Science.gov

Sample records for agriculture employees tick

  1. 28 CFR 0.64-3 - Delegation respecting designation of certain Department of Agriculture employees (Tick Inspectors...

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... certain Department of Agriculture employees (Tick Inspectors) to carry and use firearms. 0.64-3 Section 0... Inspectors) to carry and use firearms. The Assistant Attorney General in charge of the Criminal Division is... Inspectors) to carry and use firearms. This delegation includes the power and authority to issue, with...

  2. 28 CFR 0.64-3 - Delegation respecting designation of certain Department of Agriculture employees (Tick Inspectors...

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... certain Department of Agriculture employees (Tick Inspectors) to carry and use firearms. 0.64-3 Section 0... Inspectors) to carry and use firearms. The Assistant Attorney General in charge of the Criminal Division is... Inspectors) to carry and use firearms. This delegation includes the power and authority to issue, with...

  3. 28 CFR 0.64-3 - Delegation respecting designation of certain Department of Agriculture employees (Tick Inspectors...

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... certain Department of Agriculture employees (Tick Inspectors) to carry and use firearms. 0.64-3 Section 0... Inspectors) to carry and use firearms. The Assistant Attorney General in charge of the Criminal Division is... Inspectors) to carry and use firearms. This delegation includes the power and authority to issue, with...

  4. 28 CFR 0.64-3 - Delegation respecting designation of certain Department of Agriculture employees (Tick Inspectors...

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... certain Department of Agriculture employees (Tick Inspectors) to carry and use firearms. 0.64-3 Section 0... Inspectors) to carry and use firearms. The Assistant Attorney General in charge of the Criminal Division is... Inspectors) to carry and use firearms. This delegation includes the power and authority to issue, with...

  5. 28 CFR 0.64-3 - Delegation respecting designation of certain Department of Agriculture employees (Tick Inspectors...

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... certain Department of Agriculture employees (Tick Inspectors) to carry and use firearms. 0.64-3 Section 0... Inspectors) to carry and use firearms. The Assistant Attorney General in charge of the Criminal Division is... Inspectors) to carry and use firearms. This delegation includes the power and authority to issue, with...

  6. Milk Processing Plant Employee. Agricultural Cooperative Training. Vocational Agriculture.

    ERIC Educational Resources Information Center

    Blaschke, Nolan; Page, Foy

    This course of study is designed for the vocational agricultural student enrolled in an agricultural cooperative part-time training program in the area of milk processing occupations. The course consists of 11 units, each with 4 to 13 individual topics that milk processing plant employees should know. Subjects covered by the units are the…

  7. Crop Farm Employee. Agricultural Cooperative Training. Vocational Agriculture. Revised.

    ERIC Educational Resources Information Center

    Boyd, Chester; And Others

    Designed for students enrolled in the Vocational Agricultural Cooperative Part-Time Training Program, this course of study contains 13 units for crop farm employees. Units include (examples of unit topics in parentheses): introduction (opportunities in farming, farming as a science, and farming in the United States), farm records (keeping farm…

  8. Ticks

    USGS Publications Warehouse

    Ginsberg, H.S.; Faulde, M.K.

    2008-01-01

    The most common vector-borne diseases in both Europe and North America are transmitted by ticks. Lyme borreliosis (LB), a tick-borne bacterial zoonosis, is the most highly prevalent. Other important tick-borne diseases include TBE (tick-borne encephalitis) and Crimean-Congo haemorrhagic fever in Europe, Rocky Mountain spotted fever (RMSF) in North America, and numerous less common tick-borne bacterial, viral, and protozoan diseases on both continents. The major etiological agent of LB is Borrelia burgdorferi in North America, while in Europe several related species of Borrelia can also cause human illness. These Borrelia genospecies differ in clinical manifestations, ecology (for example, some have primarily avian and others primarily mammalian reservoirs), and transmission cycles, so the epizootiology of LB is more complex in Europe than in North America. Ticks dwell predominantly in woodlands and meadows, and in association with animal hosts, with only limited colonization of human dwellings by a few species. Therefore, suburbanization has contributed substantially to the increase in tick-borne disease transmission in North America by fostering increased exposure of humans to tick habitat. The current trend toward suburbanization in Europe could potentially result in similar increases in transmission of tick-borne diseases. Incidence of tick-borne diseases can be lowered by active public education campaigns, targeted at the times and places of greatest potential for encounter between humans and infected ticks. Similarly, vaccines (e.g., against TBE) are most effective when made available to people at greatest risk, and for high-prevalence diseases such as LB. Consultation with vector-borne disease experts during the planning stages of new human developments can minimize the potential for residents to encounter infected ticks (e.g., by appropriate dwelling and landscape design). Furthermore, research on tick vectors, pathogens, transmission ecology, and on

