Václav

    2016-03-01

    Paper presents a survey of principles of additive manufacturing of metal objects by accretion of molten metal droplets, focusing on fluid-mechanical problems that deserve being investigated. The main problem is slowness of manufacturing due to necessarily small size of added droplets. Increase of droplet repetition rate calls for basic research of the phenomena that take place inside and around the droplets: ballistics of their flight, internal flowfield with heat and mass transfer, oscillation of surfaces, and the ways to elimination of satellite droplets.

  4. Effect of Marangoni Convection on Surfactant Transfer Between the Drop Connected to the Reservoir and Surrounding Liquid

    NASA Astrophysics Data System (ADS)

    Kostarev, K.; Denisova, M.; Shmyrov, A.

    2018-03-01

    The paper presents the results of comparative investigation of the interaction between the capillary and buoyant mechanisms of motion in a problem of surfactant mass transfer between an insoluble drop and surrounding fluid under different gravity conditions. The research was performed for the drop that is coupled with the reservoir filled with a source mixture through a long thin tube (needle). Visualization of the flow patterns and concentration fields has shown that surfactant diffusion from the needle at normal gravity leads to the onset of the oscillatory mode of the capillary convection in the drop. It has been found that the frequency of the Marangoni convection outbursts, the lifetime of the oscillatory flow modes and the amount of the source mixture involved in the process of mass transfer depend on the drop size and initial concentration of the surfactant. The obtained results are compared with the cases of surfactant diffusion from the isolated drop under terrestrial conditions and from the drop coupled with reservoir in microgravity. Additionally, a series of experiments were performed to investigate diffusion of a surfactant from the surrounding solution into a drop.

  5. Sparger system for MMH-helium vents

    NASA Technical Reports Server (NTRS)

    Rakow, A.

    1983-01-01

    Based on a calculated vent flow rate and MMH concentration, a TI-59 program was run to determine total sparger hole area for a given sparger inlet pressure. Hole diameter is determined from a mass transfer analysis in the holding tank to achieve complete capture of MMH. In addition, based on oxidation kinetics and vapor pressure data, MMh atmospheric concentrations are determined 2 ft above the holding tank.

  6. A mass spectrometric study of gaseous H4PO+3 and H2PO-3 ions

    NASA Astrophysics Data System (ADS)

    de Petris, Giulia; Occhiucci, Giorgio; Pepi, Federico

    1994-09-01

    H4PO+3 ions have been generated in a mass spectrometer by proton-transfer to H3PO3 from different Brønsted acids. The proton affinity of H3PO3 has been estimated by bracketing and kinetic methods to be 198.6 ± 2 kcal mol-1. Gaseous H4PO+3 ions have been structurally assessed by metastable ion kinetic energy (MIKE) and collisionally induced dissociation (CID) mass spectrometry leading to the detection of a single isomeric species. The chemistry of H2PO-3 is characterized by facile addition-elimination reactions leading to formation of polyanions. Species containing up to six P atoms have been detected.

  7. DOE Office of Scientific and Technical Information (OSTI.GOV)

    Yu, Z.; Peldszus, S.; Huck, P.M.

    The adsorption of two representative PhACs (naproxen and carbamazepine) and one EDC (nonylphenol) were evaluated on two granular activated carbons (GAC) namely coal-based Calgon Filtrasorb 400 and coconut shell-based PICA CTIF TE. The primary objective was to investigate preloading effects by natural organic matter (NOM) on adsorption capacity and kinetics under conditions and concentrations (i.e., ng/L) relevant for drinking water treatment. Isotherms demonstrated that all compounds were significantly negatively impacted by NOM fouling. Adsorption capacity reduction was most severe for the acidic naproxen, followed by the neutral carbamazepine and then the more hydrophobic nonylphenol. The GAC with the wider poremore » size distribution had considerably greater NOM loading, resulting in lower adsorption capacity. Different patterns for the change in Freundlich KF and 1/n with time revealed different competitive mechanisms for the different compounds. Mass transport coefficients determined by short fixed-bed (SFB) tests with virgin and preloaded GAC demonstrated that film diffusion primarily controls mass transfer on virgin and preloaded carbon. Naproxen suffered the greatest deteriorative effect on kinetic parameters due to preloading, followed by carbamazepine, and then nonylphenol. A type of surface NOM/biofilm, which appeared to add an additional mass transfer resistance layer and thus reduce film diffusion, was observed. In addition, electrostatic interactions between NOM/biofilm and the investigated compounds are proposed to contribute to the reduction of film diffusion. A companion paper building on this work describes treatability studies in pilot-scale GAC adsorbers and the effectiveness of a selected fixed-bed model. 32 refs., 3 figs., 2 tabs.« less

  8. The quantitative impact of the mesopore size on the mass transfer mechanism of the new 1.9μm fully porous Titan-C18 particles. I: analysis of small molecules.

    PubMed

    Gritti, Fabrice; Guiochon, Georges

    2015-03-06

    Previous data have shown that could deliver a minimum reduced plate height as small as 1.7. Additionally, the reduction of the mesopore size after C18 derivatization and the subsequent restriction for sample diffusivity across the Titan-C18 particles were found responsible for the unusually small value of the experimental optimum reduced velocity (5 versus 10 for conventional particles) and for the large values of the average reduced solid-liquid mass transfer resistance coefficients (0.032 versus 0.016) measured for a series of seven n-alkanophenones. The improvements in column efficiency made by increasing the average mesopore size of the Titan silica from 80 to 120Å are investigated from a quantitative viewpoint based on the accurate measurements of the reduced coefficients (longitudinal diffusion, trans-particle mass transfer resistance, and eddy diffusion) and of the intra-particle diffusivity, pore, and surface diffusion for the same series of n-alkanophenone compounds. The experimental results reveal an increase (from 0% to 30%) of the longitudinal diffusion coefficients for the same sample concentration distribution (from 0.25 to 4) between the particle volume and the external volume of the column, a 40% increase of the intra-particle diffusivity for the same sample distribution (from 1 to 7) between the particle skeleton volume and the bulk phase, and a 15-30% decrease of the solid-liquid mass transfer coefficient for the n-alkanophenone compounds. Pore and surface diffusion are increased by 60% and 20%, respectively. The eddy dispersion term and the maximum column efficiency (295000plates/m) remain virtually unchanged. The rate of increase of the total plate height with increasing the chromatographic speed is reduced by 20% and it is mostly controlled (75% and 70% for 80 and 120Å pore size) by the flow rate dependence of the eddy dispersion term. Copyright © 2015 Elsevier B.V. All rights reserved.

  9. Effects of natural organic matter on PCB-activated carbon sorption kinetics: implications for sediment capping applications.

    PubMed

    Fairey, Julian L; Wahman, David G; Lowry, Gregory V

    2010-01-01

    In situ capping of polychlorinated biphenyl (PCB)-contaminated sediments with a layer of activated carbon has been proposed, but several questions remain regarding the long-term effectiveness of this remediation strategy. Here, we assess the degree to which kinetic limitations, size exclusion effects, and electrostatic repulsions impaired PCB sorption to activated carbon. Sorption of 11 PCB congeners with activated carbon was studied in fixed bed reactors with organic-free water (OFW) and Suwannee River natural organic matter (SR-NOM), made by reconstituting freeze-dried SR-NOM at a concentration of 10 mg L(-1) as carbon. In the OFW test, no PCBs were detected in the column effluent over the 390-d study, indicating that PCB-activated carbon equilibrium sorption capacities may be achieved before breakthrough even at the relatively high hydraulic loading rate (HLR) of 3.1 m h(-1). However, in the SR-NOM fixed-bed test, partial PCB breakthrough occurred over the entire 320-d test (HLRs of 3.1-, 1.5-, and 0.8 m h(-1)). Simulations from a modified pore and surface diffusion model indicated that external (film diffusion) mass transfer was the dominant rate-limiting step but that internal (pore diffusion) mass transfer limitations were also present. The external mass transfer limitation was likely caused by formation of PCB-NOM complexes that reduced PCB sorption through a combination of (i) increased film diffusion resistance; (ii) size exclusion effects; and (iii) electrostatic repulsive forces between the PCBs and the NOM-coated activated carbon. However, the seepage velocities in the SR-NOM fixed bed test were about 1000 times higher than would be expected in a sediment cap. Therefore, additional studies are needed to assess whether the mass transfer limitations described here would be likely to manifest themselves at the lower seepage velocities observed in practice.

  10. Tubing modifications for countercurrent chromatography (CCC): Stationary phase retention and separation efficiency.

    PubMed

    Englert, Michael; Vetter, Walter

    2015-07-16

    Countercurrent chromatography (CCC) is a separation technique in which two immiscible liquid phases are used for the preparative purification of synthetic and natural products. In CCC the number of repetitive mixing and de-mixing processes, the retention of the stationary phase and the mass transfer between the liquid phases are significant parameters that influence the resolution and separation efficiency. Limited mass transfer is the main reason for peak broadening and a low number of theoretical plates along with impaired peak resolution in CCC. Hence, technical improvements with regard to column design and tubing modifications is an important aspect to enhance mixing and mass transfer. In this study we constructed a crimping tool which allowed us to make reproducible, semi-automated modifications of conventional round-shaped tubing. Six crimped tubing modifications were prepared, mounted onto multilayer coils which were subsequently installed in the CCC system. The stationary phase retention of the tubing modifications were compared to the conventional system with unmodified tubing in a hydrophobic, an intermediate and a hydrophilic two-phase solvent system. Generally, the tubing modifications provided higher capabilities to retain the stationary phase depending on the solvent system and flow rates. In the intermediate solvent system the separation efficiency was evaluated with a mixture of six alkyl p-hydroxybenzoates. The peak resolution could be increased up to 50% with one of the tubing modifications compared to the unmodified tubing. Using the most convincing tubing modification at fixed values for the stationary phase retention, a reasonable comparison to the unmodified tubing was achieved. The peak width could be reduced up to 49% and a strong positive impact at increased flow rates regarding peak resolution and theoretical plate number was observed compared to unmodified tubing. It could be concluded that the tubing modification enhanced the interphase mixing and mass transfer of the two phases by additional and more vigorous agitation. Copyright © 2015 Elsevier B.V. All rights reserved.

  11. Characterizing particle-scale equilibrium adsorption and kinetics of uranium(VI) desorption from U-contaminated sediments

    USGS Publications Warehouse

    Stoliker, Deborah L.; Liu, Chongxuan; Kent, Douglas B.; Zachara, John M.

    2013-01-01

    Rates of U(VI) release from individual dry-sieved size fractions of a field-aggregated, field-contaminated composite sediment from the seasonally saturated lower vadose zone of the Hanford 300-Area were examined in flow-through reactors to maintain quasi-constant chemical conditions. The principal source of variability in equilibrium U(VI) adsorption properties of the various size fractions was the impact of variable chemistry on adsorption. This source of variability was represented using surface complexation models (SCMs) with different stoichiometric coefficients with respect to hydrogen ion and carbonate concentrations for the different size fractions. A reactive transport model incorporating equilibrium expressions for cation exchange and calcite dissolution, along with rate expressions for aerobic respiration and silica dissolution, described the temporal evolution of solute concentrations observed during the flow-through reactor experiments. Kinetic U(VI) desorption was well described using a multirate SCM with an assumed lognormal distribution for the mass-transfer rate coefficients. The estimated mean and standard deviation of the rate coefficients were the same for all <2 mm size fractions but differed for the 2–8 mm size fraction. Micropore volumes, assessed using t-plots to analyze N2 desorption data, were also the same for all dry-sieved <2 mm size fractions, indicating a link between micropore volumes and mass-transfer rate properties. Pore volumes for dry-sieved size fractions exceeded values for the corresponding wet-sieved fractions. We hypothesize that repeated field wetting and drying cycles lead to the formation of aggregates and/or coatings containing (micro)pore networks which provided an additional mass-transfer resistance over that associated with individual particles. The 2–8 mm fraction exhibited a larger average and standard deviation in the distribution of mass-transfer rate coefficients, possibly caused by the abundance of microporous basaltic rock fragments.

  12. Dialyzer clearances and mass transfer-area coefficients for small solutes at low dialysate flow rates.

    PubMed

    Leypoldt, John K; Kamerath, Craig D; Gilson, Janice F; Friederichs, Goetz

    2006-01-01

    New daily hemodialysis therapies operate at low dialysate flow rates to minimize dialysate volume requirements; however, the dependence of dialyzer clearances and mass transfer-area coefficients for small solutes on dialysate flow rate under these conditions have not been studied extensively. We evaluated in vitro dialyzer clearances for urea and creatinine at dialysate flow rates of 40, 80, 120, 160, and 200 ml/min and ultrafiltration flow rates of 0, 1, and 2 l/h, using a dialyzer containing PUREMA membranes (NxStage Medical, Lawrence, MA). Clearances were measured directly across the dialyzer by perfusing bovine blood with added urea and creatinine single pass through the dialyzer at a nominal blood flow rate of 400 ml/min. Limited, additional studies were performed with the use of dialyzers containing PUREMA membranes at a blood flow rate of 200 ml/min and also with the use of other dialyzers containing polysulfone membranes (Optiflux 160NR, FMC-NA, Ogden, UT) and dialyzers containing Synphan membranes (NxStage Medical). For dialyzers containing PUREMA membranes, urea and creatinine clearances increased (p < 0.001) with increasing dialysate and ultrafiltration flow rates but were not different at blood flow rates of 200 and 400 ml/min. Dialysate saturation, defined as dialysate outlet concentration divided by blood water inlet concentration, for urea and creatinine was independent of blood and ultrafiltration flow rate but varied inversely (p < 0.001) with dialysate flow rate. Mass transfer-area coefficients for urea and creatinine were independent of blood and ultrafiltration flow rate but decreased (p < 0.001) with decreasing dialysate flow rate. Calculated mass transfer-area coefficients at low dialysate flow rates for all dialyzers tested were substantially lower than those reported by the manufacturers under conventional conditions. We conclude that dialyzers require specific characterization under relevant conditions if they are used in novel daily hemodialysis therapies at low dialysate flow rate.

  13. Mass transfer cycles in cataclysmic variables

    NASA Technical Reports Server (NTRS)

    King, A. R.; Frank, J.; Kolb, U.; Ritter, H.

    1995-01-01

    It is well known that in cataclysmic variables the mass transfer rate must fluctuate about the evolutionary mean on timescales too long to be directly observable. We show that limit-cycle behavior can occur if the radius change of the secondary star is sensitive to the instantaneous mass transfer rate. The only reasonable way in which such a dependence can arise is through irradiation of this star by the accreting component. The system oscillates between high states, in which irradiation causes slow expansion of the secondary and drives an elevated transfer rate, and low states, in which this star contracts.

  14. Characterization of simultaneous heat and mass transfer phenomena for water vapour condensation on a solid surface in an abiotic environment--application to bioprocesses.

    PubMed

    Tiwari, Akhilesh; Kondjoyan, Alain; Fontaine, Jean-Pierre

    2012-07-01

    The phenomenon of heat and mass transfer by condensation of water vapour from humid air involves several key concepts in aerobic bioreactors. The high performance of bioreactors results from optimised interactions between biological processes and multiphase heat and mass transfer. Indeed in various processes such as submerged fermenters and solid-state fermenters, gas/liquid transfer need to be well controlled, as it is involved at the microorganism interface and for the control of the global process. For the theoretical prediction of such phenomena, mathematical models require heat and mass transfer coefficients. To date, very few data have been validated concerning mass transfer coefficients from humid air inflows relevant to those bioprocesses. Our study focussed on the condensation process of water vapour and developed an experimental set-up and protocol to study the velocity profiles and the mass flux on a small size horizontal flat plate in controlled environmental conditions. A closed circuit wind tunnel facility was used to control the temperature, hygrometry and hydrodynamics of the flow. The temperature of the active surface was controlled and kept isothermal below the dew point to induce condensation, by the use of thermoelectricity. The experiments were performed at ambient temperature for a relative humidity between 35-65% and for a velocity of 1.0 ms⁻¹. The obtained data are analysed and compared to available theoretical calculations on condensation mass flux.

  15. Heat transfer in a microvascular network: the effect of heart rate on heating and cooling in reptiles (Pogona barbata and Varanus varius).

    PubMed

    Seebacher, F

    2000-03-21

    Thermally-induced changes in heart rate and blood flow in reptiles are believed to be of selective advantage by allowing animal to exert some control over rates of heating and cooling. This notion has become one of the principal paradigms in reptilian thermal physiology. However, the functional significance of changes in heart rate is unclear, because the effect of heart rate and blood flow on total animal heat transfer is not known. I used heat transfer theory to determine the importance of heat transfer by blood flow relative to conduction. I validated theoretical predictions by comparing them with field data from two species of lizard, bearded dragons (Pogona barbata) and lace monitors (Varanus varius). Heart rates measured in free-ranging lizards in the field were significantly higher during heating than during cooling, and heart rates decreased with body mass. Convective heat transfer by blood flow increased with heart rate. Rates of heat transfer by both blood flow and conduction decreased with mass, but the mass scaling exponents were different. Hence, rate of conductive heat transfer decreased more rapidly with increasing mass than did heat transfer by blood flow, so that the relative importance of blood flow in total animal heat transfer increased with mass. The functional significance of changes in heart rate and, hence, rates of heat transfer, in response to heating and cooling in lizards was quantified. For example, by increasing heart rate when entering a heating environment in the morning, and decreasing heart rate when the environment cools in the evening a Pogona can spend up to 44 min longer per day with body temperature within its preferred range. It was concluded that changes in heart rate in response to heating and cooling confer a selective advantage at least on reptiles of mass similar to that of the study animals (0. 21-5.6 kg). Copyright 2000 Academic Press.

  16. Dynamic transfer applied to secondary ion imaging over large scanned fields with the nanoSIMS 50 at high mass resolution

    NASA Astrophysics Data System (ADS)

    Slodzian, Georges; Wu, Ting-Di; Duprat, Jean; Engrand, Cécile; Guerquin-Kern, Jean-Luc

    2017-12-01

    Dynamic transfer is an adaptive optical approach used for coupling a scanning ion probe with the mass spectrometer designed for analyzing sputtered ions emanating from the probe impact. Its tuning is of crucial importance for getting uniform signal collection over large scanning fields and therefore scanning images free of vignetting in a context of high mass resolution. Revisiting the optical design of the NanoSIMS 50 instrument, where the same set of lenses focuses the primary ion probe on the sample and collects secondary ions from the sample, led us to develop novel experimental procedures to achieve dynamic transfer tuning and overcome instrumental imperfections. It is the case for scanning distortion that may be induced by the octopole used for correcting probe astigmatism and may cause irreducible vignetting on scanning images. We show that it is possible to develop complete tuning procedures by compromising temporarily on the sharpness of the probe focus. Most importantly, we show that, in a context of high mass resolution, the transfer does not significantly disturb isotopic ratios over large scanned fields provided external coils are properly adjusted to compensate ambient magnetic fields. Deepening the procedures led us to demonstrate that the scanning center of the probe may not coincide with the imaging center of COOL, Coaxial Objective Lenses forming the probe and extracting secondary ions. We have checked that bringing those two centers into coincidence resulted in a better image quality over large fields. In the present work, we show how to handle the secondary beam in order to position it before it enters the spectrometer. That capability is essential for optimizing transmission at high mass resolution by aligning the secondary beam axis on a given entrance axis of the spectrometer. These results led us to propose several instrumental improvements including the crucial interest of an additional octopole upstream in the primary ion probe column to prevent scanning distortion when performing astigmatism correction and the possibility of offsetting primary beam deviating plates to bring scanning and imaging centers in coincidence.

  17. The integrated contaminant elution and tracer test toolkit, ICET3, for improved characterization of mass transfer, attenuation, and mass removal

    NASA Astrophysics Data System (ADS)

    Brusseau, Mark L.; Guo, Zhilin

    2018-01-01

    It is evident based on historical data that groundwater contaminant plumes persist at many sites, requiring costly long-term management. High-resolution site-characterization methods are needed to support accurate risk assessments and to select, design, and operate effective remediation operations. Most subsurface characterization methods are generally limited in their ability to provide unambiguous, real-time delineation of specific processes affecting mass-transfer, transformation, and mass removal, and accurate estimation of associated rates. An integrated contaminant elution and tracer test toolkit, comprising a set of local-scale groundwater extraction-and injection tests, was developed to ameliorate the primary limitations associated with standard characterization methods. The test employs extended groundwater extraction to stress the system and induce hydraulic and concentration gradients. Clean water can be injected, which removes the resident aqueous contaminant mass present in the higher-permeability zones and isolates the test zone from the surrounding plume. This ensures that the concentrations and fluxes measured within the isolated area are directly and predominantly influenced by the local mass-transfer and transformation processes controlling mass removal. A suite of standard and novel tracers can be used to delineate specific mass-transfer and attenuation processes that are active at a given site, and to quantify the associated mass-transfer and transformation rates. The conceptual basis for the test is first presented, followed by an illustrative application based on simulations produced with a 3-D mathematical model and a brief case study application.

  18. V3885 Sagittarius: A Comparison With a Range of Standard Model Accretion Disks

    NASA Technical Reports Server (NTRS)

    Linnell, Albert P.; Godon, Patrick; Hubeny, Ivan; Sion, Edward M; Szkody, Paula; Barrett, Paul E.

    2009-01-01

    A chi-squared analysis of standard model accretion disk synthetic spectrum fits to combined Far Ultraviolet Spectroscopic Explorer and Space Telescope Imaging Spectrograph spectra of V3885 Sagittarius, on an absolute flux basis, selects a model that accurately represents the observed spectral energy distribution. Calculation of the synthetic spectrum requires the following system parameters. The cataclysmic variable secondary star period-mass relation calibrated by Knigge in 2006 and 2007 sets the secondary component mass. A mean white dwarf (WD) mass from the same study, which is consistent with an observationally determined mass ratio, sets the adopted WD mass of 0.7M(solar mass), and the WD radius follows from standard theoretical models. The adopted inclination, i = 65 deg, is a literature consensus, and is subsequently supported by chi-squared analysis. The mass transfer rate is the remaining parameter to set the accretion disk T(sub eff) profile, and the Hipparcos parallax constrains that parameter to mas transfer = (5.0 +/- 2.0) x 10(exp -9) M(solar mass)/yr by a comparison with observed spectra. The fit to the observed spectra adopts the contribution of a 57,000 +/- 5000 K WD. The model thus provides realistic constraints on mass transfer and T(sub eff) for a large mass transfer system above the period gap.

  19. Dermal uptake directly from air under transient conditions: advances in modeling and comparisons with experimental results for human subjects.

    PubMed

    Morrison, G C; Weschler, C J; Bekö, G

    2016-12-01

    To better understand the dermal exposure pathway, we enhance an existing mechanistic model of transdermal uptake by including skin surface lipids (SSL) and consider the impact of clothing. Addition of SSL increases the overall resistance to uptake of SVOCs from air but also allows for rapid transfer of SVOCs to sinks like clothing or clean air. We test the model by simulating di-ethyl phthalate (DEP) and di-n-butyl phthalate (DnBP) exposures of six bare-skinned (Weschler et al. 2015, Environ. Health Perspect., 123, 928) and one clothed participant (Morrison et al. 2016, J. Expo. Sci. Environ. Epidemiol., 26, 113). The model predicts total uptake values that are consistent with the measured values. For bare-skinned participants, the model predicts a normalized mass uptake of DEP of 3.1 (μg/m 2 )/(μg/m 3 ), whereas the experimental results range from 1.0 to 4.3 (μg/m 2 )/(μg/m 3 ); uptake of DnBP is somewhat overpredicted: 4.6 (μg/m 2 )/(μg/m 3 ) vs. the experimental range of 0.5-3.2 (μg/m 2 )/(μg/m 3 ). For the clothed participant, the model predicts higher than observed uptake for both species. Uncertainty in model inputs, including convective mass transfer coefficients, partition coefficients, and diffusion coefficients, could account for overpredictions. Simulations that include transfer of skin oil to clothing improve model predictions. A dynamic model that includes SSL is more sensitive to changes that impact external mass transfer such as putting on and removing clothes and bathing. © 2015 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  20. Endocytic pathway rapidly delivers internalized molecules to lysosomes: an analysis of vesicle trafficking, clustering and mass transfer.

    PubMed

    Pangarkar, Chinmay; Dinh, Anh-Tuan; Mitragotri, Samir

    2012-08-20

    Lysosomes play a critical role in intracellular drug delivery. For enzyme-based therapies, they represent a potential target site whereas for nucleic acid or many protein drugs, they represent the potential degradation site. Either way, understanding the mechanisms and processes involved in routing of materials to lysosomes after cellular entry is of high interest to the field of drug delivery. Most therapeutic cargoes other than small hydrophobic molecules enter the cells through endocytosis. Endocytosed cargoes are routed to lysosomes via microtubule-based transport and are ultimately shared by various lysosomes via tethering and clustering of endocytic vesicles followed by exchange of their contents. Using a combined experimental and numerical approach, here we studied the rates of mass transfer into and among the endocytic vesicles in a model cell line, 3T3 fibroblasts. In order to understand the relationship of mass transfer with microtubular transport and vesicle clustering, we varied both properties through various pharmacological agents. At the same time, microtubular transport and vesicle clustering were modeled through diffusion-advection equations and the Smoluchowski equations, respectively. Our analysis revealed that the rate of mass transfer is optimally related to microtubular transport and clustering properties of vesicles. Further, the rate of mass transfer is highest in the innate state of the cell. Any perturbation to either microtubular transport or vesicle aggregation led to reduced mass transfer to lysosome. These results suggest that in the absence of an external intervention the endocytic pathway appears to maximize molecular delivery to lysosomes. Strategies are discussed to reduce mass transfer to lysosomes so as to extend the residence time of molecules in endosomes or late endosomes, thus potentially increasing the likelihood of their escape before disposition in the lysosomes. Copyright © 2012 Elsevier B.V. All rights reserved.

  1. Determination of the external mass transfer coefficient and influence of mixing intensity in moving bed biofilm reactors for wastewater treatment.

    PubMed

    Nogueira, Bruno L; Pérez, Julio; van Loosdrecht, Mark C M; Secchi, Argimiro R; Dezotti, Márcia; Biscaia, Evaristo C

    2015-09-01

    In moving bed biofilm reactors (MBBR), the removal of pollutants from wastewater is due to the substrate consumption by bacteria attached on suspended carriers. As a biofilm process, the substrates are transported from the bulk phase to the biofilm passing through a mass transfer resistance layer. This study proposes a methodology to determine the external mass transfer coefficient and identify the influence of the mixing intensity on the conversion process in-situ in MBBR systems. The method allows the determination of the external mass transfer coefficient in the reactor, which is a major advantage when compared to the previous methods that require mimicking hydrodynamics of the reactor in a flow chamber or in a separate vessel. The proposed methodology was evaluated in an aerobic lab-scale system operating with COD removal and nitrification. The impact of the mixing intensity on the conversion rates for ammonium and COD was tested individually. When comparing the effect of mixing intensity on the removal rates of COD and ammonium, a higher apparent external mass transfer resistance was found for ammonium. For the used aeration intensities, the external mass transfer coefficient for ammonium oxidation was ranging from 0.68 to 13.50 m d(-1) and for COD removal 2.9 to 22.4 m d(-1). The lower coefficient range for ammonium oxidation is likely related to the location of nitrifiers deeper in the biofilm. The measurement of external mass transfer rates in MBBR will help in better design and evaluation of MBBR system-based technologies. Copyright © 2015 Elsevier Ltd. All rights reserved.

  2. Advanced subgrid-scale modeling for convection-dominated species transport at fluid interfaces with application to mass transfer from rising bubbles

    NASA Astrophysics Data System (ADS)

    Weiner, Andre; Bothe, Dieter

    2017-10-01

    This paper presents a novel subgrid scale (SGS) model for simulating convection-dominated species transport at deformable fluid interfaces. One possible application is the Direct Numerical Simulation (DNS) of mass transfer from rising bubbles. The transport of a dissolving gas along the bubble-liquid interface is determined by two transport phenomena: convection in streamwise direction and diffusion in interface normal direction. The convective transport for technical bubble sizes is several orders of magnitude higher, leading to a thin concentration boundary layer around the bubble. A true DNS, fully resolving hydrodynamic and mass transfer length scales results in infeasible computational costs. Our approach is therefore a DNS of the flow field combined with a SGS model to compute the mass transfer between bubble and liquid. An appropriate model-function is used to compute the numerical fluxes on all cell faces of an interface cell. This allows to predict the mass transfer correctly even if the concentration boundary layer is fully contained in a single cell layer around the interface. We show that the SGS-model reduces the resolution requirements at the interface by a factor of ten and more. The integral flux correction is also applicable to other thin boundary layer problems. Two flow regimes are investigated to validate the model. A semi-analytical solution for creeping flow is used to assess local and global mass transfer quantities. For higher Reynolds numbers ranging from Re = 100 to Re = 460 and Péclet numbers between Pe =104 and Pe = 4 ṡ106 we compare the global Sherwood number against correlations from literature. In terms of accuracy, the predicted mass transfer never deviates more than 4% from the reference values.

  3. IMPLICATIONS FOR THE FORMATION OF BLUE STRAGGLER STARS FROM HST ULTRAVIOLET OBSERVATIONS OF NGC 188

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Gosnell, Natalie M.; Mathieu, Robert D.; Geller, Aaron M.

    We present results of a Hubble Space Telescope (HST) far-ultraviolet (FUV) survey searching for white dwarf (WD) companions to blue straggler stars (BSSs) in open cluster NGC 188. The majority of NGC 188 BSSs (15 of 21) are single-lined binaries with properties suggestive of mass-transfer formation via Roche lobe overflow, specifically through an asymptotic giant branch star transferring mass to a main sequence secondary, yielding a BSS binary with a WD companion. In NGC 188, a BSS formed by this mechanism within the past 400 Myr will have a WD companion that is hot and luminous enough to be directlymore » detected as a FUV photometric excess with HST. Comparing expected BSS FUV emission to observed photometry reveals four BSSs with WD companions above 12,000 K (younger than 250 Myr) and three WD companions with temperatures between 11,000 and 12,000 K. These BSS+WD binaries all formed through recent mass transfer. The location of the young BSSs in an optical color–magnitude diagram (CMD) indicates that distance from the zero-age main sequence does not necessarily correlate with BSS age. There is no clear CMD separation between mass transfer-formed BSSs and those likely formed through other mechanisms, such as collisions. The seven detected WD companions place a lower limit on the mass-transfer formation frequency of 33%. We consider other possible formation mechanisms by comparing properties of the BSS population to theoretical predictions. We conclude that 14 BSS binaries likely formed from mass transfer, resulting in an inferred mass-transfer formation frequency of approximately 67%.« less

  4. VOLATILIZATION OF ALKYLBENZENES FROM WATER.

    USGS Publications Warehouse

    Rathbun, R.E.; Tai, D.Y.

    1985-01-01

    Volatilization is a physical process of importance in determining the fate of many organic compounds in streams and rivers. This process is frequently described by the conceptual-two-film model. The model assumes uniformly mixed water and air phases separated by thin films of water and air in which mass transfer is by molecular diffusion. Mass-transfer coefficients for the water and air films are related to an overall mass-transfer coefficient for volatilization through the Henry's law constant.

  5. Modifier mass transfer kinetic effect in the performance of solvent gradient simulated moving bed (SG-SMB) process

    NASA Astrophysics Data System (ADS)

    Câmara, L. D. T.

    2015-09-01

    The solvent-gradient simulated moving bed process (SG-SMB) is the new tendency in the performance improvement if compared to the traditional isocratic solvent conditions. In such SG-SMB separation process the modulation of the solvent strength leads to significant increase in the purities and productivity followed by reduction in the solvent consumption. A stepwise modelling approach was utilized in the representation of the interconnected chromatographic columns of the system combined with lumped mass transfer models between the solid and liquid phase. The influence of the solvent modifier was considered applying the Abel model which takes into account the effect of modifier volume fraction over the partition coefficient. The modelling and simulations were carried out and compared to the experimental SG-SMB separation of the amino acids phenylalanine and tryptophan. A lumped mass transfer kinetic model was applied for both the modifier (ethanol) as well as the solutes. The simulation results showed that such simple and global mass transfer models are enough to represent all the mass transfer effect between the solid adsorbent and the liquid phase. The separation performance can be improved reducing the interaction or the mass transfer kinetic effect between the solid adsorbent phase and the modifier. The simulations showed great agreement fitting the experimental data of the amino acids concentrations both at the extract as well as at the raffinate.

  6. Theoretical models for supercritical fluid extraction.

    PubMed

    Huang, Zhen; Shi, Xiao-Han; Jiang, Wei-Juan

    2012-08-10

    For the proper design of supercritical fluid extraction processes, it is essential to have a sound knowledge of the mass transfer mechanism of the extraction process and the appropriate mathematical representation. In this paper, the advances and applications of kinetic models for describing supercritical fluid extraction from various solid matrices have been presented. The theoretical models overviewed here include the hot ball diffusion, broken and intact cell, shrinking core and some relatively simple models. Mathematical representations of these models have been in detail interpreted as well as their assumptions, parameter identifications and application examples. Extraction process of the analyte solute from the solid matrix by means of supercritical fluid includes the dissolution of the analyte from the solid, the analyte diffusion in the matrix and its transport to the bulk supercritical fluid. Mechanisms involved in a mass transfer model are discussed in terms of external mass transfer resistance, internal mass transfer resistance, solute-solid interactions and axial dispersion. The correlations of the external mass transfer coefficient and axial dispersion coefficient with certain dimensionless numbers are also discussed. Among these models, the broken and intact cell model seems to be the most relevant mathematical model as it is able to provide realistic description of the plant material structure for better understanding the mass-transfer kinetics and thus it has been widely employed for modeling supercritical fluid extraction of natural matters. Copyright © 2012 Elsevier B.V. All rights reserved.

  7. Mass Transfer Testing of a 12.5-cm Rotor Centrifugal Contactor

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    D. H. Meikrantz; T. G. Garn; J. D. Law

    2008-09-01

    TRUEX mass transfer tests were performed using a single stage commercially available 12.5 cm centrifugal contactor and stable cerium (Ce) and europium (Eu). Test conditions included throughputs ranging from 2.5 to 15 Lpm and rotor speeds of 1750 and 2250 rpm. Ce and Eu extraction forward distribution coefficients ranged from 13 to 19. The first and second stage strip back distributions were 0.5 to 1.4 and .002 to .004, respectively, throughout the dynamic test conditions studied. Visual carryover of aqueous entrainment in all organic phase samples was estimated at < 0.1 % and organic carryover into all aqueous phase samplesmore » was about ten times less. Mass transfer efficiencies of = 98 % for both Ce and Eu in the extraction section were obtained over the entire range of test conditions. The first strip stage mass transfer efficiencies ranged from 75 to 93% trending higher with increasing throughput. Second stage mass transfer was greater than 99% in all cases. Increasing the rotor speed from 1750 to 2250 rpm had no significant effect on efficiency for all throughputs tested.« less

  8. Evaluation of the mass transfer process on thin layer drying of papaya seeds from the perspective of diffusive models

    NASA Astrophysics Data System (ADS)

    Dotto, Guilherme Luiz; Meili, Lucas; Tanabe, Eduardo Hiromitsu; Chielle, Daniel Padoin; Moreira, Marcos Flávio Pinto

    2018-02-01

    The mass transfer process that occurs in the thin layer drying of papaya seeds was studied under different conditions. The external mass transfer resistance and the dependence of effective diffusivity ( D EFF ) in relation to the moisture ratio ( \\overline{MR} ) and temperature ( T) were investigated from the perspective of diffusive models. It was verified that the effective diffusivity was affected by the moisture content and temperature. A new correlation was proposed for drying of papaya seeds in order to describe these influences. Regarding the use of diffusive models, the results showed that, at conditions of low drying rates ( T ≤ 70 °C), the external mass transfer resistance, as well as the dependence of the effective diffusivity with respect to the temperature and moisture content should be considered. At high drying rates ( T > 90 °C), the dependence of the effective diffusivity with respect to the temperature and moisture content can be neglected, but the external mass transfer resistance was still considerable in the range of air velocities used in this work.

  9. Method for removing metal vapor from gas streams

    DOEpatents

    Ahluwalia, R.K.; Im, K.H.

    1996-04-02

    A process for cleaning an inert gas contaminated with a metallic vapor, such as cadmium, involves withdrawing gas containing the metallic contaminant from a gas atmosphere of high purity argon; passing the gas containing the metallic contaminant to a mass transfer unit having a plurality of hot gas channels separated by a plurality of coolant gas channels; cooling the contaminated gas as it flows upward through the mass transfer unit to cause contaminated gas vapor to condense on the gas channel walls; regenerating the gas channels of the mass transfer unit; and, returning the cleaned gas to the gas atmosphere of high purity argon. The condensing of the contaminant-containing vapor occurs while suppressing contaminant particulate formation, and is promoted by providing a sufficient amount of surface area in the mass transfer unit to cause the vapor to condense and relieve supersaturation buildup such that contaminant particulates are not formed. Condensation of the contaminant is prevented on supply and return lines in which the contaminant containing gas is withdrawn and returned from and to the electrorefiner and mass transfer unit by heating and insulating the supply and return lines. 13 figs.

  10. Method for removing metal vapor from gas streams

    DOEpatents

    Ahluwalia, R. K.; Im, K. H.

    1996-01-01

    A process for cleaning an inert gas contaminated with a metallic vapor, such as cadmium, involves withdrawing gas containing the metallic contaminant from a gas atmosphere of high purity argon; passing the gas containing the metallic contaminant to a mass transfer unit having a plurality of hot gas channels separated by a plurality of coolant gas channels; cooling the contaminated gas as it flows upward through the mass transfer unit to cause contaminated gas vapor to condense on the gas channel walls; regenerating the gas channels of the mass transfer unit; and, returning the cleaned gas to the gas atmosphere of high purity argon. The condensing of the contaminant-containing vapor occurs while suppressing contaminant particulate formation, and is promoted by providing a sufficient amount of surface area in the mass transfer unit to cause the vapor to condense and relieve supersaturation buildup such that contaminant particulates are not formed. Condensation of the contaminant is prevented on supply and return lines in which the contaminant containing gas is withdrawn and returned from and to the electrorefiner and mass transfer unit by heating and insulating the supply and return lines.

  11. The effects of recirculation flows on mass transfer from the arterial wall to flowing blood.

    PubMed

    Zhang, Zhiguo; Deng, Xiaoyan; Fan, Yubo; Guidoin, Robert

    2008-01-01

    Using a sudden tubular expansion as a model of an arterial stenosis, the effect of disturbed flow on mass transfer from the arterial wall to flowing blood was studied theoretically and tested experimentally by measuring the dissolution rate of benzoic acid disks forming the outer tube of a sudden tubular expansion. The study revealed that mass transfer from vessel wall to flowing fluid in regions of disturbed flow is independent of wall shear rates. The rate of mass transfer is significantly higher in regions of disturbed flow with a local maximum around the reattachment point where the wall shear rate is zero. The experimental study also revealed that the rate of mass transfer from the vessel wall to a flowing fluid is much higher in the presence of microspheres (as models of blood cells) in the flowing fluid and under the condition of pulsatile flow than in steady flow. These results imply that flow disturbance may enhance the transport of biochemicals and macromolecules, such as plasma proteins and lipoproteins synthesized within the blood vessel wall, from the blood vessel wall to flowing blood.

  12. Computer code for predicting coolant flow and heat transfer in turbomachinery

    NASA Technical Reports Server (NTRS)

    Meitner, Peter L.

    1990-01-01

    A computer code was developed to analyze any turbomachinery coolant flow path geometry that consist of a single flow passage with a unique inlet and exit. Flow can be bled off for tip-cap impingement cooling, and a flow bypass can be specified in which coolant flow is taken off at one point in the flow channel and reintroduced at a point farther downstream in the same channel. The user may either choose the coolant flow rate or let the program determine the flow rate from specified inlet and exit conditions. The computer code integrates the 1-D momentum and energy equations along a defined flow path and calculates the coolant's flow rate, temperature, pressure, and velocity and the heat transfer coefficients along the passage. The equations account for area change, mass addition or subtraction, pumping, friction, and heat transfer.

  13. MHD Forced Convective Laminar Boundary Layer Flow from a Convectively Heated Moving Vertical Plate with Radiation and Transpiration Effect

    PubMed Central

    Uddin, Md. Jashim; Khan, Waqar A.; Ismail, A. I. Md.

    2013-01-01

    A two-dimensional steady forced convective flow of a Newtonian fluid past a convectively heated permeable vertically moving plate in the presence of a variable magnetic field and radiation effect has been investigated numerically. The plate moves either in assisting or opposing direction to the free stream. The plate and free stream velocities are considered to be proportional to whilst the magnetic field and mass transfer velocity are taken to be proportional to where is the distance along the plate from the leading edge of the plate. Instead of using existing similarity transformations, we use a linear group of transformations to transform the governing equations into similarity equations with relevant boundary conditions. Numerical solutions of the similarity equations are presented to show the effects of the controlling parameters on the dimensionless velocity, temperature and concentration profiles as well as on the friction factor, rate of heat and mass transfer. It is found that the rate of heat transfer elevates with the mass transfer velocity, convective heat transfer, Prandtl number, velocity ratio and the magnetic field parameters. It is also found that the rate of mass transfer enhances with the mass transfer velocity, velocity ratio, power law index and the Schmidt number, whilst it suppresses with the magnetic field parameter. Our results are compared with the results existing in the open literature. The comparisons are satisfactory. PMID:23741295

  14. Comparison of x-ray cross sections for diagnostic and therapeutic medical physics.

    PubMed

    Boone, J M; Chavez, A E

    1996-12-01

    The purpose of this technical report is to make available an up-to-date source of attenuation coefficient data to the medical physics community, and to compare these data with other more familiar sources. Data files from Lawrence Livermore National Laboratory (in Livermore, CA) were truncated to match the needs of the medical physics community, and an interpolation routine was written to calculate a continuous set of cross sections spanning energies from 1 keV to 50 MeV. Coefficient data are available for elements Z = 1 through Z = 100. Values for mass attenuation coefficients, mass-energy-transfer coefficients, and mass-energy absorption coefficients are produced by a single computer subroutine. In addition to total interaction cross sections, the cross sections for photoelectric, Rayleigh, Compton, pair, and some triplet interactions are also produced by this single program. The coefficients were compared to the 1970 data of Storm and Israel over the energy interval from 1 to 1000 keV; for elements 10, 20, 30, 40, 50, 60, 70, and 80, the average positive difference between the Storm and Israel coefficients and the coefficients reported here are 1.4%, 2.7%, and 2.6%, for the mass attenuation, mass energy-transfer, and mass-energy absorption coefficients, respectively. The 1969 data compilation of mass attenuation coefficients from McMaster et al. were also compared with the newer LLNL data. Over the energy region from 10 keV to 1000 keV, and from elements Z = 1 to Z = 82 (inclusive), the overall average difference was 1.53% (sigma = 0.85%). While the overall average difference was small, there was larger variation (> 5%) between cross sections for some elements. In addition to coefficient data, other useful data such as the density, atomic weight, K, L1, L2, L3, M, and N edges, and numerous characteristic emission energies are output by the program, depending on a single input variable. The computer source code, written in C, can be accessed and downloaded from the World Wide Web at: http:@www.aip.org/epaps/epaps.html [E-MPHSA-23-1977].

  15. Quantitative and Qualitative Aspects of Gas-Metal-Oxide Mass Transfer in High-Temperature Confocal Scanning Laser Microscopy

    NASA Astrophysics Data System (ADS)

    Piva, Stephano P. T.; Pistorius, P. Chris; Webler, Bryan A.