  9. The effect of changes in agricultural practices on the density of Dermacentor reticulatus ticks.

    PubMed

    Mierzejewska, Ewa J; Alsarraf, Mohammed; Behnke, Jerzy M; Bajer, Anna

    2015-07-30

    The impact of agricultural practices/ activities on the environment has been falling in many areas of Europe due to the widespread exodus of inhabitants from rural areas. The associated abandonment of agricultural lands has enabled a wide range of wild animals to prosper in the countryside, including birds, ungulates and large carnivores. One consequence has been the increase in ticks and associated tick-borne diseases which now constitute a greater threat for public health than earlier. The aim of the present study was to compare tick densities in different habitats (pasture, meadow, fallow land, post-fire areas) to assess the impact of different agricultural practices on tick densities in vicinities close to human habitation. Between September 2011 and June 2014, 2985 Dermacentor reticulatus ticks were collected by conventional dragging, in the Mazowieckie (Mazovia) and Warmińsko-Mazurskie (Masuria) regions of Poland. In each region, 3 study sites were selected, each situated near surface water sources (i.e., ponds or canals). At each site, three neighboring habitats of surface area 150-600 m(2) were dragged: one on a cattle/horse pasture; the second on meadow; the third on fallow land (abandoned field or meadow), at least twice during each spring and autumn. Additionally, four post-fire areas (one in 2013 and three in 2014) were identified in the Mazowieckie region, and dragging was conducted there in spring and autumn, including in each case a 'control area' comprising intact unburned fallow land situated in close vicinity to the burned areas. Eight hundred D. reticulatus ticks were collected and the densities were compared by multifactorial ANOVA. The highest tick densities were recorded on the fallow lands, and the lowest - on the grazed pastures. Tick densities were up to 10 × times higher on the control sites compared to neighboring post-fire sites.

  10. Tick bites on humans in the agricultural and recreational areas in south-eastern Poland.

    PubMed

    Bartosik, Katarzyna; Sitarz, Monika; Szymańska, Jolanta; Buczek, Alicja

    2011-01-01

    The investigations were conducted in the Lublin province (south-eastern Poland) in areas of high agricultural and recreational value. Among the 418 patients admitted to medical clinics due to arthropod bites in the years 2003-2005, 184 people (44%) had been bitten by ticks. As shown by the research, high-risk groups include people whose stay in tick habitats is connected with their occupational work (54.5%) as well as recreation and tourism (45.5%). As many as 78.7% of the patients were attacked by Ixodes ricinus ticks in forests, and much fewer (31.3%) in other habitats located in urban and rural areas. In one case, a Dermacentor reticulatus female was attached to the skin. Ticks were most commonly located on the upper (28.8%) and lower (27.2%) extremities, and on the abdomen (15.8%). Local skin reactions (57.6%) with predominance of erythema were the most prevalent. Combined local and systemic symptoms were reported less frequently (20.1%). The general symptoms were headache (10.8% of patients), fever (5.4%), lymphadenitis (5.9%) and arthralgia (4.3%). No lesions produced by tick bites were reported in 22.3% of the patients. Field studies conducted in 2003-2004 demonstrated that I. ricinus is a common species in the southern part of the Lublin province, where the density of nymphs and adult forms in various localities during the period of peak seasonal activity (in May) ranges from 18.5-26 specimens/1 h of collection. Two tick species, I. ricinus and D. reticulatus, occur in the northern part of the province. The density of I. ricinus nymphs and adult forms as well as D. reticulatus adults is in the range of 2.5-42 specimens/1 hr of collection and 19.5-64.0 speciments/1 hr of collection, respectively. Due to the high risk of tick attacks in the study area, there arises the necessity to permanent the monitoring of ticks numbers and tick-borne diseases.

  11. Tick Paralysis

    MedlinePlus

    ... Resources Contact About The Foundation Select Page Tick Paralysis Menu What is Tick Paralysis? Where is Tick ... Tick Paralysis Tick-borne Relapsing Fever Tularemia Tick Paralysis Tick species that cause Tick Paralysis: Deer tick, ...

  12. 29 CFR 780.511 - Meaning of “agricultural employee.”

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... characterize him as a person who engages in them as an occupation. Isolated or sporadic instances of engagement... “agricultural employee.” His engagement in agriculture should be sufficiently substantial to demonstrate...

  13. Evaluation of the United States Department Of Agriculture Northeast Area-wide Tick Control Project by meta-analysis.

    PubMed

    Brei, Brandon; Brownstein, John S; George, John E; Pound, J Mathews; Miller, J Allen; Daniels, Thomas J; Falco, Richard C; Stafford, Kirby C; Schulze, Terry L; Mather, Thomas N; Carroll, John F; Fish, Durland

    2009-08-01

    As part of the Northeast Area-wide Tick Control Project (NEATCP), meta-analyses were performed using pooled data on the extent of tick-vector control achieved through seven concurrent studies, conducted within five states, using U.S. Department of Agriculture "4-Poster" devices to deliver targeted-acaricide to white-tailed deer. Although reductions in the abundance of all life-stages of Ixodes scapularis were the measured outcomes, this study focused on metrics associated with I. scapularis nymphal tick densities as this measure has consistently proven to directly correlate with human risk of acquiring Lyme disease. Since independent tick sampling schemes were undertaken at each of the five environmentally distinct study locations, a meta-analytic approach permitted estimation of a single true control-effect size for each treatment year of the NEATCP. The control-effect is expressed as the annual percent I. scapularis nymphal control most consistent with meta-analysis data for each treatment year. Our meta-analyses indicate that by the sixth treatment year, the NEATCP effectively reduced the relative density of I. scapularis nymphs by 71% on the 5.14 km(2) treatment sites, corresponding to a 71% lower relative entomologic risk index for acquiring Lyme disease.

  14. Stop Ticks

    MedlinePlus

    ... and bringing ticks with them. Prevent Ticks on Animals Use tick control products to prevent family pets ... medications should be used regularly to protect your animals and your family from ticks. Consult your veterinarian ...

  15. Tick bite

    MedlinePlus

    ... Images Lyme disease, erythema migrans Lyme disease organism, Borrelia burgdorferi Deer ticks Ticks Tick, deer engorged on the skin Lyme disease - Borrelia burgdorferi organism Tick, deer - adult female Deer and dog ...

  16. Tick Bites

    MedlinePlus

    ... that go outdoors, you need to beware of ticks. Ticks are small bloodsucking parasites. Many species transmit diseases ... of the diseases you can get from a tick bite are Lyme disease, ehrlichiosis, Rocky Mountain spotted ...

  17. Ticks and Tick-borne diseases in Ireland.

    PubMed

    Zintl, Annetta; Moutailler, Sara; Stuart, Peter; Paredis, Linda; Dutraive, Justine; Gonzalez, Estelle; O'Connor, Jack; Devillers, Elodie; Good, Barbara; OMuireagain, Colm; De Waal, Theo; Morris, Fergal; Gray, Jeremy

    2017-01-01

    Throughout Europe interest in tick-borne agents is increasing, particularly with regard to those that can cause human disease. The reason for this is the apparent rise in the incidence of many tick-borne diseases (TBD's). While there has never been a national survey of ticks or TBD's in Ireland, the trend here appears to be the reverse with a decline in the incidence of some agents seemingly associated with decreasing tick numbers particularly on agricultural land. In the absence of robust baseline data, however, this development cannot be confirmed. This review collates the limited information available from several dated published records on tick species and a small number of studies focused on certain TBD's. Some pilot data on tick density and TBD agents collected in 2016 are also presented. The aim is to explore the particular situation in Ireland with regard to ticks and TBD's and to provide a reference for future workers in the field.

  18. Employees.

    ERIC Educational Resources Information Center

    Sorenson, Gail Paulus

    This first chapter of "The Yearbook of School Law, 1986" summarizes and analyzes over 250 state and federal court decisions handed down in 1985 affecting the legal rights of employees of public schools and state education agencies. Among the topics examined are discrimination on the basis of race, religion, sex, national origin, age, and handicap;…

  19. Employees.

    ERIC Educational Resources Information Center

    Levin, Betsy

    This chapter summarizes recent state supreme court and federal court decisions involving school employees. The cases discussed are generally limited to those decided during 1975 and reported in the General Digest as of March 1976. In her discussion, the author attempts to integrate related cases and to illuminate any unifying legal principles that…

  20. Employees.

    ERIC Educational Resources Information Center

    Sorenson, Gail Paulus

    This chapter analyzes more than 200 cases reported in 1986 involving public-sector employees in elementary and secondary education. Also included, where appropriate, are relevant 1986 Supreme Court cases from outside the field of education, as well as leading cases from prior years. Legal issues covered by the review include the following: (1)…

  1. Employees.

    ERIC Educational Resources Information Center

    Mawdsley, Ralph D.

    This chapter covers the nearly 230 cases reported in 1988 involving precollegiate, public-sector employees. Those cases where purely procedural issues are involved are omitted, and procedural issues in the remaining cases are deemphasized. As in previous years, the section on dismissal, nonrenewal, demotion, and discipline has the greatest…

  2. Employees.

    ERIC Educational Resources Information Center

    Mawdsley, Ralph D.

    This chapter covers the nearly 220 cases reported in 1989 involving precollegiate, public-sector employees. Those cases where purely procedural issues are involved are omitted, and procedural issues in the remaining cases are deemphasized. As in previous years, the section on dismissal, nonrenewal, demotion, and discipline has the greatest…

  3. 29 CFR 516.33 - Employees employed in agriculture pursuant to section 13(a)(6) or 13(b)(12) of the Act.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... 29 Labor 3 2011-07-01 2011-07-01 false Employees employed in agriculture pursuant to section 13(a....33 Employees employed in agriculture pursuant to section 13(a)(6) or 13(b)(12) of the Act. (a) No... the number of weeks employed in agriculture during the preceding calendar year. (e) With respect...