    2018-05-01

    During high-temperature confocal scanning laser microscopy (HT-CSLM) of liquid steel samples, thermal Marangoni flow and rapid mass transfer between the sample and its surroundings occur due to the relatively small sample size (diameter around 5 mm) and large temperature gradients. The resulting evaporation and steel-slag reactions tend to change the chemical composition in the metal. Such mass transfer effects can change observed nonmetallic inclusions. This work quantifies oxide-metal-gas mass transfer of solutes during HT-CSLM experiments using computational simulations and experimental data for (1) dissolution of MgO inclusions in the presence and absence of slag and (2) Ca, Mg-silicate inclusion changes upon exposure of a Si-Mn-killed steel to an oxidizing gas atmosphere.

  16. Effect of Reynolds number on flow and mass transfer characteristics of a 90 degree elbow

    NASA Astrophysics Data System (ADS)

    Fujisawa, Nobuyuki; Ikarashi, Yuya; Yamagata, Takayuki; Taguchi, Syoichi

    2016-11-01

    The flow and mass transfer characteristics of a 90 degree elbow was studied experimentally by using the mass transfer measurement by plaster dissolution method, the surface flow visualization by oil film method and stereo PIV measurement. The experiments are carried out in a water tunnel of a circular pipe of 56mm in diameter with a working fluid of water. The Reynolds number was varied from 30000 to 200000. The experimental result indicated the change of the mass transfer coefficient distribution in the elbow with increasing the Reynolds number. This phenomenon is further examined by the surface flow visualization and measurement of secondary flow pattern in the elbow, and the results showed the suggested change of the secondary flow pattern in the elbow with increasing the Reynolds numbers.

  17. Heat Transfer of Confined Impinging Air-water Mist Jet

    NASA Astrophysics Data System (ADS)

    Chang, Shyy Woei; Su, Lo May

    This paper describes the detailed heat transfer distributions of an atomized air-water mist jet impinging orthogonally onto a confined target plate with various water-to-air mass-flow ratios. A transient technique was used to measure the full field heat transfer coefficients of the impinging surface. Results showed that the high momentum mist-jet interacting with the water-film and wall-jet flows created a variety of heat transfer contours on the impinging surface. The trade-off between the competing influences of the different heat transfer mechanisms involving in an impinging mist jet made the nonlinear variation tendency of overall heat transfer against the increase of water-to-air mass-flow ratio and extended the effective cooling region. With separation distances of 10, 8, 6 and 4 jet-diameters, the spatially averaged heat transfer values on the target plate could respectively reach about 2.01, 1.83, 2.43 and 2.12 times of the equivalent air-jet values, which confirmed the applicability of impinging mist-jet for heat transfer enhancement. The optimal choices of water-to-air mass-flow ratio for the atomized mist jet required the considerations of interactive and combined effects of separation distance, air-jet Reynolds number and the water-to-air mass-flow ratio into the atomized nozzle.

  18. Fuel conditioning facility zone-to-zone transfer administrative controls.

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Pope, C. L.

    2000-06-21

    The administrative controls associated with transferring containers from one criticality hazard control zone to another in the Argonne National Laboratory (ANL) Fuel Conditioning Facility (FCF) are described. FCF, located at the ANL-West site near Idaho Falls, Idaho, is used to remotely process spent sodium bonded metallic fuel for disposition. The process involves nearly forty widely varying material forms and types, over fifty specific use container types, and over thirty distinct zones where work activities occur. During 1999, over five thousand transfers from one zone to another were conducted. Limits are placed on mass, material form and type, and container typesmore » for each zone. Ml material and containers are tracked using the Mass Tracking System (MTG). The MTG uses an Oracle database and numerous applications to manage the database. The database stores information specific to the process, including material composition and mass, container identification number and mass, transfer history, and the operators involved in each transfer. The process is controlled using written procedures which specify the zone, containers, and material involved in a task. Transferring a container from one zone to another is called a zone-to-zone transfer (ZZT). ZZTs consist of four distinct phases, select, request, identify, and completion.« less

  19. Chemiresistive and Gravimetric Dual-Mode Gas Sensor toward Target Recognition and Differentiation.

    PubMed

    Chen, Yan; Zhang, Hao; Feng, Zhihong; Zhang, Hongxiang; Zhang, Rui; Yu, Yuanyuan; Tao, Jin; Zhao, Hongyuan; Guo, Wenlan; Pang, Wei; Duan, Xuexin; Liu, Jing; Zhang, Daihua

    2016-08-24

    We demonstrate a dual-mode gas sensor for simultaneous and independent acquisition of electrical and mechanical signals from the same gas adsorption event. The device integrates a graphene field-effect transistor (FET) with a piezoelectric resonator in a seamless manner by leveraging multiple structural and functional synergies. Dual signals resulting from independent physical processes, i.e., mass attachment and charge transfer can reflect intrinsic properties of gas molecules and potentially enable target recognition and quantification at the same time. Fabrication of the device is based on standard Integrated Circuit (IC) foundry processes and fully compatible with system-on-a-chip (SoC) integration to achieve extremely small form factors. In addition, the ability of simultaneous measurements of mass adsorption and charge transfer guides us to a more precise understanding of the interactions between graphene and various gas molecules. Besides its practical functions, the device serves as an effective tool to quantitatively investigate the physical processes and sensing mechanisms for a large library of sensing materials and target analytes.

  20. Field measurement of nitromethane from automotive emissions at a busy intersection using proton-transfer-reaction mass spectrometry

    NASA Astrophysics Data System (ADS)

    Inomata, Satoshi; Fujitani, Yuji; Fushimi, Akihiro; Tanimoto, Hiroshi; Sekimoto, Kanako; Yamada, Hiroyuki

    2014-10-01

    Field measurements of seven nitro-organic compounds including nitromethane and ten related volatile organic compounds were carried out using proton-transfer-reaction mass spectrometry at a busy intersection of an urban city, Kawasaki, Japan from 26th February to 6th March, 2011. Among the nitro-organic compounds, nitromethane was usually observed along with air pollutants emitted from automobiles. The mixing ratios of nitromethane varied substantially and sometimes clearly varied at an approximately constant interval. The interval corresponded to the cycle of the traffic signals at the intersection and the regular peaks of nitromethane concentrations were caused by emissions from diesel trucks running with high speed. In addition to the regular peaks, sharp increases of nitromethane concentrations were often observed irregularly from diesel trucks accelerating in front of the measurement site. For other nitro-organic compounds such as nitrophenol, nitrocresol, dihydroxynitrobenzene, nitrobenzene, nitrotoluene, and nitronaphthalene, most of the data fluctuated within the detection limits.

  1. Adiabatic Mass Loss Model in Binary Stars

    NASA Astrophysics Data System (ADS)

    Ge, H. W.

    2012-07-01

    Rapid mass transfer process in the interacting binary systems is very complicated. It relates to two basic problems in the binary star evolution, i.e., the dynamically unstable Roche-lobe overflow and the common envelope evolution. Both of the problems are very important and difficult to be modeled. In this PhD thesis, we focus on the rapid mass loss process of the donor in interacting binary systems. The application to the criterion of dynamically unstable mass transfer and the common envelope evolution are also included. Our results based on the adiabatic mass loss model could be used to improve the binary evolution theory, the binary population synthetic method, and other related aspects. We build up the adiabatic mass loss model. In this model, two approximations are included. The first one is that the energy generation and heat flow through the stellar interior can be neglected, hence the restructuring is adiabatic. The second one is that he stellar interior remains in hydrostatic equilibrium. We model this response by constructing model sequences, beginning with a donor star filling its Roche lobe at an arbitrary point in its evolution, holding its specific entropy and composition profiles fixed. These approximations are validated by the comparison with the time-dependent binary mass transfer calculations and the polytropic model for low mass zero-age main-sequence stars. In the dynamical time scale mass transfer, the adiabatic response of the donor star drives it to expand beyond its Roche lobe, leading to runaway mass transfer and the formation of a common envelope with its companion star. For donor stars with surface convection zones of any significant depth, this runaway condition is encountered early in mass transfer, if at all; but for main sequence stars with radiative envelopes, it may be encountered after a prolonged phase of thermal time scale mass transfer, so-called delayed dynamical instability. We identify the critical binary mass ratio for the onset of dynamical time scale mass transfer; if the ratio of donor to accretor masses exceeds this critical value, the dynamical time scale mass transfer ensues. The grid of criterion for all stars can be used to be the basic input as the binary population synthetic method, which will be improved absolutely. In common envelope evolution, the dissipation of orbital energy of the binary provides the energy to eject the common envelope; the energy budget for this process essentially consists of the initial orbital energy of the binary and the initial binding energies of the binary components. We emphasize that, because stellar core and envelope contribute mutually to each other's gravitational potential energy, proper evaluation of the total energy of a star requires integration over the entire stellar interior, not the ejected envelope alone as commonly assumed. We show that the change in total energy of the donor star, as a function of its remaining mass along an adiabatic mass-loss sequence, can be calculated. This change in total energy of the donor star, combined with the requirement that both remnant donor and its companion star fit within their respective Roche lobes, then circumscribes energetically possible survivors of common envelope evolution. It is the first time that we can calculate the accurate total energy of the donor star in common envelope evolution, while the results with the old method are inconsistent with observations.

  2. Reductive dechlorination of trichloroethene DNAPL source zones: source zone architecture versus electron donor availability

    NASA Astrophysics Data System (ADS)

    Krol, M.; Kokkinaki, A.; Sleep, B.

    2014-12-01

    The persistence of dense-non-aqueous-phase liquids (DNAPLs) in the subsurface has led practitioners and regulatory agencies to turn towards low-maintenance, low-cost remediation methods. Biological degradation has been suggested as a possible solution, based on the well-proven ability of certain microbial species to break down dissolved chlorinated ethenes under favorable conditions. However, the biodegradation of pure phase chlorinated ethenes is subject to additional constraints: the continuous release of electron acceptor at a rate governed by mass transfer kinetics, and the temporal and spatial heterogeneity of DNAPL source zones which leads to spatially and temporally variable availability of the reactants for reductive dechlorination. In this work, we investigate the relationship between various DNAPL source zone characteristics and reaction kinetics using COMPSIM, a multiphase groundwater model that considers non-equilibrium mass transfer and Monod-type kinetics for reductive dechlorination. Numerical simulations are performed for simple, homogeneous trichloroethene DNAPL source zones to demonstrate the effect of single source zone characteristics, as well as for larger, more realistic heterogeneous source zones. It is shown that source zone size, and mass transfer kinetics may have a decisive effect on the predicted bio-enhancement. Finally, we evaluate the performance of DNAPL bioremediation for realistic, thermodynamically constrained, concentrations of electron donor. Our results indicate that the latter may be the most important limitation for the success of DNAPL bioremediation, leading to reduced bio-enhancement and, in many cases, comparable performance with water flooding.

  3. Characterization of the intragranular water regime within subsurface sediments: Pore volume, surface area, and mass transfer limitations

    USGS Publications Warehouse

    Hay, M.B.; Stoliker, D.L.; Davis, J.A.; Zachara, J.M.

    2011-01-01

    Although "intragranular" pore space within grain aggregates, grain fractures, and mineral surface coatings may contain a relatively small fraction of the total porosity within a porous medium, it often contains a significant fraction of the reactive surface area, and can thus strongly affect the transport of sorbing solutes. In this work, we demonstrate a batch experiment procedure using tritiated water as a high-resolution diffusive tracer to characterize the intragranular pore space. The method was tested using uranium-contaminated sediments from the vadose and capillary fringe zones beneath the former 300A process ponds at the Hanford site (Washington). Sediments were contacted with tracers in artificial groundwater, followed by a replacement of bulk solution with tracer-free groundwater and the monitoring of tracer release. From these data, intragranular pore volumes were calculated and mass transfer rates were quantified using a multirate first-order mass transfer model. Tritium-hydrogen exchange on surface hydroxyls was accounted for by conducting additional tracer experiments on sediment that was vacuum dried after reaction. The complementary ("wet" and "dry") techniques allowed for the simultaneous determination of intragranular porosity and surface area using tritium. The Hanford 300A samples exhibited intragranular pore volumes of ???1% of the solid volume and intragranular surface areas of ???20%-35% of the total surface area. Analogous experiments using bromide ion as a tracer yielded very different results, suggesting very little penetration of bromide into the intragranular porosity. Copyright 2011 by the American Geophysical Union.

  4. Characterization of the intragranular water regime within subsurface sediments: pore volume, surface area, and mass transfer limitations

    USGS Publications Warehouse

    Hay, Michael B.; Stoliker, Deborah L.; Davis, James A.; Zachara, John M.

    2011-01-01

    Although "intragranular" pore space within grain aggregates, grain fractures, and mineral surface coatings may contain a relatively small fraction of the total porosity within a porous medium, it often contains a significant fraction of the reactive surface area, and can thus strongly affect the transport of sorbing solutes. In this work, we demonstrate a batch experiment procedure using tritiated water as a high-resolution diffusive tracer to characterize the intragranular pore space. The method was tested using uranium-contaminated sediments from the vadose and capillary fringe zones beneath the former 300A process ponds at the Hanford site (Washington). Sediments were contacted with tracers in artificial groundwater, followed by a replacement of bulk solution with tracer-free groundwater and the monitoring of tracer release. From these data, intragranular pore volumes were calculated and mass transfer rates were quantified using a multirate first-order mass transfer model. Tritium-hydrogen exchange on surface hydroxyls was accounted for by conducting additional tracer experiments on sediment that was vacuum dried after reaction. The complementary ("wet" and "dry") techniques allowed for the simultaneous determination of intragranular porosity and surface area using tritium. The Hanford 300A samples exhibited intragranular pore volumes of ~1% of the solid volume and intragranular surface areas of ~20%–35% of the total surface area. Analogous experiments using bromide ion as a tracer yielded very different results, suggesting very little penetration of bromide into the intragranular porosity.

  5. Diffusive transfer to membranes as an effective interface between gel electrophoresis and mass spectrometry

    NASA Astrophysics Data System (ADS)

    Ogorzalek Loo, Rachel R.; Mitchell, Charles; Stevenson, Tracy I.; Loo, Joseph A.; Andrews, Philip C.

    1997-12-01

    Diffusive transfer was examined as a blotting method to transfer proteins from polyacrylamide gels to membranes for ultraviolet matrix-assisted laser desorption ionization (MALDI) mass spectrometry. The method is well-suited for transfers from isoelectric focusing (IEF) gels. Spectra have been obtained for 11 pmol of 66 kDa albumin loaded onto an IEF gel and subsequently blotted to polyethylene. Similarly, masses of intact carbonic anhydrase and hemoglobin were obtained from 14 and 20 pmol loadings. This methodology is also compatible with blotting high molecular weight proteins, as seen for 6 pmol of the 150 kDa monoclonal antibody anti-[beta]-galactosidase transferred to Goretex. Polypropylene, Teflon, Nafion and polyvinylidene difluoride (PVDF) also produced good spectra following diffusive transfer. Only analysis from PVDF required that the membrane be kept wet prior to application of matrix. Considerations in mass accuracy for analysis from large-area membranes with continuous extraction and delayed extraction were explored, as were remedies for surface charging. Vapor phase CNBr cleavage was applied to membrane-bound samples for peptide mapping.

  6. Theoretical analysis for condensation heat transfer of binary refrigerant mixtures with annular flow in horizontal mini-tubes

    NASA Astrophysics Data System (ADS)

    Zhang, Hui-Yong; Li, Jun-Ming; Sun, Ji-Liang; Wang, Bu-Xuan

    2016-01-01

    A theoretical model is developed for condensation heat transfer of binary refrigerant mixtures in mini-tubes with diameter about 1.0 mm. Condensation heat transfer of R410A and R32/R134a mixtures at different mass fluxes and saturated temperatures are analyzed, assuming that the phase flow pattern is annular flow. The results indicate that there exists a maximum interface temperature at the beginning of condensation process for azeotropic and zeotropic mixtures and the corresponding vapor quality to the maximum value increases with mass flux. The effects of mass flux, heat flux, surface tension and tube diameter are analyzed. As expected, the condensation heat transfer coefficients increase with mass flux and vapor quality, and increase faster in high vapor quality region. It is found that the effects of heat flux and surface tension are not so obvious as that of tube diameter. The characteristics of condensation heat transfer of zeotropic mixtures are consistent to those of azeotropic refrigerant mixtures. The condensation heat transfer coefficients increase with the concentration of the less volatile component in binary mixtures.

  7. Modeling of the Inter-phase Mass Transfer during Cosolvent-Enhanced NAPL Remediation

    NASA Astrophysics Data System (ADS)

    Agaoglu, B.; Scheytt, T. J.; Copty, N. K.

    2012-12-01

    This study investigates the factors influencing inter-phase mass transfer during cosolvent-enhanced NAPL remediation and the ability of the REV (Representative Elementary Volume) modeling approach to simulate these processes. The NAPLs considered in this study consist of pure toluene, pure benzene and known mixtures of these two compounds, while ethanol-water mixtures were selected as the remedial flushing solutions. Batch tests were performed to identify both the equilibrium and non-equilibrium properties of the multiphase system. A series of column flushing experiments involving different NAPLs were conducted for different ethanol contents in the flushing solution and for different operational parameters. Experimental results were compared to numerical simulations obtained with the UTCHEM multiphase flow simulator (Delshad et al., 1996). Results indicate that the velocity of the flushing solution is a major parameter influencing the inter-phase mass transport processes at the pore scale. Depending on the NAPL composition and porous medium properties, the remedial solution may follow preferential flow paths and be subject to reduced contact with the NAPL. This leads to a steep decrease in the apparent mass transfer coefficient. Correlations of the apparent time-dependent mass transfer coefficient as a function of flushing velocity are developed for various porous media. Experimental results also show that the NAPL mass transfer coefficient into the cosolvent solution increases when the NAPL phase becomes mobile. This is attributed to the increase in pore scale contact area between NAPL and the remedial solution when NAPL mobilization occurs. These results suggest the need to define a temporal and spatially variable mass transfer coefficient of the NAPL into the cosolvent solution to reflect the occurrence of subscale preferential flow paths and the transient bypassing of the NAPL mass. The implications of these findings on field scale NAPL remediation with cosolvents are discussed.

  8. A History of Collapse Factor Modeling and Empirical Data for Cryogenic Propellant Tanks

    NASA Technical Reports Server (NTRS)

    deQuay, Laurence; Hodge, B. Keith

    2010-01-01

    One of the major technical problems associated with cryogenic liquid propellant systems used to supply rocket engines and their subassemblies and components is the phenomenon of propellant tank pressurant and ullage gas collapse. This collapse is mainly caused by heat transfer from ullage gas to tank walls and interfacing propellant, which are both at temperatures well below those of this gas. Mass transfer between ullage gas and cryogenic propellant can also occur and have minor to significant secondary effects that can increase or decrease ullage gas collapse. Pressurant gas is supplied into cryogenic propellant tanks in order to initially pressurize these tanks and then maintain required pressures as propellant is expelled from these tanks. The net effect of pressurant and ullage gas collapse is increased total mass and mass flow rate requirements of pressurant gases. For flight vehicles this leads to significant and undesirable weight penalties. For rocket engine component and subassembly ground test facilities this results in significantly increased facility hardware, construction, and operational costs. "Collapse Factor" is a parameter used to quantify the pressurant and ullage gas collapse. Accurate prediction of collapse factors, through analytical methods and modeling tools, and collection and evaluation of collapse factor data has evolved over the years since the start of space exploration programs in the 1950 s. Through the years, numerous documents have been published to preserve results of studies associated with the collapse factor phenomenon. This paper presents a summary and selected details of prior literature that document the aforementioned studies. Additionally other literature that present studies and results of heat and mass transfer processes, related to or providing important insights or analytical methods for the studies of collapse factor, are presented.

  9. Combined effects of heat and mass transfer to magneto hydrodynamics oscillatory dusty fluid flow in a porous channel

    NASA Astrophysics Data System (ADS)

    Govindarajan, A.; Vijayalakshmi, R.; Ramamurthy, V.

    2018-04-01

    The main aim of this article is to study the combined effects of heat and mass transfer to radiative Magneto Hydro Dynamics (MHD) oscillatory optically thin dusty fluid in a saturated porous medium channel. Based on certain assumptions, the momentum, energy, concentration equations are obtained.The governing equations are non-dimensionalised, simplified and solved analytically. The closed analytical form solutions for velocity, temperature, concentration profiles are obtained. Numerical computations are presented graphically to show the salient features of various physical parameters. The shear stress, the rate of heat transfer and the rate of mass transfer are also presented graphically.

  10. A Review of Microbubble and its Applications in Ozonation

    NASA Astrophysics Data System (ADS)

    Shangguan, Yufei; Yu, Shuili; Gong, Chao; Wang, Yue; Yang, Wangzhen; Hou, Li-an

    2018-03-01

    Ozonation has been demonstrated to be an effective technology for the oxidation of organic matters in water treatment. But the low solubility and low mass transfer efficiency limit the application. Microbubble technology has the potential of enhancing gas-liquid mass transfer efficiency, thus it can be applied in ozonation process. The applications of microbubble ozonation have shown advantages over macro bubble ozonation in mass transfer and reaction rate. Microbubble ozonation will be a promising treatment both in water and wastewater treatment.

  11. Bioaccessibility of PAHs in Fuel Soot Assessed by an in Vitro Digestive Model with Absorptive Sink: Effect of Food Ingestion.

    PubMed

    Zhang, Yanyan; Pignatello, Joseph J; Tao, Shu; Xing, Baoshan

    2015-12-15

    We investigated the effects of changing physiological conditions in the digestive tract expected with food ingestion on the apparent bioaccessibility (Bapp) of 11 polycyclic aromatic hydrocarbons (PAHs) in a fuel soot. A previously established in vitro digestive model was applied that included silicone sheet as a third-phase absorptive sink simulating passive transfer of PAHs to intestinal epithelium in the small intestine stage. The Bapp is defined as the fraction found in the digestive fluid plus sheet after digestion. We determined that Bapp was independent of gastric pH and addition of nonlipid milk representing dietary proteins and carbohydrates, whereas it increased with bile acids concentration (2.0-10 g/L), small intestinal pH (5.00-7.35), and addition of soybean oil representing dietary lipid (100% and 200% of the mean daily ingestion by 2-5 year olds in the U.S.). Bapp of PAHs increases with small intestinal pH due to the combined effects of mass transfer promotion from nonlabile to labile sorbed states in the soot, weaker sorption of the labile state, and increasingly favorable partitioning from the digestive fluid to the silicone sink. Under fed conditions, Bapp increases with inclusion of lipids due to the combined effects of mass transfer promotion from nonlabile to labile states, and increasingly favorable partitioning into bile acid micelles. Our results indicate significant variability in soot PAH bioaccessibility within the range of physiological conditions experienced by humans, and suggest that bioaccessibility will increase with coconsumption of food, especially food with high fat content.

  12. “Towards building better linkages between aqueous phase ...

    EPA Pesticide Factsheets

    Currently, CMAQ’s aqueous phase chemistry routine (AQCHEM-base) assumes Henry’s Law equilibrium and employs a forward Euler method to solve a small set of oxidation equations, considering the additional processes of aitken scavenging and wet deposition in series and employing a bisection method to calculate H+ concentrations. With potentially hundreds of reactions that may be important in cloud water and only seven reactions in the current model, expansion of the existing mechanism is an important area of investigation. However, with the current mechanism hardwired into the solver code, the module is difficult to expand with additional chemistry. It also ignores the impacts of mass transfer limitations on cloud chemistry which may be significant. Here, the Kinetic PreProcessor has been applied to generate a Rosenbrock solver for the CMAQ v5.0.1 aqueous phase chemistry mechanism. The module has been updated to simultaneously solve kinetic mass transfer between the phases, dissociation/association, chemical kinetics, Aitken scavenging, and wet deposition. This will allow for easier expansion of the chemical mechanism in the future and a better link between aqueous phase chemistry and droplet microphysics. The National Exposure Research Laboratory (NERL) Atmospheric Modeling and Analysis Division (AMAD) conducts research in support of EPA mission to protect human health and the environment. AMAD research program is engaged in developing and evaluating pre

  13. Effects of electron transfer mediators on the bioreduction of lepidocrocite ({gamma}-FeOOH).

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    O'Loughlin, E. J.; Biosciences Division

    2008-08-20

    Electron transfer mediators (ETMs) such as low-molecular-mass quinones (e.g., juglone and lawsone) and humic substances are believed to play a role in many redox reactions involved in contaminant transformations and the biogeochemical cycling of many redox-active elements (e.g., Fe and Mn) in aquatic and terrestrial environments. This study examines the effects of a series of compounds representing major classes of natural and synthetic organic ETMs, including low-molecular-mass quinones, humic substances, phenazines, phenoxazines, phenothiazines, and indigo derivatives, on the bioreduction of lepidocrocite ({gamma}-FeOOH) by the dissimilatory Fe(III)-reducing bacterium Shewanella putrefaciens CN32. Although S. putrefaciens CN32 was able to reduce lepidocrocite inmore » the absence of exogenous ETMs, the addition of exogenous ETMs enhanced the bioreduction of lepidocrocite. In general, the rate of Fe(II) production correlated well with the reduction potentials of the ETMs. The addition of humic acids or unfractionated natural organic matter at concentrations of 10 mg organic C L{sup -1} resulted in, at best, a minimal enhancement of lepidocrocite bioreduction. This observation suggests that electron shuttling by humic substances is not likely to play a major role in Fe(III) bioreduction in oligotrophic environments such as subsurface sediments with low organic C contents.« less

  14. A general stagnation-point convective heating equation for arbitrary gas mixtures

    NASA Technical Reports Server (NTRS)

    Sutton, K.; Graves, R. A., Jr.

    1971-01-01

    The stagnation-point convective heat transfer to an axisymmetric blunt body for arbitrary gases in chemical equilibrium was investigated. The gases considered were base gases of nitrogen, oxygen, hydrogen, helium, neon, argon, carbon dioxide, ammonia, and methane and 22 gas mixtures composed of the base gases. Enthalpies ranged from 2.3 to 116.2 MJ/kg, pressures ranged from 0.001 to 100 atmospheres, and the wall temperatures were 300 and 1111 K. A general equation for the stagnation-point convective heat transfer in base gases and gas mixtures was derived and is a function of the mass fraction, the molecular weight, and a transport parameter of the base gases. The relation compares well with present boundary-layer computer results and with other analytical and experimental results. In addition, the analysis verified that the convective heat transfer in gas mixtures can be determined from a summation relation involving the heat transfer coefficients of the base gases. The basic technique developed for the prediction of stagnation-point convective heating to an axisymmetric blunt body could be applied to other heat transfer problems.

  15. Buoyancy contribution to uncertainty of mass, conventional mass and force

    NASA Astrophysics Data System (ADS)

    Malengo, Andrea; Bich, Walter

    2016-04-01

    The conventional mass is a useful concept introduced to reduce the impact of the buoyancy correction in everyday mass measurements, thus avoiding in most cases its accurate determination, necessary in measurements of ‘true’ mass. Although usage of conventional mass is universal and standardized, the concept is considered as a sort of second-choice tool, to be avoided in high-accuracy applications. In this paper we show that this is a false belief, by elucidating the role played by covariances between volume and mass and between volume and conventional mass at the various stages of the dissemination chain and in the relationship between the uncertainties of mass and conventional mass. We arrive at somewhat counter-intuitive results: the volume of the transfer standard plays a comparatively minor role in the uncertainty budget of the standard under calibration. In addition, conventional mass is preferable to mass in normal, in-air operation, as its uncertainty is smaller than that of mass, if covariance terms are properly taken into account, and the uncertainty over-stating (typically) resulting from neglecting them is less severe than that (always) occurring with mass. The same considerations hold for force. In this respect, we show that the associated uncertainty is the same using mass or conventional mass, and, again, that the latter is preferable if covariance terms are neglected.

  16. Improved ion optics for introduction of ions into a 9.4-T Fourier transform ion cyclotron resonance mass spectrometer

    DOE PAGES

    Chen, Yu; Leach, Franklin E.; Kaiser, Nathan K.; ...

    2015-01-19

    Fourier transform ion cyclotron resonance (FT-ICR) mass spectrometry provides unparalleled mass accuracy and resolving power.[1],[2] With electrospray ionization (ESI), ions are typically transferred into the mass spectrometer through a skimmer, which serves as a conductance-limiting orifice. However, the skimmer allows only a small fraction of incoming ions to enter the mass spectrometer. An ion funnel, originally developed by Smith and coworkers at Pacific Northwest National Laboratory (PNNL)[3-5] provides much more efficient ion focusing and transfer. The large entrance aperture of the ion funnel allows almost all ions emanating from a heated capillary to be efficiently captured and transferred, resulting inmore » nearly lossless transmission.« less

  17. Accounting for the Effect of Noncondensing Gases on Interphasic Heat and Mass Transfer in the Two-Fluid Model Used in the KORSAR Code

    NASA Astrophysics Data System (ADS)

    Yudov, Yu. V.

    2018-03-01

    A model is presented of the interphasic heat and mass transfer in the presence of noncondensable gases for the KORSAR/GP design code. This code was developed by FGUP NITI and the special design bureau OKB Gidropress. It was certified by Rostekhnadzor in 2009 for numerical substantiation of the safety of reactor installations with VVER reactors. The model is based on the assumption that there are three types of interphasic heat and mass transfer of the vapor component: vapor condensation or evaporation on the interphase under any thermodynamic conditions of the phases, pool boiling of the liquid superheated above the saturation temperature at the total pressure, and spontaneous condensation in the volume of gas phase supercooled below the saturation temperature at the vapor partial pressure. Condensation and evaporation on the interphase continuously occur in a two-phase flow and control the time response of the interphase heat and mass transfer. Boiling and spontaneous condensation take place only at the metastable condition of the phases and run at a quite high speed. The procedure used for calculating condensation and evaporation on the interphase accounts for the combined diffusion and thermal resistance of mass transfer in all regimes of the two-phase flow. The proposed approach accounts for, in a natural manner, a decrease in the rate of steam condensation (or generation) in the presence of noncondensing components in the gas phase due to a decrease (or increase) in the interphase temperature relative to the saturation temperature at the vapor partial pressure. The model of the interphase heat transfer also accounts for the processes of dissolution or release of noncondensing components in or from the liquid. The gas concentration at the interphase and on the saturation curve is calculated by the Henry law. The mass transfer coefficient in gas dissolution is based on the heat and mass transfer analogy. Results are presented of the verification of the interphase heat and mass transfer used in the KORSAR/GP code based on the data on film condensation of steam-air flows in vertical pipes. The proposed model was also tested by solving a problem of nitrogen release from a supersaturated water solution.

  18. ChiMS: Open-source instrument control software platform on LabVIEW for imaging/depth profiling mass spectrometers.

    PubMed

    Cui, Yang; Hanley, Luke

    2015-06-01

    ChiMS is an open-source data acquisition and control software program written within LabVIEW for high speed imaging and depth profiling mass spectrometers. ChiMS can also transfer large datasets from a digitizer to computer memory at high repetition rate, save data to hard disk at high throughput, and perform high speed data processing. The data acquisition mode generally simulates a digital oscilloscope, but with peripheral devices integrated for control as well as advanced data sorting and processing capabilities. Customized user-designed experiments can be easily written based on several included templates. ChiMS is additionally well suited to non-laser based mass spectrometers imaging and various other experiments in laser physics, physical chemistry, and surface science.

  19. ChiMS: Open-source instrument control software platform on LabVIEW for imaging/depth profiling mass spectrometers

    PubMed Central

    Cui, Yang; Hanley, Luke

    2015-01-01

    ChiMS is an open-source data acquisition and control software program written within LabVIEW for high speed imaging and depth profiling mass spectrometers. ChiMS can also transfer large datasets from a digitizer to computer memory at high repetition rate, save data to hard disk at high throughput, and perform high speed data processing. The data acquisition mode generally simulates a digital oscilloscope, but with peripheral devices integrated for control as well as advanced data sorting and processing capabilities. Customized user-designed experiments can be easily written based on several included templates. ChiMS is additionally well suited to non-laser based mass spectrometers imaging and various other experiments in laser physics, physical chemistry, and surface science. PMID:26133872

  20. ChiMS: Open-source instrument control software platform on LabVIEW for imaging/depth profiling mass spectrometers

    NASA Astrophysics Data System (ADS)

    Cui, Yang; Hanley, Luke

    2015-06-01

    ChiMS is an open-source data acquisition and control software program written within LabVIEW for high speed imaging and depth profiling mass spectrometers. ChiMS can also transfer large datasets from a digitizer to computer memory at high repetition rate, save data to hard disk at high throughput, and perform high speed data processing. The data acquisition mode generally simulates a digital oscilloscope, but with peripheral devices integrated for control as well as advanced data sorting and processing capabilities. Customized user-designed experiments can be easily written based on several included templates. ChiMS is additionally well suited to non-laser based mass spectrometers imaging and various other experiments in laser physics, physical chemistry, and surface science.

  1. Biofiltration of volatile pollutants: Engineering mechanisms for improved design, long-term operation, prediction, and implementation. 1997 annual progress report

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Davison, B.H.; Klasson, K.T.; Barton, J.W.

    1997-09-01

    'Biofiltration systems can be used to treat volatile organic compounds (VOCs); however, the systems are poorly understood and are currently operated as black boxes. Common operational problems associated with biofilters include fouling, deactivation, and overgrowth, all of which make biofilters ineffective for continuous, long-term use. The objective of this investigation is to develop generic methods for long-term stable operation, in particular by using selective limitation of supplemental nutrients while maintaining high activity and the ability to regenerate biofilter activity. As part of this effort, the authors will provide a deeper fundamental understanding of the important biological and transport mechanisms inmore » biodestruction of sparingly soluble VOCs and will extend this engineering approach and developed mathematical models to two additional systems of high-priority environmental management (EM) relevance-direct degradation and cometabolic degradation of priority pollutants such as BTEX (benzene, toluene, ethylbenzene, and xylene) and TCE (trichioroethylene), respectively. Preliminary results indicate that the author can control overgrowth of the biofilm while sustaining high degradation rates and develop basic predictive models that elucidate mass transfer and kinetic limitations in this system for alkanes. The alkanes are degraded into CO, and waterwith minimal biomass (due to the methodology proposed). This system will be used to test and model additional supplemental nutrient feeding strategies as well as methods to increase the fundamental driving forces by modification of the system. Models will be extended to non-steady-state, long-term operation. The author will examine the nature of the mixed microbial community in the VOC-degrading biofilm and test for new degradative activities. He will use cosolvents with surfactant properties to enhance hydrocarbon solubility in the biofilm and evaluate their impact on mass transfer and reaction rate in an operating biofilter. These results will point to further potential improvements in systems of EM priority. Constructed and acclimated three trickling-bed biofilters. Measured kinetic activity and mass transfer in biofilters under study. Demonstrated extended activity of biofilters in absence of supplemental nutrient. Quantified filter regeneration after prolonged starvation. Demonstrated competence of microbial consortium for degrading a variety of C, to C, alkanes as sole carbon and energy sources. Demonstrated competence of microbial consortium for degrading chlorinated alkane as sole carbon and energy sources. Examined solubility enhancement agents. Completed mathematical modeling of biofilm diffusion, reaction, and mass transfer effects for simple cases.'« less

  2. Syngas fermentation to biofuel: evaluation of carbon monoxide mass transfer and analytical modeling using a composite hollow fiber (CHF) membrane bioreactor.

    PubMed

    Munasinghe, Pradeep Chaminda; Khanal, Samir Kumar

    2012-10-01

    In this study, the volumetric mass transfer coefficients (Ka) for CO were examined in a composite hollow fiber (CHF) membrane bioreactor. The mass transfer experiments were conducted at various inlet gas pressures (from 5 to 30 psig (34.5-206.8 kPa(g))) and recirculation flow rates (300, 600, 900, 1200 and 1500 mL/min) through CHF module. The highest Ka value of 946.6 1/h was observed at a recirculation rate of 1500 mL/min and at an inlet gas pressure of 30 psig(206.8 kPa(g)). The findings of this study confirm that the use of CHF membranes is effective and improves the efficiency CO mass transfer into the aqueous phase. Copyright © 2012 Elsevier Ltd. All rights reserved.

  3. Heat and mass transfer enhancement of nanofluids flow in the presence of metallic/metallic-oxides spherical nanoparticles

    NASA Astrophysics Data System (ADS)

    Qureshi, M. Zubair Akbar; Ali, Kashif; Iqbal, M. Farooq; Ashraf, Muhammad; Ahmad, Shazad

    2017-01-01

    The numerical study of heat and mass transfer for an incompressible magnetohydrodynamics (MHD) nanofluid flow containing spherical shaped nanoparticles through a channel with moving porous walls is presented. Further, another endeavour is to study the effect of two types of fluids, namely the metallic nanofluid (Au + water) and metallic-oxides nanofluid (TiO2 + water) are studied. The phenomena of spherical metallic and metallic-oxides nanoparticles have been also mathematically modelled by using the Hamilton-Crosser model. The influence of the governing parameters on the flow, heat and mass transfer aspects of the problem is discussed. The outcome of the investigation may be beneficial to the application of biotechnology and industrial purposes. Numerical solutions for the velocity, heat and mass transfer rate at the boundary are obtained and analysed.

  4. Couette flow of an incompressible fluid in a porous channel with mass transfer

    NASA Astrophysics Data System (ADS)

    Niranjana, N.; Vidhya, M.; Govindarajan, A.

    2018-04-01

    The present discussion deals with the study of couette flow through a porous medium of a viscous incompressible fluid between two infinite horizontal parallel porous flat plates with heat and mass transfer. The stationary plate and the plate in uniform motion are subjected to transverse sinusoidal injection and uniform suction of the fluid. Due to this type of injection velocity, the flow becomes three dimensional. The analytical solutions of the nonlinear partial differential equations of this problem are obtained by using perturbation technique. Expressions for the velocity, temperature fields and the rate of heat and mass transfers are obtained. Effects of the following parameters Schmidt number (Sc), Modified Grashof number (Gm) on the velocity, temperature and concentration fields are obtained numerically and depicted through graphs. The rate of heat and mass transfer are also analyzed.

  5. Reduction of benzene and naphthalene mass transfer from crude oils by aging-induced interfacial films.

    PubMed

    Ghoshal, Subhasis; Pasion, Catherine; Alshafie, Mohammed

    2004-04-01

    Semi-rigid films or skins form at the interface of crude oil and water as a result of the accumulation of asphaltene and resin fractions when the water-immiscible crude oil is contacted with water for a period of time or "aged". The time varying patterns of area-independent mass transfer coefficients of two compounds, benzene and naphthalene, for dissolution from crude oil and gasoline were determined. Aqueous concentrations of the compounds were measured in the eluent from flow-through reactors, where a nondispersed oil phase and constant oil-water interfacial area were maintained. For Brent Blend crude oil and for gasoline amended with asphaltenes and resins, a rapid decrease in both benzene and naphthalene mass transfer coefficients over the first few days of aging was observed. The mass transfer coefficients of the two target solutes were reduced by up to 80% over 35 d although the equilibrium partition coefficients were unchanged. Aging of gasoline, which has negligible amounts of asphaltene and resin, did not result in a change in the solute mass transfer coefficients. The study demonstrates that formation of crude oil-water interfacial films comprised of asphaltenes and resins contribute to time-dependent decreases in rates of release of environmentally relevant solutes from crude oils and may contribute to the persistence of such solutes at crude oil-contaminated sites. It is estimated that the interfacial film has an extremely low film mass transfer coefficient in the range of 10(-6) cm/min.

  6. Determination of external and internal mass transfer limitation in nitrifying microbial aggregates.

    PubMed

    Wilén, Britt-Marie; Gapes, Daniel; Keller, Jürg

    2004-05-20

    In this article we present a study of the effects of external and internal mass transfer limitation of oxygen in a nitrifying system. The oxygen uptake rates (OUR) were measured on both a macro-scale with a respirometric reactor using off-gas analysis (Titrimetric and Off-Gas Analysis (TOGA) sensor) and on a micro-scale with microsensors. These two methods provide independent, accurate measurements of the reaction rates and concentration profiles around and in the granules. The TOGA sensor and microsensor measurements showed a significant external mass transfer effect at low dissolved oxygen (DO) concentrations in the bulk liquid while it was insignificant at higher DO concentrations. The oxygen distribution with anaerobic or anoxic conditions in the center clearly shows major mass transfer limitation in the aggregate interior. The large drop in DO concentration of 22-80% between the bulk liquid and aggregate surface demonstrates that the external mass transfer resistance is also highly important. The maximum OUR even for floccular biomass was only attained at much higher DO concentrations (approximately 8 mg/L) than typically used in such systems. For granules, the DO required for maximal activity was estimated to be >20 mg/L, clearly indicating the effects of the major external and internal mass transfer limitations on the overall biomass activity. Smaller aggregates had a larger volumetric OUR indicating that the granules may have a lower activity in the interior part of the aggregate. Copyright 2004 Wiley Periodicals, Inc.

  7. The awakening of a classical nova from hibernation.

    PubMed

    Mróz, Przemek; Udalski, Andrzej; Pietrukowicz, Paweł; Szymański, Michał K; Soszyński, Igor; Wyrzykowski, Łukasz; Poleski, Radosław; Kozłowski, Szymon; Skowron, Jan; Ulaczyk, Krzysztof; Skowron, Dorota; Pawlak, Michał

    2016-09-29

    Cataclysmic variable stars-novae, dwarf novae, and nova-likes-are close binary systems consisting of a white dwarf star (the primary) that is accreting matter from a low-mass companion star (the secondary). From time to time such systems undergo large-amplitude brightenings. The most spectacular eruptions, with a ten-thousandfold increase in brightness, occur in classical novae and are caused by a thermonuclear runaway on the surface of the white dwarf. Such eruptions are thought to recur on timescales of ten thousand to a million years. In between, the system's properties depend primarily on the mass-transfer rate: if it is lower than a billionth of a solar mass per year, the accretion becomes unstable and the matter is dumped onto the white dwarf during quasi-periodic dwarf nova outbursts. The hibernation hypothesis predicts that nova eruptions strongly affect the mass-transfer rate in the binary, keeping it high for centuries after the event. Subsequently, the mass-transfer rate should significantly decrease for a thousand to a million years, starting the hibernation phase. After that the nova awakes again-with accretion returning to the pre-eruption level and leading to a new nova explosion. The hibernation model predicts cyclical evolution of cataclysmic variables through phases of high and low mass-transfer. The theory gained some support from the discovery of ancient nova shells around the dwarf novae Z Camelopardalis and AT Cancri, but direct evidence for considerable mass-transfer changes prior, during and after nova eruptions has not hitherto been found. Here we report long-term observations of the classical nova V1213 Cen (Nova Centauri 2009) covering its pre- and post-eruption phases and precisely documenting its evolution. Within the six years before the explosion, the system revealed dwarf nova outbursts indicative of a low mass-transfer rate. The post-nova is two orders of magnitude brighter than the pre-nova at minimum light with no trace of dwarf nova behaviour, implying that the mass-transfer rate increased considerably as a result of the nova explosion.

  8. Coaxial ion trap mass spectrometer: concentric toroidal and quadrupolar trapping regions.

    PubMed

    Peng, Ying; Hansen, Brett J; Quist, Hannah; Zhang, Zhiping; Wang, Miao; Hawkins, Aaron R; Austin, Daniel E

    2011-07-15

    We present the design and results for a new radio-frequency ion trap mass analyzer, the coaxial ion trap, in which both toroidal and quadrupolar trapping regions are created simultaneously. The device is composed of two parallel ceramic plates, the facing surfaces of which are lithographically patterned with concentric metal rings and covered with a thin film of germanium. Experiments demonstrate that ions can be trapped in either region, transferred from the toroidal to the quadrupolar region, and mass-selectively ejected from the quadrupolar region to a detector. Ions trapped in the toroidal region can be transferred to the quadrupole region using an applied ac signal in the radial direction, although it appears that the mechanism of this transfer does not involve resonance with the ion secular frequency, and the process is not mass selective. Ions in the quadrupole trapping region are mass analyzed using dipole resonant ejection. Multiple transfer steps and mass analysis scans are possible on a single population of ions, as from a single ionization/trapping event. The device demonstrates better mass resolving power than the radially ejecting halo ion trap and better sensitivity than the planar quadrupole ion trap.

  9. Mass transfer in thin films under counter-current gas: experiments and numerical study

    NASA Astrophysics Data System (ADS)

    Lucquiaud, Mathieu; Lavalle, Gianluca; Schmidt, Patrick; Ausner, Ilja; Wehrli, Marc; O Naraigh, Lennon; Valluri, Prashant

    2016-11-01

    Mass transfer in liquid-gas stratified flows is strongly affected by the waviness of the interface. For reactive flows, the chemical reactions occurring at the liquid-gas interface also influence the mass transfer rate. This is encountered in several technological applications, such as absorption units for carbon capture. We investigate the absorption rate of carbon dioxide in a liquid solution. The experimental set-up consists of a vertical channel where a falling film is sheared by a counter-current gas flow. We measure the absorption occurring at different flow conditions, by changing the liquid solution, the liquid flow rate and the gas composition. With the aim to support the experimental results with numerical simulations, we implement in our level-set flow solver a novel module for mass transfer taking into account a variant of the ghost-fluid formalism. We firstly validate the pure mass transfer case with and without hydrodynamics by comparing the species concentration in the bulk flow to the analytical solution. In a final stage, we analyse the absorption rate in reactive flows, and try to reproduce the experimental results by means of numerical simulations to explore the active role of the waves at the interface.

  10. Preliminary characterization of carbon dioxide transfer in a hollow fiber membrane module as a possible solution for gas-liquid transfer in microgravity conditions

    NASA Astrophysics Data System (ADS)

    Farges, Bérangère; Duchez, David; Dussap, Claude-Gilles; Cornet, Jean-François

    2012-01-01

    In microgravity, one of the major challenge encountered in biological life support systems (BLSS) is the gas-liquid transfer with, for instance, the necessity to provide CO2 (carbon source, pH control) and to recover the evolved O2 in photobioreactors used as atmosphere bioregenerative systems.This paper describes first the development of a system enabling the accurate characterization of the mass transfer limiting step for a PTFE membrane module used as a possible efficient solution to the microgravity gas-liquid transfer. This original technical apparatus, together with a technical assessment of membrane permeability to different gases, is associated with a balance model, determining thus completely the CO2 mass transfer problem between phases. First results are given and discussed for the CO2 mass transfer coefficient kLCO obtained in case of absorption experiments at pH 8 using the hollow fiber membrane module. The consistency of the proposed method, based on a gas and liquid phase balances verifying carbon conservation enables a very accurate determination of the kLCO value as a main limiting step of the whole process. Nevertheless, further experiments are still needed to demonstrate that the proposed method could serve in the future as reference method for mass transfer coefficient determination if using membrane modules for BLSS in reduced or microgravity conditions.

  11. End-Functionalized Palladium SCS Pincer Polymers via Controlled Radical Polymerizations.

    PubMed

    Lye, Diane S; Cohen, Aaron E; Wong, Madeleine Z; Weck, Marcus

    2017-07-01

    A direct and facile route toward semitelechelic polymers, end-functionalized with palladated sulfur-carbon-sulfur pincer (Pd II -pincer) complexes is reported that avoids any post-polymerization step. Key to our methodology is the combination of reversible addition-fragmentation chain-transfer (RAFT) polymerization with functionalized chain-transfer agents. This strategy yields Pd end-group-functionalized materials with monomodal molar mass dispersities (Đ) of 1.18-1.44. The RAFT polymerization is investigated using a Pd II -pincer chain-transfer agent for three classes of monomers: styrene, tert-butyl acrylate, and N-isopropylacrylamide. The ensuing Pd II -pincer end-functionalized polymers are analyzed using 1 H NMR spectroscopy, gel-permeation chromatography, and elemental analysis. The RAFT polymerization methodology provides a direct pathway for the fabrication of Pd II -pincer functionalized polymers with complete end-group functionalization. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  12. An investigation on near wall transport characteristics in an adiabatic upward gas-liquid two-phase slug flow

    NASA Astrophysics Data System (ADS)

    Zheng, Donghong; Che, Defu

    2007-08-01

    The near-wall transport characteristics, inclusive of mass transfer coefficient and wall shear stress, which have a great effect on gas-liquid two-phase flow induced internal corrosion of low alloy pipelines in vertical upward oil and gas mixing transport, have been both mechanistically and experimentally investigated in this paper. Based on the analyses on the hydrodynamic characteristics of an upward slug unit, the mass transfer in the near wall can be divided into four zones, Taylor bubble nose zone, falling liquid film zone, Taylor bubble wake zone and the remaining liquid slug zone; the wall shear stress can be divided into two zones, the positive wall shear stress zone associated with the falling liquid film and the negative wall shear stress zone associated with the liquid slug. Based on the conventional mass transfer and wall shear stress characteristics formulas of single phase liquid full-pipe turbulent flow, corrected normalized mass transfer coefficient formula and wall shear stress formula are proposed. The calculated results are in good agreement with the experimental data. The shear stress and the mass transfer coefficient in the near wall zone are increased with the increase of superficial gas velocity and decreased with the increase of superficial liquid velocity. The mass transfer coefficients in the falling liquid film zone and the wake zone of leading Taylor bubble are lager than those in the Taylor bubble nose zone and the remaining liquid slug zone, and the wall shear stress associated falling liquid film is larger than that associated the liquid slug. The mass transfer coefficient is within 10-3 m/s, and the wall shear stress below 103 Pa. It can be concluded that the alternate wall shear stress due to upward gas-liquid slug flow is considered to be the major cause of the corrosion production film fatigue cracking.

  13. Mass transfer equation for proteins in very high-pressure liquid chromatography.

    PubMed

    Gritti, Fabrice; Guiochon, Georges

    2009-04-01

    The mass transfer kinetics of human insulin was investigated on a 50 mm x 2.1 mm column packed with 1.7 microm BEH-C(18) particles, eluted with a water/acetonitrile/trifluoroacetic acid (TFA) (68/32/0.1, v/v/v) solution. The different contributions to the mass transfer kinetics, e.g., those of longitudinal diffusion, eddy dispersion, the film mass transfer resistance, cross-particle diffusivity, adsorption-desorption kinetics, and transcolumn differential sorption, were incorporated into a general mass transfer equation designed to account for the mass transfer kinetics of proteins under high pressure. More specifically, this equation includes the effects of pore size exclusion, pressure, and temperature on the band broadening of a protein. The flow rate was first increased from 0.001 to 0.250 mL/min, the pressure drop increasing from 2 to 298 bar, and the column being placed in stagnant air at 296.5 K, in order to determine the effective diffusivity of insulin through the porous particles, the mass transfer rate constants, and the adsorption equilibrium constant in the low-pressure range. Then, the column inlet pressure was increased by using capillary flow restrictors downstream the column, at the constant flow rate of 0.03 mL/min. The column temperature was kept uniform by immersing the column in a circulating water bath thermostatted at 298.7 and 323.15 K, successively. The results showed that the surface diffusion coefficient of insulin decreases faster than its bulk diffusion coefficient with increasing average column pressure. This is consistent with the adsorption energy of insulin onto the BEH-C(18) surface increasing strongly with increasing pressure. In contrast, given the precision of the height equivalent to a theoretical plate (HETP) measurement (+/-12%), the adsorption kinetics of insulin appears to be rather independent of the pressure. On average, the adsorption rate constant of insulin is doubled from about 40 to 80 s(-1) when the temperature increases from 298.7 to 323.15 K.

  14. Low Thrust Cis-Lunar Transfers Using a 40 kW-Class Solar Electric Propulsion Spacecraft

    NASA Technical Reports Server (NTRS)

    Mcguire, Melissa L.; Burke, Laura M.; Mccarty, Steven L.; Hack, Kurt J.; Whitley, Ryan J.; Davis, Diane C.; Ocampo, Cesar

    2017-01-01

    This paper captures trajectory analysis of a representative low thrust, high power Solar Electric Propulsion (SEP) vehicle to move a mass around cis-lunar space in the range of 20 to 40 kW power to the Electric Propulsion (EP) system. These cis-lunar transfers depart from a selected Near Rectilinear Halo Orbit (NRHO) and target other cis-lunar orbits. The NRHO cannot be characterized in the classical two-body dynamics more familiar in the human spaceflight community, and the use of low thrust orbit transfers provides unique analysis challenges. Among the target orbit destinations documented in this paper are transfers between a Southern and Northern NRHO, transfers between the NRHO and a Distant Retrograde Orbit (DRO) and a transfer between the NRHO and two different Earth Moon Lagrange Point 2 (EML2) Halo orbits. Because many different NRHOs and EML2 halo orbits exist, simplifying assumptions rely on previous analysis of orbits that meet current abort and communication requirements for human mission planning. Investigation is done into the sensitivities of these low thrust transfers to EP system power. Additionally, the impact of the Thrust to Weight ratio of these low thrust SEP systems and the ability to transit between these unique orbits are investigated.

  15. Generation of cloned mice and nuclear transfer embryonic stem cell lines from urine-derived cells.

    PubMed

    Mizutani, Eiji; Torikai, Kohei; Wakayama, Sayaka; Nagatomo, Hiroaki; Ohinata, Yasuhide; Kishigami, Satoshi; Wakayama, Teruhiko

    2016-04-01

    Cloning animals by nuclear transfer provides the opportunity to preserve endangered mammalian species. However, there are risks associated with the collection of donor cells from the body such as accidental injury to or death of the animal. Here, we report the production of cloned mice from urine-derived cells collected noninvasively. Most of the urine-derived cells survived and were available as donors for nuclear transfer without any pretreatment. After nuclear transfer, 38-77% of the reconstructed embryos developed to the morula/blastocyst, in which the cell numbers in the inner cell mass and trophectoderm were similar to those of controls. Male and female cloned mice were delivered from cloned embryos transferred to recipient females, and these cloned animals grew to adulthood and delivered pups naturally when mated with each other. The results suggest that these cloned mice had normal fertility. In additional experiments, 26 nuclear transfer embryonic stem cell lines were established from 108 cloned blastocysts derived from four mouse strains including inbreds and F1 hybrids with relatively high success rates. Thus, cells derived from urine, which can be collected noninvasively, may be used in the rescue of endangered mammalian species by using nuclear transfer without causing injury to the animal.

  16. Generation of cloned mice and nuclear transfer embryonic stem cell lines from urine-derived cells

    PubMed Central

    Mizutani, Eiji; Torikai, Kohei; Wakayama, Sayaka; Nagatomo, Hiroaki; Ohinata, Yasuhide; Kishigami, Satoshi; Wakayama, Teruhiko

    2016-01-01

    Cloning animals by nuclear transfer provides the opportunity to preserve endangered mammalian species. However, there are risks associated with the collection of donor cells from the body such as accidental injury to or death of the animal. Here, we report the production of cloned mice from urine-derived cells collected noninvasively. Most of the urine-derived cells survived and were available as donors for nuclear transfer without any pretreatment. After nuclear transfer, 38–77% of the reconstructed embryos developed to the morula/blastocyst, in which the cell numbers in the inner cell mass and trophectoderm were similar to those of controls. Male and female cloned mice were delivered from cloned embryos transferred to recipient females, and these cloned animals grew to adulthood and delivered pups naturally when mated with each other. The results suggest that these cloned mice had normal fertility. In additional experiments, 26 nuclear transfer embryonic stem cell lines were established from 108 cloned blastocysts derived from four mouse strains including inbreds and F1 hybrids with relatively high success rates. Thus, cells derived from urine, which can be collected noninvasively, may be used in the rescue of endangered mammalian species by using nuclear transfer without causing injury to the animal. PMID:27033801

  17. Convective mass transfer around a dissolving bubble

    NASA Astrophysics Data System (ADS)

    Duplat, Jerome; Grandemange, Mathieu; Poulain, Cedric

    2017-11-01

    Heat or mass transfer around an evaporating drop or condensing vapor bubble is a complex issue due to the interplay between the substrate properties, diffusion- and convection-driven mass transfer, and Marangoni effects, to mention but a few. In order to disentangle these mechanisms, we focus here mainly on the convective mass transfer contribution in an isothermal mass transfer problem. For this, we study the case of a millimetric carbon dioxide bubble which is suspended under a substrate and dissolved into pure liquid water. The high solubility of CO2 in water makes the liquid denser and promotes a buoyant-driven flow at a high (solutal) Rayleigh number (Ra˜104 ). The alteration of p H allows the concentration field in the liquid to be imaged by laser fluorescence enabling us to measure both the global mass flux (bubble volume, contact angle) and local mass flux around the bubble along time. After a short period of mass diffusion, where the boundary layer thickens like the square root of time, convection starts and the CO2 is carried by a plume falling at constant velocity. The boundary layer thickness then reaches a plateau which depends on the bubble cross section. Meanwhile the plume velocity scales like (dV /d t )1 /2 with V being the volume of the bubble. As for the rate of volume loss, we recover a constant mass flux in the diffusion-driven regime followed by a decrease in the volume V like V2 /3 after convection has started. We present a model which agrees well with the bubble dynamics and discuss our results in the context of droplet evaporation, as well as high Rayleigh convection.

  18. Controlling the column spacing in isothermal magnetic advection to enable tunable heat and mass transfer.

    DOE PAGES

    Solis, Kyle Jameson; Martin, James E.

    2012-11-01

    Isothermal magnetic advection is a recently discovered method of inducing highly organized, non-contact flow lattices in suspensions of magnetic particles, using only uniform ac magnetic fields of modest strength. The initiation of these vigorous flows requires neither a thermal gradient nor a gravitational field and so can be used to transfer heat and mass in circumstances where natural convection does not occur. These advection lattices are comprised of a square lattice of antiparallel flow columns. If the column spacing is sufficiently large compared to the column length, and the flow rate within the columns is sufficiently large, then one wouldmore » expect efficient transfer of both heat and mass. Otherwise, the flow lattice could act as a countercurrent heat exchanger and only mass will be efficiently transferred. Although this latter case might be useful for feeding a reaction front without extracting heat, it is likely that most interest will be focused on using IMA for heat transfer. In this paper we explore the various experimental parameters of IMA to determine which of these can be used to control the column spacing. These parameters include the field frequency, strength, and phase relation between the two field components, the liquid viscosity and particle volume fraction. We find that the column spacing can easily be tuned over a wide range, to enable the careful control of heat and mass transfer.« less

  19. 2D modeling of direct laser metal deposition process using a finite particle method

    NASA Astrophysics Data System (ADS)

    Anedaf, T.; Abbès, B.; Abbès, F.; Li, Y. M.

    2018-05-01

    Direct laser metal deposition is one of the material additive manufacturing processes used to produce complex metallic parts. A thorough understanding of the underlying physical phenomena is required to obtain a high-quality parts. In this work, a mathematical model is presented to simulate the coaxial laser direct deposition process tacking into account of mass addition, heat transfer, and fluid flow with free surface and melting. The fluid flow in the melt pool together with mass and energy balances are solved using the Computational Fluid Dynamics (CFD) software NOGRID-points, based on the meshless Finite Pointset Method (FPM). The basis of the computations is a point cloud, which represents the continuum fluid domain. Each finite point carries all fluid information (density, velocity, pressure and temperature). The dynamic shape of the molten zone is explicitly described by the point cloud. The proposed model is used to simulate a single layer cladding.

  20. Temperature-difference-driven mass transfer through the vapor from a cold to a warm liquid.

    PubMed

    Struchtrup, Henning; Kjelstrup, Signe; Bedeaux, Dick

    2012-06-01

    Irreversible thermodynamics provides interface conditions that yield temperature and chemical potential jumps at phase boundaries. The interfacial jumps allow unexpected transport phenomena, such as the inverted temperature profile [Pao, Phys. Fluids 14, 306 (1971)] and mass transfer from a cold to a warm liquid driven by a temperature difference across the vapor phase [Mills and Phillips, Chem. Phys. Lett. 372, 615 (2002)]. Careful evaluation of the thermodynamic laws has shown [Bedeaux et al., Physica A 169, 263 (1990)] that the inverted temperature profile is observed for processes with a high heat of vaporization. In this paper, we show that cold to warm mass transfer through the vapor from a cold to a warm liquid is only possible when the heat of evaporation is sufficiently small. A necessary criterium for the size of the mass transfer coefficient is given.

  1. Influence of fluid dynamic conditions on enzymatic hydrolysis of lignocellulosic biomass: Effect of mass transfer rate.

    PubMed

    Wojtusik, Mateusz; Zurita, Mauricio; Villar, Juan C; Ladero, Miguel; Garcia-Ochoa, Felix

    2016-09-01

    The effect of fluid dynamic conditions on enzymatic hydrolysis of acid pretreated corn stover (PCS) has been assessed. Runs were performed in stirred tanks at several stirrer speed values, under typical conditions of temperature (50°C), pH (4.8) and solid charge (20% w/w). A complex mixture of cellulases, xylanases and mannanases was employed for PCS saccharification. At low stirring speeds (<150rpm), estimated mass transfer coefficients and rates, when compared to chemical hydrolysis rates, lead to results that clearly show low mass transfer rates, being this phenomenon the controlling step of the overall process rate. However, for stirrer speed from 300rpm upwards, the overall process rate is controlled by hydrolysis reactions. The ratio between mass transfer and overall chemical reaction rates changes with time depending on the conditions of each run. Copyright © 2016 Elsevier Ltd. All rights reserved.

  2. Mass transfer from an oscillating microsphere.

    PubMed

    Zhu, Jiahua; Zheng, Feng; Laucks, Mary L; Davis, E James

    2002-05-15

    The enhancement of mass transfer from single oscillating aerocolloidal droplets having initial diameters approximately 40 microm has been measured using electrodynamic levitation to trap and oscillate a droplet evaporating in nitrogen gas. The frequency and amplitude of the oscillation were controlled by means of ac and dc fields applied to the ring electrodes of the electrodynamic balance (EDB). Elastic light scattering was used to size the droplet. It is shown that the mass transfer process for a colloidal or aerocolloidal particle oscillating in the Stokes flow regime is governed by a Peclet number for oscillation and a dimensionless oscillation parameter that represents the ratio of the diffusion time scale to the oscillation time scale. Evaporation rates are reported for stably oscillating droplets that are as much as five times the rate for evaporation in a stagnant gas. The enhancement is substantially larger than that predicted by quasi-steady-flow mass transfer.

  3. Improving microalgal growth with small bubbles in a raceway pond with swing gas aerators.

    PubMed

    Yang, Zongbo; Cheng, Jun; Liu, Jianzhong; Zhou, Junhu; Cen, Kefa

    2016-09-01

    A novel swing gas aerator was developed to generate small bubbles for improving the mass transfer coefficient and microalgal growth rate in a raceway pond. A high-speed photography system (HSP) was used to measure the bubble diameter and generation time, and online precise dissolved oxygen probes and pH probes were used to measure the mass transfer coefficient and mixing time. Bubble generation time and diameter decreased by 21% and 9%, respectively, when rubber gas aerators were swung in the microalgae solution. When water pump power and gas aeration rate increased in a raceway pond with swing gas aerators and oscillating baffles (SGAOB), bubble generation time and diameter decreased but solution velocity and mass transfer coefficient increased. The mass transfer coefficient increased by 25% and the solution velocity increased by 11% when SGAOB was used, and the microalgal biomass yield increased by 18%. Copyright © 2016 Elsevier Ltd. All rights reserved.

  4. Determination of volumetric gas-liquid mass transfer coefficient of carbon monoxide in a batch cultivation system using kinetic simulations.

    PubMed

    Jang, Nulee; Yasin, Muhammad; Park, Shinyoung; Lovitt, Robert W; Chang, In Seop

    2017-09-01

    A mathematical model of microbial kinetics was introduced to predict the overall volumetric gas-liquid mass transfer coefficient (k L a) of carbon monoxide (CO) in a batch cultivation system. The cell concentration (X), acetate concentration (C ace ), headspace gas (N co and [Formula: see text] ), dissolved CO concentration in the fermentation medium (C co ), and mass transfer rate (R) were simulated using a variety of k L a values. The simulated results showed excellent agreement with the experimental data for a k L a of 13/hr. The C co values decreased with increase in cultivation times, whereas the maximum mass transfer rate was achieved at the mid-log phase due to vigorous microbial CO consumption rate higher than R. The model suggested in this study may be applied to a variety of microbial systems involving gaseous substrates. Copyright © 2017 Elsevier Ltd. All rights reserved.

  5. Influence of external mass transfer limitation on apparent kinetic parameters of penicillin G acylase immobilized on nonporous ultrafine silica particles.

    PubMed

    Kheirolomoom, Azadeh; Khorasheh, Farhad; Fazelinia, Hossein

    2002-01-01

    Immobilization of enzymes on nonporous supports provides a suitable model for investigating the effect of external mass transfer limitation on the reaction rate in the absence of internal diffusional resistance. In this study, deacylation of penicillin G was investigated using penicillin acylase immobilized on ultrafine silica particles. Kinetic studies were performed within the low-substrate-concentration region, where the external mass transfer limitation becomes significant. To predict the apparent kinetic parameters and the overall effectiveness factor, knowledge of the external mass transfer coefficient, k(L)a, is necessary. Although various correlations exist for estimation of k(L)a, in this study, an optimization scheme was utilized to obtain this coefficient. Using the optimum values of k(L)a, the initial reaction rates were predicted and found to be in good agreement with the experimental data.

  6. Fem Formulation for Heat and Mass Transfer in Porous Medium

    NASA Astrophysics Data System (ADS)

    Azeem; Soudagar, Manzoor Elahi M.; Salman Ahmed, N. J.; Anjum Badruddin, Irfan

    2017-08-01

    Heat and mass transfer in porous medium can be modelled using three partial differential equations namely, momentum equation, energy equation and mass diffusion. These three equations are coupled to each other by some common terms that turn the whole phenomenon into a complex problem with inter-dependable variables. The current article describes the finite element formulation of heat and mass transfer in porous medium with respect to Cartesian coordinates. The problem under study is formulated into algebraic form of equations by using Galerkin's method with the help of two-node linear triangular element having three nodes. The domain is meshed with smaller sized elements near the wall region and bigger size away from walls.

  7. Physical and Theoretical Models of Heat Pollution Applied to Cramped Conditions Welding Taking into Account the Different Types of Heat

    NASA Astrophysics Data System (ADS)

    Bulygin, Y. I.; Koronchik, D. A.; Legkonogikh, A. N.; Zharkova, M. G.; Azimova, N. N.

    2017-05-01

    The standard k-epsilon turbulence model, adapted for welding workshops, equipped with fixed workstations with sources of pollution took into account only the convective component of heat transfer, which is quite reasonable for large-volume rooms (with low density distribution of sources of pollution) especially the results of model calculations taking into account only the convective component correlated well with experimental data. For the purposes of this study, when we are dealing with a small confined space where necessary to take account of the body heated to a high temperature (for welding), located next to each other as additional sources of heat, it can no longer be neglected radiative heat exchange. In the task - to experimentally investigate the various types of heat transfer in a limited closed space for welding and behavior of a mathematical model, describing the contribution of the various components of the heat exchange, including radiation, influencing the formation of fields of concentration, temperature, air movement and thermal stress in the test environment. Conducted field experiments to model cubic body, allowing you to configure and debug the model of heat and mass transfer processes with the help of the developed approaches, comparing the measurement results of air flow velocity and temperature with the calculated data showed qualitative and quantitative agreement between process parameters, that is an indicator of the adequacy of heat and mass transfer model.

  8. Modeling pH-zone refining countercurrent chromatography: a dynamic approach.

    PubMed

    Kotland, Alexis; Chollet, Sébastien; Autret, Jean-Marie; Diard, Catherine; Marchal, Luc; Renault, Jean-Hugues

    2015-04-24

    A model based on mass transfer resistances and acid-base equilibriums at the liquid-liquid interface was developed for the pH-zone refining mode when it is used in countercurrent chromatography (CCC). The binary separation of catharanthine and vindoline, two alkaloids used as starting material for the semi-synthesis of chemotherapy drugs, was chosen for the model validation. Toluene/CH3CN/water (4/1/5, v/v/v) was selected as biphasic solvent system. First, hydrodynamics and mass transfer were studied by using chemical tracers. Trypan blue only present in the aqueous phase allowed the determination of the parameters τextra and Pe for hydrodynamic characterization whereas acetone, which partitioned between the two phases, allowed the determination of the transfer parameter k0a. It was shown that mass transfer was improved by increasing both flow rate and rotational speed, which is consistent with the observed mobile phase dispersion. Then, the different transfer parameters of the model (i.e. the local transfer coefficient for the different species involved in the process) were determined by fitting experimental concentration profiles. The model accurately predicted both equilibrium and dynamics factors (i.e. local mass transfer coefficients and acid-base equilibrium constant) variation with the CCC operating conditions (cell number, flow rate, rotational speed and thus stationary phase retention). The initial hypotheses (the acid-base reactions occurs instantaneously at the interface and the process is mainly governed by mass transfer) are thus validated. Finally, the model was used as a tool for catharanthine and vindoline separation prediction in the whole experimental domain that corresponded to a flow rate between 20 and 60 mL/min and rotational speeds from 900 and 2100 rotation per minutes. Copyright © 2015 Elsevier B.V. All rights reserved.

  9. Influence of blade leading edge geometry and upstream blowing on the heat/mass transfer in a turbine cascade

    NASA Astrophysics Data System (ADS)

    Papa, Marco

    The effect of secondary flows on mass transfer from a simulated gas turbine blade and hubwall is investigated. Measurements performed using naphthalene sublimation provide non-dimensional mass transfer coefficients, in the form of Sherwood numbers, that can be converted to heat transfer coefficients through the use of an analogy. Tests are conducted in a linear cascade composed of five blades having the profile of a first stage rotor blade of a high-pressure turbine aircraft engine. Detailed mass transfer maps on the airfoil and endwall surfaces allow the identification of significant flow features that are in good agreement with existing secondary flow models. These results are well-suited for validation of numerical codes, as they are obtained with an accurate technique that does not suffer from conduction or radiation errors and allows the imposition of precise boundary conditions. The performance of a RANS (Reynolds Averaged Navier-Stokes) numerical code that simulates the flow and heat/mass transfer in the cascade using the SST (Shear Stress Transport) k-o model is evaluated through a comparison with the experimental results. Tests performed with a modified blade leading edge show that the introduction of a fillet at the junction with the endwall reduces the effects of the horseshoe vortex in the first part of the passage, while no measurable changes in mass transfer are observed further downstream. Air injected through a slot located upstream of the cascade simulates the engine wheelspace coolant injection between the stator and the rotor. Local mass transfer data obtained injecting naphthalene-free and naphthalene-saturated air are reduced to derive maps of cooling effectiveness on the blade and endwall. Oil dot tests show the surface flow on the endwall. The surface downstream of the gap is coplanar to the upstream surface in the baseline configuration and is shifted to form a forward and backward facing step to investigate the effects of component misalignments. Sufficiently high injection rates alter the structure of the secondary flows and significantly improve the cooling performance.

  10. LUT Reveals a New Mass-transferring Semi-detached Binary

    NASA Astrophysics Data System (ADS)

    Qian, S.-B.; Zhou, X.; Zhu, L.-Y.; Zejda, M.; Soonthornthum, B.; Zhao, E.-G.; Zhang, J.; Zhang, B.; Liao, W.-P.

    2015-12-01

    GQ Dra is a short-period eclipsing binary in a double stellar system that was discovered by Hipparcos. Complete light curves in the UV band were obtained with the Lunar-based Ultraviolet Telescope in 2014 November and December. Photometric solutions are determined using the W-D (Wilson and Devinney) method. It is discovered that GQ Dra is a classical Algol-type semi-detached binary where the secondary component is filling the critical Roche lobe. An analysis of all available times of minimum light suggests that the orbital period is increasing continuously at a rate of \\dot{P}=+3.48(+/- 0.23)× {10}-7 days yr-1. This could be explained by mass transfer from the secondary to the primary, which is in agreement with the semi-detached configuration with a lobe-filling secondary. By assuming a conservation of mass and angular momentum, the mass transfer rate is estimated as \\dot{m}=9.57(+/- 0.63)× {10}-8 {M}⊙ {{yr}}-1. All of these results reveal that GQ Dra is a mass-transferring semi-detached binary in a double system that was formed from an initially detached binary star. After the massive primary evolves to fill the critical Roche lobe, the mass transfer will be reversed and the binary will evolve into a contact configuration with two sub-giant or giant component stars.

  11. Three-dimensional Hydrodynamical Simulations of Mass Transfer in Binary Systems by a Free Wind

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Liu, Zheng-Wei; Stancliffe, Richard J.; Abate, Carlo

    A large fraction of stars in binary systems are expected to undergo mass and angular momentum exchange at some point in their evolution, which can drastically alter the chemical and dynamical properties and fates of the systems. Interaction by stellar wind is an important process in wide binaries. However, the details of wind mass transfer are still not well understood. We perform three-dimensional hydrodynamical simulations of wind mass transfer in binary systems to explore mass-accretion efficiencies and geometries of mass outflows, for a range of mass ratios from 0.05 to 1.0. In particular, we focus on the case of amore » free wind, in which some physical mechanism accelerates the expelled wind material balancing the gravity of the mass-losing star with the wind velocity comparable to the orbital velocity of the system. We find that the mass-accretion efficiency and accreted specific angular momentum increase with the mass ratio of the system. For an adiabatic wind, we obtain that the accretion efficiency onto the secondary star varies from about 0.1% to 8% for mass ratios between 0.05 and 1.0.« less

  12. Visualization of natural convection heat transfer on a sphere

    NASA Astrophysics Data System (ADS)

    Lee, Dong-Young; Chung, Bum-Jin

    2017-12-01

    Natural convection heat transfer phenomena on spheres were investigated by adopting mass transfer experiments based on analogy concept. The diameters of spheres were varied from 0.01 m to 0.12 m, which correspond to the Rayleigh numbers of 1.69×108-2.91×1011. The measured mass transfer coefficients agreed well with the existing correlations. The copper electroplating patterns on the spheres visualized the local heat transfer depending on angular distance. The streak plating patterns were observed on the upper part of the sphere, resulting from the wavy flow patterns caused by the instability.

  13. Seismic design of passive tuned mass damper parameters using active control algorithm

    NASA Astrophysics Data System (ADS)

    Chang, Chia-Ming; Shia, Syuan; Lai, Yong-An

    2018-07-01

    Tuned mass dampers are a widely-accepted control method to effectively reduce the vibrations of tall buildings. A tuned mass damper employs a damped harmonic oscillator with specific dynamic characteristics, thus the response of structures can be regulated by the additive dynamics. The additive dynamics are, however, similar to the feedback control system in active control. Therefore, the objective of this study is to develop a new tuned mass damper design procedure based on the active control algorithm, i.e., the H2/LQG control. This design facilitates the similarity of feedback control in the active control algorithm to determine the spring and damper in a tuned mass damper. Given a mass ratio between the damper and structure, the stiffness and damping coefficient of the tuned mass damper are derived by minimizing the response objective function of the primary structure, where the structural properties are known. Varying a single weighting in this objective function yields the optimal TMD design when the minimum peak in the displacement transfer function of the structure with the TMD is met. This study examines various objective functions as well as derives the associated equations to compute the stiffness and damping coefficient. The relationship between the primary structure and optimal tuned mass damper is parametrically studied. Performance is evaluated by exploring the h2-and h∞-norms of displacements and accelerations of the primary structure. In time-domain analysis, the damping effectiveness of the tune mass damper controlled structures is investigated under impulse excitation. Structures with the optimal tuned mass dampers are also assessed under seismic excitation. As a result, the proposed design procedure produces an effective tuned mass damper to be employed in a structure against earthquakes.

  14. The effect of microbubbles on gas-liquid mass transfer coefficient and degradation rate of COD in wastewater treatment.

    PubMed

    Yao, Kangning; Chi, Yong; Wang, Fei; Yan, Jianhua; Ni, Mingjiang; Cen, Kefa

    2016-01-01

    A commonly used aeration device at present has the disadvantages of low mass transfer rate because the generated bubbles are several millimeters in diameter which are much bigger than microbubbles. Therefore, the effect of a microbubble on gas-liquid mass transfer and wastewater treatment process was investigated. To evaluate the effect of each bubble type, the volumetric mass transfer coefficients for microbubbles and conventional bubbles were determined. The volumetric mass transfer coefficient was 0.02905 s(-1) and 0.02191 s(-1) at a gas flow rate of 0.67 L min(-1) in tap water for microbubbles and conventional bubbles, respectively. The degradation rate of simulated municipal wastewater was also investigated, using aerobic activated sludge and ozone. Compared with the conventional bubble generator, the chemical oxygen demand (COD) removal rate was 2.04, 5.9, 3.26 times higher than those of the conventional bubble contactor at the same initial COD concentration of COD 200 mg L(-1), 400 mg L(-1), and 600 mg L(-1), while aerobic activated sludge was used. For the ozonation process, the rate of COD removal using microbubble generator was 2.38, 2.51, 2.89 times of those of the conventional bubble generator. Based on the results, the effect of initial COD concentration on the specific COD degradation rate were discussed in different systems. Thus, the results revealed that microbubbles could enhance mass transfer in wastewater treatment and be an effective method to improve the degradation of wastewater.

  15. Mass transfer of hydrophobic organic chemicals between silicone sheets and through plant leaves and low-density polyethylene.

    PubMed

    Ahmadi, Hamid; Bolinius, Damien Johann; Jahnke, Annika; MacLeod, Matthew

    2016-12-01

    Plant leaves play an important role in the fate of hydrophobic organic contaminants (HOCs) in the environment. Yet much remains unknown about the permeability of leaves by HOCs. In this pilot study we measured (i) the kinetics of mass transfer of three polycyclic aromatic hydrocarbons (PAHs) and six polychlorinated biphenyls between a spiked and an unspiked sheet of polydimethylsiloxane (PDMS) in direct contact with each other for 24 h and (ii) kinetics of mass transfer of two PAHs through leaves and low-density polyethylene (LDPE) in a passive dosing experiment by inserting these matrices between the two sheets of PDMS for 48 h. The kinetics of mass transfer of fluoranthene between PDMS sheets in direct contact were a factor of 12 slower than those reported in the literature. The kinetics of mass transfer of fluorene and phenanthrene through leaves were within the range of those previously reported for 2,4-dichlorophenoxyacetic acid through isolated cuticles. Our results provide a proof-of-concept demonstration that the passive dosing method applied in this study can be used to measure the mass transfer coefficients of organic chemicals through leaves. Key recommendations for future experiments are to load the PDMS at the highest feasible concentrations to avoid working at analyte levels close to the limit of detection, to keep the leaves moist and to minimize potential pathways for contamination of the PDMS sheets by exposure to laboratory air. Copyright © 2016 The Authors. Published by Elsevier Ltd.. All rights reserved.

  16. The mechanism of thermal-gradient mass transfer in the sodium hydroxide-nickel system

    NASA Technical Reports Server (NTRS)

    May, Charles E

    1958-01-01

    "Thermal-gradient mass transfer" was investigated in the molten sodium hydroxide-nickel system. Possible mechanisms (physical, electrochemical, and chemical) are discussed in terms of experimental and theoretical evidence. Experimental details are included in appendixes.

  17. Local endwall heat/mass-transfer distributions in pin fin channels

    NASA Astrophysics Data System (ADS)

    Lau, S. C.; Kim, Y. S.; Han, J. C.

    1987-10-01

    Naphthalene sublimination experiments were conducted to study the effects of the pin configuration, the pin length-to-diameter ratio, and the entrance length on local endwall heat/mass transfer in a channel with short pin fins (pin length-to-diameter ratios of 0.5 and 1.0). The detailed distributions of the local endwall heat/mass-transfer coefficient were obtained for staggered and aligned arrays of pin fins, for the spanwise pin spacing-to-diameter ratio of 2.5, and for streamwise pin spacing-to-diameter ratios of 1.25 and 2.5. The Reynolds numbers were kept at about 33,000. Overall- and row-averaged Nusselt numbers compared very well with those from previous heat-transfer studies.

  18. Mathematical simulation of convective-radiative heat transfer in a ventilated rectangular cavity with consideration of internal mass transfer

    NASA Astrophysics Data System (ADS)

    Sheremet, M. A.; Shishkin, N. I.

    2012-07-01

    Mathematical simulation of the nonstationary regimes of heat-and-mass transfer in a ventilated rectangular cavity with heat-conducting walls of finite thickness in the presence of a heat-generating element of constant temperature has been carried out with account for the radiative heat transfer in the Rosseland approximation. As mechanisms of energy transfer in this cavity, the combined convection and the thermal radiation in the gas space of the cavity and the heat conduction in the elements of its fencing solid shell were considered. The mathematical model formulated in the dimensionless stream function-vorticity vector-temperature-concentration variables was realized numerically with the use of the finite-difference method. The streamline, temperature-field, and concentration distributions reflecting the influence of the Rayleigh number (Ra = 104, 105, 106), the nonstationarity (0 < τ ≤ 1000), and the optical thickness of the medium (τλ = 50, 100, 200) on the regimes of the gas flow and the heat-and-mass transfer in the cavity have been obtained.

  19. Heat And Mass Transfer Analysis of a Film Evaporative MEMS Tunable Array

    NASA Astrophysics Data System (ADS)

    O'Neill, William J.

    This thesis details the heat and mass transfer analysis of a MEMs microthruster designed to provide propulsive, attitude control and thermal control capabilities to a cubesat. This thruster is designed to function by retaining water as a propellant and applying resistive heating in order to increase the temperature of the liquid-vapor interface to either increase evaporation or induce boiling to regulate mass flow. The resulting vapor is then expanded out of a diverging nozzle to produce thrust. Because of the low operating pressure and small length scale of this thruster, unique forms of mass transfer analysis such as non-continuum gas flow were modeled using the Direct Simulation Monte Carlo method. Continuum fluid/thermal simulations using COMSOL Multiphysics have been applied to model heat and mass transfer in the solid and liquid portions of the thruster. The two methods were coupled through variables at the liquid-vapor interface and solved iteratively by the bisection method. The simulations presented in this thesis confirm the thermal valving concept. It is shown that when power is applied to the thruster there is a nearly linear increase in mass flow and thrust. Thus, mass flow can be regulated by regulating the applied power. This concept can also be used as a thermal control device for spacecraft.

  20. Pattern formation and mass transfer under stationary solutal Marangoni instability.

    PubMed

    Schwarzenberger, Karin; Köllner, Thomas; Linde, Hartmut; Boeck, Thomas; Odenbach, Stefan; Eckert, Kerstin

    2014-04-01

    According to the seminal theory by Sternling and Scriven, solutal Marangoni convection during mass transfer of surface-active solutes may occur as either oscillatory or stationary instability. With strong support of Manuel G. Velarde, a combined initiative of experimental works, in particular to mention those of Linde, Wierschem and coworkers, and theory has enabled a classification of dominant wave types of the oscillatory mode and their interactions. In this way a rather comprehensive understanding of the nonlinear evolution of the oscillatory instability could be achieved. A comparably advanced state-of-the-art with respect to the stationary counterpart seemed to be out of reach a short time ago. Recent developments on both the numerical and experimental side, in combination with assessing an extensive number of older experiments, now allow one to draw a more unified picture. By reviewing these works, we show that three main building blocks exist during the nonlinear evolution: roll cells, relaxation oscillations and relaxation oscillations waves. What is frequently called interfacial turbulence results from the interaction between these partly coexisting basic patterns which may additionally occur in different hierarchy levels. The second focus of this review lies on the practical importance of such convection patterns concerning their influence on mass transfer characteristics. Particular attention is paid here to the interaction between Marangoni and buoyancy effects which frequently complicates the pattern formation even more. To shed more light on these dependencies, new simulations regarding the limiting case of stabilizing density stratification and vanishing buoyancy are incorporated. Copyright © 2013 Elsevier B.V. All rights reserved.

  1. Partially-irreversible sorption of formaldehyde in five polymers

    NASA Astrophysics Data System (ADS)

    Ye, Wei; Cox, Steven S.; Zhao, Xiaomin; Frazier, Charles E.; Little, John C.

    2014-12-01

    Due to its environmental ubiquity and concern over its potential toxicity, the mass-transfer characteristics of formaldehyde are of critical importance to indoor air quality research. Previous studies have suggested that formaldehyde mass transfer in polymer is partially irreversible. In this study, mechanisms that could cause the observed irreversibility were investigated. Polycarbonate and four other polymeric matrices were selected and subjected to formaldehyde sorption/desorption cycles. Mass transfer of formaldehyde was partially irreversible in all cases, and three potential mechanisms were evaluated. First, attenuated total reflectance Fourier transform infrared spectroscopy (ATR-FTIR) analysis was used to investigate possible formaldehyde polymerization on polymer surfaces. ATR-FTIR showed no detectable paraformaldehyde or formaldehyde on the film surfaces that had been exposed to formaldehyde and air. ATR-FTIR did detect aliphatic acids suggesting oxidation had occurred on film surfaces as a result of exposure to formaldehyde. However, additional study suggested that air is not the primary cause for irreversibility. Second, statistical physics theory was tested as a possible explanation. According to this theory, reversible and irreversible sorption could be taking place simultaneously. The irreversible fraction should be constant during sorption and the fraction could be determined by performing a complete sorption/desorption test. The sorption/desorption data was consistent with this theory. Third, chemisorption was considered as another possible cause for irreversibility. Extraction/fluorimetry testing of post-sorption and post-desorption polymer films showed measurable quantities of formaldehyde suggesting that some of the chemisorbed formaldehyde was reversible at the higher extraction temperature. Further quantitative study on chemical reaction products is needed.

  2. An Experiment to Introduce Mass Transfer Concepts Using a Commercial Hollow Fiber Blood Oxygenator

    ERIC Educational Resources Information Center

    McIver, Keith; Merrill, Thomas; Farrell, Stephanie

    2017-01-01

    A commercial hollow fiber blood oxygenation laboratory experiment was used to introduce lower level engineering students to mass balances in a two-phase system. Using measured values of concentration and flow rate, students calculated the rate of mass transfer from the gas phase and into the liquid phase, and compared the two values to determine…

  3. Effect of acoustic streaming on the mass transfer from a sublimating sphere

    NASA Astrophysics Data System (ADS)

    Kawahara, N.; Yarin, A. L.; Brenn, G.; Kastner, O.; Durst, F.

    2000-04-01

    The effect of the acoustic streaming on the mass transfer from the surface of a sphere positioned in an ultrasonic acoustic levitator is studied both experimentally and theoretically. Acoustic levitation using standing ultrasonic waves is an experimental tool for studying the heat and mass transfer from small solid or liquid samples, because it allows an almost steady positioning of a sample at a fixed location in space. However, the levitator introduces some difficulties. One of the main problems with acoustic levitation is that an acoustic streaming is induced near the sample surface, which affects the heat and mass transfer rates, as characterized by increased Nusselt and Sherwood numbers. The transfer rates are not uniform along the sample surface, and the aim of the present study is to quantify the spatial Sherwood number distribution over the surface of a sphere. The experiments are based on the measurement of the surface shape of a sphere layered with a solid substance as a function of time using a charge-coupled device (CCD) camera with backlighting. The sphere used in this research is a glass sphere layered with a volatile solid substance (naphthalene or camphor). The local mass transfer from the surface both with and without an ultrasonic acoustic field is investigated in order to evaluate the effect of the acoustic streaming. The experimental results are compared with predictions following from the theory outlined [A. L. Yarin, M. Pfaffenlehner, and C. Tropea, J. Fluid Mech. 356, 65 (1998); A. L. Yarin, G. Brenn, O. Kastner, D. Rensink, and C. Tropea, ibid. 399, 151 (1999)] which describes the acoustic field and the resulting acoustic streaming, and the mass transfer at the surface of particles and droplets located in an acoustic levitator. The results are also compared with the experimental data and with the theoretical predictions of Burdukov and Nakoryakov [J. Appl. Mech. Tech. Phys. 6, 51 (1965)], which are valid only in the case of spherical particles much smaller than the sound wavelength. Good agreement between experiment and the theory of Yarin et al. is demonstrated. The time-averaged heat and mass transfer rates over a sphere surface are greatest at the sphere's equator and least at its poles in the experiment as predicted by the theory (the ultrasonic standing wave spans the vertical axis passing through the poles). The measured distribution of the mass transfer rate over the sphere surface also agrees with the theoretical predictions, which shows that in strong acoustic fields sublimation (or evaporation) results from the acoustic streaming.