  4. 29 CFR 516.33 - Employees employed in agriculture pursuant to section 13(a)(6) or 13(b)(12) of the Act.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... 29 Labor 3 2012-07-01 2012-07-01 false Employees employed in agriculture pursuant to section 13(a....33 Employees employed in agriculture pursuant to section 13(a)(6) or 13(b)(12) of the Act. (a) No... the number of weeks employed in agriculture during the preceding calendar year. (e) With respect...

  5. 29 CFR 516.33 - Employees employed in agriculture pursuant to section 13(a)(6) or 13(b)(12) of the Act.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Employees employed in agriculture pursuant to section 13(a....33 Employees employed in agriculture pursuant to section 13(a)(6) or 13(b)(12) of the Act. (a) No... the number of weeks employed in agriculture during the preceding calendar year. (e) With respect...

  6. 29 CFR 516.33 - Employees employed in agriculture pursuant to section 13(a)(6) or 13(b)(12) of the Act.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... 29 Labor 3 2013-07-01 2013-07-01 false Employees employed in agriculture pursuant to section 13(a....33 Employees employed in agriculture pursuant to section 13(a)(6) or 13(b)(12) of the Act. (a) No... the number of weeks employed in agriculture during the preceding calendar year. (e) With respect...

  7. 29 CFR 516.33 - Employees employed in agriculture pursuant to section 13(a)(6) or 13(b)(12) of the Act.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... 29 Labor 3 2014-07-01 2014-07-01 false Employees employed in agriculture pursuant to section 13(a....33 Employees employed in agriculture pursuant to section 13(a)(6) or 13(b)(12) of the Act. (a) No... the number of weeks employed in agriculture during the preceding calendar year. (e) With respect...

  8. Career Preparation Programs for Potential Agribusinessmen, Agricultural Agency Employees, and Agricultural Instructors. Final Report. July 1, 1976-June 30, 1977.

    ERIC Educational Resources Information Center

    Mississippi State Univ., State College. Dept. of Agricultural Education.

    The purpose of the project was to develop innovative agricultural education programs within the comprehensive high school setting in selected school districts in the state of Mississippi, with the project's second year (described here) focusing on continuing existing specialized career preparation program in agriculture and continuing to orient…

  9. Tick Removal

    MedlinePlus

    ... There are several tick removal devices on the market, but a plain set of fine-tipped tweezers ... for Disease Control and Prevention National Center for Emerging and Zoonotic Infectious Diseases (NCEZID) Division of Vector- ...

  10. Tick-Borne Relapsing Fever

    MedlinePlus

    ... bite from a tick that carries the bacteria Borrelia hermsii. In the United States, these ticks are ... was contributed by: familydoctor.org editorial staff Tags: borrelia hermsii, illness from ticks, recurring, TBRF, tick, tick ...

  11. Tick Bites (For Parents)

    MedlinePlus

    ... medical treatment, some ticks (like the deer tick, wood tick, and others) can carry harmful germs and ... with at least 10% to 30% DEET for protection against bites and stings in kids older than ...

  12. The ecology of ticks and epidemiology of tick-borne viral diseases.

    PubMed

    Estrada-Peña, Agustín; de la Fuente, José

    2014-08-01

    A number of tick-borne diseases of humans have increased in incidence and geographic range over the past few decades, and there is concern that they will pose an even greater threat to public health in future. Although global warming is often cited as the underlying mechanism favoring the spread of tick-borne diseases, climate is just one of many factors that determine which tick species are found in a given geographic region, their population density, the likelihood that they will be infected with microbes pathogenic for humans and the frequency of tick-human contact. This article provides basic information needed for microbiologists to understand the many factors that affect the geographic range and population density of ticks and the risk of human exposure to infected ticks. It first briefly summarizes the life cycle and basic ecology of ticks and how ticks and vertebrate hosts interact, then reviews current understanding of the role of climate, sociodemographic factors, agricultural development and changes in human behavior that affect the incidence of tick-borne diseases. These concepts are then illustrated in specific discussions of tick-borne encephalitis and Crimean-Congo hemorrhagic fever.

  13. Risk of tick-borne diseases in various categories of employment among forestry workers in eastern Poland.

    PubMed

    Cisak, Ewa; Zając, Violetta; Wójcik-Fatla, Angelina; Dutkiewicz, Jacek

    2012-01-01

    Among the zoonotic agents causing occupational diseases, those transmitted by ticks are very important, in particular the spirochetes Borrelia burgdorferi which are the common cause of occupational Lyme borreliosis in forestry and agricultural workers. The objective of this study was an evaluation of the exposure of forestry workers employed at individual workplaces to infection with tick-borne pathogens (especially Borrelia burgdorferi spirochetes), based on epidemiological investigation and serologic tests. Epidemiological studies covered 111 forestry employees from eastern Poland employed in 4 randomly-selected forest inspectorates which replied to questions in the area of epidemiology and prophylaxis of diseases transmitted by ticks. Eighty-two forestry workers employed in one forest inspectorate were examined for the presence of specific anti-Borrelia burgdorferi antibodies. The correlation between individual items of the questionnaire was assessed by Spearman's test. Results of serological tests were assessed by Mann-Whitney test. Statistical analysis of the results indicated that the workers performing manual jobs in the forest are at the greatest risk of tick bite and contraction of tick-borne disease. They are aware of the risk, but use the improper method of removal of ticks with the fingers. Comparisons of the relationship between job category and the results of serologic study, expressed in BBU/ml, revealed that the serologic response was significantly greater in manual workers than in administrative workers (p=0.019). All other comparisons did not produce significant results. Therefore, providing a simple tweezer-like device to forest inspectorates seems to be an effective mean of protection against Lyme borreliosis and other tick-borne diseases.

  14. Tick (Amblyomma chabaudi) infestation of endemic tortoises in southwest Madagascar and investigation of tick-borne pathogens.

    PubMed

    Ehlers, Julian; Ganzhorn, Jörg U; Silaghi, Cornelia; Krüger, Andreas; Pothmann, Daniela; Ratovonamana, R Yedidya; Veit, Alexandra; Keller, Christian; Poppert, Sven

    2016-03-01

    Little is known about the role of endemic ticks as vectors for bacterial and protozoan pathogens for animals and humans in Madagascar and their interaction in anthropogenic habitats where humans, their livestock and native Malagasy species (vectors and hosts) come into more frequent contact than in natural forest ecosystems. The aims of the study were (1) to test whether habitat degradation is associated with increased infestation of tortoises by ticks and (2) to investigate whether ticks carried Babesia, Borrelia or Rickettsia species that might be pathogenic for humans and livestock. We studied hard ticks of two endemic Malagasy tortoises, Astrochelys radiata and Pyxis arachnoides in March and April 2013 in southwest Madagascar. Two tortoise habitats were compared, the National Park of Tsimanampetsotsa and the adjacent degraded pasture and agricultural land at the end of the wet season. Ticks were screened for protozoan and bacterial pathogens via PCR on DNA isolated from ticks using genus-specific primers. Only one out of 42 A. radiata collected from both habitats had ticks. The low prevalence did not allow further analyses of the effect of habitat degradation. Forty-two P. arachnoides were found in the anthropogenic habitat and 36 individuals in the national park. Tick infestation rates of P. arachnoides differed significantly between the two study sites. Tortoises inside the park had lower tick prevalence than outside (8 of 36 (22%) versus 32 of 42 individuals (76%)) and infected animals tended to have fewer ticks inside than outside the park. All ticks collected in both habitats were adults of the ixodid tick Amblyomma chabaudi, which is supposed to be a host-specific tick of P. arachnoides. Screening for Borrelia sp. and Babesia sp. was negative in all ticks. But all A. chabaudi ticks were infected with Rickettsia africae, known to cause spotted fever in humans. Thus, habitat degradation seems to be linked to higher infestation of tortoises with ticks with

  15. Are ticks venomous animals?

    PubMed Central

    2014-01-01

    Introduction As an ecological adaptation venoms have evolved independently in several species of Metazoa. As haematophagous arthropods ticks are mainly considered as ectoparasites due to directly feeding on the skin of animal hosts. Ticks are of major importance since they serve as vectors for several diseases affecting humans and livestock animals. Ticks are rarely considered as venomous animals despite that tick saliva contains several protein families present in venomous taxa and that many Ixodida genera can induce paralysis and other types of toxicoses. Tick saliva was previously proposed as a special kind of venom since tick venom is used for blood feeding that counteracts host defense mechanisms. As a result, the present study provides evidence to reconsider the venomous properties of tick saliva. Results Based on our extensive literature mining and in silico research, we demonstrate that ticks share several similarities with other venomous taxa. Many tick salivary protein families and their previously described functions are homologous to proteins found in scorpion, spider, snake, platypus and bee venoms. This infers that there is a structural and functional convergence between several molecular components in tick saliva and the venoms from other recognized venomous taxa. We also highlight the fact that the immune response against tick saliva and venoms (from recognized venomous taxa) are both dominated by an allergic immunity background. Furthermore, by comparing the major molecular components of human saliva, as an example of a non-venomous animal, with that of ticks we find evidence that ticks resemble more venomous than non-venomous animals. Finally, we introduce our considerations regarding the evolution of venoms in Arachnida. Conclusions Taking into account the composition of tick saliva, the venomous functions that ticks have while interacting with their hosts, and the distinguishable differences between human (non-venomous) and tick salivary

  16. Agriculture

    EPA Pesticide Factsheets

    The EPA Agriculture Resource Directory offers comprehensive, easy-to-understand information about environmental stewardship on farms and ranches; commonsense, flexible approaches that are both environmentally protective and agriculturally sound.