  4. X-Ray Spectra from MHD Simulations of Accreting Black Holes

    NASA Technical Reports Server (NTRS)

    Schnittman, Jeremy D.; Noble, Scott C.; Krolik, Julian H.

    2011-01-01

    We present new global calculations of X-ray spectra from fully relativistic magneto-hydrodynamic (MHO) simulations of black hole (BH) accretion disks. With a self consistent radiative transfer code including Compton scattering and returning radiation, we can reproduce the predominant spectral features seen in decades of X-ray observations of stellar-mass BHs: a broad thermal peak around 1 keV, power-law continuum up to >100 keV, and a relativistically broadened iron fluorescent line. By varying the mass accretion rate, different spectral states naturally emerge: thermal-dominant, steep power-law, and low/hard. In addition to the spectral features, we briefly discuss applications to X-ray timing and polarization.

  5. Modeling of cryopreservation of engineered tissues with one-dimensional geometry.

    PubMed

    Cui, Z F; Dykhuizen, R C; Nerem, R M; Sembanis, A

    2002-01-01

    Long-term storage of engineered bio-artificial tissues is required to ensure the off-the-shelf availability to clinicians due to their long production cycle. Cryopreservation is likely the choice for long-term preservation. Although the cryopreservation of cells is well established for many cell types, cryopreservation of tissues is far more complicated. Cells at different locations in the tissue could experience very different local environmental changes, i.e., the change of concentration of cryoprotecting chemicals (CPA) and temperature, during the addition/removal of CPA and cooling/warming, which leads to nonuniformity in cell survival in the tissue. This is due to the limitation of mass and heat transfer within the tissue. A specific aim of cryopreservation of tissue is to ensure a maximum recovery of cells and their functionality throughout a tissue. Cells at all locations should be protected adequately by the CPA and frozen at rates conducive to survival. It is hence highly desirable to know the cell transient and final states during cryopreservation within the whole tissue, which can be best studied by mathematical modeling. In this work, a model framework for cryopreservation of one-dimensional artificial tissues is developed on the basis of solving the coupled equations to describe the mass and heat transfer within the tissue and osmotic transport through the cell membrane. Using an artificial pancreas as an example, we carried out a simulation to examine the temperature history, cell volume, solute redistribution, and other state parameters during the freezing of the spherical heterogeneous construct (a single bead). It is found that the parameters affecting the mass transfer of CPA in tissue and through the cell membrane and the freezing rate play dominant roles in affecting the cell volume transient and extracellular ice formation. Thermal conductivity and extracellular ice formation kinetics, on the other hand, have little effect on cell transient and final states, as the heat transfer rate is much faster than mass diffusion. The outcome of such a model study can be used to evaluate the construct design on its survivability during cryopreservation and to select a cryopreservation protocol to achieve maximum cell survival.

  6. Simulations and Measurements of Human Middle Ear Vibrations Using Multi-Body Systems and Laser-Doppler Vibrometry with the Floating Mass Transducer.

    PubMed

    Böhnke, Frank; Bretan, Theodor; Lehner, Stefan; Strenger, Tobias

    2013-10-22

    The transfer characteristic of the human middle ear with an applied middle ear implant (floating mass transducer) is examined computationally with a Multi-body System approach and compared with experimental results. For this purpose, the geometry of the middle ear was reconstructed from μ-computer tomography slice data and prepared for a Multi-body System simulation. The transfer function of the floating mass transducer, which is the ratio of the input voltage and the generated force, is derived based on a physical context. The numerical results obtained with the Multi-body System approach are compared with experimental results by Laser Doppler measurements of the stapes footplate velocities of five different specimens. Although slightly differing anatomical structures were used for the calculation and the measurement, a high correspondence with respect to the course of stapes footplate displacement along the frequency was found. Notably, a notch at frequencies just below 1 kHz occurred. Additionally, phase courses of stapes footplate displacements were determined computationally if possible and compared with experimental results. The examinations were undertaken to quantify stapes footplate displacements in the clinical practice of middle ear implants and, also, to develop fitting strategies on a physical basis for hearing impaired patients aided with middle ear implants.

  7. Experimental assessment of heat and mass transfer of modular nozzles of cooling towers

    NASA Astrophysics Data System (ADS)

    Merentsov, N. A.; Lebedev, V. N.; Golovanchikov, A. B.; Balashov, V. A.; Nefed'eva, E. E.

    2018-01-01

    Data of experimental study of hydrodynamics, heat and mass transfer of modular nozzles of cooling towers and some comparative characteristics of the packed device with nozzles, which have wide industrial application, are given in the article.

  8. New method for mass transfer across the surface of non-spherical particles in turbulence

    NASA Astrophysics Data System (ADS)

    Oehmke, T.; Variano, E. A.

    2016-12-01

    We present a method for making model particles that allow for the interfacial mass transfer rate to be measured. This is similar to traditional use of gypsum plaster used to measure erosion rates on the timescale of weeks to years. Our new method is useful for measuring erosion rates on the timescale of minutes. We use this to measure the manner in which particle shape affects its rate of dissolution in turbulent flow. The related questions are relevant to mass transfer in turbulence, e.g. in cases of marine biology and pollution by microplastics.

  9. Mass transfer apparatus and method for separation of gases

    DOEpatents

    Blount, Gerald C.

    2015-10-13

    A process and apparatus for separating components of a source gas is provided in which more soluble components of the source gas are dissolved in an aqueous solvent at high pressure. The system can utilize hydrostatic pressure to increase solubility of the components of the source gas. The apparatus includes gas recycle throughout multiple mass transfer stages to improve mass transfer of the targeted components from the liquid to gas phase. Separated components can be recovered for use in a value added application or can be processed for long-term storage, for instance in an underwater reservoir.

  10. Intensification of heat and mass transfer by ultrasound: application to heat exchangers and membrane separation processes.

    PubMed

    Gondrexon, N; Cheze, L; Jin, Y; Legay, M; Tissot, Q; Hengl, N; Baup, S; Boldo, P; Pignon, F; Talansier, E

    2015-07-01

    This paper aims to illustrate the interest of ultrasound technology as an efficient technique for both heat and mass transfer intensification. It is demonstrated that the use of ultrasound results in an increase of heat exchanger performances and in a possible fouling monitoring in heat exchangers. Mass transfer intensification was observed in the case of cross-flow ultrafiltration. It is shown that the enhancement of the membrane separation process strongly depends on the physico-chemical properties of the filtered suspensions. Copyright © 2014 Elsevier B.V. All rights reserved.

  11. Mass transfer apparatus and method for separation of gases

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Blount, Gerald C.; Gorensek, Maximilian Boris; Hamm, Luther L.

    A process and apparatus for separating components of a source gas is provided in which more soluble components of the source gas are dissolved in an aqueous solvent at high pressure. The system can utilize hydrostatic pressure to increase solubility of the components of the source gas. The apparatus includes gas recycle throughout multiple mass transfer stages to improve mass transfer of the targeted components from the liquid to gas phase. Separated components can be recovered for use in a value added application or can be processed for long-term storage, for instance in an underwater reservoir.

  12. The Multi-Scale Mass Transfer Processes Controlling Natural Attenuation and Engineered Remediation: An IFC Focused on Hanford’s 300 Area Uranium Plume Quality Assurance Project Plan

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Fix, N. J.

    The purpose of the project is to conduct research at an Integrated Field-Scale Research Challenge Site in the Hanford Site 300 Area, CERCLA OU 300-FF-5 (Figure 1), to investigate multi-scale mass transfer processes associated with a subsurface uranium plume impacting both the vadose zone and groundwater. The project will investigate a series of science questions posed for research related to the effect of spatial heterogeneities, the importance of scale, coupled interactions between biogeochemical, hydrologic, and mass transfer processes, and measurements/approaches needed to characterize a mass-transfer dominated system. The research will be conducted by evaluating three (3) different hypotheses focused onmore » multi-scale mass transfer processes in the vadose zone and groundwater, their influence on field-scale U(VI) biogeochemistry and transport, and their implications to natural systems and remediation. The project also includes goals to 1) provide relevant materials and field experimental opportunities for other ERSD researchers and 2) generate a lasting, accessible, and high-quality field experimental database that can be used by the scientific community for testing and validation of new conceptual and numerical models of subsurface reactive transport.« less

  13. The effect of arsenic chemical form and mixing regime on arsenic mass transfer from soil to magnetite.

    PubMed

    Yang, Kyung; Kim, Byung-Chul; Nam, Kyoungphile; Choi, Yongju

    2017-03-01

    This study investigated the effect of chemical forms of arsenic (As) and soil-magnetite mixing regimes on As mass transfer in magnetite-amended soil. Two soil samples with different component ratios of As chemical forms were prepared. In the absence of magnetite, the amount of desorbable As was strongly dependent on the fraction of easily extractable As in soil. Contact of the soils with magnetite in a slurry phase significantly reduced soil As concentration for both soils. Changes in As concentrations in soil, magnetite, and water by the slurry phase contact were simulated using an As mass transfer model. The model parameters were determined independently for each process of As soil desorption and magnetite sorption. The experimentally measured As mass transfer from soil to magnetite was significantly greater than the simulation result. By sequential extraction, it was observed that the soil As concentration was significantly reduced not only for easily extractable As, but also for relatively strongly bound forms of As. Enclosing the magnetite in a dialysis bag substantially limited the As mass transfer from soil to magnetite. These results suggest that improving the mixture between Fe oxides and soils can facilitate the effectiveness of As stabilization using Fe oxides.

  14. The ultrasonic-enhanced factor of mass-transfer coefficient in the supercritical carbon dioxide extraction

    NASA Astrophysics Data System (ADS)

    Luo, Benyi; Lu, Yigang

    2008-10-01

    Based on several hypotheses about the process of supercritical carbon dioxide extraction, the onflow around the solute granule is figured out by the Navier-Stocks equation. In combination with the Higbie’s solute infiltration model, the link between the mass-transfer coefficient and the velocity of flow is found. The mass-transfer coefficient with the ultrasonical effect is compared with that without the ultrasonical effect, and then a new parameter named the ultrasonic-enhanced factor of mass-transfer coefficient is brought forward, which describes the mathematical model of the supercritical carbon dioxide extraction process enhanced by ultrasonic. The model gives out the relationships among the ultrasonical power, the ultrasonical frequency, the radius of solute granule and the ultrasonic-enhanced factor of mass-transfer coefficient. The results calculated by this model fit well with the experimental data, including the extraction of Coix Lacryma-jobi Seed Oil (CLSO) and Coix Lacryma-jobi Seed Ester (CLSE) from coix seeds and the extraction of Eicosapentaenoic Acid (EPA) and Docosahexaenoic Acid (DHA) from the alga by means of the ultrasonic-enhanced supercritical carbon dioxide extraction (USFE) and the supercritical carbon dioxide extraction (SFE) respectively. This proves the rationality of the ultrasonic-enhanced factor model. The model provides a theoretical basis for the application of ultrasonic-enhanced supercritical fluid extraction technique.

  15. Lightweight acoustic treatments for aerospace applications

    NASA Astrophysics Data System (ADS)

    Naify, Christina Jeanne

    2011-12-01

    Increase in the use of composites for aerospace applications has the benefit of decreased structural weight, but at the cost of decreased acoustic performance. Stiff, lightweight structures (such as composites) are traditionally not ideal for acoustic insulation applications because of high transmission loss at low frequencies. A need has thus arisen for effective sound insulation materials for aerospace and automotive applications with low weight addition. Current approaches, such as the addition of mass law dominated materials (foams) also perform poorly when scaled to small thickness and low density. In this dissertation, methods which reduce sound transmission without adding significant weight are investigated. The methods presented are intended to be integrated into currently used lightweight structures such as honeycomb sandwich panels and to cover a wide range of frequencies. Layering gasses of differing acoustic impedances on a panel substantially reduced the amount of sound energy transmitted through the panel with respect to the panel alone or an equivalent-thickness single species gas layer. The additional transmission loss derives from successive impedance mismatches at the interfaces between gas layers and the resulting inefficient energy transfer. Attachment of additional gas layers increased the transmission loss (TL) by as much as 17 dB at high (>1 kHz) frequencies. The location and ordering of the gasses with respect to the panel were important factors in determining the magnitude of the total TL. Theoretical analysis using a transfer matrix method was used to calculate the frequency dependence of sound transmission for the different configurations tested. The method accurately predicted the relative increases in TL observed with the addition of different gas layer configurations. To address low-frequency sound insulation, membrane-type locally resonant acoustic materials (LRAM) were fabricated, characterized, and analyzed to understand their acoustic response. Acoustic metamaterials with negative dynamic mass density have been shown to demonstrate a significant (5x) increase in TL over mass law predictions for a narrow band (100Hz) at low frequencies (100--1000Hz). The peak TL frequency can be tuned to specific values by varying the membrane and mass properties. TL magnitude as a function of frequency was measured for variations of the mass magnitude and membrane tension using an impedance tube setup. The dynamic properties of membranes constructed from different materials and thicknesses were measured and compared to the results of coupled field acoustic-structural finite element analysis (FEA) modeling to understand the role of tension and element quality factor. To better comprehend the mechanism(s) responsible for the TL peak, a laser vibrometer was used to map the out-of-plane dynamic response of the structure under acoustic loading at discrete frequencies. Negative dynamic mass was experimentally demonstrated at the peak TL frequency. The scale-up of the acoustic metamaterial structure was explored by examining the behavior of multiple elements arranged in arrays. Single membranes were stretched over rigid frame supports and masses were attached to the center of each divided cell. TL behavior was measured for multiple configurations with different magnitudes of mass distributed across each of the cell membranes in the array resulting in a multi-peak TL profile. To better understand scale-up issues, the effect of the frame structure compliance was evaluated, and more compliant frames resulted in a reduction in TL peak frequency bandwidth. In addition, displacement measurements of frames and membranes were performed using a laser vibrometer. The measured TL of the multi-celled structure was compared with TL behavior predicted by FEA to understand the role of non-uniform mass distribution and frame compliance. TL of membrane-type LRAM with added ring masses was analyzed using both finite element analysis and experimental techniques. The addition of a ring mass to the structure either increased the bandwidth of the TL peak, or introduced multiple peaks, depending on the number of rings, the distribution of mass between the center and ring masses, and radii of the rings. FEA was used to predict TL behavior of several ring configurations, and TL for these configurations was measured to validate the model predictions. Finally, FEA was used to predict the mode shapes of the structure under single-frequency excitation to understand the mechanisms responsible for the TL peaks.

  16. Particle decay of proton-unbound levels in N 12

    DOE PAGES

    Chipps, K. A.; Pain, S. D.; Greife, U.; ...

    2017-04-24

    Transfer reactions are a useful tool for studying nuclear structure, particularly in the regime of low level densities and strong single-particle strengths. Additionally, transfer reactions can populate levels above particle decay thresholds, allowing for the possibility of studying the subsequent decays and furthering our understanding of the nuclei being probed. In particular, the decay of loosely bound nuclei such as 12 N can help inform and improve structure models.The purpose of this paper is to learn about the decay of excited states in 12 N , to more generally inform nuclear structure models, particularly in the case of particle-unbound levelsmore » in low-mass systems which are within the reach of state-of-the-art ab initio calculations.« less

  17. Impact of chemical reaction in fully developed radiated mixed convective flow between two rotating disk

    NASA Astrophysics Data System (ADS)

    Hayat, T.; Khan, M. Waleed Ahmed; Khan, M. Ijaz; Waqas, M.; Alsaedi, A.

    2018-06-01

    Flow of magnetohydrodynamic (MHD) viscous fluid between two rotating disks is modeled. Angular velocities of two disks are different. Flow is investigated for nonlinear mixed convection. Heat transfer is analyzed for nonlinear thermal radiation and heat generation/absorption. Chemical reaction is also implemented. Convective conditions of heat and mass transfer are studied. Transformations used lead to reduction of PDEs into the ODEs. The impacts of important physical variables like Prandtl number, Reynold number, Hartman number, mixed convection parameter, chemical reaction and Schmidt number on velocities, temperature and concentration are elaborated. In addition velocity and temperature gradients are physically interpreted. Our obtained results indicate that radial, axial and tangential velocities decrease for higher estimation of Hartman number.

  18. Geochemistry of spring water, southeastern Uinta Basin, Utah and Colorado

    USGS Publications Warehouse

    Kimball, Briant A.

    1981-01-01

    The chemical quality of water in the southeastern Uinta Basin, Utah and Colorado, is important to the future development of the abundant oil-shale resources of the area. This report examines the observed changes in chemistry as water circulates in both shallow and deep ground-water systems. Mass-balance and mass- transfer calculations are used to define reactions that simulate the observed water chemistry in the mixed sandstone, siltstone, and carbonate lithology of the Green River Formation of Tertiary age.The mass-transfer calculations determine a reaction path particular to this system. The early dominance of calcite dissolution produces a calcium carbonate water. After calcite saturation, deeper circulation and further rock-water interaction cause the reprecipitation of calcite, the dissolution of dolomite and plagioclase, and the oxidation of pyrite; all combining to produce a calcium magnesium sodium bicarbonate sulfate water. The calculations suggest that silica concentrations are controlled by a kaolinite-Ca-montmorillonite phase boundary. Close agreement of mineral-saturation indices calculated by both an aqueous-equilibrium model and the mass-transfer model support the selection of reactions from the mass-transfer calculations.

  19. THE QUASI-ROCHE LOBE OVERFLOW STATE IN THE EVOLUTION OF CLOSE BINARY SYSTEMS CONTAINING A RADIO PULSAR

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Benvenuto, O. G.; De Vito, M. A.; Horvath, J. E., E-mail: adevito@fcaglp.unlp.edu.ar, E-mail: foton@iag.usp.br

    We study the evolution of close binary systems formed by a normal (solar composition), intermediate-mass-donor star together with a neutron star. We consider models including irradiation feedback and evaporation. These nonstandard ingredients deeply modify the mass-transfer stages of these binaries. While models that neglect irradiation feedback undergo continuous, long-standing mass-transfer episodes, models including these effects suffer a number of cycles of mass transfer and detachment. During mass transfer, the systems should reveal themselves as low-mass X-ray binaries (LMXBs), whereas when they are detached they behave as binary radio pulsars. We show that at these stages irradiated models are in amore » Roche lobe overflow (RLOF) state or in a quasi-RLOF state. Quasi-RLOF stars have radii slightly smaller than their Roche lobes. Remarkably, these conditions are attained for an orbital period as well as donor mass values in the range corresponding to a family of binary radio pulsars known as ''redbacks''. Thus, redback companions should be quasi-RLOF stars. We show that the characteristics of the redback system PSR J1723-2837 are accounted for by these models. In each mass-transfer cycle these systems should switch from LMXB to binary radio pulsar states with a timescale of approximately one million years. However, there is recent and fast growing evidence of systems switching on far shorter, human timescales. This should be related to instabilities in the accretion disk surrounding the neutron star and/or radio ejection, still to be included in the model having the quasi-RLOF state as a general condition.« less

  20. Fission of actinide nuclei using multi-nucleon transfer reactions

    NASA Astrophysics Data System (ADS)

    Léguillon, Romain; Nishio, Katsuhisa; Hirose, Kentaro; Orlandi, Riccardo; Makii, Hiroyuki; Nishinaka, Ichiro; Ishii, Tetsuro; Tsukada, Kazuaki; Asai, Masato; Chiba, Satoshi; Ohtsuki, Tsutomu; Araki, Shohei; Watanabe, Yukinobu; Tatsuzawa, Ryotaro; Takaki, Naoyuki

    2014-09-01

    We are promoting a campaign to measure fission-fragment mass distributions for neutron-rich actinide nuclei populated by transfer reactions from their ground state up to an excitation energy of several tens MeV. We thus obtain the excitation energy dependence of the mass distribution. The experiment was carried out at the 20 MV JAEA tandem facility at Tokai. We report on the data obtained in the direct reaction 18 O + 232 Th . Transfer-channels and excitation energies of the fissioning nuclei were identified using silicon dE-E detectors located at forward angle. Two fission fragments were detected in coincidence using multi-wire proportional counters. Fission fragment masses were determined by kinematic consideration. We obtained the fission fragment mass distributions for 13 nuclei from actinium to uranium and some fission barrier heights. We are promoting a campaign to measure fission-fragment mass distributions for neutron-rich actinide nuclei populated by transfer reactions from their ground state up to an excitation energy of several tens MeV. We thus obtain the excitation energy dependence of the mass distribution. The experiment was carried out at the 20 MV JAEA tandem facility at Tokai. We report on the data obtained in the direct reaction 18 O + 232 Th . Transfer-channels and excitation energies of the fissioning nuclei were identified using silicon dE-E detectors located at forward angle. Two fission fragments were detected in coincidence using multi-wire proportional counters. Fission fragment masses were determined by kinematic consideration. We obtained the fission fragment mass distributions for 13 nuclei from actinium to uranium and some fission barrier heights. Present study is supported by the Ministry of Education, Culture, Sports, Science and Technology of Japan.

  1. Active mass damper system for high-rise buildings using neural oscillator and position controller considering stroke limitation of the auxiliary mass

    NASA Astrophysics Data System (ADS)

    Hongu, J.; Iba, D.; Nakamura, M.; Moriwaki, I.

    2016-04-01

    This paper proposes a problem-solving method for the stroke limitation problem, which is related to auxiliary masses of active mass damper systems for high-rise buildings. The proposed method is used in a new simple control system for the active mass dampers mimicking the motion of bipedal mammals, which has a neural oscillator synchronizing with the acceleration response of structures and a position controller. In the system, the travel distance and direction of the auxiliary mass of the active mass damper is determined by reference to the output of the neural oscillator, and then, the auxiliary mass is transferred to the decided location by using a PID controller. The one of the purpose of the previouslyproposed system is stroke restriction problem avoidance of the auxiliary mass during large earthquakes by the determination of the desired value within the stroke limitation of the auxiliary mass. However, only applying the limited desired value could not rigorously restrict the auxiliary mass within the limitation, because the excessive inertia force except for the control force produced by the position controller affected on the motion of the auxiliary mass. In order to eliminate the effect on the auxiliary mass by the structural absolute acceleration, a cancellation method is introduced by adding a term to the control force of the position controller. We first develop the previously-proposed system for the active mass damper and the additional term for cancellation, and verity through numerical experiments that the new system is able to operate the auxiliary mass within the restriction during large earthquakes. Based on the comparison of the proposed system with the LQ system, a conclusion was drawn regarding which the proposed neuronal system with the additional term appears to be able to limit the stroke of the auxiliary mass of the AMD.

  2. Heat and mass transfer analysis for paraffin/nitrous oxide burning rate in hybrid propulsion

    NASA Astrophysics Data System (ADS)

    Ben-Basat (Sisi), Shani; Gany, Alon

    2016-03-01

    This research presents a physical-mathematical model for the combustion of liquefying fuels in hybrid combustors, accounting for blowing effect on the heat transfer. A particular attention is given to a paraffin/nitrous oxide hybrid system. The use of a paraffin fuel in hybrid propulsion has been considered because of its much higher regression rate enabling significantly higher thrust compared to that of common polymeric fuels. The model predicts the overall regression rate (melting rate) of the fuel and the different mechanisms involved, including evaporation, entrainment of droplets of molten material, and mass loss due to melt flow on the condensed fuel surface. Prediction of the thickness and velocity of the liquid (melt) layer formed at the surface during combustion was done as well. Applying the model for an oxidizer mass flux of 45 kg/(s m2) as an example representing experimental range, it was found that 21% of the molten liquid undergoes evaporation, 30% enters the gas flow by the entrainment mechanism, and 49% reaches the end of the combustion chamber as a flowing liquid layer. When increasing the oxidizer mass flux in the port, the effect of entrainment increases while that of the flowing liquid layer along the surface shows a relatively lower contribution. Yet, the latter is predicted to have a significant contribution to the overall mass loss. In practical applications it may cause reduced combustion efficiency and should be taken into account in the motor design, e.g., by reinforcing the paraffin fuel with different additives. The model predictions have been compared to experimental results revealing good agreement.

  3. Post-Dryout Heat Transfer to a Refrigerant Flowing in Horizontal Evaporator Tubes

    NASA Astrophysics Data System (ADS)

    Mori, Hideo; Yoshida, Suguru; Kakimoto, Yasushi; Ohishi, Katsumi; Fukuda, Kenichi

    Studies of the post-dryout heat transfer were made based on the experimental data for HFC-134a flowing in horizontal smooth and spiral1y grooved (micro-fin) tubes and the characteristics of the post-dryout heat transfer were c1arified. The heat transfer coefficient at medium and high mass flow rates in the smooth tube was lower than the single-phase heat transfer coefficient of the superheated vapor flow, of which mass flow rate was given on the assumption that the flow was in a thermodynamic equilibrium. A prediction method of post-dryout heat transfer coefficient was developed to reproduce the measurement satisfactorily for the smooth tube. The post dryout heat transfer in the micro-fin tube can be regarded approximately as a superheated vapor single-phase heat transfer.

  4. Vitrified-warmed embryo transfer is associated with mean higher singleton birth weight compared to fresh embryo transfer.

    PubMed

    Beyer, Daniel Alexander; Griesinger, Georg

    2016-08-01

    To test for differences in birth weight between singletons born after IVF with fresh embryo transfer vs. vitrified-warmed 2PN embryo transfer (vitrification protocol). Retrospective analysis of 464 singleton live births after IVF or ICSI during a 12 year period. University hospital. Fresh embryo transfer, vitrified-warmed 2PN embryo transfer (vitrification protocol). Birth weight standardized as a z-score, adjusting for gestational week at delivery and fetal sex. As a reference, birth weight means from regular deliveries from the same hospital were used. Multivariate regression analysis was used to investigate the relationship between the dependent variable z-score (fetal birth weight) and the independent predictor variables maternal age, weight, height, body mass index, RDS prophylaxis, transfer protocol, number of embryos transferred, indication for IVF treatment and sperm quality. The mean z-score was significantly lower after fresh transfer (-0.11±92) as compared to vitrification transfer (0.72±83) (p<0.001). Multivariate regression analysis indicated that only maternal height and maternal body mass index, but not type of cryopreservation protocol, was a significant predictor of birth weight. In this analysis focusing on 2PN oocytes, vitrified-warmed embryo transfer is associated with mean higher birth weight compared to fresh embryo transfer. Maternal height and body mass index are significant confounders of fetal birth weight and need to be taken into account when studying birth weight differences between ART protocols. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  5. Steady boundary layer slip flow along with heat and mass transfer over a flat porous plate embedded in a porous medium.

    PubMed

    Aziz, Asim; Siddique, J I; Aziz, Taha

    2014-01-01

    In this paper, a simplified model of an incompressible fluid flow along with heat and mass transfer past a porous flat plate embedded in a Darcy type porous medium is investigated. The velocity, thermal and mass slip conditions are utilized that has not been discussed in the literature before. The similarity transformations are used to transform the governing partial differential equations (PDEs) into a nonlinear ordinary differential equations (ODEs). The resulting system of ODEs is then reduced to a system of first order differential equations which was solved numerically by using Matlab bvp4c code. The effects of permeability, suction/injection parameter, velocity parameter and slip parameter on the structure of velocity, temperature and mass transfer rates are examined with the aid of several graphs. Moreover, observations based on Schmidt number and Soret number are also presented. The result shows, the increase in permeability of the porous medium increase the velocity and decrease the temperature profile. This happens due to a decrease in drag of the fluid flow. In the case of heat transfer, the increase in permeability and slip parameter causes an increase in heat transfer. However for the case of increase in thermal slip parameter there is a decrease in heat transfer. An increase in the mass slip parameter causes a decrease in the concentration field. The suction and injection parameter has similar effect on concentration profile as for the case of velocity profile.

  6. Steady Boundary Layer Slip Flow along with Heat and Mass Transfer over a Flat Porous Plate Embedded in a Porous Medium

    PubMed Central

    Aziz, Asim; Siddique, J. I.; Aziz, Taha

    2014-01-01

    In this paper, a simplified model of an incompressible fluid flow along with heat and mass transfer past a porous flat plate embedded in a Darcy type porous medium is investigated. The velocity, thermal and mass slip conditions are utilized that has not been discussed in the literature before. The similarity transformations are used to transform the governing partial differential equations (PDEs) into a nonlinear ordinary differential equations (ODEs). The resulting system of ODEs is then reduced to a system of first order differential equations which was solved numerically by using Matlab bvp4c code. The effects of permeability, suction/injection parameter, velocity parameter and slip parameter on the structure of velocity, temperature and mass transfer rates are examined with the aid of several graphs. Moreover, observations based on Schmidt number and Soret number are also presented. The result shows, the increase in permeability of the porous medium increase the velocity and decrease the temperature profile. This happens due to a decrease in drag of the fluid flow. In the case of heat transfer, the increase in permeability and slip parameter causes an increase in heat transfer. However for the case of increase in thermal slip parameter there is a decrease in heat transfer. An increase in the mass slip parameter causes a decrease in the concentration field. The suction and injection parameter has similar effect on concentration profile as for the case of velocity profile. PMID:25531301

  7. Dehydration reactions, mass transfer and rock deformation relationships during subduction of Alpine metabauxites: insights from LIBS compositional profiles between metamorphic veins

    NASA Astrophysics Data System (ADS)

    Verlaguet, Anne; Brunet, Fabrice; Goffé, Bruno; Menut, Denis; Findling, Nathaniel; Poinssot, Christophe

    2013-04-01

    In subduction zones, the significant amounts of aqueous fluid released in the course of the successive dehydration reactions occurring during prograde metamorphism are expected to strongly influence the rock rheology, as well as kinetics of metamorphic reactions and mass transfer efficiency. Mineralized veins, ubiquitous in metamorphic rocks, can be seen as preserved witnesses of fluid and mass redistribution that partly accommodate the rock deformation (lateral segregation). However, the driving forces and mechanisms of mass transfer towards fluid-filled open spaces remain somewhat unclear. The aim of this study is to investigate the vein-forming processes and the modalities of mass transfer during local fluid-rock interactions, and their links with fluid production and rock deformation, with new insights from Laser Induced Breakdown Spectroscopy (LIBS) profiles. This study focuses on karstic pockets (metre scale) of Triassic metabauxites embedded in thick carbonate units, that have been isolated from large-scale fluid flow during HP-LT Alpine metamorphism (W. Vanoise, French Alps). These rocks display several generations of metamorphic veins containing various Al-bearing minerals, which give particular insights into mass transfer processes. It is proposed that the internally-derived fluid (~13 vol% produced by successive dehydration reactions) has promoted the opening of fluid-filled open spaces (euhedral habits of vein minerals) and served as medium for diffusive mass transfer from rock to vein. Based on mineralogical and textural features, two vein types can be distinguished: (1) some veins are filled with newly formed products of either prograde (chloritoid) or retrograde (chlorite) metamorphic reactions; in this case, fluid-filled open spaces seem to offer energetically favourable nucleation/growth sites; (2) the second vein type is filled with cookeite (Li-Al-rich chlorite) or pyrophyllite, that were present in the host rock prior to the vein formation. In this closed chemical system, mass transfer from rock to vein was achieved through the fluid, in a dissolution-transport-precipitation process, possibly stress-assisted. To investigate the modalities of mass transfer towards this second vein type, LIBS profiles were performed in the rock matrix, taking Li concentration as a proxy for cookeite distribution. Cookeite is highly concentrated (40-70 vol%) in regularly spaced veins, and the LIBS profiles show that cookeite is evenly distributed in the rock matrix comprised between two veins. The absence of diffusion profiles suggests that the characteristic diffusion length for Li, Al and Si is greater than or equal to the distance separating two cookeite veins (3-6 cm). This is in agreement with characteristic diffusion lengths calculated from both grain boundary and pore fluid diffusion coefficients, for the estimated duration of the peak of metamorphism. Concerning mass transfer driving forces, phyllosilicates have very different morphologies in the rock matrix (fibers) compared to veins (euhedral crystals): fluid-mineral interfacial energy may be maximal in the small matrix pores, which can maintain higher cookeite solubility than in fluid-filled open spaces. Therefore, as soon as veins open, chemical potential gradients may develop and drive cookeite transfer from rock matrix to veins.

  8. Gas hold-up and oxygen mass transfer in three pneumatic bioreactors operating with sugarcane bagasse suspensions.

    PubMed

    Esperança, M N; Cunha, F M; Cerri, M O; Zangirolami, T C; Farinas, C S; Badino, A C

    2014-05-01

    Sugarcane bagasse is a low-cost and abundant by-product generated by the bioethanol industry, and is a potential substrate for cellulolytic enzyme production. The aim of this work was to evaluate the effects of air flow rate (QAIR), solids loading (%S), sugarcane bagasse type, and particle size on the gas hold-up (εG) and volumetric oxygen transfer coefficient (kLa) in three different pneumatic bioreactors, using response surface methodology. Concentric tube airlift (CTA), split-cylinder airlift (SCA), and bubble column (BC) bioreactor types were tested. QAIR and %S affected oxygen mass transfer positively and negatively, respectively, while sugarcane bagasse type and particle size (within the range studied) did not influence kLa. Using large particles of untreated sugarcane bagasse, the loop-type bioreactors (CTA and SCA) exhibited higher mass transfer, compared to the BC reactor. At higher %S, SCA presented a higher kLa value (0.0448 s−1) than CTA, and the best operational conditions in terms of oxygen mass transfer were achieved for %S < 10.0 g L−1 and QAIR > 27.0 L min−1. These results demonstrated that pneumatic bioreactors can provide elevated oxygen transfer in the presence of vegetal biomass, making them an excellent option for use in three-phase systems for cellulolytic enzyme production by filamentous fungi.

  9. OVERALL MASS TRANSFER COEFFICIENT FOR POLLUTANT EMISSIONS FROM SMALL WATER POOLS UNDER SIMULATED INDOOR ENVIRONMENTAL CONDITIONS

    EPA Science Inventory

    Small chamber tests were conducted to experimentally determine the overall mass transfer coefficient for pollutant emissions from still water under simulated indoor-residential or occupational-environmental conditions. Fourteen tests were conducted in small environmental chambers...

  10. Leveraging Electron Transfer Dissociation for Site Selective Radical Generation: Applications for Peptide Epimer Analysis

    NASA Astrophysics Data System (ADS)

    Lyon, Yana A.; Beran, Gregory; Julian, Ryan R.

    2017-07-01

    Traditional electron-transfer dissociation (ETD) experiments operate through a complex combination of hydrogen abundant and hydrogen deficient fragmentation pathways, yielding c and z ions, side-chain losses, and disulfide bond scission. Herein, a novel dissociation pathway is reported, yielding homolytic cleavage of carbon-iodine bonds via electronic excitation. This observation is very similar to photodissociation experiments where homolytic cleavage of carbon-iodine bonds has been utilized previously, but ETD activation can be performed without addition of a laser to the mass spectrometer. Both loss of iodine and loss of hydrogen iodide are observed, with the abundance of the latter product being greatly enhanced for some peptides after additional collisional activation. These observations suggest a novel ETD fragmentation pathway involving temporary storage of the electron in a charge-reduced arginine side chain. Subsequent collisional activation of the peptide radical produced by loss of HI yields spectra dominated by radical-directed dissociation, which can be usefully employed for identification of peptide isomers, including epimers.

  11. Transient Catalytic Combustor Model With Detailed Gas and Surface Chemistry

    NASA Technical Reports Server (NTRS)

    Struk, Peter M.; Dietrich, Daniel L.; Mellish, Benjamin P.; Miller, Fletcher J.; Tien, James S.

    2005-01-01

    In this work, we numerically investigate the transient combustion of a premixed gas mixture in a narrow, perfectly-insulated, catalytic channel which can represent an interior channel of a catalytic monolith. The model assumes a quasi-steady gas-phase and a transient, thermally thin solid phase. The gas phase is one-dimensional, but it does account for heat and mass transfer in a direction perpendicular to the flow via appropriate heat and mass transfer coefficients. The model neglects axial conduction in both the gas and in the solid. The model includes both detailed gas-phase reactions and catalytic surface reactions. The reactants modeled so far include lean mixtures of dry CO and CO/H2 mixtures, with pure oxygen as the oxidizer. The results include transient computations of light-off and system response to inlet condition variations. In some cases, the model predicts two different steady-state solutions depending on whether the channel is initially hot or cold. Additionally, the model suggests that the catalytic ignition of CO/O2 mixtures is extremely sensitive to small variations of inlet equivalence ratios and parts per million levels of H2.

  12. Unsteady Sisko magneto-nanofluid flow with heat absorption and temperature dependent thermal conductivity: A 3D numerical study

    NASA Astrophysics Data System (ADS)

    Khan, Masood; Ahmad, Latif; Gulzar, M. Mudassar

    2018-03-01

    The impact of temperature dependent thermal conductivity and convective surface conditions on unsteady 3D Sisko nanofluid flow over a stretching surface is studied in the presence of heat generation/absorption and magnetic field. The numerical solution of nonlinear coupled equations has been carried out to explore the properties of different physical profiles of the fluid flow with varying of parameters. Specifically, the application of generalized Biot numbers and heat generation/absorption parameter in the sketching of temperature and concentration profiles are explored. The effect of all three parameters is noticed in the increasing order for shear thinning (0 < n < 1) and for shear thickening (n > 1) fluids. Moreover, the influence of Biot number γ1 on heat and mass transfer rates, are found in the enhancement and diminishing conducts respectively, in both cases of shear thinning as well as shear thickening fluids and a reverse trend is observed with the variation of Biot number γ2 . Additionally, the present results are validated through skin friction, heat and mass transfer rate values with the comparable values in the existing previous values.

  13. Some features of the effect the pH value and the physicochemical properties of boric acid have on mass transfer in a VVER reactor's core

    NASA Astrophysics Data System (ADS)

    Gavrilov, A. V.; Kritskii, V. G.; Rodionov, Yu. A.; Berezina, I. G.

    2013-07-01

    Certain features of the effect of boric acid in the reactor coolant of nuclear power installations equipped with a VVER-440 reactor on mass transfer in the reactor core are considered. It is determined that formation of boric acid polyborate complexes begins under field conditions at a temperature of 300°C when the boric acid concentration is equal to around 0.065 mol/L (4 g/L). Operations for decontaminating the reactor coolant system entail a growth of corrosion product concentration in the coolant, which gives rise to formation of iron borates in the zones where subcooled boiling of coolant takes place and to the effect of axial offset anomalies. A model for simulating variation of pressure drop in a VVER-440 reactor's core that has invariable parameters during the entire fuel campaign is developed by additionally taking into account the concentrations of boric acid polyborate complexes and the quantity of corrosion products (Fe, Ni) represented by the ratio of their solubilities.

  14. Exploring the Cattaneo-Christov heat flux phenomenon on a Maxwell-type nanofluid coexisting with homogeneous/heterogeneous reactions

    NASA Astrophysics Data System (ADS)

    Sarkar, Amit; Kundu, Prabir Kumar

    2017-12-01

    This specific article unfolds the efficacy of Cattaneo-Christov heat flux on the heat and mass transport of Maxwell nanofluid flow over a stretched sheet with changeable thickness. Homogeneous/heterogeneous reactions in the fluid are additionally considered. The Cattaneo-Christov heat flux model is initiated in the energy equation. Appropriate similarity transformations are taken up to form a system of nonlinear ODEs. The impact of related parameters on the nanoparticle concentration and temperature is inspected through tables and diagrams. It is renowned that temperature distribution increases for lower values of the thermal relaxation parameter. The rate of mass transfer is enhanced for increasing in the heterogeneous reaction parameter but the reverse tendency is ensued for the homogeneous reaction parameter. On the other side, the rate of heat transfer is getting enhanced for the Cattaneo-Christov model compared to the classical Fourier's model for some flow factors. Thus the implication of the current study is to delve its unique effort towards the generalized version of traditional Fourier's law at nano level.

  15. Mathematical model of compact type evaporator

    NASA Astrophysics Data System (ADS)

    Borovička, Martin; Hyhlík, Tomáš

    2018-06-01

    In this paper, development of the mathematical model for evaporator used in heat pump circuits is covered, with focus on air dehumidification application. Main target of this ad-hoc numerical model is to simulate heat and mass transfer in evaporator for prescribed inlet conditions and different geometrical parameters. Simplified 2D mathematical model is developed in MATLAB SW. Solvers for multiple heat and mass transfer problems - plate surface temperature, condensate film temperature, local heat and mass transfer coefficients, refrigerant temperature distribution, humid air enthalpy change are included as subprocedures of this model. An automatic procedure of data transfer is developed in order to use results of MATLAB model in more complex simulation within commercial CFD code. In the end, Proper Orthogonal Decomposition (POD) method is introduced and implemented into MATLAB model.

  16. Experimental Study on Flow Boiling of Deionized Water in a Horizontal Long Small Channel

    NASA Astrophysics Data System (ADS)

    Huang, Qian; Jia, Li; Dang, Chao; Yang, Lixin

    2018-04-01

    In this paper, an experimental investigation on the flow boiling heat transfer in a horizontal long mini-channel was carried out. The mini-channel was with 2 mm wide and 1 mm deep and 900 mm long. The material of the mini-channel was stainless. The working fluid was deionized water. The experiments were conducted with the conditions of inlet pressure in the range of 0.2 0.5 MPa, mass flux in the range of 196.57-548.96 kg/m2s, and the outlet vapor quality in the range of 0.2 to 1. The heat flux was in the range of 292.86 kW/m2 to 788.48 kW/m2, respectively. The influences of mass flux and heat flux were studied. At a certain mass flow rate, the local heat transfer coefficient increased with the increase of the heat flux. If dry-out occurred in the mini-channel, the heat transfer coefficient decreased. At the same heat flux, the local heat transfer coefficient would depend on the mass flux. It would increase with the mass flux in a certain range, and then decrease if the mass flux was beyond this range. Experimental data were compared with the results of previous studies. Flow visualization and measurements were conducted to identify flow regime transitions. Results showed that there were eight different kinds of flow patterns occurring during the flow boiling. It was found that flow pattern had a significant effect on heat transfer.

  17. Sensing of metal-transfer mode for process control of GMAW (gas metal arc welding)

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Carlson, N.M.; Johnson, J.A.; Smartt, H.B.

    1989-01-01

    One of the requirements of a sensing system for feedback control of gas metal arc welding (GMAW) is the capability to determine the metal-transfer mode. Because the operating boundary for the desired transfer mode, expressed as a function of mass input and heat input, may vary due to conditions beyond the control of the system, a means of detecting the transfer mode during welding is necessary. A series of sensing experiments was performed during which the ultrasonic emissions, audio emissions, welding current fluctuations and welding voltage fluctuations were recorded as a function of the transfer mode. In addition, high speedmore » movies (5000 frames/s) of the droplet formation and detachment were taken synchronously with the sensing data. An LED mounted in the camera was used to mark the film at the beginning and end of the data acquisition period. A second LED was pulsed at a 1 kHz rate and the pulses recorded on film and with the sensor data. Thus events recorded on the film can be correlated with the sensor data. Data acquired during globular transfer, spray transfer, and stiff spray or streaming transfer were observed to correlate with droplet detachment and arc shorting. The audio, current, and voltage data can be used to discriminate among these different transfer modes. However, the current and voltage data are also dependent on the characteristic of the welding power supply. 5 refs., 3 figs., 1 tab.« less

  18. Detection of metal-transfer mode in GMAW

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Johnson, J.A.; Carlson, N.M.; Smartt, H.B.