  17. Deer ticks (image)

    MedlinePlus

    Diseases are often carried by ticks, including Rocky Mountain Spotted Fever, Colorado Tick Fever, Lyme disease, and tularemia. Less common or less frequent diseases include typhus, Q-fever, relapsing fever, viral encephalitis, hemorrhagic fever, ...

  18. Establishing protocols for tick containment at Biosafety Level 4

    PubMed Central

    Thangamani, Saravanan; Bente, Dennis

    2014-01-01

    Tick borne diseases continue to emerge and have a great impact on public health and agriculture. In addition, many of the tick borne diseases agents, which are classified as Biosafety Level 4 (BSL-4) viruses, have the potential to be used as biothreat agents. In spite of the known importance of these pathogens, there is an acute shortage of facilities and trained personnel to study the pathogenesis of tick-borne diseases and to assess vaccine as well as other therapeutic interventions against tick-borne diseases as they are transmitted in nature. We, at the Galveston National Laboratory, have developed facilities and protocols to safely work with BSL4 virus infected ticks. This capability adds tremendous value to the Nation's training and research endeavors. In this report we describe the procedures and protocols to establish tick work in a BSL4 laboratory. PMID:24838773

  19. Biological control of ticks

    USGS Publications Warehouse

    Samish, M.; Ginsberg, H.; Glazer, I.; Bowman, A.S.; Nuttall, P.

    2004-01-01

    Ticks have numerous natural enemies, but only a few species have been evaluated as tick biocontrol agents (BCAs). Some laboratory results suggest that several bacteria are pathogenic to ticks, but their mode of action and their potential value as biocontrol agents remain to be determined. The most promising entomopathogenic fungi appear to be Metarhizium anisopliae and Beauveria bassiana, strains of which are already commercially available for the control of some pests. Development of effective formulations is critical for tick management. Entomopathogenic nematodes that are pathogenic to ticks can potentially control ticks, but improved formulations and selection of novel nematode strains are needed. Parasitoid wasps of the genus Ixodiphagus do not typically control ticks under natural conditions, but inundative releases show potential value. Most predators of ticks are generalists, with a limited potential for tick management (one possible exception is oxpeckers in Africa). Biological control is likely to play a substantial role in future IPM programmes for ticks because of the diversity of taxa that show high potential as tick BCAs. Considerable research is required to select appropriate strains, develop them as BCAs, establish their effectiveness, and devise production strategies to bring them to practical use.

  20. Tick infestation patterns in free ranging African buffalo (Syncercus caffer): Effects of host innate immunity and niche segregation among tick species☆

    PubMed Central

    Anderson, Kadie; Ezenwa, Vanessa O.; Jolles, Anna E.

    2012-01-01

    Ticks are of vast importance to livestock health, and contribute to conflicts between wildlife conservation and agricultural interests; but factors driving tick infestation patterns on wild hosts are not well understood. We studied tick infestation patterns on free-ranging African buffalo (Syncercus caffer), asking (i) is there evidence for niche segregation among tick species?; and (ii) how do host characteristics affect variation in tick abundance among hosts? We identified ticks and estimated tick burdens on 134 adult female buffalo from two herds at Kruger National Park, South Africa. To assess niche segregation, we evaluated attachment site preferences and tested for correlations between abundances of different tick species. To investigate which host factors may drive variability in tick abundance, we measured age, body condition, reproductive and immune status in all hosts, and examined their effects on tick burdens. Two tick species were abundant on buffalo, Amblyomma hebraeum and Rhipicephalus evertsi evertsi. A. hebraeum were found primarily in the inguinal and axillary regions; R. e. evertsi attached exclusively in the perianal area. Abundances of A. hebraeum and R. e. evertsi on the host were unrelated. These results suggest spatial niche segregation between A. hebraeum and R. e. evertsi on the buffalo. Buffalo with stronger innate immunity, and younger buffalo, had fewer ticks. Buffalo with low body condition scores, and pregnant buffalo, had higher tick burdens, but these effects varied between the two herds we sampled. This study is one of the first to link ectoparasite abundance patterns and immunity in a free-ranging mammalian host population. Based on independent abundances of A. hebraeum and R. e. evertsi on individual buffalo, we would expect no association between the diseases these ticks transmit. Longitudinal studies linking environmental variability with host immunity are needed to understand tick infestation patterns and the dynamics of tick

  1. Human toxicosis caused by the tick Ixodes redikorzevi in Israel.

    PubMed

    Kassis, I; Ioffe-Uspensky, I; Uspensky, I; Mumcuoglu, K Y

    1997-11-01

    The clinical symptoms of a tick toxicosis caused by Ixodes redikorzevi in northern Israel are described. The patient was a nine-year-old Arab boy from an agricultural village who was admitted to a local hospital and had been suffering for 4 days from fever and torticollis. A partially engorged female tick was removed from the nuchal area of the scalp, and the symptoms disappeared within 2 hours. Morphometrical measurements indicated that the tick was attached to the skin for 3-4 days.

  2. Tick microbiome: the force within

    PubMed Central

    Narasimhan, Sukanya; Fikrig, Erol

    2015-01-01

    Ticks are obligate blood-feeders and serve as vectors of human and livestock pathogens worldwide. Defining the tick microbiome and deciphering the interactions between the tick and its symbiotic bacteria in the context of tick development and pathogen transmission, will likely reveal new insights and spawn new paradigms to control tick-borne diseases. Descriptive observations on the tick microbiome that began almost a century ago serve as forerunners to the gathering momentum to define the tick microbiome in greater detail. This review will focus on the current efforts to address the microbiomes of diverse ticks, and the evolving understanding of tick microbiomes. There is hope that these efforts will bring a holistic understanding of pathogen transmission by ticks. PMID:25936226

  3. Management of ticks and tick-borne diseases

    USGS Publications Warehouse

    Ginsberg, H.S.; Stafford, K.C.; Goodman, J.L.; Dennis, D.T.; Sonenshine, D .E.

    2005-01-01

    The mainstays of tick management and protection from tick-borne diseases have traditionally been personal precautions and the application of acaricides. These techniques maintain their value, and current innovations hold considerable promise for future improvement in effective targeting of materials for tick control. Furthermore, an explosion of research in the past few decades has resulted in the development and expansion of several novel and potentially valuable approaches to tick control, including vaccination against tick-borne pathogen transmission and against tick attachment, host management, use of natural enemies (especially entomopathogenic fungi), and pheromone-based techniques. The situations that require tick management are diverse, and occur under varied ecological conditions. Therefore, the likelihood of finding a single ?magic bullet? for tick management is low. In practical terms, the approach to tick management or to management of tick-borne disease must be tailored to the specific conditions at hand. One area that needs increased attention is the decision-making process in applying IPM to tick control. Further development of novel tick control measures, and increased efficiency in their integration and application to achieve desired goals, holds great promise for effective future management of ticks and tick-borne diseases.

  4. Southern Tick-Associated Rash Illness (STARI)

    MedlinePlus

    ... known. STARI or Lyme? Symptoms, Diagnosis and Treatment Distribution References General Tick Information Avoiding ticks Tick life ... by ticks STARI Home STARI or Lyme? Symptoms Distribution References File Formats Help: How do I view ...

  5. Beware of Ticks … & Lyme Disease

    MedlinePlus

    ... ticks known as Ixodes . Ticks in this group—deer ticks, western black-legged ticks, and black-legged ... is a key early-stage symptom. This circular red patch usually appears at the bite site 3 ...

  6. Tick Bites (For Parents)

    MedlinePlus

    ... cause diseases like Rocky Mountain spotted fever and Lyme disease . The deer tick is tiny, no larger than ... red rash, which looks like a bull's-eye (Lyme disease) red dots on the ankles and wrists (Rocky ...

  7. [Protection against tick bites].

    PubMed

    Boulanger, N; Lipsker, Dan

    2015-04-01

    There are numerous tick-borne infections, which include viral (TBE), parasitic (babesiosis) and bacterial diseases. Lyme disease (Lyme borreliosis) is the most common tick-borne disease in France. In temperate climates such as in France, ticks bite humans between March and October. Prevention relies on adequate clothing and on repellents. The latter are reviewed in this work. Repellents may be natural, made from eucalyptus, tomato and coconut, or synthetic, among which the most widely used is DEET (N,N,-Diethyl-m-toluamide). Newer, synthetic repellents exist such as IR3535 which, as well as being less toxic, also exhibits greater efficacy against ticks. Some repellents are used on the skin, while others, like permethrin, which is actually an insecticide, may be applied to clothing.

  8. Developing Anti-tick Vaccines.

    PubMed

    Rodríguez-Mallon, Alina

    2016-01-01

    Ticks are responsible for the transmission of viral, bacterial, and protozoal diseases of man and animals and also produce significant economic losses to cattle industry. The use of acaricides constitutes a major component of integrated tick control strategies. However, this is accompanied by the selection of acaricide-resistant ticks and contamination of environment and milk and meat products with drug residues. These issues highlight the need for alternative approaches to control tick infestations and have triggered the search for tick protective antigens for vaccine development. Vaccination as a tick control method has been practiced since the introduction of TickGARD and Gavac that were developed using the midgut glycoprotein Bm86 as antigen. Gavac within integrated tick management systems has proven to reduce the number of acaricidal applications per year that are required to control some strains of R. microplus ticks in different geographical regions. Nevertheless, it has limited or no efficacy against other tick species. These issues have stimulated research for additional tick protective antigens with critical functions in the tick. This chapter presents methodologies for the design and test of molecules as antigens against ticks. Considerations about different methods for the tick control compared to the immunological methods, the desirable characteristics for an anti-tick vaccine and the obstacles encountered for developing this kind of vaccines are discussed. Detailed methodologies for the establishment of a biological model to test new molecules as immunogens against ticks and to perform challenge trials with this model are presented. General considerations in the efficacy calculation for any anti-tick vaccine are also discussed.