    1989-01-01

    One of the requirements of a sensing system for feedback control of gas metal arc welding (GMAW) is the capability to detect information about the metal-transfer mode. Because the operating boundary for the desired transfer mode, expressed as a function of mass input and heat input, may vary due to conditions beyond the control of the system, a means of determining the transfer mode during welding is necessary. A series of sensing experiments is performed during which the ultrasonic emissions, audio emissions, welding current fluctuations, and welding voltage fluctuations are recorded as a function of the transfer mode. In addition,more » high speed movies (5000 frame/s) of the droplet formation and detachment are taken synchronously with the sensing data. An LED mounted in the camera is used to work the film at the beginning and end of the data acquisition period. A second LED is pulsed at a 1 kHz rate and the pulses are recorded on film and with the sensor data. Thus events observed on the film can be correlated with the sensor data. Data acquired during globular transfer, spray transfer, and stiff spray or streaming transfer are observed to correlate with droplet detachment and arc shorting. The audio, current, and voltage data can be used to discriminate among these different transfer modes. However, the current and voltage data are also dependent on the characteristics of the welding power supply. 4 refs., 5 figs.« less

  19. A mass transfer origin for blue stragglers in NGC 188 as revealed by half-solar-mass companions.

    PubMed

    Geller, Aaron M; Mathieu, Robert D

    2011-10-19

    In open star clusters, where all members formed at about the same time, blue straggler stars are typically observed to be brighter and bluer than hydrogen-burning main-sequence stars, and therefore should already have evolved into giant stars and stellar remnants. Correlations between blue straggler frequency and cluster binary star fraction, core mass and radial position suggest that mass transfer or mergers in binary stars dominates the production of blue stragglers in open clusters. Analytic models, detailed observations and sophisticated N-body simulations, however, argue in favour of stellar collisions. Here we report that the blue stragglers in long-period binaries in the old (7 × 10(9)-year) open cluster NGC 188 have companions with masses of about half a solar mass, with a surprisingly narrow mass distribution. This conclusively rules out a collisional origin, as the collision hypothesis predicts a companion mass distribution with significantly higher masses. Mergers in hierarchical triple stars are marginally permitted by the data, but the observations do not favour this hypothesis. The data are highly consistent with a mass transfer origin for the long-period blue straggler binaries in NGC 188, in which the companions would be white dwarfs of about half a solar mass.

  20. CFD Study of Full-Scale Aerobic Bioreactors: Evaluation of Dynamic O2 Distribution, Gas-Liquid Mass Transfer and Reaction

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Humbird, David; Sitaraman, Hariswaran; Stickel, Jonathan

    If advanced biofuels are to measurably displace fossil fuels in the near term, they will have to operate at levels of scale, efficiency, and margin unprecedented in the current biotech industry. For aerobically-grown products in particular, scale-up is complex and the practical size, cost, and operability of extremely large reactors is not well understood. Put simply, the problem of how to attain fuel-class production scales comes down to cost-effective delivery of oxygen at high mass transfer rates and low capital and operating costs. To that end, very large reactor vessels (>500 m3) are proposed in order to achieve favorable economiesmore » of scale. Additionally, techno-economic evaluation indicates that bubble-column reactors are more cost-effective than stirred-tank reactors in many low-viscosity cultures. In order to advance the design of extremely large aerobic bioreactors, we have performed computational fluid dynamics (CFD) simulations of bubble-column reactors. A multiphase Euler-Euler model is used to explicitly account for the spatial distribution of air (i.e., gas bubbles) in the reactor. Expanding on the existing bioreactor CFD literature (typically focused on the hydrodynamics of bubbly flows), our simulations include interphase mass transfer of oxygen and a simple phenomenological reaction representing the uptake and consumption of dissolved oxygen by submerged cells. The simulations reproduce the expected flow profiles, with net upward flow in the center of column and downward flow near the wall. At high simulated oxygen uptake rates (OUR), oxygen-depleted regions can be observed in the reactor. By increasing the gas flow to enhance mixing and eliminate depleted areas, a maximum oxygen transfer (OTR) rate is obtained as a function of superficial velocity. These insights regarding minimum superficial velocity and maximum reactor size are incorporated into NREL's larger techno-economic models to supplement standard reactor design equations.« less

  1. Three-dimensional large-eddy simulations of the early phase of contrail-to-cirrus transition: effects of atmospheric turbulence and radiative transfer

    DOE PAGES

    Paoli, Roberto; Thouron, Odile; Cariolle, Daniel; ...

    2017-12-08

    Here, this article presents the results from numerical experiments of the early phase of contrail-cirrus formation using a limited set of fully three-dimensional, high-resolution large-eddy-simulations. The focus is laid on the interplay between atmospheric turbulence and the radiative transfer (and to a limited extent the ambient ice relative humidity), and how this interaction affects the contrail evolution and the characteristics of the resulting contrail-cirrus one hour after emission. Turbulence is sustained via a large-scale stochastic forcing that creates a non-uniform shear in addition to pure turbulent fluctuations. This effect manifests in the formation of vertically sheared structures of ice crystals.more » When radiative transfer is activated, ice tends to redistribute more uniformly along the vertical direction forming spotty vertical structures. For the conditions analyzed in this study, atmospheric turbulence, inclusive of non-uniform turbulent shear and turbulent fluctuations, affects primarily the contrail width whereas the microphysical properties such ice water path and ice mass are controlled by radiative transfer and relative humidity.« less

  2. Microplastics as vectors for environmental contaminants: Exploring sorption, desorption, and transfer to biota.

    PubMed

    Hartmann, Nanna B; Rist, Sinja; Bodin, Julia; Jensen, Louise Hs; Schmidt, Stine N; Mayer, Philipp; Meibom, Anders; Baun, Anders

    2017-05-01

    The occurrence and effects of microplastics (MPs) in the aquatic environment are receiving increasing attention. In addition to their possible direct adverse effects on biota, the potential role of MPs as vectors for hydrophobic organic chemicals (HOCs), compared to natural pathways, is a topic of much debate. It is evident, however, that temporal and spatial variations of MP occurrence do (and will) occur. To further improve the estimations of the role of MPs as vectors for HOC transfer into biota under varying MP concentrations and environmental conditions, it is important to identify and understand the governing processes. Here, we explore HOC sorption to and desorption from MPs and the underlying principles for their interactions. We discuss intrinsic and extrinsic parameters influencing these processes and focus on the importance of the exposure route for diffusive mass transfer. Also, we outline research needed to fill knowledge gaps and improve model-based calculations of MP-facilitated HOC transfer in the environment. Integr Environ Assess Manag 2017;13:488-493. © 2017 SETAC. © 2017 SETAC.

  3. Three-dimensional large-eddy simulations of the early phase of contrail-to-cirrus transition: effects of atmospheric turbulence and radiative transfer

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Paoli, Roberto; Thouron, Odile; Cariolle, Daniel

    Here, this article presents the results from numerical experiments of the early phase of contrail-cirrus formation using a limited set of fully three-dimensional, high-resolution large-eddy-simulations. The focus is laid on the interplay between atmospheric turbulence and the radiative transfer (and to a limited extent the ambient ice relative humidity), and how this interaction affects the contrail evolution and the characteristics of the resulting contrail-cirrus one hour after emission. Turbulence is sustained via a large-scale stochastic forcing that creates a non-uniform shear in addition to pure turbulent fluctuations. This effect manifests in the formation of vertically sheared structures of ice crystals.more » When radiative transfer is activated, ice tends to redistribute more uniformly along the vertical direction forming spotty vertical structures. For the conditions analyzed in this study, atmospheric turbulence, inclusive of non-uniform turbulent shear and turbulent fluctuations, affects primarily the contrail width whereas the microphysical properties such ice water path and ice mass are controlled by radiative transfer and relative humidity.« less

  4. An Entrance Region Mass Transfer Experiment.

    ERIC Educational Resources Information Center

    Youngquist, G. R.

    1979-01-01

    This paper describes an experiment designed to reveal the consequences of the development of a concentration boundary layer. The rate of a mass transfer limited electrochemical reaction is measured and used to obtain the dependence of average Sherwood number on Reynolds number and entrance length. (Author/BB)

  5. Biomass drying in a pulsed fluidized bed without inert bed particles

    DOE PAGES

    Jia, Dening; Bi, Xiaotao; Lim, C. Jim; ...

    2016-08-29

    Batch drying was performed in the pulsed fluidized bed with various species of biomass particles as an indicator of gas–solid contact efficiency and mass transfer rate under different operating conditions including pulsation duty cycle and particle size distribution. The fluidization of cohesive biomass particles benefited from the shorter opening time of pulsed gas flow and increased peak pressure drop. The presence of fines enhanced gas–solid contact of large and irregular biomass particles, as well as the mass transfer efficiency. A drying model based on two-phase theory was proposed, from which effective diffusivity was calculated for various gas flow rates, temperaturemore » and pulsation frequency. Intricate relationship was discovered between pulsation frequency and effective diffusivity, as mass transfer was deeply connected with the hydrodynamics. Effective diffusivity was also found to be proportional to gas flow rate and drying temperature. In conclusion, operating near the natural frequency of the system also favored drying and mass transfer.« less

  6. Biochemicals from food waste and recalcitrant biomass via syngas fermentation: A review.

    PubMed

    Wainaina, Steven; Horváth, Ilona Sárvári; Taherzadeh, Mohammad J

    2018-01-01

    An effective method for the production of value-added chemicals from food waste and lignocellulosic materials is a hybrid thermal-biological process, which involves gasification of the solid materials to syngas (primarily CO and H 2 ) followed by fermentation. This paper reviews the recent advances in this process. The special focus is on the cultivation methods that involve the use of single strains, defined mixed cultures and undefined mixed cultures for production of carboxylic acids and higher alcohols. A rate limiting step in these processes is the low mass transfer between the gas and the liquid phases. Therefore, novel techniques that can enhance the gas-liquid mass transfer including membrane- and trickle-bed bioreactors were discussed. Such bioreactors have shown promising results in increasing the volumetric mass transfer coefficient (k L a). High gas pressure also influences the mass transfer in certain batch processes, although the presence of impurities in the gas would impede the process. Copyright © 2017 Elsevier Ltd. All rights reserved.

  7. Heat and mass transfer analysis of unsteady MHD nanofluid flow through a channel with moving porous walls and medium

    NASA Astrophysics Data System (ADS)

    Zubair Akbar, Muhammad; Ashraf, Muhammad; Farooq Iqbal, Muhammad; Ali, Kashif

    2016-04-01

    The paper presents the numerical study of heat and mass transfer analysis in a viscous unsteady MHD nanofluid flow through a channel with porous walls and medium in the presence of metallic nanoparticles. The two cases for effective thermal conductivity are discussed in the analysis through H-C model. The impacts of the governing parameters on the flow, heat and mass transfer aspects of the issue are talked about. Under the patronage of small values of permeable Reynolds number and relaxation/contraction parameter, we locate that, when wall contraction is together with suction, flow turning is encouraged close to the wall where the boundary layer is shaped. On the other hand, when the wall relaxation is coupled with injection, the flow adjacent to the porous walls decreased. The outcome of the exploration may be beneficial for applications of biotechnology. Numerical solutions for the velocity, heat and mass transfer rate at the boundary are obtained and analyzed.

  8. DETECTION OF WHITE DWARF COMPANIONS TO BLUE STRAGGLERS IN THE OPEN CLUSTER NGC 188: DIRECT EVIDENCE FOR RECENT MASS TRANSFER

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Gosnell, Natalie M.; Mathieu, Robert D.; Geller, Aaron M.

    2014-03-01

    Several possible formation pathways for blue straggler stars have been developed recently, but no one pathway has yet been observationally confirmed for a specific blue straggler. Here we report the first findings from a Hubble Space Telescope Advanced Camera for Surveys/Solar Blind Channel far-UV photometric program to search for white dwarf companions to blue straggler stars. We find three hot and young white dwarf companions to blue straggler stars in the 7 Gyr open cluster NGC 188, indicating that mass transfer in these systems ended less than 300 Myr ago. These companions are direct and secure observational evidence that these blue straggler starsmore » were formed through mass transfer in binary stars. Their existence in a well-studied cluster environment allows for observational constraints of both the current binary system and the progenitor binary system, mapping the entire mass transfer history.« less

  9. Improving microalgal growth with reduced diameters of aeration bubbles and enhanced mass transfer of solution in an oscillating flow field.

    PubMed

    Yang, Zongbo; Cheng, Jun; Lin, Richen; Zhou, Junhu; Cen, Kefa

    2016-07-01

    A novel oscillating gas aerator combined with an oscillating baffle was proposed to generate smaller aeration bubbles and enhance solution mass transfer, which can improve microalgal growth in a raceway pond. A high-speed photography system (HSP) was used to measure bubble diameter and generation time, and online precise dissolved oxygen probes and pH probes were used to measure mass-transfer coefficient and mixing time. Bubble diameter and generation time decreased with decreased aeration gas rate, decreased orifice diameter, and increased water velocity in the oscillating gas aerator. The optimized oscillating gas aerator decreased bubble diameter and generation time by 25% and 58%, respectively, compared with a horizontal tubular gas aerator. Using an oscillating gas aerator and an oscillating baffle in a raceway pond increased the solution mass-transfer coefficient by 15% and decreased mixing time by 32%; consequently, microalgal biomass yield increased by 19%. Copyright © 2016 Elsevier Ltd. All rights reserved.

  10. Drop mass transfer in a microfluidic chip compared to a centrifugal contactor

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Nemer, Martin B.; Roberts, Christine C.; Hughes, Lindsey G.

    2014-06-13

    A model system was developed for enabling a multiscale understanding of centrifugal-contactor liquid–liquid extraction.The system consisted of Nd(III) + xylenol orange in the aqueous phase buffered to pH =5.5 by KHP, and dodecane + thenoyltrifluroroacetone (HTTA) + tributyphosphate (TBP) in the organic phase. Diffusion constants were measured for neodymium in both the organic and aqueous phases, and the Nd(III) partition coefficients were measured at various HTTA and TBP concentrations. A microfluidic channel was used as a high-shear model environment to observe mass-transfer on a droplet scale with xylenol orange as the aqueous-phase metal indicator; mass-transfer rates were measured quantitatively inmore » both diffusion and reaction limited regimes on the droplet scale. Lastly, the microfluidic results were comparable to observations made for the same system in a laboratory scale liquid–liquid centrifugal contactor, indicating that single drop microfluidic experiments can provide information on mass transfer in complicated flows and geometries.« less

  11. Sorption and reemission of formaldehyde by gypsum wallboard. Report for June 1990-August 1992

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Chang, J.C.S.

    1993-01-01

    The paper gives results of an analysis of the sorption and desorption of formaldehyde by unpainted wallboard, using a mass transfer model based on the Langmuir sorption isotherm. The sorption and desorption rate constants are determined by short-term experimental data. Long-term sorption and desorption curves are developed by the mass transfer model without any adjustable parameters. Compared with other empirically developed models, the mass transfer model has more extensive applicability and provides an elucidation of the sorption and desorption mechanism that empirical models cannot. The mass transfer model is also more feasible and accurate than empirical models for applications suchmore » as scale-up and exposure assessment. For a typical indoor environment, the model predicts that gypsum wallboard is a much stronger sink for formaldehyde than for other indoor air pollutants such as tetrachloroethylene and ethylbenzene. The strong sink effects are reflected by the high equilibrium capacity and slow decay of the desorption curve.« less

  12. Ultrasound in gas-liquid systems: effects on solubility and mass transfer.

    PubMed

    Laugier, F; Andriantsiferana, C; Wilhelm, A M; Delmas, H

    2008-09-01

    The effect of ultrasound on the pseudo-solubility of nitrogen in water and on gas-liquid mass transfer kinetics has been investigated in an autoclave reactor equipped with a gas induced impeller. In order to use organic liquids and to investigate the effect of pressure, gas-liquid mass transfer coefficient was calculated from the evolution of autoclave pressure during gas absorption to avoid any side-effects of ultrasound on the concentrations measurements. Ultrasound effect on the apparent solubility is very low (below 12%). Conversely ultrasound greatly improves gas-liquid mass transfer, especially below gas induction speed, this improvement being boosted by pressure. In typical conditions of organic synthesis: 323 K, 1100 rpm, 10 bar, k(L).a is multiplied by 11 with ultrasound (20 kHz/62.6 W). The impact of sonication is much higher on gassing out than on gassing in. In the same conditions, this enhancement is at least five times higher for degassing.

  13. Method and system for simulating heat and mass transfer in cooling towers

    DOEpatents

    Bharathan, Desikan; Hassani, A. Vahab

    1997-01-01

    The present invention is a system and method for simulating the performance of a cooling tower. More precisely, the simulator of the present invention predicts values related to the heat and mass transfer from a liquid (e.g., water) to a gas (e.g., air) when provided with input data related to a cooling tower design. In particular, the simulator accepts input data regarding: (a) cooling tower site environmental characteristics; (b) cooling tower operational characteristics; and (c) geometric characteristics of the packing used to increase the surface area within the cooling tower upon which the heat and mass transfer interactions occur. In providing such performance predictions, the simulator performs computations related to the physics of heat and mass transfer within the packing. Thus, instead of relying solely on trial and error wherein various packing geometries are tested during construction of the cooling tower, the packing geometries for a proposed cooling tower can be simulated for use in selecting a desired packing geometry for the cooling tower.

  14. Mass-transfer limitations for immobilized enzyme-catalyzed kinetic resolution of racemate in a fixed-bed reactor.

    PubMed

    Xiu, G H; Jiang, L; Li, P

    2001-07-05

    A mathematical model has been developed for immobilized enzyme-catalyzed kinetic resolution of racemate in a fixed-bed reactor in which the enzyme-catalyzed reaction (the irreversible uni-uni competitive Michaelis-Menten kinetics is chosen as an example) was coupled with intraparticle diffusion, external mass transfer, and axial dispersion. The effects of mass-transfer limitations, competitive inhibition of substrates, deactivation on the enzyme effective enantioselectivity, and the optical purity and yield of the desired product are examined quantitatively over a wide range of parameters using the orthogonal collocation method. For a first-order reaction, an analytical solution is derived from the mathematical model for slab-, cylindrical-, and spherical-enzyme supports. Based on the analytical solution for the steady-state resolution process, a new concise formulation is presented to predict quantitatively the mass-transfer limitations on enzyme effective enantioselectivity and optical purity and yield of the desired product for a continuous steady-state kinetic resolution process in a fixed-bed reactor. Copyright 2001 John Wiley & Sons, Inc.

  15. Analysis of the K{sub S}K{sub S} system from the reaction {pi}{sup -}p {sup {yields}} K{sub S}K{sub S}n at 40 GeV

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Vladimirsky, V. V.; Grigor'ev, V. K.; Erofeev, I. A.

    2006-03-15

    On the basis of experimental data from the 6-m spectrometer of the Institute of Theoretical and Experimental Physics (ITEP, Moscow), an amplitude analysis of 40 553 events of the reaction {pi}{sup -}p {sup {yields}} K{sub S}K{sub S}n induced by a negatively charged pion of energy 40 GeV is performed over a broad momentum transfer range by using a new procedure. The results for vertical bar t vertical bar > 0.1 GeV{sup 2} are obtained for the first time. In particular, resonances of mass 1700 and 1900 MeV and width 120 MeV are discovered in the D{sub +} wave (there weremore » no such resonances for vertical bar t vertical bar < 0.1 GeV{sup 2}). In the region of low momentum transfers, the S wave exhibits a structure that lies in the mass region around 1370 MeV and which requires three resonances for its explanation. Two of these (that of mass 1234 {+-} 6 MeV and width 47 {+-} 33 MeV and that of mass 1478 {+-} 6 MeV and width 119 {+-} 10 MeV) were found in the studies of A. Etkin et al. [Phys. Rev. D 25, 2446 (1982)] and O.N. Baloshin et al. {l_brace}Yad. Fiz. 43, 1487 (1986) [Phys. At. Nucl. 43, 959 (1986)]{r_brace}. The third has a mass of 1389 {+-} 9 MeV and a width of 30 {+-} 24 MeV. At high momentum transfers, the S wave is found to feature resonances that have the following parameters: M = 1328 {+-} 8 MeV and {gamma} = 237 {+-} 20 MeV, M = 1440 {+-} 6 MeV and {gamma} = 121 {+-} 15 MeV, and M = 1776 {+-} 15 MeV and {gamma} 250 {+-} 30 MeV. For the D{sub 0} wave, it is found that, in addition to the well-known resonances f{sub 2}, a{sub 2}, and f'{sub 2}, there appear the following resonances in this wave: a resonance of mass 2005 {+-} 12 MeV and width 209 {+-} 32 MeV and a resonance of mass 2270 {+-} 12 MeV and width 90 {+-} 29 MeV at low vertical bar t vertical bar and a resonance of mass 1659 {+-} 6 and width 152 {+-} 18 and a resonance of mass 2200 {+-} 13 MeV and width 91 {+-} 62 MeV at high vertical bar t vertical bar.« less

  16. EVERY INTERACTING DOUBLE WHITE DWARF BINARY MAY MERGE

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Shen, Ken J.

    2015-05-20

    Interacting double white dwarf (WD) binaries can give rise to a wide variety of astrophysical outcomes ranging from faint thermonuclear and Type Ia supernovae to the formation of neutron stars and stably accreting AM Canum Venaticorum systems. One key factor affecting the final outcome is whether mass transfer remains dynamically stable or instead diverges, leading to the tidal disruption of the donor and the merger of the binary. It is typically thought that for low ratios of the donor mass to the accretor mass, mass transfer remains stable, especially if accretion occurs via a disk. In this Letter, we examinemore » low mass ratio double WD binaries and find that the initial phase of hydrogen-rich mass transfer leads to a classical nova-like outburst on the accretor. Dynamical friction within the expanding nova shell shrinks the orbit and causes the mass transfer rate to increase dramatically above the accretor's Eddington limit, possibly resulting in a binary merger. If the binary survives the first hydrogen-rich nova outbursts, dynamical friction within the subsequent helium-powered nova shells pushes the system even more strongly toward merger. While further calculations are necessary to confirm this outcome for the entire range of binaries previously thought to be dynamically stable, it appears likely that most, if not all, interacting double WD binaries will merge during the course of their evolution.« less

  17. Acceleration of plates using non-conventional explosives heavily-loaded with inert materials

    NASA Astrophysics Data System (ADS)

    Loiseau, J.; Petel, O. E.; Huneault, J.; Serge, M.; Frost, D. L.; Higgins, A. J.

    2014-05-01

    The detonation behavior of high explosives containing quantities of dense additives has been previously investigated with the observation that such systems depart dramatically from the approximately "gamma law" behavior typical of conventional explosives due to momentum transfer and thermalization between particles and detonation products. However, the influence of this non-ideal detonation behavior on the divergence speed of plates has been less thoroughly studied and existing literature suggests that the effect of dense additives cannot be explained solely through the straightforward application of the Gurney method with energy and density averaging of the explosive. In the current study, the acceleration history and terminal velocity of aluminum flyers launched by packed beds of granular material saturated by amine-sensitized nitromethane is reported. It was observed that terminal flyer velocity scales primarily with the ratio of flyer mass to mass of the explosive component; a fundamental feature of the Gurney method. Velocity decrement from the addition of particles was only 20%-30% compared to the resulting velocity if propelled by an equivalent quantity of neat explosive.

  18. Modeling aerosol suspension from soils and oceans as sources of micropollutants to air.

    PubMed

    Qureshi, Asif; MacLeod, Matthew; Hungerbühler, Konrad

    2009-10-01

    Soil and marine aerosol suspension are two physical mass transfer processes that are not usually included in models describing fate and transport of environmental pollutants. Here, we review the literature on soil and marine aerosol suspension and estimate aerosol suspension mass transfer velocities for inclusion in multimedia models, as a global average and on a 1 x 1 scale. The yearly, global average mass transfer velocity for soil aerosol suspension is estimated to be 6 x 10(-10)mh(-1), approximately an order of magnitude smaller than marine aerosol suspension, which is estimated to be 8 x 10(-9)mh(-1). Monthly averages of these velocities can be as high as 10(-7)mh(-1) and 10(-5)mh(-1) for soil and marine aerosol suspension, respectively, depending on location. We use a unit-world multimedia model to analyze the relevance of these two suspension processes as a mechanism that enhances long-range atmospheric transport of pollutants. This is done by monitoring a metric of long-range transport potential, phi-one thousand (phi1000), that denotes the fraction of modeled emissions to air, water or soil in a source region that reaches a distance of 1000 km in air. We find that when the yearly, globally averaged mass transfer velocity is used, marine aerosol suspension increases phi1000 only fractionally for both emissions to air and water. However, enrichment of substances in marine aerosols, or speciation between ionic and neutral forms in ocean water may increase the influence of this surface-to-air transfer process. Soil aerosol suspension can be the dominant process for soil-to-air transfer in an emission-to-soil scenario for certain substances that have a high affinity to soil. When a suspension mass transfer velocity near the maximum limit is used, soil suspension remains important if the emissions are made to soil, and marine aerosol suspension becomes important regardless of if emissions are made to air or water compartments. We recommend that multimedia models designed to assess the environmental fate and long-range transport behavior of substances with a range of chemical properties include both aerosol suspension processes, using the mass transfer velocities estimated here.

  19. Geoelectrical inference of mass transfer parameters using temporal moments

    USGS Publications Warehouse

    Day-Lewis, Frederick D.; Singha, Kamini

    2008-01-01

    We present an approach to infer mass transfer parameters based on (1) an analytical model that relates the temporal moments of mobile and bulk concentration and (2) a bicontinuum modification to Archie's law. Whereas conventional geochemical measurements preferentially sample from the mobile domain, electrical resistivity tomography (ERT) is sensitive to bulk electrical conductivity and, thus, electrolytic solute in both the mobile and immobile domains. We demonstrate the new approach, in which temporal moments of collocated mobile domain conductivity (i.e., conventional sampling) and ERT‐estimated bulk conductivity are used to calculate heterogeneous mass transfer rate and immobile porosity fractions in a series of numerical column experiments.

  20. Prediction of mass transfer coefficients in non-Newtonian fermentation media using first-principles methods.

    PubMed

    Radl, Stefan; Khinast, Johannes G

    2007-08-01

    Bubble flows in non-Newtonian fluids were analyzed using first-principles methods with the aim to compute and predict mass transfer coefficients in such fermentation media. The method we used is a Direct Numerical Simulation (DNS) of the reactive multiphase flow with deformable boundaries and interfaces. With this method, we are able for the first time to calculate mass transfer coefficients in non-Newtonian liquids of different rheologies without any experimental data. In the current article, shear-thinning fluids are considered. However, the results provide the basis for further investigations, such as the study of viscoelastic fluids. (c) 2007 Wiley Periodicals, Inc.

  1. Mass correlation between light and heavy reaction products in multinucleon transfer 197Au+130Te collisions

    NASA Astrophysics Data System (ADS)

    Galtarossa, F.; Corradi, L.; Szilner, S.; Fioretto, E.; Pollarolo, G.; Mijatović, T.; Montanari, D.; Ackermann, D.; Bourgin, D.; Courtin, S.; Fruet, G.; Goasduff, A.; Grebosz, J.; Haas, F.; Jelavić Malenica, D.; Jeong, S. C.; Jia, H. M.; John, P. R.; Mengoni, D.; Milin, M.; Montagnoli, G.; Scarlassara, F.; Skukan, N.; Soić, N.; Stefanini, A. M.; Strano, E.; Tokić, V.; Ur, C. A.; Valiente-Dobón, J. J.; Watanabe, Y. X.

    2018-05-01

    We studied multinucleon transfer reactions in the 197Au+130Te system at Elab=1.07 GeV by employing the PRISMA magnetic spectrometer coupled to a coincident detector. For each light fragment we constructed, in coincidence, the distribution in mass of the heavy partner of the reaction. With a Monte Carlo method, starting from the binary character of the reaction, we simulated the de-excitation process of the produced heavy fragments to be able to understand their final mass distribution. The total cross sections for pure neutron transfer channels have also been extracted and compared with calculations performed with the grazing code.

  2. Fluid and mass transfer at subduction interfaces-The field metamorphic record

    NASA Astrophysics Data System (ADS)

    Bebout, Gray E.; Penniston-Dorland, Sarah C.

    2016-01-01

    The interface between subducting oceanic slabs and the hanging wall is a structurally and lithologically complex region. Chemically disparate lithologies (sedimentary, mafic and ultramafic rocks) and mechanical mixtures thereof show heterogeneous deformation. These lithologies are tectonically juxtaposed at mm to km scales, particularly in more intensely sheared regions (mélange zones, which act as fluid channelways). This juxtaposition, commonly in the presence of a mobile fluid phase, offers up huge potential for mass transfer and related metasomatic alteration. Fluids in this setting appear capable of transporting mass over scales of kms, along flow paths with widely varying geometries and P-T trajectories. Current models of arc magmatism require km-scale migration of fluids from the interface into mantle wedge magma source regions and implicit in these models is the transport of any fluids generated in the subducting slab along and ultimately through the subduction interface. Field and geochemical studies of high- and ultrahigh-pressure metamorphic rocks elucidate the sources and compositions of fluids in subduction interfaces and the interplay between deformation and fluid and mass transfer in this region. Recent geophysical studies of the subduction interface - its thickness, mineralogy, density, and H2O content - indicate that its rheology greatly influences the ways in which the subducting plate is coupled with the hanging wall. Field investigation of the magnitude and styles of fluid-rock interaction in metamorphic rocks representing "seismogenic zone" depths (and greater) yields insight regarding the roles of fluids and elevated fluid pore pressure in the weakening of plate interface rocks and the deformation leading to seismic events. From a geochemical perspective, the plate interface contributes to shaping the "slab signature" observed in studies of the composition of arc volcanic rocks. Understanding the production of fluids with hybridized chemical/isotopic compositions could improve models aimed at identifying the relative contributions of end-member rock reservoirs through analyses of arc volcanic rocks. Production of rocks rich in hydrous minerals, along the subduction interface, could stabilize H2O to great depths in subduction zones and influence deep-Earth H2O cycling. Enhancement of decarbonation reactions and dissolution by fluid infiltration facilitated by deformation at the interface could influence the C flux from subducting slabs entering the sub-arc mantle wedge and various forearc reservoirs. In this paper, we consider records of fluid and mass transfer at localities representing various depths and structural expressions of evolving paleo-interfaces, ranging widely in structural character, the rock types involved (ultramafic, mafic, sedimentary), and the rheology of these rocks. We stress commonalities in styles of fluid and mass transfer as related to deformation style and the associated geometries of fluid mobility at subduction interfaces. Variations in thermal structure among individual margins will lead to significant differences in not only the rheology of subducting rocks, and thus seismicity, but also the profiles of devolatilization and melting, through the forearc and subarc, and the element/mineral solubilities in any aqueous fluids or silicate melts that are produced. One key factor in considering fluid and mass transfer in the subduction interface, influencing C cycling and other chemical additions to arcs, is the uncertain degree to which sub-crustal ultramafic rocks in downgoing slabs are hydrated and release H2O-rich fluids.

  3. Heat transfer within a flat micro heat pipe with extra liquid

    NASA Astrophysics Data System (ADS)

    Sprinceana, Silviu; Mihai, Ioan

    2016-12-01

    In the real functioning of flat micro heat pipe (FMHP), there can appear cases when the temperature from the vaporization zone can exceed a critical value caused by a sudden increase of the thermal flow. The heat transfer which is completed conductively through the copper wall of a FMHP vaporizer causes the vaporization of the work fluid. On the condenser, the condensation of the fluid vapors and the transfer of the condenser to the vaporizer can no longer be achieved. The solution proposed for enhancing heat transfer in the event of blockage phenomenon FMHP, it is the injection of a certain amount of working fluid in the vaporization zone. By this process the working fluid injected into the evaporator passes suddenly in the vapor, producing a cooling zone. The new product additional mass of vapor will leave the vaporization zone and will condense in condensation zone, thereby supplementing the amount of condensation. Thus resumes normal operating cycle of FMHP. For the experimental measurements made for the transfer of heat through the FMHP working fluid demineralized water, they were made two micro-capillary tubes of sintered copper layer. The first was filled with 1ml of demineralized water was dropped under vacuum until the internal pressure has reached a level of 1•104Pa. The second FMHP was filled with the same amount of working fluid was used and the same capillary inner layer over which was laid a polysynthetic material that will accrue an additional amount of fluid. In this case, the internal pressure was reduced to 1•104Pa.

  4. Identification and characterization of an oocyte factor required for development of porcine nuclear transfer embryos

    PubMed Central

    Miyamoto, Kei; Nagai, Kouhei; Kitamura, Naoya; Nishikawa, Tomoaki; Ikegami, Haruka; Binh, Nguyen T.; Tsukamoto, Satoshi; Matsumoto, Mai; Tsukiyama, Tomoyuki; Minami, Naojiro; Yamada, Masayasu; Ariga, Hiroyoshi; Miyake, Masashi; Kawarasaki, Tatsuo; Matsumoto, Kazuya; Imai, Hiroshi

    2011-01-01

    Nuclear reprogramming of differentiated cells can be induced by oocyte factors. Despite numerous attempts, these factors and mechanisms responsible for successful reprogramming remain elusive. Here, we identify one such factor, necessary for the development of nuclear transfer embryos, using porcine oocyte extracts in which some reprogramming events are recapitulated. After incubating somatic nuclei in oocyte extracts from the metaphase II stage, the oocyte proteins that were specifically and abundantly incorporated into the nuclei were identified by mass spectrometry. Among 25 identified proteins, we especially focused on a multifunctional protein, DJ-1. DJ-1 is present at a high concentration in oocytes from the germinal vesicle stage until embryos at the four-cell stage. Inhibition of DJ-1 function compromises the development of nuclear transfer embryos but not that of fertilized embryos. Microarray analysis of nuclear transfer embryos in which DJ-1 function is inhibited shows perturbed expression of P53 pathway components. In addition, embryonic arrest of nuclear transfer embryos injected with anti–DJ-1 antibody is rescued by P53 inhibition. We conclude that DJ-1 is an oocyte factor that is required for development of nuclear transfer embryos. This study presents a means for identifying natural reprogramming factors in mammalian oocytes and a unique insight into the mechanisms underlying reprogramming by nuclear transfer. PMID:21482765

  5. Upward and downward heat and mass transfer with miniature periodically operating loop thermosyphons

    NASA Astrophysics Data System (ADS)

    Fantozzi, Fabio; Filippeschi, Sauro; Latrofa, Enrico Maria

    2004-03-01

    Upward and downward two-phase heat and mass transfer has been considered in the present paper. The heat and mass transfer with the condenser located below the evaporator has been obtained by inserting an accumulator tank in the liquid line of a loop thermosyphon and enforcing a pressure pulsation. In previous papers these heat transfer devices have been called pulsated two phase thermosyphons (PTPT). A mini PTPT has been experimentally investigated. It has shown a stable periodic heat transfer regime weakly influenced by the position of the condenser with respect to the evaporator. In contrast a classical loop mini thermosyphon (diameter of connecting pipes 4 mm) did not achieve a stable functioning for the investigated level differences between evaporator and condenser lower than 0.37 m. The present study shows that the functioning of a PTPT device does not directly depend on the level difference or the presence of noncondensable gas. In order to obtain a natural circulation in mini or micro loops, a periodically operating heat transfer regime should therefore be considered.

  6. Mass Transfer Study of Chlorine Dioxide Gas Through Polymeric Packaging Materials

    USDA-ARS?s Scientific Manuscript database

    A continuous system for measuring the mass transfer of gaseous chlorine dioxide (ClO2), a strong oxidizing agent and used in food and pharmaceutical packaging, through 10 different types of polymeric packaging material was developed utilizing electrochemical sensor as a detector. Permeability, diff...

  7. Smoothed particle hydrodynamics method for evaporating multiphase flows.

    PubMed

    Yang, Xiufeng; Kong, Song-Charng

    2017-09-01

    The smoothed particle hydrodynamics (SPH) method has been increasingly used for simulating fluid flows; however, its ability to simulate evaporating flow requires significant improvements. This paper proposes an SPH method for evaporating multiphase flows. The present SPH method can simulate the heat and mass transfers across the liquid-gas interfaces. The conservation equations of mass, momentum, and energy were reformulated based on SPH, then were used to govern the fluid flow and heat transfer in both the liquid and gas phases. The continuity equation of the vapor species was employed to simulate the vapor mass fraction in the gas phase. The vapor mass fraction at the interface was predicted by the Clausius-Clapeyron correlation. An evaporation rate was derived to predict the mass transfer from the liquid phase to the gas phase at the interface. Because of the mass transfer across the liquid-gas interface, the mass of an SPH particle was allowed to change. Alternative particle splitting and merging techniques were developed to avoid large mass difference between SPH particles of the same phase. The proposed method was tested by simulating three problems, including the Stefan problem, evaporation of a static drop, and evaporation of a drop impacting a hot surface. For the Stefan problem, the SPH results of the evaporation rate at the interface agreed well with the analytical solution. For drop evaporation, the SPH result was compared with the result predicted by a level-set method from the literature. In the case of drop impact on a hot surface, the evolution of the shape of the drop, temperature, and vapor mass fraction were predicted.

  8. Motility and Flagellar Glycosylation in Clostridium difficile▿ †

    PubMed Central

    Twine, Susan M.; Reid, Christopher W.; Aubry, Annie; McMullin, David R.; Fulton, Kelly M.; Austin, John; Logan, Susan M.

    2009-01-01

    In this study, intact flagellin proteins were purified from strains of Clostridium difficile and analyzed using quadrupole time of flight and linear ion trap mass spectrometers. Top-down studies showed the flagellin proteins to have a mass greater than that predicted from the corresponding gene sequence. These top-down studies revealed marker ions characteristic of glycan modifications. Additionally, diversity in the observed masses of glycan modifications was seen between strains. Electron transfer dissociation mass spectrometry was used to demonstrate that the glycan was attached to the flagellin protein backbone in O linkage via a HexNAc residue in all strains examined. Bioinformatic analysis of C. difficile genomes revealed diversity with respect to glycan biosynthesis gene content within the flagellar biosynthesis locus, likely reflected by the observed flagellar glycan diversity. In C. difficile strain 630, insertional inactivation of a glycosyltransferase gene (CD0240) present in all sequenced genomes resulted in an inability to produce flagellar filaments at the cell surface and only minor amounts of unmodified flagellin protein. PMID:19749038

  9. Boron nitride nanotubes matrix for signal enhancement in infrared laser desorption postionization mass spectrometry.

    PubMed

    Lu, Qiao; Hu, Yongjun; Chen, Jiaxin; Li, Yujian; Song, Wentao; Jin, Shan; Liu, Fuyi; Sheng, Liusi

    2018-09-01

    The nanomaterials function as the substrate to trap analytes, absorb energy from the laser irradiation and transfer energy to the analytes to facilitate the laser desorption process. In this work, the signal intensity and reproducibility of analytes with nanomaterials as matrices were explored by laser desorption postionization mass spectrometry (LDPI-MS). Herein, the desorbed neutral species were further ionized by vacuum ultraviolet (VUV, 118 nm) and analyzed by mass spectrometer. Compared with other nanomaterial matrices such as graphene and carbon nanotubes (CNTs), boron nitride nanotubes (BNNTs) exhibited much higher desorption efficiency under infrared (IR) light and produced no background signal in the whole mass range by LDPI-MS. Additionally, this method was successfully and firstly exploited to in situ detection and imaging for drugs of low concentration in intact tissues, which proved the utility, facility and convenience of this method applied in drug discovery and biomedical research. Copyright © 2018 Elsevier B.V. All rights reserved.

  10. Verification and validation of an advanced model of heat and mass transfer in the protective clothing

    NASA Astrophysics Data System (ADS)

    Łapka, Piotr; Furmański, Piotr

    2018-04-01

    The paper presents verification and validation of an advanced numerical model of heat and moisture transfer in the multi-layer protective clothing and in components of the experimental stand subjected to either high surroundings temperature or high radiative heat flux emitted by hot objects. The developed model included conductive-radiative heat transfer in the hygroscopic porous fabrics and air gaps as well as conductive heat transfer in components of the stand. Additionally, water vapour diffusion in the pores and air spaces as well as phase transition of the bound water in the fabric fibres (sorption and desorption) were accounted for. All optical phenomena at internal or external walls were modelled and the thermal radiation was treated in the rigorous way, i.e., semi-transparent absorbing, emitting and scattering fabrics with the non-grey properties were assumed. The air was treated as transparent. Complex energy and mass balances as well as optical conditions at internal or external interfaces were formulated in order to find values of temperatures, vapour densities and radiation intensities at these interfaces. The obtained highly non-linear coupled system of discrete equations was solved by the Finite Volume based in-house iterative algorithm. The developed model passed discretisation convergence tests and was successfully verified against the results obtained applying commercial software for simplified cases. Then validation was carried out using experimental measurements collected during exposure of the protective clothing to high radiative heat flux emitted by the IR lamp. Satisfactory agreement of simulated and measured temporal variation of temperature at external and internal surfaces of the multi-layer clothing was attained.

  11. LUT observations of the mass-transferring binary AI Dra

    NASA Astrophysics Data System (ADS)

    Liao, Wenping; Qian, Shengbang; Li, Linjia; Zhou, Xiao; Zhao, Ergang; Liu, Nianping

    2016-06-01

    Complete UV band light curve of the eclipsing binary AI Dra was observed with the Lunar-based Ultraviolet Telescope (LUT) in October 2014. It is very useful to adopt this continuous and uninterrupted light curve to determine physical and orbital parameters of the binary system. Photometric solutions of the spot model are obtained by using the W-D (Wilson and Devinney) method. It is confirmed that AI Dra is a semi-detached binary with secondary component filling its critical Roche lobe, which indicates that a mass transfer from the secondary component to the primary one should happen. Orbital period analysis based on all available eclipse times suggests a secular period increase and two cyclic variations. The secular period increase was interpreted by mass transfer from the secondary component to the primary one at a rate of 4.12 ×10^{-8}M_{⊙}/yr, which is in agreement with the photometric solutions. Two cyclic oscillations were due to light travel-time effect (LTTE) via the presence of two cool stellar companions in a near 2:1 mean-motion resonance. Both photometric solutions and orbital period analysis confirm that AI Dra is a mass-transferring binary, the massive primary is filling 69 % of its critical Roche lobe. After the primary evolves to fill the critical Roche lobe, the mass transfer will be reversed and the binary will evolve into a contact configuration.

  12. Experimental and CFD-PBM Study of Oxygen Mass Transfer Coefficient in Different Impeller Configurations and Operational Conditions of a Two-Phase Partitioning Bioreactor.

    PubMed

    Moradkhani, Hamed; Izadkhah, Mir-Shahabeddin; Anarjan, Navideh

    2017-02-01

    In this work, gas dispersion in a two-phase partitioning bioreactor is analyzed by calculating volumetric oxygen mass transfer coefficient which is modeled using a commercial computational fluid dynamics (CFD), code FLUENT 6.2. Dispersed oxygen bubbles dynamics is based on standard "k-ε" Reynolds-averaged Navier-Stokes (RANS) model. This paper describes a three-dimensional CFD model coupled with population balance equations (PBE) in order to get more confirming results of experimental measurements. Values of k L a are obtained using dynamic gassing-out method. Using the CFD simulation, the volumetric mass transfer coefficient is calculated based on Higbie's penetration theory. Characteristics of mass transfer coefficient are investigated for five configurations of impeller and three different aeration flow rates. The pitched six blade type, due to the creation of downward flow direction, leads to higher dissolved oxygen (DO) concentrations, thereby, higher values of k L a compared with other impeller compositions. The magnitude of dissolved oxygen percentage in the aqueous phase has direct correlation with impeller speed and any increase of the aeration magnitude leads to faster saturation in shorter periods of time. Agitation speeds of 300 to 800 rpm are found to be the most effective rotational speeds for the mass transfer of oxygen in two-phase partitioning bioreactors (TPPB).

  13. A novel inverse numerical modeling method for the estimation of water and salt mass transfer coefficients during ultrasonic assisted-osmotic dehydration of cucumber cubes.

    PubMed

    Kiani, Hosein; Karimi, Farzaneh; Labbafi, Mohsen; Fathi, Morteza

    2018-06-01

    The objective of this paper was to study the moisture and salt diffusivity during ultrasonic assisted-osmotic dehydration of cucumbers. Experimental measurements of moisture and salt concentration versus time were carried out and an inverse numerical method was performed by coupling a CFD package (OpenFOAM) with a parameter estimation software (DAKOTA) to determine mass transfer coefficients. A good agreement between experimental and numerical results was observed. Mass transfer coefficients were from 3.5 × 10 -9 to 7 × 10 -9  m/s for water and from 4.8 × 10 -9  m/s to 7.4 × 10 -9  m/s for salt at different conditions (diffusion coefficients of around 3.5 × 10 -12 -11.5 × 10 -12  m 2 /s for water and 5 × 10 -12  m/s-12 × 10 -12  m 2 /s for salt). Ultrasound irradiation could increase the mass transfer coefficient. The values obtained by this method were closer to the actual data. The inverse simulation method can be an accurate technique to study the mass transfer phenomena during food processing. Copyright © 2018 Elsevier B.V. All rights reserved.

  14. Mixing and solid-liquid mass-transfer rates in a creusot-loire uddeholm vessel: A water model case study

    NASA Astrophysics Data System (ADS)

    Nyoka, M.; Akdogan, G.; Eric, R. H.; Sutcliffe, N.

    2003-12-01

    The process of mixing and solid-liquid mass transfer in a one-fifth scale water model of a 100-ton Creusot-Loire Uddeholm (CLU) converter was investigated. The modified Froude number was used to relate gas flow rates between the model and its protoype. The influences of gas flow rate between 0.010 and 0.018 m3/s and bath height from 0.50 to 0.70 m on mixing time were examined. The results indicated that mixing time decreased with increasing gas flow rate and increased with increasing bath height. The mixing time results were evaluated in terms of specific energy input and the following correlation was proposed for estimating mixing times in the model CLU converter: T mix=1.08Q -1.05 W 0.35, where Q (m3/s) is the gas flow rate and W (tons) is the model bath weight. Solid-liquid mass-transfer rates from benzoic acid specimens immersed in the gas-agitated liquid phase were assessed by a weight loss measurement technique. The calculated mass-transfer coefficients were highest at the bath surface reaching a value of 6.40 × 10-5 m/s in the sprout region. Mass-transfer coefficients and turbulence parameters decreased with depth, reaching minimum values at the bottom of the vessel.

  15. First isolation and antinociceptive activity of a lipid transfer protein from noni (Morinda citrifolia) seeds.

    PubMed

    Campos, Dyély C O; Costa, Andrea S; Lima, Amanda D R; Silva, Fredy D A; Lobo, Marina D P; Monteiro-Moreira, Ana Cristina O; Moreira, Renato A; Leal, Luzia K A M; Miron, Diogo; Vasconcelos, Ilka M; Oliveira, Hermógenes D

    2016-05-01

    In this study a novel heat-stable lipid transfer protein, designated McLTP1, was purified from noni (Morinda citrifolia L.) seeds, using four purification steps which resulted in a high-purified protein yield (72 mg McLTP1 from 100g of noni seeds). McLTP1 exhibited molecular masses of 9.450 and 9.466 kDa, determined by electrospray ionisation mass spectrometry. The N-terminal sequence of McLTP1 (AVPCGQVSSALSPCMSYLTGGGDDPEARCCAGV), as analysed by NCBI-BLAST database, revealed a high degree of identity with other reported plant lipid transfer proteins. In addition, this protein proved to be resistant to pepsin, trypsin and chymotrypsin digestion. McLTP1 given intraperitoneally (1, 2, 4 and 8 mg/kg) and orally (8 mg/kg) caused an inhibition of the writhing response induced by acetic acid in mice. This protein displayed thermostability, retaining 100% of its antinociceptive activity after 30 min incubation at 80 °C. Pretreatment of mice with McLTP1 (8 mg/kg, i.p. and p.o.) also decreased neurogenic and inflammatory phases of nociception in the formalin test. Naloxone (2 mg/kg, i.p.) antagonised the antinociceptive effect of McLTP1 suggesting that the opioid mechanisms mediate the analgesic properties of this protein. Copyright © 2016 Elsevier B.V. All rights reserved.

  16. Visualisation of gas-liquid mass transfer around a rising bubble in a quiescent liquid using an oxygen sensitive dye

    NASA Astrophysics Data System (ADS)

    Dietrich, Nicolas; Hebrard, Gilles

    2018-02-01

    An approach for visualizing and measuring the mass transfer around a single bubble rising in a quiescent liquid is reported. A colorimetric technique, developed by (Dietrich et al. Chem Eng Sci 100:172-182, 2013) using an oxygen sensitive redox dye was implemented. It was based on the reduction of the colorimetric indicator in presence of oxygen, this reduction being catalysed by sodium hydroxide and glucose. In this study, resazurin was selected because it offered various reduced forms with colours ranging from transparent (without oxygen) to pink (in presence of oxygen). These advantages made it possible to visualize the spatio-temporal oxygen mass transfer around rising bubbles. Images were recorded by a CCD camera and, after post-processing, the shape, size, and velocity of the bubbles were measured and the colours around the bubbles mapped. A calibration, linking the level of colour with the dissolved oxygen concentration, enabled colour maps to be converted into oxygen concentration fields. A rheoscopic fluid was used to visualize the wake of the bubbles. A calculation method was also developed to determine the transferred oxygen fluxes around bubbles of two sizes (d = 0.82 mm and d = 2.12 mm) and the associated liquid-side mass transfer coefficients. The results compared satisfactorily with classical global measurements made by oxygen micro-sensors or from the classical models. This study thus constitutes a striking example of how this new colorimetric method could become a remarkable tool for exploring gas-liquid mass transfer in fluids.

  17. Mass transfer characteristics during convective, microwave and combined microwave-convective drying of lemon slices.

    PubMed

    Sadeghi, Morteza; Mirzabeigi Kesbi, Omid; Mireei, Seyed Ahmad

    2013-02-01

    The investigation of drying kinetics and mass transfer phenomena is important for selecting optimum operating conditions, and obtaining a high quality dried product. Two analytical models, conventional solution of the diffusion equation and the Dincer and Dost model, were used to investigate mass transfer characteristics during combined microwave-convective drying of lemon slices. Air temperatures of 50, 55 and 60 °C, and specific microwave powers of 0.97 and 2.04 W g(-1) were the process variables. Kinetics curves for drying indicated one constant rate period followed by one falling rate period in convective and microwave drying methods, and only one falling rate period with the exception of a very short accelerating period at the beginning of microwave-convective treatments. Applying the conventional method, the effective moisture diffusivity varied from 2.4 × 10(-11) to 1.2 × 10(-9) m(2) s(-1). The Biot number, the moisture transfer coefficient, and the moisture diffusivity, respectively in the ranges of 0.2 to 3.0 (indicating simultaneous internal and external mass transfer control), 3.7 × 10(-8) to 4.3 × 10(-6) m s(-1), and 2.2 × 10(-10) to 4.2 × 10(-9) m(2) s(-1) were also determined using the Dincer and Dost model. The higher degree of prediction accuracy was achieved by using the Dincer and Dost model for all treatments. Therefore, this model could be applied as an effective tool for predicting mass transfer characteristics during the drying of lemon slices. Copyright © 2012 Society of Chemical Industry.

  18. Visualisation of gas-liquid mass transfer around a rising bubble in a quiescent liquid using an oxygen sensitive dye

    NASA Astrophysics Data System (ADS)

    Dietrich, Nicolas; Hebrard, Gilles

    2018-07-01

    An approach for visualizing and measuring the mass transfer around a single bubble rising in a quiescent liquid is reported. A colorimetric technique, developed by (Dietrich et al. Chem Eng Sci 100:172-182, 2013) using an oxygen sensitive redox dye was implemented. It was based on the reduction of the colorimetric indicator in presence of oxygen, this reduction being catalysed by sodium hydroxide and glucose. In this study, resazurin was selected because it offered various reduced forms with colours ranging from transparent (without oxygen) to pink (in presence of oxygen). These advantages made it possible to visualize the spatio-temporal oxygen mass transfer around rising bubbles. Images were recorded by a CCD camera and, after post-processing, the shape, size, and velocity of the bubbles were measured and the colours around the bubbles mapped. A calibration, linking the level of colour with the dissolved oxygen concentration, enabled colour maps to be converted into oxygen concentration fields. A rheoscopic fluid was used to visualize the wake of the bubbles. A calculation method was also developed to determine the transferred oxygen fluxes around bubbles of two sizes (d = 0.82 mm and d = 2.12 mm) and the associated liquid-side mass transfer coefficients. The results compared satisfactorily with classical global measurements made by oxygen micro-sensors or from the classical models. This study thus constitutes a striking example of how this new colorimetric method could become a remarkable tool for exploring gas-liquid mass transfer in fluids.

  19. A mathematical analysis of drug dissolution in the USP flow through apparatus

    NASA Astrophysics Data System (ADS)

    McDonnell, David; D'Arcy, D. M.; Crane, L. J.; Redmond, Brendan

    2018-03-01

    This paper applies boundary layer theory to the process of drug dissolution in the USP (United States Pharmacopeia) Flow Through Apparatus. The mass transfer rate from the vertical planar surface of a compact within the device is examined. The theoretical results obtained are then compared with those of experiment. The paper also examines the effect on the dissolution process caused by the interaction between natural and forced convection within the apparatus and the introduction of additional boundaries.

  20. Drag reduction in nature

    NASA Technical Reports Server (NTRS)

    Bushnell, D. M.; Moore, K. J.

    1991-01-01

    Recent studies on the drag-reducing shapes, structures, and behaviors of swimming and flying animals are reviewed, with an emphasis on potential analogs in vehicle design. Consideration is given to form drag reduction (turbulent flow, vortex generation, mass transfer, and adaptations for body-intersection regions), skin-friction drag reduction (polymers, surfactants, and bubbles as surface 'additives'), reduction of the drag due to lift, drag-reduction studies on porpoises, and drag-reducing animal behavior (e.g., leaping out of the water by porpoises). The need for further research is stressed.

  1. Method for reduction of selected ion intensities in confined ion beams

    DOEpatents

    Eiden, Gregory C.; Barinaga, Charles J.; Koppenaal, David W.

    1998-01-01

    A method for producing an ion beam having an increased proportion of analyte ions compared to carrier gas ions is disclosed. Specifically, the method has the step of addition of a charge transfer gas to the carrier analyte combination that accepts charge from the carrier gas ions yet minimally accepts charge from the analyte ions thereby selectively neutralizing the carrier gas ions. Also disclosed is the method as employed in various analytical instruments including an inductively coupled plasma mass spectrometer.

  2. Method for reduction of selected ion intensities in confined ion beams

    DOEpatents

    Eiden, G.C.; Barinaga, C.J.; Koppenaal, D.W.

    1998-06-16

    A method for producing an ion beam having an increased proportion of analyte ions compared to carrier gas ions is disclosed. Specifically, the method has the step of addition of a charge transfer gas to the carrier analyte combination that accepts charge from the carrier gas ions yet minimally accepts charge from the analyte ions thereby selectively neutralizing the carrier gas ions. Also disclosed is the method as employed in various analytical instruments including an inductively coupled plasma mass spectrometer. 7 figs.

  3. Numerical Modeling of Conjugate Heat Transfer in Fluid Network

    NASA Technical Reports Server (NTRS)

    Majumdar, Alok

    2004-01-01

    Fluid network modeling with conjugate heat transfer has many applications in Aerospace engineering. In modeling unsteady flow with heat transfer, it is important to know the variation of wall temperature in time and space to calculate heat transfer between solid to fluid. Since wall temperature is a function of flow, a coupled analysis of temperature of solid and fluid is necessary. In cryogenic applications, modeling of conjugate heat transfer is of great importance to correctly predict boil-off rate in propellant tanks and chill down of transfer lines. In TFAWS 2003, the present author delivered a paper to describe a general-purpose computer program, GFSSP (Generalized Fluid System Simulation Program). GFSSP calculates flow distribution in complex flow circuit for compressible/incompressible, with or without heat transfer or phase change in all real fluids or mixtures. The flow circuit constitutes of fluid nodes and branches. The mass, energy and specie conservation equations are solved at the nodes where as momentum conservation equations are solved at the branches. The proposed paper describes the extension of GFSSP to model conjugate heat transfer. The network also includes solid nodes and conductors in addition to fluid nodes and branches. The energy conservation equations for solid nodes solves to determine the temperatures of the solid nodes simultaneously with all conservation equations governing fluid flow. The numerical scheme accounts for conduction, convection and radiation heat transfer. The paper will also describe the applications of the code to predict chill down of cryogenic transfer line and boil-off rate of cryogenic propellant storage tank.

  4. Mathematical Model of Two Phase Flow in Natural Draft Wet-Cooling Tower Including Flue Gas Injection

    NASA Astrophysics Data System (ADS)

    Hyhlík, Tomáš

    2016-03-01

    The previously developed model of natural draft wet-cooling tower flow, heat and mass transfer is extended to be able to take into account the flow of supersaturated moist air. The two phase flow model is based on void fraction of gas phase which is included in the governing equations. Homogeneous equilibrium model, where the two phases are well mixed and have the same velocity, is used. The effect of flue gas injection is included into the developed mathematical model by using source terms in governing equations and by using momentum flux coefficient and kinetic energy flux coefficient. Heat and mass transfer in the fill zone is described by the system of ordinary differential equations, where the mass transfer is represented by measured fill Merkel number and heat transfer is calculated using prescribed Lewis factor.

  5. Combined heat and mass transfer device for improving separation process

    DOEpatents

    Tran, Thanh Nhon

    1999-01-01

    A two-phase small channel heat exchange matrix simultaneously provides for heat transfer and mass transfer between the liquid and vapor phases of a multi-component mixture at a single, predetermined location within a separation column, significantly improving the thermodynamic efficiency of the separation process. The small channel heat exchange matrix is composed of a series of channels having a hydraulic diameter no greater than 5.0 millimeters for conducting a two-phase coolant. In operation, the matrix provides the liquid-vapor contacting surfaces within the separation column, such that heat and mass are transferred simultaneously between the liquid and vapor phases. The two-phase coolant allows for a uniform heat transfer coefficient to be maintained along the length of the channels and across the surface of the matrix. Preferably, a perforated, concave sheet connects each channel to an adjacent channel to facilitate the flow of the liquid and vapor phases within the column and to increase the liquid-vapor contacting surface area.

  6. Combined heat and mass transfer device for improving separation process

    DOEpatents

    Tran, T.N.

    1999-08-24

    A two-phase small channel heat exchange matrix simultaneously provides for heat transfer and mass transfer between the liquid and vapor phases of a multi-component mixture at a single, predetermined location within a separation column, significantly improving the thermodynamic efficiency of the separation process. The small channel heat exchange matrix is composed of a series of channels having a hydraulic diameter no greater than 5.0 millimeters for conducting a two-phase coolant. In operation, the matrix provides the liquid-vapor contacting surfaces within the separation column, such that heat and mass are transferred simultaneously between the liquid and vapor phases. The two-phase coolant allows for a uniform heat transfer coefficient to be maintained along the length of the channels and across the surface of the matrix. Preferably, a perforated, concave sheet connects each channel to an adjacent channel to facilitate the flow of the liquid and vapor phases within the column and to increase the liquid-vapor contacting surface area. 12 figs.

  7. Experimental study of the condensation heat transfer characteristics of CO2 in a horizontal microfin tube with a diameter of 4.95 mm

    NASA Astrophysics Data System (ADS)

    Son, Chang-Hyo; Oh, Hoo-Kyu

    2012-11-01

    The condensation heat transfer characteristics for CO2 flowing in a horizontal microfin tube were investigated by experiment with respect to condensation temperature and mass flux. The test section consists of a 2,400 mm long horizontal copper tube of 4.6 mm inner diameter. The experiments were conducted at refrigerant mass flux of 400-800 kg/m2s, and saturation temperature of 20-30 °C. The main experimental results showed that annular flow was highly dominated the majority of condensation flow in the horizontal microfin tube. The condensation heat transfer coefficient increases with decreasing saturation temperature and increasing mass flux. The experimental data were compared against previous heat transfer correlations. Most correlations failed to predict the experimental data. However, the correlation by Cavallini et al. showed relatively good agreement with experimental data in the microfin tube. Therefore, a new condensation heat transfer correlation is proposed with mean and average deviations of 3.14 and -7.6 %, respectively.

  8. A METHOD FOR ESTIMATING DISTRIBUTIONS OF MASS TRANSFER RATE COEFFICIENTS WITH APPLICATION TO PURGING AND BATCH EXPERIMENTS. (R825825)

    EPA Science Inventory

    Mass transfer between aquifer material and groundwater is often modeled as first-order rate-limited sorption or diffusive exchange between mobile zones and immobile zones with idealized geometries. Recent improvements in experimental techniques and advances in our understanding o...

  9. DETERMINATION OF THE MASS TRANSFER CHARACTERIZATION OF A CERAMIC-POLYMER COMPOSITE MEMBRANE IN THE PERVAPORATION MODE

    EPA Science Inventory

    The effect of the coating layer thickness on VOC extraction performance of a ceramic polymer composite membrane has been investigated. It was found, under experimental condiitons representing typical field operation, the overall mass transfer rates of feed components were control...

  10. An overview of recent applications of computational modelling in neonatology

    PubMed Central

    Wrobel, Luiz C.; Ginalski, Maciej K.; Nowak, Andrzej J.; Ingham, Derek B.; Fic, Anna M.

    2010-01-01

    This paper reviews some of our recent applications of computational fluid dynamics (CFD) to model heat and mass transfer problems in neonatology and investigates the major heat and mass-transfer mechanisms taking place in medical devices, such as incubators, radiant warmers and oxygen hoods. It is shown that CFD simulations are very flexible tools that can take into account all modes of heat transfer in assisting neonatal care and improving the design of medical devices. PMID:20439275

  11. Experimental investigation of the heat and mass transfer in a tube bundle absorber of an absorption chiller

    NASA Astrophysics Data System (ADS)

    Olbricht, Michael; Luke, Andrea

    2018-05-01

    The design of the absorber of absorption chillers is still subject to great uncertainty since the coupled processes of heat and mass transfer as well as the influence of systemic interactions on the absorption process are not fully understood. Unfortunately, only a few investigations on the transport phenomena in the absorber during operation in an absorption chiller are reported in the literature. Therefore, experimental investigations on the heat and mass transfer during falling film absorption of steam in aqueous LiBr-solution are carried out in an absorber installed in an absorption chiller in this work. An improvement of heat and mass transfer due to the increase in convective effects are observed as the Ref number increases. Furthermore, an improvement of the heat transfer in the absorber with increasing coolant temperature can be identified in the systemic context. This is explained by a corresponding reduction in the average viscosity of the solution in the absorber. A comparison with experimental data from literature obtained from so-called absorber-generator test rigs shows a good consistency. Thus, it has been shown that the findings obtained on these simplified experimental setups can be transferred to the absorber in an absorption chiller. However, a comparison with correlations from the literature reveals a strong deviation between experimental and calculated results. Hence, further research activities on the development of better correlations are required in future.

  12. Massive graviton dark matter with environment dependent mass: A natural explanation of the dark matter-baryon ratio

    NASA Astrophysics Data System (ADS)

    Aoki, Katsuki; Mukohyama, Shinji

    2017-11-01

    We propose a scenario that can naturally explain the observed dark matter-baryon ratio in the context of bimetric theory with a chameleon field. We introduce two additional gravitational degrees of freedom, the massive graviton and the chameleon field, corresponding to dark matter and dark energy, respectively. The chameleon field is assumed to be nonminimally coupled to dark matter, i.e., the massive graviton, through the graviton mass terms. We find that the dark matter-baryon ratio is dynamically adjusted to the observed value due to the energy transfer by the chameleon field. As a result, the model can explain the observed dark matter-baryon ratio independently from the initial abundance of them.

  13. The embodiment design of the heat rejection system for the portable life support system

    NASA Technical Reports Server (NTRS)

    Stuckwisch, Sue; Francois, Jason; Laughlin, Julia; Phillips, Lee; Carrion, Carlos A.

    1994-01-01

    The Portable Life Support System (PLSS) provides a suitable environment for the astronaut in the Extravehicular Mobility Unit (EMU), and the heat rejection system controls the thermal conditions in the space suit. The current PLSS sublimates water to the space environment; therefore, the system loses mass. Since additional supplies of fluid must be available on the Space Shuttle, NASA desires a closed heat rejecting system. This document presents the embodiment design for a radiative plate heat rejection system without mass transfer to the space environment. This project will transform the concept variant into a design complete with material selection, dimensions of the system, layouts of the heat rejection system, suggestions for manufacturing, and financial viability.

  14. NACRE II: an update of the NACRE compilation of charged-particle-induced thermonuclear reaction rates for nuclei with mass number A<16

    NASA Astrophysics Data System (ADS)

    Xu, Y.; Takahashi, K.; Goriely, S.; Arnould, M.; Ohta, M.; Utsunomiya, H.

    2013-11-01

    An update of the NACRE compilation [3] is presented. This new compilation, referred to as NACRE II, reports thermonuclear reaction rates for 34 charged-particle induced, two-body exoergic reactions on nuclides with mass number A<16, of which fifteen are particle-transfer reactions and the rest radiative capture reactions. When compared with NACRE, NACRE II features in particular (1) the addition to the experimental data collected in NACRE of those reported later, preferentially in the major journals of the field by early 2013, and (2) the adoption of potential models as the primary tool for extrapolation to very low energies of astrophysical S-factors, with a systematic evaluation of uncertainties.

  15. Accelerating research into bio-based FDCA-polyesters by using small scale parallel film reactors.

    PubMed

    Gruter, Gert-Jan M; Sipos, Laszlo; Adrianus Dam, Matheus

    2012-02-01

    High Throughput experimentation has been well established as a tool in early stage catalyst development and catalyst and process scale-up today. One of the more challenging areas of catalytic research is polymer catalysis. The main difference with most non-polymer catalytic conversions is the fact that the product is not a well defined molecule and the catalytic performance cannot be easily expressed only in terms of catalyst activity and selectivity. In polymerization reactions, polymer chains are formed that can have various lengths (resulting in a molecular weight distribution rather than a defined molecular weight), that can have different compositions (when random or block co-polymers are produced), that can have cross-linking (often significantly affecting physical properties), that can have different endgroups (often affecting subsequent processing steps) and several other variations. In addition, for polyolefins, mass and heat transfer, oxygen and moisture sensitivity, stereoregularity and many other intrinsic features make relevant high throughput screening in this field an incredible challenge. For polycondensation reactions performed in the melt often the viscosity becomes already high at modest molecular weights, which greatly influences mass transfer of the condensation product (often water or methanol). When reactions become mass transfer limited, catalyst performance comparison is often no longer relevant. This however does not mean that relevant experiments for these application areas cannot be performed on small scale. Relevant catalyst screening experiments for polycondensation reactions can be performed in very efficient small scale parallel equipment. Both transesterification and polycondensation as well as post condensation through solid-stating in parallel equipment have been developed. Next to polymer synthesis, polymer characterization also needs to be accelerated without making concessions to quality in order to draw relevant conclusions.

  16. Energy dissipation/transfer and stable attitude of spatial on-orbit tethered system

    NASA Astrophysics Data System (ADS)

    Hu, Weipeng; Song, Mingzhe; Deng, Zichen

    2018-01-01

    For the Tethered Satellite System, the coupling between the platform system and the solar panel is a challenge in the dynamic analysis. In this paper, the coupling dynamic behaviors of the Tethered Satellite System that is idealized as a planar flexible damping beam-spring-mass composite system are investigated via a structure-preserving method. Considering the coupling between the plane motion of the system, the oscillation of the spring and the transverse vibration of the beam, the dynamic model of the composite system is established based on the Hamiltonian variational principle. A symplectic dimensionality reduction method is proposed to decouple the dynamic system into two subsystems approximately. Employing the complex structure-preserving approach presented in our previous work, numerical iterations are performed between the two subsystems with weak damping to study the energy dissipation/transfer in the composite system, the effect of the spring stiffness on the energy distribution and the effect of the particle mass on the stability of the composite system. The numerical results show that: the energy transfer approach is uniquely determined by the initial attitude angle, while the energy dissipation speed is mainly depending on the initial attitude angle and the spring stiffness besides the weak damping. In addition, the mass ratio between the platform system and the solar panel determines the stable state as well as the time needed to reach the stable state of the composite system. The numerical approach presented in this paper provides a new way to deal with the coupling dynamic system and the conclusions obtained give some useful advices on the overall design of the Tethered Satellite System.

  17. Characterization of Polyester Cloth as an Alternative Separator to Nafion Membrane in Microbial Fuel Cells for Bioelectricity Generation Using Swine Wastewater.

    PubMed

    Kim, Taeyoung; Kang, Sukwon; Sung, Je Hoon; Kang, Youn Koo; Kim, Young Hwa; Jang, Jae Kyung

    2016-12-28

    Polyester cloth (PC) was selected as a prospective inexpensive substitute separator material for microbial fuel cells (MFCs). PC was compared with a traditional Nafion proton exchange membrane (PEM) as an MFC separator by analyzing its physical and electrochemical properties. A single layer of PC showed higher mass transfer ( e.g ., for O₂/H⁺/ions) than the Nafion PEM; in the case of oxygen mass transfer coefficient (k o ), a rate of 50.0 × 10⁻⁵ cm·s⁻¹ was observed compared with a rate of 20.8 × 10⁻⁵ cm/s in the Nafion PEM. Increased numbers of PC layers were found to reduce the oxygen mass transfer coefficient. In addition, the diffusion coefficient of oxygen (D O ) for PC (2.0-3.3 × 10⁻⁶ cm²/s) was lower than that of the Nafion PEM (3.8 × 10⁻⁶ cm²/s). The PC was found to have a low ohmic resistance (0.29-0.38 Ω) in the MFC, which was similar to that of Nafion PEM (0.31 Ω); this resulted in comparable maximum power density and maximum current density in MFCs with PC and those with Nafion PEMs. Moreover, a higher average current generation was observed in MFCs with PC (104.3 ± 15.3 A/m³) compared with MFCs with Nafion PEM (100.4 ± 17.7 A/m³), as well as showing insignificant degradation of the PC surface, during 177 days of use in swine wastewater. These results suggest that PC separators could serve as a low-cost alternative to Nafion PEMs for construction of cost-effective MFCs.

  18. Acoustically enhanced boiling heat transfer on a heated surface containing open microchannels

    NASA Astrophysics Data System (ADS)

    Boziuk, Thomas R.; Smith, Marc K.; Glezer, Ari

    2011-11-01

    Acoustic actuation is used to enhance boiling heat transfer on a submerged heated surface containing an array of open microchannels by controlling the formation and evolution of vapor bubbles and inhibiting the instability that leads to film boiling at the critical heat flux. The effect of actuation at millimeter and micrometer scales is investigated with emphasis on the behavior of bubble nucleation, growth, contact-line motion, condensation, and detachment. The results show that microchannels control the location of boiling and reduce the mean surface superheat. In addition, acoustic actuation increases the heat flux at a given surface temperature and leads to a significant increase in the critical heat flux, a reduction of the vapor mass above the surface, and the breakup of low-frequency vapor slug formation. Supported by ONR.

  19. Kinetic Release of Alkalinity from Particle-Containing Oil-in-Water Emulsions

    NASA Astrophysics Data System (ADS)

    Muller, K.; Chapra, S. C.; Ramsburg, A.

    2014-12-01

    Oil-in-water emulsions are typically employed during remediation to promote biotic reduction of contaminants. Emulsions, however, hold promise for encapsulated delivery of many types of active ingredients required for successful site remediation or long-term site stewardship. Our research is currently focused on using alkalinity-containing particles held within oil-in-water emulsions to sustain control of subsurface pH. Here we describe results from laboratory experiments and mathematical modeling conducted to quantify the kinetics associated with the emulsion delivery and alkalinity release process. Kinetically stable oil-in-water emulsions containing (~60 nmCaCO3 or ~100 nm MgO particles) were previously developed using soybean oil and Gum Arabic as a stabilizing agent. Batch and column experiments were employed to assess the accessibility and release of the alkalinity from the emulsion. Successive additions of HCl were used in batch systems to produce several pH responses (pH rebounds) that were subsequently modeled to elucidate release mechanisms and rates for varying emulsion compositions and particle types. Initial results suggest that a linear-driving-force model is generally able to capture the release behavior in the batch system when the temporally-constant, lumped mass-transfer coefficient is scaled by the fraction of particle mass remaining within the droplets. This result suggests that the rate limiting step in the release process may be the interphase transfer of reactive species at the oil-water interface. 1-d column experiments were also completed in order to quantify the extent and rate of alkalinity release from emulsion droplets retained in a sandy medium. Alkalinity release from the retained droplets treated a pH 4 influent water for 25-60 pore volumes (the duration depended on particle type and mass loading), and the cessation in treatment corresponded to exhaustion of the particle mass held within the oil. Column experiments were simulated using a transport code containing the linear-driving-force expression evaluated in the batch experiments. In these simulations the lumped mass transfer coefficient was fit and compared with values predicted using existing correlations for liquid-liquid and solid-liquid interfaces in porous media.

  20. Predictive models of lyophilization process for development, scale-up/tech transfer and manufacturing.

    PubMed

    Zhu, Tong; Moussa, Ehab M; Witting, Madeleine; Zhou, Deliang; Sinha, Kushal; Hirth, Mario; Gastens, Martin; Shang, Sherwin; Nere, Nandkishor; Somashekar, Shubha Chetan; Alexeenko, Alina; Jameel, Feroz

    2018-07-01

    Scale-up and technology transfer of lyophilization processes remains a challenge that requires thorough characterization of the laboratory and larger scale lyophilizers. In this study, computational fluid dynamics (CFD) was employed to develop computer-based models of both laboratory and manufacturing scale lyophilizers in order to understand the differences in equipment performance arising from distinct designs. CFD coupled with steady state heat and mass transfer modeling of the vial were then utilized to study and predict independent variables such as shelf temperature and chamber pressure, and response variables such as product resistance, product temperature and primary drying time for a given formulation. The models were then verified experimentally for the different lyophilizers. Additionally, the models were applied to create and evaluate a design space for a lyophilized product in order to provide justification for the flexibility to operate within a certain range of process parameters without the need for validation. Published by Elsevier B.V.

  1. Energy transfer simulation for radiantly heated and cooled enclosures

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Chapman, K.S.; Zhang, P.

    1996-11-01

    This paper presents the development of a three-dimensional mathematical model to compute heat transfer within a radiantly heated or cooled room, which then calculates the mass-averaged room air temperature and the wall surface temperature distributions. The radiation formulation used in the model accommodates arbitrary placement of walls and objects within the room. The convection model utilizes Nusselt number correlations published in the open literature. The complete energy transfer model is validated by comparing calculated room temperatures to temperatures measured in a radiantly heated room. This three-dimensional model may be applied to a building to assist the heating/cooling system design engineermore » in sizing a radiant heating/cooling system. By coupling this model with a thermal comfort model, the comfort levels throughout the room can be easily and efficiently mapped for a given radiant heater/cooler location. In addition, obstacles such as airplanes, trucks, furniture, and partitions can be easily incorporated to determine their effect on the radiant heating system performance.« less

  2. DOE Office of Scientific and Technical Information (OSTI.GOV)

    Park, Jongmin; Saba, Stacey A.; Hillmyer, Marc A.

    We report on the phase separation behaviors of polymerization mixtures containing a polylactide macro-chain transfer agent (PLA-CTA), styrene, divinylbenzene, hydroxyl-terminated PLA (PLA-OH), and a molecular chain transfer agent which enable the ability to tune the pore size of a cross-linked polymer monolith in a facile manner. Cross-linked monoliths were produced from the mixtures via reversible addition-fragmentation chain transfer (RAFT) polymerization and converted into cross-linked porous polymers by selective removal of PLA while retaining the parent morphology. We demonstrate that pore sizes are tunable over a wide range of length scales from the meso- to macroporous regimes by adjusting the ratiomore » of PLA-CTA to PLA-OH in the reaction mixture which causes the phase separation mechanism to change from polymerization-induced microphase separation to polymerization-induced phase separation. The possibility of increasing porosity and inducing simultaneous micro- and macrophase separation was also realized by adjustments in the molar mass of PLA which enabled the synthesis of hierarchically meso- and macroporous polymers.« less

  3. Does tidal capture produce cataclysmic variables?

    NASA Technical Reports Server (NTRS)

    Bailyn, Charles D.; Grindlay, Jonathan E.; Garcia, Michael R.

    1990-01-01

    It is shown that earlier estimates of the number of cataclysmic variables (CVs) to be expected from tidal capture in globular clusters may have been considerably too high, since many such binaries will result in unstable mass transfer, and thus not become CVs after all. In particular, CVs with white dwarf masses less than or obout 1.0 solar mass will be supressed. Such unstable mass transfer events may produce some of the cluster mass loss required to stabilize the cluster core. The smaller number of stable CVs predicted may suggest a reconsideration of the nature of some of the low-luminosity cluster X-ray sources.

  4. Kinetic Study of Mass Transfer by Sodium Hydroxide in Nickel Under Free-convection Conditions /by Don R. Mosher and Robert A. Lad

    NASA Technical Reports Server (NTRS)

    Mosher, Don R; Lad, Robert A

    1954-01-01

    An investigation was conducted using static capsules fabricated from "L" nickel tubing to determine the effect of temperature level, temperature gradient, and test duration on corrosion and mass transfer by molten sodium hydroxide under free-convection conditions. A base temperature range from 1000 degrees to 1600 degrees F with temperature differences to 500 degrees was studied. The rate of mass transfer was found to be strongly dependent on both temperature level and gradient. The rate shows little tendency to decrease for test durations up to 200 hours, although the concentration of nickel in the melt approaches a limited value after 100 hours.

  5. Heat and mass transfer in vertical porous medium due to partial heating

    NASA Astrophysics Data System (ADS)

    Salman Ahmed N., J.; Khan, T. M. Yunus; Ahamad, N. Ameer; Kamangar, Sarfaraz

    2018-05-01

    The investigation of heat and mass transfer adjacent to vertical plate subjected to partial heating of plate in multiple segments is carried out. A section of the plate is heated with isothermal temperature Th and the far away condition is maintained at ambient temperature T∞.. The vertical plate is maintained at constant concentration Ch as opposed to lowest concentration at far away condition. Finite element method is used and governing equations are converted into simple form of equations using Galerkin approach. The results are discussed in terms of contour plots. Study is carried out with respect to various physical parameters. The heat and mass transfer rate found to increase with increase in Rayleigh number.

  6. Unit operations for gas-liquid mass transfer in reduced gravity environments

    NASA Technical Reports Server (NTRS)

    Pettit, Donald R.; Allen, David T.

    1992-01-01

    Basic scaling rules are derived for converting Earth-based designs of mass transfer equipment into designs for a reduced gravity environment. Three types of gas-liquid mass transfer operations are considered: bubble columns, spray towers, and packed columns. Application of the scaling rules reveals that the height of a bubble column in lunar- and Mars-based operations would be lower than terrestrial designs by factors of 0.64 and 0.79 respectively. The reduced gravity columns would have greater cross-sectional areas, however, by factors of 2.4 and 1.6 for lunar and Martian settings. Similar results were obtained for spray towers. In contract, packed column height was found to be nearly independent of gravity.

  7. Hints for Small Disks around Very Low Mass Stars and Brown Dwarfs

    NASA Astrophysics Data System (ADS)

    Hendler, Nathanial P.; Mulders, Gijs D.; Pascucci, Ilaria; Greenwood, Aaron; Kamp, Inga; Henning, Thomas; Ménard, François; Dent, William R. F.; Evans, Neal J., II

    2017-06-01

    The properties of disks around brown dwarfs and very low mass stars (hereafter VLMOs) provide important boundary conditions on the process of planet formation and inform us about the numbers and masses of planets than can form in this regime. We use the Herschel Space Observatory PACS spectrometer to measure the continuum and [O I] 63 μm line emission toward 11 VLMOs with known disks in the Taurus and Chamaeleon I star-forming regions. We fit radiative transfer models to the spectral energy distributions of these sources. Additionally, we carry out a grid of radiative transfer models run in a regime that connects the luminosity of our sources with brighter T Tauri stars. We find that VLMO disks with sizes 1.3-78 au, smaller than typical T Tauri disks, fit well the spectral energy distributions assuming that disk geometry and dust properties are stellar mass independent. Reducing the disk size increases the disk temperature, and we show that VLMOs do not follow previously derived disk temperature-stellar luminosity relationships if the disk outer radius scales with stellar mass. Only 2 out of 11 sources are detected in [O I] despite a better sensitivity than was achieved for T Tauri stars, suggesting that VLMO disks are underluminous. Using thermochemical models, we show that smaller disks can lead to the unexpected [O I] 63 μm nondetections in our sample. The disk outer radius is an important factor in determining the gas and dust observables. Hence, spatially resolved observations with ALMA—to establish if and how disk radii scale with stellar mass—should be pursued further. Herschel is an ESA space observatory with science instruments provided by European-led Principal Investigator consortia and with important participation from NASA.

  8. Updating the orbital ephemeris of the dipping source XB 1254-690 and the distance to the source

    NASA Astrophysics Data System (ADS)

    Gambino, Angelo F.; Iaria, Rosario; Di Salvo, Tiziana; Matranga, Marco; Burderi, Luciano; Pintore, Fabio; Riggio, Alessandro; Sanna, Andrea

    2017-09-01

    XB 1254-690 is a dipping low mass X-ray binary system hosting a neutron star and showing type I X-ray bursts. We aim at obtaining a more accurate orbital ephemeris and at constraining the orbital period derivative of the system for the first time. In addition, we want to better constrain the distance to the source in order to locate the system in a well defined evolutive scenario. We apply, for the first time, an orbital timing technique to XB 1254-690, using the arrival times of the dips present in the light curves that have been collected during 26 yr of X-ray pointed observations acquired from different space missions. We estimate the dip arrival times using a statistical method that weights the count-rate inside the dip with respect to the level of persistent emission outside the dip. We fit the obtained delays as a function of the orbital cycles both with a linear and a quadratic function. We infer the orbital ephemeris of XB 1254-690, improving the accuracy of the orbital period with respect to previous estimates. We infer a mass of M 2 = 0.42 ± 0.04 M ʘ for the donor star, in agreement with estimations already present in literature, assuming that the star is in thermal equilibrium while it transfers part of its mass via the inner Lagrangian point, and assuming a neutron star mass of 1.4 M ʘ. Using these assumptions, we also constrain the distance to the source, finding a value of 7.6 ± 0.8 kpc. Finally, we discuss the evolution of the system, suggesting that it is compatible with a conservative mass transfer driven by magnetic braking.

  9. The Effect of Protein Mass Modulation on Human Dihydrofolate Reductase

    PubMed Central

    Francis, Kevin; Sapienza, Paul J.; Lee, Andrew L.; Kohen, Amnon

    2016-01-01

    Dihydrofolate reductase (DHFR) from Escherichia coli has long served as a model enzyme with which to elucidate possible links between protein dynamics and the catalyzed reaction. Such physical properties of its human counterpart have not been rigorously studied so far, but recent computer-based simulations suggest that these two DHFRs differ significantly in how closely coupled the protein dynamics and the catalyzed C-H→C hydride transfer step are. To test this prediction, two contemporary probes for studying the effect of protein dynamics on catalysis were combined here: temperature dependence of intrinsic kinetic isotope effects (KIEs) that are sensitive to the physical nature of the chemical step, and protein mass-modulation that slows down fast dynamics (femto- to picosecond timescale) throughout the protein. The intrinsic H/T KIEs of human DHFR, like those of E. coli DHFR, are shown to be temperature-independent in the range from 5–45 °C, indicating fast sampling of donor and acceptor distances (DADs) at the reaction’s transition state (or tunneling ready state – TRS). Mass modulation of these enzymes through isotopic labeling with 13C, 15N, and 2H at nonexchangeable hydrogens yield an 11% heavier enzyme. The additional mass has no effect on the intrinsic KIEs of the human enzyme. This finding indicates that the mass-modulation of the human DHFR affects neither DAD distribution nor the DAD’s conformational sampling dynamics. Furthermore, reduction in the enzymatic turnover number and the dissociation rate constant for the product indicate that the isotopic substitution affects kinetic steps that are not the catalyzed C-H→C hydride transfer. The findings are discussed in terms of fast dynamics and their role in catalysis, the comparison of calculations and experiments, and the interpretation of isotopically-modulated heavy enzymes in general. PMID:26813442

  10. Quantification of colloidal and aqueous element transfer in soils: The dual-phase mass balance model

    USGS Publications Warehouse

    Bern, Carleton R.; Thompson, Aaron; Chadwick, Oliver A.

    2015-01-01

    Mass balance models have become standard tools for characterizing element gains and losses and volumetric change during weathering and soil development. However, they rely on the assumption of complete immobility for an index element such as Ti or Zr. Here we describe a dual-phase mass balance model that eliminates the need for an assumption of immobility and in the process quantifies the contribution of aqueous versus colloidal element transfer. In the model, the high field strength elements Ti and Zr are assumed to be mobile only as suspended solids (colloids) and can therefore be used to distinguish elemental redistribution via colloids from redistribution via dissolved aqueous solutes. Calculations are based upon element concentrations in soil, parent material, and colloids dispersed from soil in the laboratory. We illustrate the utility of this model using a catena in South Africa. Traditional mass balance models systematically distort elemental gains and losses and changes in soil volume in this catena due to significant redistribution of Zr-bearing colloids. Applying the dual-phase model accounts for this colloidal redistribution and we find that the process accounts for a substantial portion of the major element (e.g., Al, Fe and Si) loss from eluvial soil. In addition, we find that in illuvial soils along this catena, gains of colloidal material significantly offset aqueous elemental loss. In other settings, processes such as accumulation of exogenous dust can mimic the geochemical effects of colloid redistribution and we suggest strategies for distinguishing between the two. The movement of clays and colloidal material is a major process in weathering and pedogenesis; the mass balance model presented here is a tool for quantifying effects of that process over time scales of soil development.

  11. High-resolution experiments on chemical oxidation of DNAPL in variable-aperture fractures

    NASA Astrophysics Data System (ADS)

    Arshadi, Masoud; Rajaram, Harihar; Detwiler, Russell L.; Jones, Trevor

    2015-04-01

    Chemical oxidation of dense nonaqueous-phase liquids (DNAPLs) by permanganate has emerged as an effective remediation strategy in fractured rock. We present high-resolution experimental investigations in transparent analog variable-aperture fractures to improve understanding of chemical oxidation of residual entrapped trichloroethylene (TCE) in fractures. Four experiments were performed with different permanganate concentrations, flow rates, and initial TCE phase geometry. The initial aperture field and evolving entrapped-phase geometry were quantified for each experiment. The integrated mass transfer rate from the TCE phase for all experiments exhibited three time regimes: an early-time regime with slower mass transfer rates limited by low specific interfacial area; an intermediate-time regime with higher mass transfer rates resulting from breakup of large TCE blobs, which greatly increases specific interfacial area; and a late-time regime with low mass transfer rates due to the deposition of MnO2 precipitates. In two experiments, mass balance analyses suggested that TCE mass removal rates exceeded the maximum upper bound mass removal rates derived by assuming that oxidation and dissolution are the only mechanisms for TCE mass removal. We propose incomplete oxidation by permanganate and TCE solubility enhancement by intermediate reaction products as potential mechanisms to explain this behavior. We also speculate that some intermediate reaction products with surfactant-like properties may play a role in lowering the TCE-water interfacial tension, thus causing breakup of large TCE blobs. Our quantitative experimental measurements will be useful in the context of developing accurate computational models for chemical oxidation of TCE in fractures.

  12. An improved biomechanical model for simulating the strain of the hand-arm system under vibration stress.

    PubMed

    Fritz, M

    1991-01-01

    In order to define relationships between the vibration stress and the strain of the human hand-arm system a biomechanical model was developed. The four masses of the model representing the hand, the forearm and the upper arm were connected by dampers and springs in two perpendicular directions. Simulating muscle activity, damped torsion springs were included additionally. The motions of the model were described by a differential matrix equation which was solved by using a 'transfer matrix routine' as well as by numerical integration. Thus, functions with harmonic or transient time courses could be selected as an excitation. The simulated vibrations were compared with those of other hand-arm models. The forces and torques transmitted between the masses, and the energy dissipated by the dampers were computed for several combinations of exciter frequencies and accelerations. The dependence of torques upon excitation agreed fairly well with the behaviour of the arm muscles under vibration as described by various investigators. At frequencies above 100 Hz the energy was dissipated mainly by the dampers between the masses near to the exciter. Transferring this result to the hand-arm system it shows that at high frequencies energy is dissipated by the hand and its palmar tissues and this might be one cause for the incidence of vibration-induced white finger disease.

  13. Demonstrating the Effect of Interphase Mass Transfer in a Transparent Fluidized Bed Reactor

    ERIC Educational Resources Information Center

    Saayman, Jean; Nicol, Willie

    2011-01-01

    A demonstration experiment is described that employs the ozone decomposition reaction at ambient conditions on Fe2O3 impregnated Fluidized Catalytic Cracking (FCC) catalyst. Using a two-dimensional see-through column the importance of interphase mass transfer is clearly illustrated by the significant difference in ozone conversion between the…

  14. A mass transfer model of ethanol emission from thin layers of corn silage

    USDA-ARS?s Scientific Manuscript database

    A mass transfer model of ethanol emission from thin layers of corn silage was developed and validated. The model was developed based on data from wind tunnel experiments conducted at different temperatures and air velocities. Multiple regression analysis was used to derive an equation that related t...

  15. HIGH-TEMPERATURE, SHORT-TIME SULFATION OF CALCIUM- BASED SORBENTS. 1. THEORETICAL SULFATION MODEL

    EPA Science Inventory

    A mathematical model for the sulfation of CaO is developed around the overlapping grain concept. The potential influence of high mass-transfer rates from simultaneous calcination of CaCO3 or Ca(OH)2 is incorporated in the mass-transfer coefficient for SO2 diffusion to the partic...

  16. Henry’s Law Constant and Overall Mass Transfer Coefficient for Formaldehyde Emission from Small Water Pools under Simulated Indoor Environmental Conditions

    EPA Science Inventory

    The Henry’s law constant (HLC) and the overall mass transfer coefficient are both important parameters for modeling formaldehyde emissions from aqueous solutions. In this work, the apparent HLCs for aqueous formaldehyde solutions were determined in the concentration range from 0....

  17. Sales Training: Effects of Spaced Practice on Training Transfer

    ERIC Educational Resources Information Center

    Kauffeld, Simone; Lehmann-Willenbrock, Nale

    2010-01-01

    Purpose: The benefits of spaced training over massed training practice are well established in the laboratory setting. In a field study design with sales trainings, the purpose of this paper is to investigate the effects of spaced compared with massed practice on transfer quantity and quality, sales competence, and key figures.…

  18. Effect of mass transfer in a recirculation batch reactor system for immobilized penicillin amidase.

    PubMed

    Park, J M; Choi, C Y; Seong, B L; Han, M H

    1982-10-01

    The effect of external mass transfer resistance on the overall reaction rate of the immobilized whole cell penicillin amidase of E. coli in a recirculation batch reactor was investigated. The internal diffusional resistance was found negligible as indicated by the value of effectiveness factor, 0.95. The local environmental change in a column due to the pH drop was successfully overcome by employing buffer solution. The reaction rate was measured by pH-stat method and was found to follow the simple Michaelis-Menten law at the initial stage of the reaction. The values of the net reaction rate experimentally determined were used to calculate the substrate concentration at the external surface of the catalyst pellet and then to calculate the mass transfer coefficient, k(L), at various flow rates and substrate concentrations. The correlation proposed by Chilton and Colburn represented adequately the experimental data. The linear change of log j(D) at low log N(Re) with negative slope was ascribed to the fact that the external mass transfer approached the state of pure diffusion in the limit of zero superficial velocity.

  19. Influence of mass transfer resistance on overall nitrate removal rate in upflow sludge bed reactors.

    PubMed

    Ting, Wen-Huei; Huang, Ju-Sheng

    2006-09-01

    A kinetic model with intrinsic reaction kinetics and a simplified model with apparent reaction kinetics for denitrification in upflow sludge bed (USB) reactors were proposed. USB-reactor performance data with and without sludge wasting were also obtained for model verification. An independent batch study showed that the apparent kinetic constants k' did not differ from the intrinsic k but the apparent Ks' was significantly larger than the intrinsic Ks suggesting that the intra-granule mass transfer resistance can be modeled by changes in Ks. Calculations of the overall effectiveness factor, Thiele modulus, and Biot number combined with parametric sensitivity analysis showed that the influence of internal mass transfer resistance on the overall nitrate removal rate in USB reactors is more significant than the external mass transfer resistance. The simulated residual nitrate concentrations using the simplified model were in good agreement with the experimental data; the simulated results using the simplified model were also close to those using the kinetic model. Accordingly, the simplified model adequately described the overall nitrate removal rate and can be used for process design.

  20. Modelling mass and heat transfer in nano-based cancer hyperthermia.

    PubMed

    Nabil, M; Decuzzi, P; Zunino, P

    2015-10-01

    We derive a sophisticated mathematical model for coupled heat and mass transport in the tumour microenvironment and we apply it to study nanoparticle delivery and hyperthermic treatment of cancer. The model has the unique ability of combining the following features: (i) realistic vasculature; (ii) coupled capillary and interstitial flow; (iii) coupled capillary and interstitial mass transfer applied to nanoparticles; and (iv) coupled capillary and interstitial heat transfer, which are the fundamental mechanisms governing nano-based hyperthermic treatment. This is an improvement with respect to previous modelling approaches, where the effect of blood perfusion on heat transfer is modelled in a spatially averaged form. We analyse the time evolution and the spatial distribution of particles and temperature in a tumour mass treated with superparamagnetic nanoparticles excited by an alternating magnetic field. By means of numerical experiments, we synthesize scaling laws that illustrate how nano-based hyperthermia depends on tumour size and vascularity. In particular, we identify two distinct mechanisms that regulate the distribution of particle and temperature, which are characterized by perfusion and diffusion, respectively.

  1. Influence of the liquid-phase mass transfer on the performance of a packed-bed bioreactor for wastewater treatment.

    PubMed

    Sarti, A; Vieira, L G; Foresti, E; Zaiat, M

    2001-07-01

    This paper reports on the influence of the liquid-phase mass transfer on the performance of a horizontal-flow, anaerobic, immobilized-biomass (HAIB) reactor treating low-strength wastewater. The HAIB reactor was subjected to liquid superficial velocities (vs) ranging from 10 to 50 cm h(-1), corresponding to hydraulic detention time (theta h) of 10-2 h. The best performance was achieved at an overall theta h of 3.3 h due to the interdependence of biochemical reactions and mass transfer mechanisms for process optimization. The HAIB reactor was provided with four intermediate sampling ports, and the values of v(s) were fixed to permit sampling at different ports corresponding to thetah of 2 h as vs increased. The chemical oxygen demand removal (COD) efficiencies increased from 68% to 82% with the increase of v(s) from 10 to 50 cm h(-1). It could be concluded that the performance of the HAIB reactor was improved significantly by increasing vs, thus decreasing the liquid-phase mass transfer resistance.

  2. DOE Office of Scientific and Technical Information (OSTI.GOV)

    Lobo, R.; Revah, S.; Viveros-Garcia, T.

    An analysis of the local processes occurring in a trickle-bed bioreactor (TBB) with a first-order bioreaction shows that the identification of the TBB operating regime requires knowledge of the substrate concentration in the liquid phase. If the substrate liquid concentration is close to 0, the rate-controlling step is mass transfer at the gas-liquid interface; when it is close to the value in equilibrium with the gas phase, the controlling step is the phenomena occurring in the biofilm, CS{sub 2} removal rate data obtained in a TBB with a Thiobacilii consortia biofilm are analyzed to obtain the mass transfer and kineticmore » parameters, and to show that the bioreactor operates in a regime mainly controlled by mass transfer. A TBB model with two experimentally determined parameters is developed and used to show how the bioreactor size depends on the rate-limiting step, the absorption factor, the substrate fractional conversion, and on the gas and liquid contact pattern. Under certain conditions, the TBB size is independent of the flowing phases` contact pattern. The model effectively describes substrate gas and liquid concentration data for mass transfer and biodegradation rate controlled processes.« less

  3. Measurement and modeling of CO2 mass transfer in brine at reservoir conditions

    NASA Astrophysics Data System (ADS)

    Shi, Z.; Wen, B.; Hesse, M. A.; Tsotsis, T. T.; Jessen, K.

    2018-03-01

    In this work, we combine measurements and modeling to investigate the application of pressure-decay experiments towards delineation and interpretation of CO2 solubility, uptake and mass transfer in water/brine systems at elevated pressures of relevance to CO2 storage operations in saline aquifers. Accurate measurements and modeling of mass transfer in this context are crucial to an improved understanding of the longer-term fate of CO2 that is injected into the subsurface for storage purposes. Pressure-decay experiments are presented for CO2/water and CO2/brine systems with and without the presence of unconsolidated porous media. We demonstrate, via high-resolution numerical calculations in 2-D, that natural convection will complicate the interpretation of the experimental observations if the particle size is not sufficiently small. In such settings, we demonstrate that simple 1-D interpretations can result in an overestimation of the uptake (diffusivity) by two orders of magnitude. Furthermore, we demonstrate that high-resolution numerical calculations agree well with the experimental observations for settings where natural convection contributes substantially to the overall mass transfer process.

  4. Surfactant effects on alpha-factors in aeration systems.

    PubMed

    Rosso, Diego; Stenstrom, Michael K

    2006-04-01

    Aeration in wastewater treatment processes accounts for the largest fraction of plant energy costs. Aeration systems function by shearing the surface (surface aerators) or releasing bubbles at the bottom of the tank (coarse- or fine-bubble aerators). Surfactant accumulation on gas-liquid interfaces reduces mass transfer rates, and this reduction in general is larger for fine-bubble aerators. This study evaluates mass transfer effects on the characterization and specification of aeration systems in clean and process water conditions. Tests at different interfacial turbulence regimes show higher gas transfer depression for lower turbulence regimes. Contamination effects can be offset at the expense of operating efficiency, which is characteristic of surface aerators and coarse-bubble diffusers. Results describe the variability of alpha-factors measured at small scale, due to uncontrolled energy density. Results are also reported in dimensionless empirical correlations describing mass transfer as a function of physiochemical and geometrical characteristics of the aeration process.

  5. Heat and Mass Transfer in the Over-Shower Zone of a Cooling Tower with Flow Rotation

    NASA Astrophysics Data System (ADS)

    Kashani, M. M. Hemmasian; Dobrego, K. V.

    2013-11-01

    The influence of flow rotation in the over-shower zone of a natural draft wet cooling tower (NDCT) on heat and mass transfer in this zone is investigated numerically. The 3D geometry of an actual NDCT and three models of the induced rotation velocity fields are utilized for calculations. Two phases (liquid and gaseous) and three components are taken into consideration. The interphase heat exchange, heat transfer to the walls, condensation-evaporation intensity field, and other parameters are investigated as functions of the induced rotation intensity (the inclination of the velocity vector at the periphery). It is shown that the induced flow rotation intensifies the heat and mass transfer in the over-shower zone of an NDCT. Flow rotation leads to specific redistribution of evaporation-condensation areas in an NDCT and stimulates water condensation near its walls.

  6. Relationship between mass-flux reduction and source-zone mass removal: analysis of field data.

    PubMed

    Difilippo, Erica L; Brusseau, Mark L

    2008-05-26

    The magnitude of contaminant mass-flux reduction associated with a specific amount of contaminant mass removed is a key consideration for evaluating the effectiveness of a source-zone remediation effort. Thus, there is great interest in characterizing, estimating, and predicting relationships between mass-flux reduction and mass removal. Published data collected for several field studies were examined to evaluate relationships between mass-flux reduction and source-zone mass removal. The studies analyzed herein represent a variety of source-zone architectures, immiscible-liquid compositions, and implemented remediation technologies. There are two general approaches to characterizing the mass-flux-reduction/mass-removal relationship, end-point analysis and time-continuous analysis. End-point analysis, based on comparing masses and mass fluxes measured before and after a source-zone remediation effort, was conducted for 21 remediation projects. Mass removals were greater than 60% for all but three of the studies. Mass-flux reductions ranging from slightly less than to slightly greater than one-to-one were observed for the majority of the sites. However, these single-snapshot characterizations are limited in that the antecedent behavior is indeterminate. Time-continuous analysis, based on continuous monitoring of mass removal and mass flux, was performed for two sites, both for which data were obtained under water-flushing conditions. The reductions in mass flux were significantly different for the two sites (90% vs. approximately 8%) for similar mass removals ( approximately 40%). These results illustrate the dependence of the mass-flux-reduction/mass-removal relationship on source-zone architecture and associated mass-transfer processes. Minimal mass-flux reduction was observed for a system wherein mass removal was relatively efficient (ideal mass-transfer and displacement). Conversely, a significant degree of mass-flux reduction was observed for a site wherein mass removal was inefficient (non-ideal mass-transfer and displacement). The mass-flux-reduction/mass-removal relationship for the latter site exhibited a multi-step behavior, which cannot be predicted using some of the available simple estimation functions.

  7. Is effective mass in combat sports punching above its weight?

    PubMed

    Lenetsky, Seth; Nates, Roy J; Brughelli, Matt; Harris, Nigel K

    2015-04-01

    The segmental and muscular complexity of the human body can result in challenges when examining the kinetics of impacts. To better understand this complexity, combat sports literature has selected effective mass as a measure of an athlete's inertial contribution to the momentum transfer during the impact of strikes. This measure helps to clarify the analysis of striking kinetics in combat sports. This paper will review: (1) effective mass as a concept and its usage as a measure of impact intensity in combat sports, (2) the neuromuscular pattern known as "double peak muscle activation" which has been theorized to help enhance initial hand velocity upon impact and joint stiffening during impact, (3) the methods and equations used to calculate effective mass, and (4) practitioner recommendations based on the literature. We will argue in this manuscript that the act of punching presents unique challenges to the current understanding of effective mass due to additional force application during impact. This review will improve the understanding of effective mass and its roles in effective striking serving to underpin future research into performance enhancement in striking based combat sports. Copyright © 2014 Elsevier B.V. All rights reserved.

  8. Bibliography on augmentation of convective heat and mass transfer-II

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Bergles, A.E.; Nirmalan, V.; Junkhan, G.H.

    1983-12-01

    Heat transfer augmentation has developed into a major specialty area in heat transfer research and development. This report presents and updated bibliography of world literature on augmentation. The literature is classified into passive augmentation techniques, which require no external power, and active techniques, which do require external power. The fifteen techniques are grouped in terms of their applications to the various modes of heat transfer. Mass transfer is included for completeness. Key words are included with each citation for technique/mode identification. The total number of publications cited is 3045, including 135 surveys of various techniques and 86 papers on performancemore » evaluation of passive techniques. Patents are not included, as they are the subject of a separate bibliographic report.« less

  9. Bibliography on augmentation of convective heat and mass transfer

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Bergles, A.E.; Webb, R.L.; Junkhan, G.H.

    1979-05-01

    Heat transfer augmentation has developed into a major specialty area in heat transfer research and development. A bibliography of world literature on augmentation is presented. The literature is classified into passive augmentation techniques, which require no external power, and active techniques, which do require external power. The fourteen techniques are grouped in terms of their application to the various modes of heat transfer. Mass transfer is included for completeness. Key words are included with each citation for technique/mode identification. The total number of publications cited is 1,967, including 75 surveys of various techniques and 42 papers on performance evaluation ofmore » passive techniques. Patents are not included as they will be the subject of a future topical report.« less

  10. Development of a test facility and preliminary testing of flow boiling heat transfer of R410A refrigerant with Al2O3 nanolubricants

    NASA Astrophysics Data System (ADS)

    Wong, Thiam

    In vapor compression cycles, a small portion of the oil circulates with the refrigerant throughout the system components, while most of the oil stays in the compressors. In heat exchangers, the lubricant in excess penalizes the heat transfer and increases the pressure losses: both effects are highly undesired but yet unavoidable. Nanoparticles dispersed in the excess lubricant are expected to provide enhancements in heat transfer. While solubility and miscibility of refrigerants in polyolesters (POE) lubricant are well established knowledge, there is a lack of information regarding if and how nanoparticles dispersed in the lubricant affect these properties. This thesis presents experimental data of solubility of two types of Al2O3 nanolubricants with refrigerant R-410A. The nanoparticles were dispersed in POE lubricant by using different surfactants and dispersion methods. The nanolubricants appeared to have slightly lower solubility than that of R-410A but actually the solid nanoparticles did not really interfere with the POE oil solubility characteristics. A test facility and experimental methodology was developed for the investigation of heat transfer coefficient and pressure drop. The pressure drop of the refrigerant lubricant mixtures during flow boiling depended on the mass flux of the refrigerant. Greater augmentation was seen in the pressure drop results with decreasing mass flow rate. Pure refrigerant R410A showed the lowest pressure drop, addition of nanolubricants to the refrigerant showed a slightly higher pressure drop and POE-refrigerant mixture showed the highest pressure drop in the tests conducted. Enhancement or degradation in heat transfer coefficient during flow boiling depended on the nanoparticle concentration in the lubricant as well as the lubricant concentration in refrigerant. R410A showed the highest heat transfer coefficient for all conditions tested. For a concentration of 1% nanolubricant in refrigerant, the heat transfer coefficient showed more enhancement with increase in nanoparticle concentration compared to POE refrigerant mixtures. For a concentration of 3% nanolubricant in refrigerant mixtures there was little to no enhancement for tests conducted.

  11. DOE Office of Scientific and Technical Information (OSTI.GOV)

    Clausen, Drew; Wade, Richard A.; Kopparapu, Ravi Kumar

    Binaries that contain a hot subdwarf (sdB) star and a main-sequence companion may have interacted in the past. This binary population has historically helped determine our understanding of binary stellar evolution. We have computed a grid of binary population synthesis models using different assumptions about the minimum core mass for helium ignition, the envelope binding energy, the common-envelope ejection efficiency, the amount of mass and angular momentum lost during stable mass transfer, and the criteria for stable mass transfer on the red giant branch and in the Hertzsprung gap. These parameters separately and together can significantly change the entire predictedmore » population of sdBs. Nonetheless, several different parameter sets can reproduce the observed subpopulation of sdB + white dwarf and sdB + M dwarf binaries, which has been used to constrain these parameters in previous studies. The period distribution of sdB + early F dwarf binaries offers a better test of different mass transfer scenarios for stars that fill their Roche lobes on the red giant branch.« less

  12. Numerical investigation of saturated upward flow boiling of water in a vertical tube using VOF model: effect of different boundary conditions

    NASA Astrophysics Data System (ADS)

    Hasanpour, B.; Irandoost, M. S.; Hassani, M.; Kouhikamali, R.

    2018-01-01

    In this paper a numerical simulation of upward two-phase flow evaporation in a vertical tube has been studied by considering water as working fluid. To this end, the computational fluid dynamic simulations of this system are performed with heat and mass transfer mechanisms due to energy transfer during the phase change interaction near the heat transfer surface. The volume of fluid model in an available Eulerian-Eulerian approach based on finite volume method is utilized and the mass source term in conservation of mass equation is implemented using a user defined function. The characteristics of water flow boiling such as void fraction and heat transfer coefficient distribution are investigated. The main cause of fluctuations on heat transfer coefficient and volume fraction is velocity increment in the vapor phase rather than the liquid phase. The case study of this research including convective heat transfer coefficient and tube diameter are considered as a parametric study. The operating conditions are considered at high pressure in saturation temperature and the physical properties of water are determined by considering system's inlet temperature and pressure in saturation conditions. Good agreement is achieved between the numerical and the experimental values of heat transfer coefficients.

  13. Numerical investigation of saturated upward flow boiling of water in a vertical tube using VOF model: effect of different boundary conditions

    NASA Astrophysics Data System (ADS)

    Hasanpour, B.; Irandoost, M. S.; Hassani, M.; Kouhikamali, R.

    2018-07-01

    In this paper a numerical simulation of upward two-phase flow evaporation in a vertical tube has been studied by considering water as working fluid. To this end, the computational fluid dynamic simulations of this system are performed with heat and mass transfer mechanisms due to energy transfer during the phase change interaction near the heat transfer surface. The volume of fluid model in an available Eulerian-Eulerian approach based on finite volume method is utilized and the mass source term in conservation of mass equation is implemented using a user defined function. The characteristics of water flow boiling such as void fraction and heat transfer coefficient distribution are investigated. The main cause of fluctuations on heat transfer coefficient and volume fraction is velocity increment in the vapor phase rather than the liquid phase. The case study of this research including convective heat transfer coefficient and tube diameter are considered as a parametric study. The operating conditions are considered at high pressure in saturation temperature and the physical properties of water are determined by considering system's inlet temperature and pressure in saturation conditions. Good agreement is achieved between the numerical and the experimental values of heat transfer coefficients.

  14. Oxygen mass transfer in a stirred tank bioreactor using different impeller configurations for environmental purposes

    PubMed Central

    2013-01-01

    In this study, a miniature stirred tank bioreactor was designed for treatment of waste gas containing benzene, toluene and xylene. Oxygen mass transfer characteristics for various twin and single-impeller systems were investigated for 6 configurations in a vessel with 10 cm of inner diameter and working volume of 1.77L. Three types of impellers, namely, Rushton turbine, Pitched 4blades and Pitched 2blades impellers with downward pumping have been used. Deionized water was used as a liquid phase. With respect to other independent variables such as agitation speed, aeration rate, type of sparger, number of impellers, the relative performance of these impellers was assessed by comparing the values of (KLa) as a key parameter. Based on the experimental data, empirical correlations as a function of the operational conditions have been proposed, to study the oxygen transfer rates from air bubbles generated in the bioreactor. It was shown that twin Rushton turbine configuration demonstrates superior performance (23% to 77% enhancement in KLa) compared with other impeller compositions and that sparger type has negligible effect on oxygen mass transfer rate. Agitation speeds of 400 to 800 rpm were the most efficient speeds for oxygen mass transfer in the stirred bioreactor. PMID:23369581

  15. A simple mathematical method to estimate ammonia emission from in-house windrowing of poultry litter.

    PubMed

    Ro, Kyoung S; Szogi, Ariel A; Moore, Philip A

    2018-05-12

    In-house windrowing between flocks is an emerging sanitary management practice to partially disinfect the built-up litter in broiler houses. However, this practice may also increase ammonia (NH 3 ) emission from the litter due to the increase in litter temperature. The objectives of this study were to develop mathematical models to estimate NH 3 emission rates from broiler houses practicing in-house windrowing between flocks. Equations to estimate mass-transfer areas form different shapes windrowed litter (triangular, rectangular, and semi-cylindrical prisms) were developed. Using these equations, the heights of windrows yielding the smallest mass-transfer area were estimated. Smaller mass-transfer area is preferred as it reduces both emission rates and heat loss. The heights yielding the minimum mass-transfer area were 0.8 and 0.5 m for triangular and rectangular windrows, respectively. Only one height (0.6 m) was theoretically possible for semi-cylindrical windrows because the base and the height were not independent. Mass-transfer areas were integrated with published process-based mathematical models to estimate the total house NH 3 emission rates during in-house windrowing of poultry litter. The NH 3 emission rate change calculated from the integrated model compared well with the observed values except for the very high NH 3 initial emission rate from mechanically disturbing the litter to form the windrows. This approach can be used to conveniently estimate broiler house NH 3 emission rates during in-house windrowing between flocks by simply measuring litter temperatures.

  16. Magnetic nanoparticles stimulation to enhance liquid-liquid two-phase mass transfer under static and rotating magnetic fields

    NASA Astrophysics Data System (ADS)

    Azimi, Neda; Rahimi, Masoud

    2017-01-01

    Rotating magnetic field (RMF) was applied on a micromixer to break the laminar flow and induce chaotic flow to enhance mass transfer between two-immiscible organic and aqueous phases. The results of RMF were compared to those of static magnetic field (SMF). For this purpose, experiments were carried out in a T-micromixer at equal volumetric flow rates of organic and aqueous phases. Fe3O4 nanoparticles were synthesized by co-precipitation technique and they were dissolved in organic phase. Results obtained from RMF and SMF were compared in terms of overall volumetric mass transfer coefficient (KLa) and extraction efficiency (E) at various Reynolds numbers. Generally, RMF showed higher effect in mass transfer characteristics enhancement compared with SMF. The influence of rotational speeds of magnets (ω) in RMF was investigated, and measurable enhancements of KLa and E were observed. In RMF, the effect of magnetic field induction (B) was investigated. The results reveal that at constant concentration of nanoparticles, by increasing of B, mass transfer characteristics will be enhanced. The effect of various nanoparticles concentrations (ϕ) within 0.002-0.01 (w/v) on KLa and E at maximum induction of RMF (B=76 mT) was evaluated. Maximum values of KLa (2.1±0.001) and E (0.884±0.001) were achieved for the layout of RMF (B=76 mT), ω=16 rad/s and MNPs concentration of 0.008-0.01 (w/v).

  17. Intrinsic kinetic parameters of substrate utilization by immobilized anaerobic sludge.

    PubMed

    Zaiat, M; Vieira, L G; Foresti, E

    1997-01-20

    This article presents a method for evaluating the intrinsic kinetic parameters of the specific substrate utilization rate (r) equation and discusses the results obtained for anaerobic sludge-bed samples taken from a horizontal-flow anaerobic immobilized sludge (HAIS) reactor. This method utilizes a differential reactor filled with polyurethane foam matrices containing immobilized anaerobic sludge which is subjected to a range of feeding substrate flow rates. The range of liquid superficial velocities thus obtained are used for generating data of observed specific substrate utilization rates (r(obs)) under a diversity of external mass transfer resistance conditions. The r(obs) curves are then adjusted to permit their extrapolation for the condition of no external mass transfer resistance, and the values determined are used as a test for the condition of absence of limitation of internal mass transfer. The intrinsic parameters r(max), the maximum specific substrate utilization rate, and K(s), the half-velocity coefficient, are evaluated from the r values under no external mass transfer resistance and no internal mass transfer limitation. The application of such a method for anaerobic sludge immobilized in polyurethane foam particles treating a glucose substrate at 30 degrees C resulted in intrinsic r(max) and K(s), respectively, of 0.330 mg chemical oxygen demand (COD) . mg(-1) volatile suspended solids (VSS) . h(-1) and 72 mg COD . L(-1). In comparison with the values found in the literature, intrinsic r(max) is significantly high and intrinsic K(s) is relatively low. (c) 1997 John Wiley & Sons, Inc.

  18. Lattice Boltzmann simulation of the gas-solid adsorption process in reconstructed random porous media.

    PubMed

    Zhou, L; Qu, Z G; Ding, T; Miao, J Y

    2016-04-01

    The gas-solid adsorption process in reconstructed random porous media is numerically studied with the lattice Boltzmann (LB) method at the pore scale with consideration of interparticle, interfacial, and intraparticle mass transfer performances. Adsorbent structures are reconstructed in two dimensions by employing the quartet structure generation set approach. To implement boundary conditions accurately, all the porous interfacial nodes are recognized and classified into 14 types using a proposed universal program called the boundary recognition and classification program. The multiple-relaxation-time LB model and single-relaxation-time LB model are adopted to simulate flow and mass transport, respectively. The interparticle, interfacial, and intraparticle mass transfer capacities are evaluated with the permeability factor and interparticle transfer coefficient, Langmuir adsorption kinetics, and the solid diffusion model, respectively. Adsorption processes are performed in two groups of adsorbent media with different porosities and particle sizes. External and internal mass transfer resistances govern the adsorption system. A large porosity leads to an early time for adsorption equilibrium because of the controlling factor of external resistance. External and internal resistances are dominant at small and large particle sizes, respectively. Particle size, under which the total resistance is minimum, ranges from 3 to 7 μm with the preset parameters. Pore-scale simulation clearly explains the effect of both external and internal mass transfer resistances. The present paper provides both theoretical and practical guidance for the design and optimization of adsorption systems.

  19. Lattice Boltzmann simulation of the gas-solid adsorption process in reconstructed random porous media

    NASA Astrophysics Data System (ADS)

    Zhou, L.; Qu, Z. G.; Ding, T.; Miao, J. Y.

    2016-04-01

    The gas-solid adsorption process in reconstructed random porous media is numerically studied with the lattice Boltzmann (LB) method at the pore scale with consideration of interparticle, interfacial, and intraparticle mass transfer performances. Adsorbent structures are reconstructed in two dimensions by employing the quartet structure generation set approach. To implement boundary conditions accurately, all the porous interfacial nodes are recognized and classified into 14 types using a proposed universal program called the boundary recognition and classification program. The multiple-relaxation-time LB model and single-relaxation-time LB model are adopted to simulate flow and mass transport, respectively. The interparticle, interfacial, and intraparticle mass transfer capacities are evaluated with the permeability factor and interparticle transfer coefficient, Langmuir adsorption kinetics, and the solid diffusion model, respectively. Adsorption processes are performed in two groups of adsorbent media with different porosities and particle sizes. External and internal mass transfer resistances govern the adsorption system. A large porosity leads to an early time for adsorption equilibrium because of the controlling factor of external resistance. External and internal resistances are dominant at small and large particle sizes, respectively. Particle size, under which the total resistance is minimum, ranges from 3 to 7 μm with the preset parameters. Pore-scale simulation clearly explains the effect of both external and internal mass transfer resistances. The present paper provides both theoretical and practical guidance for the design and optimization of adsorption systems.

  20. Mass transfer coefficient in ginger oil extraction by microwave hydrotropic solution

    NASA Astrophysics Data System (ADS)

    Handayani, Dwi; Ikhsan, Diyono; Yulianto, Mohamad Endy; Dwisukma, Mandy Ayulia

    2015-12-01

    This research aims to obtain mass transfer coefficient data on the extraction of ginger oil using microwave hydrotropic solvent as an alternative to increase zingiberene. The innovation of this study is extraction with microwave heater and hydrotropic solvent,which able to shift the phase equilibrium, and the increasing rate of the extraction process and to improve the content of ginger oil zingiberene. The experiment was conducted at the Laboratory of Separation Techniques at Chemical Engineering Department of Diponegoro University. The research activities carried out in two stages, namely experimental and modeling work. Preparation of the model postulated, then lowered to obtain equations that were tested and validated using data obtained from experimental. Measurement of experimental data was performed using microwave power (300 W), extraction temperature of 90 ° C and the independent variable, i.e.: type of hydrotropic, the volume of solvent and concentration in order, to obtain zingiberen levels as a function of time. Measured data was used as a tool to validate the postulation, in order to obtain validation of models and empirical equations. The results showed that the mass transfer coefficient (Kla) on zingiberene mass transfer models ginger oil extraction at various hydrotropic solution attained more 14 ± 2 Kla value than its reported on the extraction with electric heating. The larger value of Kla, the faster rate of mass transfer on the extraction process. To obtain the same yields, the microwave-assisted extraction required one twelfth time shorter.

  1. Electron Capture Supernovae from Close Binary Systems

    NASA Astrophysics Data System (ADS)

    Poelarends, Arend J. T.; Wurtz, Scott; Tarka, James; Cole Adams, L.; Hills, Spencer T.

    2017-12-01

    We present the first detailed study of the Electron Capture Supernova Channel (ECSN Channel) for a primary star in a close binary star system. Progenitors of ECSN occupy the lower end of the mass spectrum of supernova progenitors and are thought to form the transition between white dwarf progenitors and core-collapse progenitors. The mass range for ECSN from close binary systems is thought to be wider than the range for single stars, because of the effects of mass transfer on the helium core. Using the MESA stellar evolution code, we explored the parameter space of initial primary masses between 8 and 17 {M}⊙ , using a large grid of models. We find that the initial primary mass and the mass transfer evolution are important factors in the final fate of stars in this mass range. Mass transfer due to Roche lobe overflow during and after carbon burning causes the core to cool down so that it avoids neon ignition, even in helium-free cores with masses up to 1.52 {M}⊙ , which in single stars would ignite neon. If the core is able to contract to high enough densities for electron captures to commence, we find that, for the adopted Ledoux convection criterion, the initial mass range for the primary to evolve into an ECSN is between 13.5 and 17.6 {M}⊙ . The mass ratio, initial period, and mass-loss efficiency only marginally affect the predicted ranges.

  2. Mass Transfer via Low-Velocity Rebound in a Microgravity Environment

    NASA Astrophysics Data System (ADS)

    Jarmak, S. G.; Colwell, J. E.; Brisset, J.; Dove, A.; Brown, A. Q.

    2017-12-01

    Observations of low-velocity collisions (< 1 m/s) between μm to cm-size particles in a microgravity environment are crucial to an understanding of the surface properties of small, airless bodies as well as the processes that lead to their formation. The COLLIDE (Collisions Into Dust Experiment) and PRIME (Physics of Regolith Impacts in Microgravity Experiment) programs created impacts into simulated planetary regolith with cm-scale impactors to observe ejecta production and coefficients of restitution in microgravity. These experiments were carried out on orbit (COLLIDE, COLLIDE-2), in suborbital space (COLLIDE-3), and on parabolic airplane flights (PRIME) under vacuum. Some impacts at speeds less than 40 cm/s resulted in mass transfer from the target regolith onto the impactor. To study these mass-transfer collisions in more detail without the cost or time requirements of spaceflight or parabolic flights, we developed an experimental apparatus in a laboratory drop tower (free-fall time 0.75 s) and performed experiments at standard pressure. The impactor is suspended from a spring and remains in contact with the bed of regolith until free-fall allows the spring to retract and pull the impactor upwards. This method allowed us to simulate the rebound portion of a low-velocity collision in a laboratory microgravity environment. We achieved rebound velocities of 10 - 60 cm/s, and we observed mass transfer events with rebound speeds below 40 cm/s. The amount of mass transfer produced was more significant than a monolayer of granular material, but less than the amount observed in the COLLIDE and PRIME experiments. These mass-transfer collisions may play a role in the growth of planetesimals. We will present the results of our laboratory-based studies where we vary impact velocity and target material, and discuss implications for collisional evolution in the protoplanetary disk and planetary rings.

  3. Advanced Heat/Mass Exchanger Technology for Geothermal and Solar Renewable Energy Systems

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Greiner, Miles; Childress, Amy; Hiibel, Sage

    2014-12-16

    Northern Nevada has abundant geothermal and solar energy resources, and these renewable energy sources provide an ample opportunity to produce economically viable power. Heat/mass exchangers are essential components to any energy conversion system. Improvements in the heat/mass exchange process will lead to smaller, less costly (more efficient) systems. There is an emerging heat transfer technology, based on micro/nano/molecular-scale surface science that can be applied to heat/mass exchanger design. The objective is to develop and characterize unique coating materials, surface configurations and membranes capable of accommodating a 10-fold increase in heat/mass exchanger performance via phase change processes (boiling, condensation, etc.) andmore » single phase convective heat/mass transfer.« less

  4. Experimental study on bubble dynamics and wall heat transfer arising from a single nucleation site at subcooled flow boiling conditions – Part 2: Data analysis on sliding bubble characteristics and associated wall heat transfer

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Yooa, Junsoo; Estrada-Perez, Carlos E.; Hassan, Yassin A.

    In this second of two companion papers presents an analysis of sliding bubble and wall heat transfer parameters measured during subcooled boiling in a square, vertical, upward flow channel. Bubbles were generated only from a single nucleation site for better observation of both the sliding bubbles’ characteristics and their impact on wall heat transfer through optical measurement techniques. Specific interests include: (i) bubbles departure and subsequent growth while sliding, (ii) bubbles release frequency, (iii) coalescence of sliding bubbles, (iv) sliding bubbles velocity, (v) bubbles size distribution and (vi) wall heat transfer influenced by sliding bubbles. Our results showed that slidingmore » bubbles involve two distinct growth behaviors: (i) at low mass fluxes, sliding bubbles grew fast near the nucleation site, subsequently shrank, and then grew again, (ii) as mass flux increased, however, sliding bubbles grew more steadily. The bubbles originating from the single nucleation site coalesced frequently while sliding, which showed close relation with bubbles release frequency. The sliding bubble velocity near the nucleation site consistently decreased by increasing mass flux, while the observation often became reversed as the bubbles slid downstream due to the effect of interfacial drag. The sliding bubbles moved faster than the local liquid (i.e., ur<0) at low mass flux conditions, but it became reversed as the mass flux increased. The size distribution of sliding bubbles followed Gaussian distribution well both near and far from the nucleation site. The standard deviation of bubble size varied insignificantly through sliding compared to the changes in mean bubble size. Lastly, the sliding bubbles enhanced the wall heat transfer and the effect became more noticeable as inlet subcooling/mass flux decreased or wall heat flux increased. Particularly, the sliding bubble characteristics such as bubble growth behavior observed near the nucleation site played a dominant role in determining the ultimate level of wall heat transfer enhancement within the test channel.« less

  5. Experimental study on bubble dynamics and wall heat transfer arising from a single nucleation site at subcooled flow boiling conditions – Part 2: Data analysis on sliding bubble characteristics and associated wall heat transfer

    DOE PAGES

    Yooa, Junsoo; Estrada-Perez, Carlos E.; Hassan, Yassin A.

    2016-04-28

    In this second of two companion papers presents an analysis of sliding bubble and wall heat transfer parameters measured during subcooled boiling in a square, vertical, upward flow channel. Bubbles were generated only from a single nucleation site for better observation of both the sliding bubbles’ characteristics and their impact on wall heat transfer through optical measurement techniques. Specific interests include: (i) bubbles departure and subsequent growth while sliding, (ii) bubbles release frequency, (iii) coalescence of sliding bubbles, (iv) sliding bubbles velocity, (v) bubbles size distribution and (vi) wall heat transfer influenced by sliding bubbles. Our results showed that slidingmore » bubbles involve two distinct growth behaviors: (i) at low mass fluxes, sliding bubbles grew fast near the nucleation site, subsequently shrank, and then grew again, (ii) as mass flux increased, however, sliding bubbles grew more steadily. The bubbles originating from the single nucleation site coalesced frequently while sliding, which showed close relation with bubbles release frequency. The sliding bubble velocity near the nucleation site consistently decreased by increasing mass flux, while the observation often became reversed as the bubbles slid downstream due to the effect of interfacial drag. The sliding bubbles moved faster than the local liquid (i.e., ur<0) at low mass flux conditions, but it became reversed as the mass flux increased. The size distribution of sliding bubbles followed Gaussian distribution well both near and far from the nucleation site. The standard deviation of bubble size varied insignificantly through sliding compared to the changes in mean bubble size. Lastly, the sliding bubbles enhanced the wall heat transfer and the effect became more noticeable as inlet subcooling/mass flux decreased or wall heat flux increased. Particularly, the sliding bubble characteristics such as bubble growth behavior observed near the nucleation site played a dominant role in determining the ultimate level of wall heat transfer enhancement within the test channel.« less

  6. Impact of forced convective radiative heat and mass transfer mechanisms on 3D Carreau nanofluid: A numerical study

    NASA Astrophysics Data System (ADS)

    Khan, M.; Irfan, M.; Khan, W. A.

    2017-12-01

    Nanoliquids retain remarkable features that have fascinated various researchers owing to their utilization in nanoscience and nanotechnology. We will present a mathematical relation for 3D forced convective heat and mass transfer mechanism of a Carreau nanoliquid over a bidirectional stretched surface. Additionally, the features of heat source/sink and nonlinear thermal radiation are considered for the 3D Carreau nanoliquid. The governing nonlinear PDEs are established and altered into a set of nonlinear ODEs by utilizing a suitable conversion. A numerical approach, namely the bvp4c is adopted to resolve the resultant equations. The achieved outcomes are schemed and conferred in detail for somatic parameters. It is realized that amassed values of Brownian motion parameter Nb lead to enhance the temperature of the Carreau nanoliquid while quite conflicting behavior is being noticed for the concentration of the Carreau nanoliquid. Moreover, it is also noted that the influence of heat source δ > 0 is relatively antithetic to heat sink δ < 0 parameter, whereas an analogous impact is being identified for thermal Biot number γ on temperature and concentration Biot number γ1 on concentration of the Carreau nanoliquid for shear thinning/thickening liquids. Additionally, an assessment between the analytical technique, namely the homotopy analysis method (HAM) and the numerical scheme bvp4c is presented graphically, as well as in tabular form. From these comparisons we initiate a splendid communication with these results.

  7. Simulating the volatilization of solvents in unsaturated soils during laboratory and field infiltration experiments

    USGS Publications Warehouse

    Cho, H. Jean; Jaffe, Peter R.; Smith, James A.

    1993-01-01

    This paper describes laboratory and field experiments which were conducted to study the dynamics of trichloroethylene (TCE) as it volatilized from contaminated groundwater and diffused in the presence of infiltrating water through the unsaturated soil zone to the land surface. The field experiments were conducted at the Picatinny Arsenal, which is part of the United States Geological Survey Toxic Substances Hydrology Program. In both laboratory and field settings the gas and water phase concentrations of TCE were not in equilibrium during infiltration. Gas-water mass transfer rate constants were calibrated to the experimental data using a model in which the water phase was treated as two phases: a mobile water phase and an immobile water phase. The mass transfer limitations of a volatile organic compound between the gas and liquid phases were described explicitly in the model. In the laboratory experiment the porous medium was nonsorbing, and water infiltration rates ranged from 0.076 to 0.28 cm h−1. In the field experiment the water infiltration rate was 0.34 cm h−1, and sorption onto the soil matrix was significant. The laboratory-calibrated gas-water mass transfer rate constant is 3.3×10−4 h−1 for an infiltration rate of 0.076 cm h−1 and 1.4×10−3 h−1 for an infiltration rate of 0.28 cm h−1. The overall mass transfer rate coefficients, incorporating the contribution of mass transfer between mobile and immobile water phases and the variation of interfacial area with moisture content, range from 3×10−4 h−1 to 1×10−2 h−1. A power law model relates the gas-water mass transfer rate constant to the infiltration rate and the fraction of the water phase which is mobile. It was found that the results from the laboratory experiments could not be extrapolated to the field. In order to simulate the field experiment the very slow desorption of TCE from the soil matrix was incorporated into the mathematical model. When desorption from the soil matrix was added to the model, the calibrated gas-water mass transfer rate constant is 2 orders of magnitude lower than that predicted using the power law model developed for the nonsorbing laboratory soil.

  8. Dynamics of internal waves on the Southeast Florida shelf: Implications for cross-shelf exchange and turbulent mixing on a barrier reef system

    NASA Astrophysics Data System (ADS)

    Davis, Kristen Alexis

    The dynamics of internal waves shoaling on the Southeast Florida shelf and the resulting stratified turbulence in the shelf bottom boundary layer are investigated using observational studies completed during the summers of 2003-2005. This work is driven by a desire to understand the effects of internal wave-driven flow and the shoreward transport of cool, nutrient-rich water masses on cross-shelf exchange, vertical mixing, and mass transfer to benthic reef organisms. Shelf sea internal wave fields are typically highly variable and dominated by wind and tidal forces. However, this is not necessarily true for outer shelf regions or very narrow shelves where remote physical processes originating over the slope or deep ocean may exert a strong influence on the internal wave climate. During the summers of 2003 and 2004 observational studies were conducted to examine the effects of a western boundary current (the Florida Current), tides, and wind on the mean currents and internal wave field on the outer Southeast Florida shelf. We present evidence that suggests that the Florida Current plays as large a role in the determination of the high frequency internal wave field as tidal forces. These observations and analyses show that it is necessary to include the forcing from the Florida Current meanders and instabilities in order to predict accurately the episodic nature of the internal wave field on the Southeast Florida shelf. Deep ocean and continental shelf processes intersect at the shelf edge and influence the exchange of water masses and their associated characteristics including heat, nutrients, sediment, and larvae across the shelf. Thus, the dynamics of cross-shelf circulation have important consequences for organisms living on the shelf. In the second phase of this work, we investigate physical mechanisms controlling the exchange of water masses during the summer season across the Southeast Florida shelf. A time series of cross-shelf transport from May to August 2003 suggests that, during the summer months, instabilities in the Florida Current and nonlinear internal waves are the primary mechanisms driving cross-shelf transport on the outer shelf Surface tide, wind, and wave-driven transport were found to be small in comparison. Additionally, this data set highlights the importance of baroclinic processes to cross-shelf transport in this region. In the last phase of my research, I sought to investigate how boundary layer dynamics over a rough coral bed were modified by shoaling internal waves and to understand the implications for mixing and mass transfer to the bed. Results are presented from an observational study of the turbulent bottom boundary layer on the outer Southeast Florida shelf in July and August 2005. Turbulence in the reef bottom boundary layer is highly variable in time and is modified by near bed flow, shear, and stratification driven by shoaling internal waves. We examined turbulence in the bottom boundary layer during a typical internal wave event and found that in addition to the episodic onshore transport of cool, subthermocline water masses, with elevated nutrient concentrations, bottom-intensified currents from shoaling internal waves can increase turbulent dissipation and mixing in the reef bottom boundary layer. Additionally, we show that estimates of flux Richardson number, calculated directly from measurements of dissipation and buoyancy flux, support the dependence of R f on turbulent intensity, epsilon/nuN 2, a relationship that has only been previously shown in laboratory and numerical work. While the importance of surface gravity waves in generating turbulent mixing and controlling mass transfer on coral reefs has been well documented in the literature, this work represents the first time the appropriate field data have been collected for a detailed dynamic analysis of the physical effects and biological implications of internal waves on reef ecosystems. Results from these studies suggest that for reef communities exposed to continental shelf and slope processes, internal waves may play an important role in cross-shelf transport and mass transfer to benthic organisms and may be essential to modeling key biological processes, the connectivity of coral populations, or designing and managing marine reserves and fisheries.

  9. Reactive Gas transport in soil: Kinetics versus Local Equilibrium Approach

    NASA Astrophysics Data System (ADS)

    Geistlinger, Helmut; Jia, Ruijan

    2010-05-01

    Gas transport through the unsaturated soil zone was studied using an analytical solution of the gas transport model that is mathematically equivalent to the Two-Region model. The gas transport model includes diffusive and convective gas fluxes, interphase mass transfer between the gas and water phase, and biodegradation. The influence of non-equilibrium phenomena, spatially variable initial conditions, and transient boundary conditions are studied. The objective of this paper is to compare the kinetic approach for interphase mass transfer with the standard local equilibrium approach and to find conditions and time-scales under which the local equilibrium approach is justified. The time-scale of investigation was limited to the day-scale, because this is the relevant scale for understanding gas emission from the soil zone with transient water saturation. For the first time a generalized mass transfer coefficient is proposed that justifies the often used steady-state Thin-Film mass transfer coefficient for small and medium water-saturated aggregates of about 10 mm. The main conclusion from this study is that non-equilibrium mass transfer depends strongly on the temporal and small-scale spatial distribution of water within the unsaturated soil zone. For regions with low water saturation and small water-saturated aggregates (radius about 1 mm) the local equilibrium approach can be used as a first approximation for diffusive gas transport. For higher water saturation and medium radii of water-saturated aggregates (radius about 10 mm) and for convective gas transport, the non-equilibrium effect becomes more and more important if the hydraulic residence time and the Damköhler number decrease. Relative errors can range up to 100% and more. While for medium radii the local equilibrium approach describes the main features both of the spatial concentration profile and the time-dependence of the emission rate, it fails completely for larger aggregates (radius about 100 mm). From the comparative study of relevant scenarios with and without biodegradation it can be concluded that, under realistic field conditions, biodegradation within the immobile water phase is often mass-transfer limited and the local equilibrium approach assuming instantaneous mass transfer becomes rather questionable. References Geistlinger, H., Ruiyan Jia, D. Eisermann, and C.-F. Stange (2008): Spatial and temporal variability of dissolved nitrous oxide in near-surface groundwater and bubble-mediated mass transfer to the unsaturated zone, J. Plant Nutrition and Soil Science, in press. Geistlinger, H. (2009) Vapor transport in soil: concepts and mathematical description. In: Eds.: S. Saponari, E. Sezenna, and L. Bonoma, Vapor emission to outdoor air and enclosed spaces for human health risk assessment: Site characterization, monitoring, and modeling. Nova Science Publisher. Milano. Accepted for publication.

  10. Dehydration reactions, mass transfer and rock deformation relationships during subduction of Alpine metabauxites: insights from LIBS compositional profiles between metamorphic veins

    NASA Astrophysics Data System (ADS)

    Verlaguet, A.; Brunet, F.; Goffe, B.; Menut, D.; Findling, N.; Poinssot, C.

    2011-12-01

    In subduction zones, the significant amounts of aqueous fluid released in the course of the successive dehydration reactions occurring during prograde metamorphism are expected to strongly influence the rock rheology, as well as kinetics of metamorphic reactions and mass transfer efficiency. Mineralized veins, ubiquitous in metamorphic rocks, can be seen as preserved witnesses of fluid and mass redistribution that partly accommodate the rock deformation (lateral segregation). However, the driving forces and mechanisms of mass transfer towards fluid-filled open spaces remain somewhat unclear. The aim of this study is to investigate the modalities of mass transfer during local fluid-rock interactions, and their links with fluid production and rock deformation. This study focuses on karstic pockets (metre scale) of Triassic metabauxites embedded in thick carbonate units, that have been isolated from large-scale fluid flow during HP-LT Alpine metamorphism (W. Vanoise, French Alps). These rocks display several generations of metamorphic veins containing various Al-bearing minerals, which give particular insights into mass transfer processes. It is proposed that the internally-derived fluid (~13 vol% produced by successive dehydration reactions) has promoted the opening of fluid-filled open spaces (euhedral habits of vein minerals) and served as medium for diffusive mass transfer from rock to vein. Based on mineralogical and textural features, two vein types can be distinguished: (1) some veins are filled with newly formed products of either prograde (chloritoid) or retrograde (chlorite) metamorphic reactions; in this case, fluid-filled open spaces seem to offer energetically favourable nucleation/growth sites; (2) the second vein type is filled with cookeite (Li-Al-rich chlorite) or pyrophyllite, that were present in the host rock prior to the vein formation. In this closed chemical system, mass transfer from rock to vein was achieved through the fluid, in a dissolution-transport-precipitation process, possibly stress-assisted. Cookeite is highly concentrated (40-70 vol%) in regularly spaced veins. Laser Induced Breakdown Spectroscopy profiles show that cookeite is evenly distributed in the rock matrix comprised between two veins. The absence of diffusion profiles suggests that the characteristic diffusion length for Li, Al and Si is greater than or equal to the distance separating two cookeite veins (3-6 cm). This is in agreement with characteristic diffusion lengths calculated from both grain boundary and pore fluid diffusion coefficients, for the estimated duration of the peak of metamorphism. Phyllosilicates have very different morphologies in the rock matrix (fibers) compared to veins (euhedral crystals): fluid-mineral interfacial energy may be maximal in the small matrix pores, which can maintain higher cookeite solubility than in fluid-filled open spaces. Therefore, as soon as veins open, chemical potential gradients may develop and drive cookeite transfer from rock matrix to veins.

  11. Aseismic creep along the North Anatolian Fault quantified by coupling microstructural strain and chemical analyses

    NASA Astrophysics Data System (ADS)

    Kaduri, Maor; Gratier, Jean-Pierre; Renard, François; Çakir, Ziyadin; Lasserre, Cécile

    2017-04-01

    In the last decade aseismic creep has been noted as one of the key processes along tectonic plate boundaries. It contributes to the energy budget during the seismic cycle, delaying or triggering the occurrence of large earthquakes. Several major continental active faults show spatial alternation of creeping and locked segments. A great challenge is to understand which parameters control the transition from seismic to aseismic deformation in fault zones, such as the lithology, the degree of deformation from damage rocks to gouge, and the stress driven fault architecture transformations at all scales. The present study focuses on the North Anatolian Fault (Turkey) and characterizes the mechanisms responsible for the partition between seismic and aseismic deformation. Strain values were calculated using various methods, e.g. Fry, R-φs from microstructural measurements in gouge and damage samples collected on more than 30 outcrops along the fault. Maps of mineral composition were reconstructed from microprobe measurements of gouge and damage rock microstructure, in order to calculate the relative mass changes due to stress driven processes during deformation. Strain values were extracted, in addition to the geometrical properties of grain orientation and size distribution. Our data cover subsamples in the damage zones that were protected from deformation and are reminiscent of the host rock microstructure and composition, and subsamples that were highly deformed and recorded both seismic and aseismic deformations. Increase of strain value is linked to the evolution of the orientation of the grains from random to sheared sub-parallel and may be related to various parameters: (1) relative mass transfer increase with increasing strain indicating how stress driven mass transfer processes control aseismic creep evolution with time; (2) measured strain is strongly related with the initial lithology and with the evolution of mineral composition: monomineralic rocks are stronger (less deformed) than polymineralic ones; (3) strain measurements allow to evaluate the cumulated geological displacement accommodated by aseismic creep and the relative ratio between seismic and aseismic displacement for each section of an active fault. These relations allow to quantify more accurately the aseismic creep processes and their evolution with time along the North Anatolian Fault which are controlled by a superposition of two kinds of mechanisms: (1) stress driven mass transfer (pressure solution and metamorphism) that control local and regional mass transfer and associated rheology evolution and (2) grain boundary sliding along weak mineral interfaces (initially weak minerals or more often transformed by deformation-related reactions).

  12. Simultaneous thermodynamic and geochemical analyses for P-T-time and mass transport toward comprehensive understanding of metamorphism

    NASA Astrophysics Data System (ADS)

    Uno, M.; Nakamura, H.; Iwamori, H.

    2011-12-01

    Individual parcel of regional metamorphic rock records physico-chemical conditions such as P-T path, mass transfer and deformation with the Lagrangian specification. On the other hand, a metamorphic belt as an ensemble of such parcels may provide a large-scale flow field of energy (e.g., temperature, entropy) and mass (including both solid and fluid phases with elements and isotopes) with the Eulerian specification. However, there is so far few model that integrates all the variables stated above. Phase petrology provides mostly the intensive variables (e.g., P-T path), whereas geochemistry provides mostly the extensive variables (time-integrated mass transfer), and these two have been treated separately. Here we combine phase petrology and geochemistry from a scale of mineral grain, and solve them under a simultaneous and consistent set of thermodynamic and mass balance equation. For this sake, the Sanbagawa metamorphic belt in Japan has been surveyed. To understand the nature of fluid during rehydration, we analyzed both basic rocks and pelitic rocks that record retrograde reactions. Major and trace element compositions of each mineral, and bulk rock chemistry have been analyzed with EPMA, LA-ICP-MS, XRF and ICP-MS, respectively. Retrograde P-T path and the extent of rehydration of each rock have been obtained by applying the Gibbs' method (e.g. Spear, 1993; Okamoto&Toriumi, 2001) to amphiboles. Trace element budget along a specific P-T path were calculated by equating differential mass balance equation for major and trace elements as follows; XfluiddMfluid = ⊙MsolidXsolid + ⊙XsoliddMsolid Where the X and M denotes compositions and modes of minerals and dX and dM are their changes along a specific P-T change. The mineral compositions (Xsolid), mineral modes (Msolid), mineral growths (dMsolid) for zoned minerals (amphibole and/or garnet) and fluid compositions (Xfluid) were derived from the results of Gibbs' method, X-ray map and fluid/mineral partition coefficients, respectively. Thus, the unknowns are dMs, and the equations are solved for them. As a result, the mass transfer during the specific P-T change (Xfluid dMfluid) can be specified. It is revealed that fluid mobile elements such as LIL elements, Sr and Pb are mostly proportional to LOI (loss on ignition). LOI and extent of rehydration is proportional in the Sanbagawa belt (Okamoto&Toriumi, 2005), thus the observed enrichment of LILE, Sr and Pb are interpreted to be associated with rehydration. The Sr isotope ratios of the basic shists also increase with LOI, implying that the differences in bulk rock chemistry are not attributed to differences in mineral modes,but addition and/or reaction with external source of fluids with high 87Sr/86Sr. The estimated fluid composition is similar to calculated compositions of slab-derived fluids (Nakamura et al., 2008). From mass balance calculation, trace element budget associated with rehydration reactions and their spatial distribution will be presented, and the mechanisms of mass and fluid transfer will be discussed.

  13. Efficiency of ETV diagrams as diagnostic tools for long-term period variations. II. Non-conservative mass transfer, and gravitational radiation

    NASA Astrophysics Data System (ADS)

    Nanouris, N.; Kalimeris, A.; Antonopoulou, E.; Rovithis-Livaniou, H.

    2015-03-01

    Context. The credibility of an eclipse timing variation (ETV) diagram analysis is investigated for various manifestations of the mass transfer and gravitational radiation processes in binary systems. The monotonicity of the period variations and the morphology of the respective ETV diagrams are thoroughly explored in both the direct impact and the accretion disk mode of mass transfer, accompanied by different types of mass and angular momentum losses (through a hot-spot emission from the gainer and via the L2/L3 points). Aims: Our primary objective concerns the traceability of each physical mechanism by means of an ETV diagram analysis. Also, possible critical mass ratio values are sought for those transfer modes that involve orbital angular momentum losses strong enough to dictate the secular period changes even when highly competitive mechanisms with the opposite direction act simultaneously. Methods: The dot{J-dot{P}} relation that governs the orbital evolution of a binary system is set to provide the exact solution for the period and the function expected to represent the subsequent eclipse timing variations. The angular momentum transport is parameterized through appropriate empirical relations, which are inferred from semi-analytical ballistic models. Then, we numerically determine the minimum temporal range over which a particular mechanism is rendered measurable, as well as the critical mass ratio values that signify monotonicity inversion in the period modulations. Results: Mass transfer rates comparable to or greater than 10-8 M⊙ yr-1 are measurable for typical noise levels of the ETV diagrams, regardless of whether the process is conservative. However, the presence of a transient disk around the more massive component defines a critical mass ratio (qcr ≈ 0.83) above which the period turns out to decrease when still in the conservative regime, rendering the measurability of the anticipated variations a much more complicated task. The effects of gravitational radiation proved to be rather undetectable, except for systems with physical characteristics that only refer to cataclysmic variables. Conclusions: The monotonicity of the period variations and the curvature of the respective ETV diagrams depend strongly on the accretion mode and the degree of conservatism of the transfer process. Unlike the hot-spot effects, the Lagrangian points L2 and L3 support very efficient routes of strong angular momentum loss. It is further shown that escape of mass via the L3 point - when the donor is the less massive component - safely provides critical mass ratios above which the period is expected to decrease, no matter how intense the process is.

  14. VOLATILIZATION RATES FROM WATER TO INDOOR AIR ...

    EPA Pesticide Factsheets

    Contaminated water can lead to volatilization of chemicals to residential indoor air. Previous research has focused on only one source (shower stalls) and has been limited to chemicals in which gas-phase resistance to mass transfer is of marginal significance. As a result, attempts to extrapolate chemical emissions from high-volatility chemicals to lower volatility chemicals, or to sources other than showers, have been difficult or impossible. This study involved the development of two-phase, dynamic mass balance models for estimating chemical emissions from washing machines, dishwashers, and bathtubs. An existing model was adopted for showers only. Each model required the use of source- and chemical-specific mass transfer coefficients. Air exchange (ventilation) rates were required for dishwashers and washing machines as well. These parameters were estimated based on a series of 113 experiments involving 5 tracer chemicals (acetone, ethyl acetate, toluene, ethylbenzene, and cyclohexane) and 4 sources (showers, bathtubs, washing machines, and dishwashers). Each set of experiments led to the determination of chemical stripping efficiencies and mass transfer coefficients (overall, liquid-phase, gas-phase), and to an assessment of the importance of gas- phase resistance to mass transfer. Stripping efficiencies ranged from 6.3% to 80% for showers, 2.6% to 69% for bathtubs, 18% to 100% for dishwashers, and 3.8% to 100% for washing machines. Acetone and cyclohexane al

  15. DOE Office of Scientific and Technical Information (OSTI.GOV)

    Hendler, Nathanial P.; Mulders, Gijs D.; Pascucci, Ilaria

    The properties of disks around brown dwarfs and very low mass stars (hereafter VLMOs) provide important boundary conditions on the process of planet formation and inform us about the numbers and masses of planets than can form in this regime. We use the Herschel Space Observatory PACS spectrometer to measure the continuum and [O i] 63 μ m line emission toward 11 VLMOs with known disks in the Taurus and Chamaeleon I star-forming regions. We fit radiative transfer models to the spectral energy distributions of these sources. Additionally, we carry out a grid of radiative transfer models run in amore » regime that connects the luminosity of our sources with brighter T Tauri stars. We find that VLMO disks with sizes 1.3–78 au, smaller than typical T Tauri disks, fit well the spectral energy distributions assuming that disk geometry and dust properties are stellar mass independent. Reducing the disk size increases the disk temperature, and we show that VLMOs do not follow previously derived disk temperature–stellar luminosity relationships if the disk outer radius scales with stellar mass. Only 2 out of 11 sources are detected in [O i] despite a better sensitivity than was achieved for T Tauri stars, suggesting that VLMO disks are underluminous. Using thermochemical models, we show that smaller disks can lead to the unexpected [O i] 63 μ m nondetections in our sample. The disk outer radius is an important factor in determining the gas and dust observables. Hence, spatially resolved observations with ALMA—to establish if and how disk radii scale with stellar mass—should be pursued further.« less

  16. [Study on the dynamic model with supercritical CO2 fluid extracting the lipophilic components in Panax notoginseng].

    PubMed

    Duan, Xian-Chun; Wang, Yong-Zhong; Zhang, Jun-Ru; Luo, Huan; Zhang, Heng; Xia, Lun-Zhu

    2011-08-01

    To establish a dynamics model for extracting the lipophilic components in Panax notoginseng with supercritical carbon dioxide (CO2). Based on the theory of counter-flow mass transfer and the molecular mass transfer between the material and the supercritical CO2 fluid under differential mass-conservation equation, a dynamics model was established and computed to compare forecasting result with the experiment process. A dynamics model has been established for supercritical CO2 to extract the lipophilic components in Panax notoginseng, the computed result of this model was consistent with the experiment process basically. The supercritical fluid extract dynamics model established in this research can expound the mechanism in the extract process of which lipophilic components of Panax notoginseng dissolve the mass transfer and is tallied with the actual extract process. This provides certain instruction for the supercritical CO2 fluid extract' s industrialization enlargement.

  17. Modeling the improvement of ultrafiltration membrane mass transfer when using biofiltration pretreatment in surface water applications.

    PubMed

    Netcher, Andrea C; Duranceau, Steven J

    2016-03-01

    In surface water treatment, ultrafiltration (UF) membranes are widely used because of their ability to supply safe drinking water. Although UF membranes produce high-quality water, their efficiency is limited by fouling. Improving UF filtrate productivity is economically desirable and has been attempted by incorporating sustainable biofiltration processes as pretreatment to UF with varying success. The availability of models that can be applied to describe the effectiveness of biofiltration on membrane mass transfer are lacking. In this work, UF water productivity was empirically modeled as a function of biofilter feed water quality using either a quadratic or Gaussian relationship. UF membrane mass transfer variability was found to be governed by the dimensionless mass ratio between the alkalinity (ALK) and dissolved organic carbon (DOC). UF membrane productivity was optimized when the biofilter feed water ALK to DOC ratio fell between 10 and 14. Copyright © 2015 Elsevier Ltd. All rights reserved.

  18. The role of symmetry in the mass independent isotope effect in ozone

    PubMed Central

    Michalski, Greg; Bhattacharya, S. K.

    2009-01-01

    Understanding the internal distribution of “anomalous” isotope enrichments has important implications for validating theoretical postulates on the origin of these enrichments in molecules such as ozone and for understanding the transfer of these enrichments to other compounds in the atmosphere via mass transfer. Here, we present an approach, using the reaction NO2− + O3, for assessing the internal distribution of the Δ17O anomaly and the δ18O enrichment in ozone produced by electric discharge. The Δ17O results strongly support the symmetry mechanism for generating mass independent fractionations, and the δ18O results are consistent with published data. Positional Δ17O and δ18O enrichments in ozone can now be more effectively used in photochemical models that use mass balance oxygen atom transfer mechanisms to infer atmospheric oxidation chemistry. PMID:19307571

  19. Sherwood correlation for dissolution of pooled NAPL in porous media

    NASA Astrophysics Data System (ADS)

    Aydin Sarikurt, Derya; Gokdemir, Cagri; Copty, Nadim K.

    2017-11-01

    The rate of interphase mass transfer from non-aqueous phase liquids (NAPLs) entrapped in the subsurface into the surrounding mobile aqueous phase is commonly expressed in terms of Sherwood (Sh) correlations that are expressed as a function of flow and porous media properties. Because of the lack of precise methods for the estimation of the interfacial area separating the NAPL and aqueous phases, most studies have opted to use modified Sherwood expressions that lump the interfacial area into the interphase mass transfer coefficient. To date, there are only two studies in the literature that have developed non-lumped Sherwood correlations; however, these correlations have undergone limited validation. In this paper controlled dissolution experiments from pooled NAPL were conducted. The immobile NAPL mass is placed at the bottom of a flow cell filled with porous media with water flowing horizontally on top. Effluent aqueous phase concentrations were measured for a wide range of aqueous phase velocities and for two different porous media. To interpret the experimental results, a two-dimensional pore network model of the NAPL dissolution kinetics and aqueous phase transport was developed. The observed effluent concentrations were then used to compute best-fit mass transfer coefficients. Comparison of the effluent concentrations computed with the two-dimensional pore network model to those estimated with one-dimensional analytical solutions indicates that the analytical model which ignores the transport in the lateral direction can lead to under-estimation of the mass transfer coefficient. Based on system parameters and the estimated mass transfer coefficients, non-lumped Sherwood correlations were developed and compared to previously published data. The developed correlations, which are a significant improvement over currently available correlations that are associated with large uncertainties, can be incorporated into future modeling studies requiring non-lumped Sh expressions.

  20. Determination of the mass-transfer coefficient in liquid phase in a stream-bubble contact device

    NASA Astrophysics Data System (ADS)

    Dmitriev, A. V.; Dmitrieva, O. S.; Madyshev, I. N.

    2016-09-01

    One of the most effective energy saving technologies is the improvement of existing heat and mass exchange units. A stream-bubble contact device is designed to enhance the operation efficiency of heat and mass exchange units. The stages of the stream-bubble units that are proposed by the authors for the decarbonization process comprise contact devices with equivalent sizes, whose number is determined by the required performance of a unit. This approach to the structural design eliminates the problems that arise upon the transition from laboratory samples to industrial facilities and makes it possible to design the units of any required performance without a decrease in the effectiveness of mass exchange. To choose the optimal design that provides the maximum effectiveness of the mass-exchange processes in units and their intensification, the change of the mass-transfer coefficient is analyzed with the assumption of a number of parameters. The results of the study of the effect of various structural parameters of a stream-bubble contact device on the mass-transfer coefficient in the liquid phase are given. It is proven that the mass-transfer coefficient increases in the liquid phase, in the first place, with the growth of the level of liquid in the contact element, because the rate of the liquid run-off grows in this case and, consequently, the time of surface renewal is reduced; in the second place, with an increase in the slot diameter in the downpipe, because the jet diameter and, accordingly, their section perimeter and the area of the surface that is immersed in liquid increase; and, in the third place, with an increase in the number of slots in the downpipe, because the area of the surface that is immersed in the liquid of the contact element increases. Thus, in order to increase the mass-transfer coefficient in the liquid phase, it is necessary to design the contact elements with a minimum width and a large number of slots and their increased diameter; in this case, the filling degree of contact elements by the liquid must be maximum.

  1. Spectral and Structure Modeling of Low and High Mass Young Stars Using a Radiative Trasnfer Code

    NASA Astrophysics Data System (ADS)

    Robson Rocha, Will; Pilling, Sergio

    The spectroscopy data from space telescopes (ISO, Spitzer, Herchel) shows that in addition to dust grains (e.g. silicates), there is also the presence of the frozen molecular species (astrophysical ices, such as H _{2}O, CO, CO _{2}, CH _{3}OH) in the circumstellar environments. In this work we present a study of the modeling of low and high mass young stellar objects (YSOs), where we highlight the importance in the use of the astrophysical ices processed by the radiation (UV, cosmic rays) comes from stars in formation process. This is important to characterize the physicochemical evolution of the ices distributed by the protostellar disk and its envelope in some situations. To perform this analysis, we gathered (i) observational data from Infrared Space Observatory (ISO) related with low mass protostar Elias29 and high mass protostar W33A, (ii) absorbance experimental data in the infrared spectral range used to determinate the optical constants of the materials observed around this objects and (iii) a powerful radiative transfer code to simulate the astrophysical environment (RADMC-3D, Dullemond et al, 2012). Briefly, the radiative transfer calculation of the YSOs was done employing the RADMC-3D code. The model outputs were the spectral energy distribution and theoretical images in different wavelengths of the studied objects. The functionality of this code is based on the Monte Carlo methodology in addition to Mie theory for interaction among radiation and matter. The observational data from different space telescopes was used as reference for comparison with the modeled data. The optical constants in the infrared, used as input in the models, were calculated directly from absorbance data obtained in the laboratory of both unprocessed and processed simulated interstellar samples by using NKABS code (Rocha & Pilling 2014). We show from this study that some absorption bands in the infrared, observed in the spectrum of Elias29 and W33A can arises after the ices around the protostars were processed by the radiation comes from central object. In addition, we were able also to compare the observational data for this two objects with those obtained in the modeling. Authors would like to thanks the agencies FAPESP (JP#2009/18304-0 and PHD#2013/07657-5).

  2. Hygrothermal behavior for a clay brick wall

    NASA Astrophysics Data System (ADS)

    Allam, R.; Issaadi, N.; Belarbi, R.; El-Meligy, M.; Altahrany, A.

    2018-06-01

    In Egypt, the clay brick is the common building materials which are used. By studying clay brick walls behavior for the heat and moisture transfer, the efficient use of the clay brick can be reached. So, this research studies the hygrothermal transfer in this material by measuring the hygrothermal properties and performing experimental tests for a constructed clay brick wall. We present the model for the hygrothermal transfer in the clay brick which takes the temperature and the vapor pressure as driving potentials. In addition, this research compares the presented model with previous models. By constructing the clay brick wall between two climates chambers with different boundary conditions, we can validate the numerical model and analyze the hygrothermal transfer in the wall. The temperature and relative humidity profiles within the material are measured experimentally and determined numerically. The numerical and experimental results have a good convergence with 3.5% difference. The surface boundary conditions, the ground effect, the infiltration from the closed chambers and the material heterogeneity affects the results. Thermal transfer of the clay brick walls reaches the steady state very rapidly than the moisture transfer. That means the effect of using only the external brick wall in the building in hot climate without increase the thermal resistance for the wall, will add more energy losses in the clay brick walls buildings. Also, the behavior of the wall at the heat and mass transfer calls the three-dimensional analysis for the whole building to reach the real behavior.

  3. Hygrothermal behavior for a clay brick wall

    NASA Astrophysics Data System (ADS)

    Allam, R.; Issaadi, N.; Belarbi, R.; El-Meligy, M.; Altahrany, A.

    2018-01-01

    In Egypt, the clay brick is the common building materials which are used. By studying clay brick walls behavior for the heat and moisture transfer, the efficient use of the clay brick can be reached. So, this research studies the hygrothermal transfer in this material by measuring the hygrothermal properties and performing experimental tests for a constructed clay brick wall. We present the model for the hygrothermal transfer in the clay brick which takes the temperature and the vapor pressure as driving potentials. In addition, this research compares the presented model with previous models. By constructing the clay brick wall between two climates chambers with different boundary conditions, we can validate the numerical model and analyze the hygrothermal transfer in the wall. The temperature and relative humidity profiles within the material are measured experimentally and determined numerically. The numerical and experimental results have a good convergence with 3.5% difference. The surface boundary conditions, the ground effect, the infiltration from the closed chambers and the material heterogeneity affects the results. Thermal transfer of the clay brick walls reaches the steady state very rapidly than the moisture transfer. That means the effect of using only the external brick wall in the building in hot climate without increase the thermal resistance for the wall, will add more energy losses in the clay brick walls buildings. Also, the behavior of the wall at the heat and mass transfer calls the three-dimensional analysis for the whole building to reach the real behavior.

  4. Mass transfer from a circular cylinder: Effects of flow unsteadiness and slight nonuniformities

    NASA Technical Reports Server (NTRS)

    Marziale, M. L.; Mayle, R. E.

    1984-01-01

    Experiments were performed to determine the effect of periodic variations in the angle of the flow incident to a turbine blade on its leading edge heat load. To model this situation, measurements were made on a circular cylinder oscillating rotationally in a uniform steady flow. A naphthalene mass transfer technique was developed and used in the experiments and heat transfer rates are inferred from the results. The investigation consisted of two parts. In the first, a stationary cylinder was used and the transfer rate was measured for Re = 75,000 to 110,000 and turbulence levels from .34 percent to 4.9 percent. Comparisons with both theory and the results of others demonstrate that the accuracy and repeatability of the developed mass transfer technique is about + or - 2 percent, a large improvement over similar methods. In the second part identical flow conditions were used but the cylinder was oscillated. A Strouhal number range from .0071 to .1406 was covered. Comparisons of the unsteady and steady results indicate that the magnitude of the effect of oscillation is small and dependent on the incident turbulence conditions.

  5. Numerical Problems and Agent-Based Models for a Mass Transfer Course

    ERIC Educational Resources Information Center

    Murthi, Manohar; Shea, Lonnie D.; Snurr, Randall Q.

    2009-01-01

    Problems requiring numerical solutions of differential equations or the use of agent-based modeling are presented for use in a course on mass transfer. These problems were solved using the popular technical computing language MATLABTM. Students were introduced to MATLAB via a problem with an analytical solution. A more complex problem to which no…

  6. Determination of the Heat and Mass Transfer Efficiency at the Contact Stage of a Jet-Film Facility

    NASA Astrophysics Data System (ADS)

    Dmitrieva, O. S.; Madyshev, I. N.; Dmitriev, A. V.

    2017-05-01

    A contact jet-film facility has been developed for increasing the efficiency of operation of industrial cooling towers. The results of experimental and analytical investigation of the operation of this facility, its hydraulic resistance, and of the heat and mass transfer efficiency of its contact stage are presented.

  7. Temperature Coefficient for Modeling Denitrification in Surface Water Sediments Using the Mass Transfer Coefficient

    Treesearch

    T. W. Appelboom; G. M. Chescheir; R. W. Skaggs; J. W. Gilliam; Devendra M. Amatya

    2006-01-01

    Watershed modeling has become an important tool for researchers with the high costs of water quality monitoring. When modeling nitrate transport within drainage networks, denitrification within the sediments needs to be accounted for. Birgand et. al. developed an equation using a term called a mass transfer coefficient to mathematically describe sediment...

  8. Modeling of mass transfer of Phospholipids in separation process with supercritical CO2 fluid by RBF artificial neural networks

    USDA-ARS?s Scientific Manuscript database

    An artificial Radial Basis Function (RBF) neural network model was developed for the prediction of mass transfer of the phospholipids from canola meal in supercritical CO2 fluid. The RBF kind of artificial neural networks (ANN) with orthogonal least squares (OLS) learning algorithm were used for mod...

  9. Temperature coefficient for modeling denitrification in surface water sediments using the mass transfer coefficient

    Treesearch

    T.W. Appelboom; G.M. Chescheir; F. Birgand; R.W. Skaggs; J.W. Gilliam; D. Amatya

    2010-01-01

    Watershed modeling has become an important tool for researchers. Modeling nitrate transport within drainage networks requires quantifying the denitrification within the sediments in canals and streams. In a previous study, several of the authors developed an equation using a term called a mass transfer coefficient to mathematically describe sediment denitrification....

  10. Temperature coefficient for modeling denitrification in surface water sediments using the mass transfer coefficient.

    Treesearch

    T.W. Appelboom; G.M. Chescheir; F. Birgand; R.W. Skaggs; J.W. Gilliam; D. Amatya

    2010-01-01

    Watershed modeling has become an important tool for researchers. Modeling nitrate transport within drainage networks requires quantifying the denitrification within the sediments in canals and streams. In a previous study, several of the authors developed an equation using a term called a mass transfer coefficient to mathematically describe sediment denitrification....

  11. Teaching Mass Transfer and Filtration Using Crossflow Reverse Osmosis and Nanofiltration: An Experiment for the Undergraduate Unit Operations Lab

    ERIC Educational Resources Information Center

    Anastasio, Daniel; McCutcheon, Jeffrey

    2012-01-01

    A crossflow reverse osmosis (RO) system was built for a senior-level chemical engineering unit operations laboratory course. Intended to teach students mass transfer fundamentals related to membrane separations, students tested several commercial desalination membranes, measuring water flux and salt rejections at various pressures, flow rates, and…

  12. Numerical simulation of heat and mass transfer in unsteady nanofluid between two orthogonally moving porous coaxial disks

    NASA Astrophysics Data System (ADS)

    Ali, Kashif; Akbar, Muhammad Zubair; Iqbal, Muhammad Farooq; Ashraf, Muhammad

    2014-10-01

    The paper deals with the study of heat and mass transfer in an unsteady viscous incompressible water-based nanofluid (containing Titanium dioxide nanoparticles) between two orthogonally moving porous coaxial disks with suction. A combination of iterative (successive over relaxation) and a direct method is employed for solving the sparse systems of linear algebraic equations arising from the FD discretization of the linearized self similar ODEs. It has been noticed that the rate of mass transfer at the disks decreases with the permeability Reynolds number whether the disks are approaching or receding. The findings of the present investigation may be beneficial for the electronic industry in maintaining the electronic components under effective and safe operational conditions.

  13. Two-dimensional CFD modeling of the heat and mass transfer process during sewage sludge drying in a solar dryer

    NASA Astrophysics Data System (ADS)

    Krawczyk, Piotr; Badyda, Krzysztof

    2011-12-01

    The paper presents key assumptions of the mathematical model which describes heat and mass transfer phenomena in a solar sewage drying process, as well as techniques used for solving this model with the Fluent computational fluid dynamics (CFD) software. Special attention was paid to implementation of boundary conditions on the sludge surface, which is a physical boundary between the gaseous phase - air, and solid phase - dried matter. Those conditions allow to model heat and mass transfer between the media during first and second drying stages. Selection of the computational geometry is also discussed - it is a fragment of the entire drying facility. Selected modelling results are presented in the final part of the paper.

  14. Three phase heat and mass transfer model for unsaturated soil freezing process: Part 2 - model validation

    NASA Astrophysics Data System (ADS)

    Zhang, Yaning; Xu, Fei; Li, Bingxi; Kim, Yong-Song; Zhao, Wenke; Xie, Gongnan; Fu, Zhongbin

    2018-04-01

    This study aims to validate the three-phase heat and mass transfer model developed in the first part (Three phase heat and mass transfer model for unsaturated soil freezing process: Part 1 - model development). Experimental results from studies and experiments were used for the validation. The results showed that the correlation coefficients for the simulated and experimental water contents at different soil depths were between 0.83 and 0.92. The correlation coefficients for the simulated and experimental liquid water contents at different soil temperatures were between 0.95 and 0.99. With these high accuracies, the developed model can be well used to predict the water contents at different soil depths and temperatures.

  15. Form, shape and function: segmented blood flow in the choriocapillaris

    PubMed Central

    Zouache, M. A.; Eames, I.; Klettner, C. A.; Luthert, P. J.

    2016-01-01

    The development of fluid transport systems was a key event in the evolution of animals and plants. While within vertebrates branched geometries predominate, the choriocapillaris, which is the microvascular bed that is responsible for the maintenance of the outer retina, has evolved a planar topology. Here we examine the flow and mass transfer properties associated with this unusual geometry. We show that as a result of the form of the choriocapillaris, the blood flow is decomposed into a tessellation of functional vascular segments of various shapes delineated by separation surfaces across which there is no flow, and in the vicinity of which the transport of passive substances is diffusion-limited. The shape of each functional segment is determined by the distribution of arterioles and venules and their respective relative flow rates. We also show that, remarkably, the mass exchange with the outer retina is a function of the shape of each functional segment. In addition to introducing a novel framework in which the structure and function of the metabolite delivery system to the outer retina may be investigated in health and disease, the present work provides a general characterisation of the flow and transfers in multipole Hele-Shaw configurations. PMID:27779198

  16. Highly efficient reversible addition-fragmentation chain-transfer polymerization in ethanol/water via flow chemistry

    DOE Office of Scientific and Technical Information (OSTI.GOV)

    Ye, Piaoran; Cao, Peng -Fei; Su, Zhe

    Here, utilization of a flow reactor under high pressure allows highly efficient polymer synthesis via reversible addition–fragmentation chain-transfer (RAFT) polymerization in an aqueous system. Compared with the batch reaction, the flow reactor allows the RAFT polymerization to be performed in a high-efficiency manner at the same temperature. The adjustable pressure of the system allows further elevation of the reaction temperature and hence faster polymerization. Other reaction parameters, such as flow rate and initiator concentration, were also well studied to tune the monomer conversion and the molar mass dispersity (Ð) of the obtained polymers. Gel permeation chromatography, nuclear magnetic resonance (NMR),more » and Fourier transform infrared spectroscopies (FTIR) were utilized to monitor the polymerization process. With the initiator concentration of 0.15 mmol L –1, polymerization of poly(ethylene glycol) methyl ethermethacrylate with monomer conversion of 52% at 100 °C under 73 bar can be achieved within 40 min with narrow molar mass dispersity (D) Ð (<1.25). The strategy developed here provides a method to produce well-defined polymers via RAFT polymerization with high efficiency in a continuous manner.« less

  17. Influence of cavitation bubble growth by rectified diffusion on cavitation-enhanced HIFU

    NASA Astrophysics Data System (ADS)

    Okita, Kohei; Sugiyama, Kazuyasu; Takagi, Shu; Matsumoto, Yoichiro

    2017-11-01

    Cavitation is becoming increasingly important in therapeutic ultrasound applications such as diagnostic, tumor ablation and lithotripsy. Mass transfer through gas-liquid interface due to rectified diffusion is important role in an initial stage of cavitation bubble growth. In the present study, influences of the rectified diffusion on cavitation-enhanced high-intensity focused ultrasound (HIFU) was investigated numerically. Firstly, the mass transfer rate of gas from the surrounding medium to the bubble was examined as function of the initial bubble radius and the driving pressure amplitude. As the result, the pressure required to bubble growth was decreases with increasing the initial bubble radius. Next, the cavitation-enhanced HIFU, which generates cavitation bubbles by high-intensity burst and induces the localized heating owing to cavitation bubble oscillation by low-intensity continuous waves, was reproduced by the present simulation. The heating region obtained by the simulation is agree to the treatment region of an in vitro experiment. Additionally, the simulation result shows that the localized heating is enhanced by the increase of the equilibrium bubble size due to the rectified diffusion. This work was supported by JSPS KAKENHI Grant Numbers JP26420125,JP17K06170.

  18. Hydrocarbon-fuel/combustion-chamber-liner materials compatibility

    NASA Technical Reports Server (NTRS)

    Homer, G. David

    1991-01-01

    The results of dynamic tests using methane and NASA-Z copper test specimen under conditions that simulate those expected in the cooling channels of a regeneratively cooled LOX/hydrocarbon booster engine operating at chamber pressures up to 3000 psi are presented. Methane with less than 0.5 ppm sulfur contamination has little or no effect on cooling channel performance. At higher sulfur concentrations, severe corrosion of the NASA-Z copper alloy occurs and the cuprous sulfide Cu2S, thus formed impedes mass flow rate and heat transfer efficiency. Therefore, it is recommended that the methane specification for this end use set the allowable sulfur content at 0.5 ppm (max). Bulk high purity liquid methane that meets this low sulfur requirement is currently available from only one producer. Pricing, availability, and quality assurance are discussed in detail. Additionally, it was found that dilute sodium cyanide solutions effectively refurbish sulfur corroded cooling channels in only 2 to 5 minutes by completely dissolving all the Cu2S. Sulfur corroded/sodium cyanide refurbished channels are highly roughened and the increased surface roughness leads to significant improvements in heat transfer efficiency with an attendant loss in mass flow rate. Both the sulfur corrosion and refurbishment effects are discussed in detail.

  19. Electrochemically controlled iron isotope fractionation

    NASA Astrophysics Data System (ADS)

    Black, Jay R.; Young, Edward D.; Kavner, Abby

    2010-02-01

    Variations in the stable isotope abundances of transition metals have been observed in the geologic record and trying to understand and reconstruct the physical/environmental conditions that produced these signatures is an area of active research. It is clear that changes in oxidation state lead to large fractionations of the stable isotopes of many transition metals such as iron, suggesting that transition metal stable isotope signatures could be used as a paleo-redox proxy. However, the factors contributing to these observed stable isotope variations are poorly understood. Here we investigate how the kinetics of iron redox electrochemistry generates isotope fractionation. Through a combination of electrodeposition experiments and modeling of electrochemical processes including mass-transport, we show that electron transfer reactions are the cause of a large isotope separation, while mass transport-limited supply of reactant to the electrode attenuates the observed isotopic fractionation. Furthermore, the stable isotope composition of electroplated transition metals can be tuned in the laboratory by controlling parameters such as solution chemistry, reaction overpotential, and solution convection. These methods are potentially useful for generating isotopically-marked metal surfaces for tracking and forensic purposes. In addition, our studies will help interpret stable isotope data in terms of identifying underlying electron transfer processes in laboratory and natural samples.

  20. Nonequilibrium adiabatic molecular dynamics simulations of methane clathrate hydrate decomposition

    NASA Astrophysics Data System (ADS)

    Alavi, Saman; Ripmeester, J. A.

    2010-04-01

    Nonequilibrium, constant energy, constant volume (NVE) molecular dynamics simulations are used to study the decomposition of methane clathrate hydrate in contact with water. Under adiabatic conditions, the rate of methane clathrate decomposition is affected by heat and mass transfer arising from the breakup of the clathrate hydrate framework and release of the methane gas at the solid-liquid interface and diffusion of methane through water. We observe that temperature gradients are established between the clathrate and solution phases as a result of the endothermic clathrate decomposition process and this factor must be considered when modeling the decomposition process. Additionally we observe that clathrate decomposition does not occur gradually with breakup of individual cages, but rather in a concerted fashion with rows of structure I cages parallel to the interface decomposing simultaneously. Due to the concerted breakup of layers of the hydrate, large amounts of methane gas are released near the surface which can form bubbles that will greatly affect the rate of mass transfer near the surface of the clathrate phase. The effects of these phenomena on the rate of methane hydrate decomposition are determined and implications on hydrate dissociation in natural methane hydrate reservoirs are discussed.

Top