  9. Tips to Prevent Tick Bites

    EPA Pesticide Factsheets

    Using the right insect repellent and other preventive actions can discourage ticks, mosquitoes, and other biting insects from landing on you. Tips include avoiding tick habitats and minimizing exposed skin.

  10. Hey! A Tick Bit Me!

    MedlinePlus

    ... this type of tick can carry is called Rocky Mountain spotted fever. What a Bite Looks and Feels Like A ... ticks carry diseases (such as Lyme disease or Rocky Mountain spotted fever) and can pass them to people. What You ...

  11. 7 CFR 1.501 - Policy on employee indemnification.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... 7 Agriculture 1 2013-01-01 2013-01-01 false Policy on employee indemnification. 1.501 Section 1.501 Agriculture Office of the Secretary of Agriculture ADMINISTRATIVE REGULATIONS Policy With Regard to Indemnification of Department of Agriculture Employees § 1.501 Policy on employee...

  12. 7 CFR 1.501 - Policy on employee indemnification.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Policy on employee indemnification. 1.501 Section 1.501 Agriculture Office of the Secretary of Agriculture ADMINISTRATIVE REGULATIONS Policy With Regard to Indemnification of Department of Agriculture Employees § 1.501 Policy on employee...

  13. Ticks: Geographic Distribution

    MedlinePlus

    ... areas on the Pacific Coast. Transmits: Tularemia and Rocky Mountain spotted fever . Comments: The highest risk of being bitten occurs ... dog tick ( Rhipicephalus sanguineus ) Where found: Worldwide. Transmits: Rocky Mountain spotted fever (in the southwestern U.S. and along the U.S.- ...

  14. Tick imbedded in the skin (image)

    MedlinePlus

    This is a close-up photograph of a tick embedded in the skin. Ticks are important because they can carry diseases such as Rocky Mountain spotted fever, tularemia, Colorado tick fever, Lyme disease, and others.

  15. Tick vaccines: current status and future directions.

    PubMed

    de la Fuente, José; Contreras, Marinela

    2015-01-01

    Ticks and tick-borne diseases are a growing problem affecting human and animal health worldwide. Traditional control methods, based primarily on chemical acaricides, have proven not to be sustainable because of the selection of acaricide-resistant ticks. Tick vaccines appear to be a promising and effective alternative for control of tick infestations and pathogen transmission. The purpose of this review is to summarize previous tick vaccine development and performance and formulate critical issues and recommendations for future directions for the development of improved and effective tick vaccines. The development of effective screening platforms and algorithms using omics approaches focused on relevant biological processes will allow the discovery of new tick-protective antigens. Future vaccines will likely combine tick antigens with different protective mechanisms alone or pathogen-derived antigens. The application of tick vaccines as a part of integrated control strategies will ultimately result in the control of tick-borne diseases.

  16. Tick-borne encephalitis.

    PubMed

    Gritsun, T S; Lashkevich, V A; Gould, E A

    2003-01-01

    Tick-borne encephalitis (TBE) is one of the most dangerous human infections occurring in Europe and many parts of Asia. The etiological agent Tick-borne encephalitis virus (TBEV), is a member of the virus genus Flavivirus, of the family Flaviviridae. TBEV is believed to cause at least 11,000 human cases of encephalitis in Russia and about 3000 cases in the rest of Europe annually. Related viruses within the same group, Louping ill virus (LIV), Langat virus (LGTV) and Powassan virus (POWV), also cause human encephalitis but rarely on an epidemic scale. Three other viruses within the same group, Omsk hemorrhagic fever virus (OHFV), Kyasanur Forest disease virus (KFDV) and Alkhurma virus (ALKV), are closely related to the TBEV complex viruses and tend to cause fatal hemorrhagic fevers rather than encephalitis. This review describes the clinical manifestations associated with TBEV infections, the main molecular-biological properties of these viruses, and the different factors that define the incidence and severity of disease. The role of ticks and their local hosts in the emergence of new virus variants with different pathogenic characteristics is also discussed. This review also contains a brief history of vaccination against TBE including trials with live attenuated vaccine and modern tendencies in developing of vaccine virus strains.

  17. Tick-borne viruses*

    PubMed Central

    Work, Telford H.

    1963-01-01

    More than 150 arthropod-borne viruses are now recognized, and over 50 of these are known to produce human infections and disease. Among these viruses are those of the tick-borne Russian spring-summer complex, which is etiologically involved in a wide variety of human diseases of varying severity. The eight antigenically different members of this complex so far known are Russian spring-summer encephalitis, louping-ill, Central European encephalitis, Omsk haemorrhagic fever, Kyasanur Forest disease, Langat, Negishi and Powassan viruses. In his review of the problems posed by these viruses and of research on them, the author points out that, while this complex is distributed around the globe in the temperate zone of the northern hemisphere, the only serious tick-borne virus disease known in the tropics is Kyasanur Forest disease. It is probable, however, that there are other, unrecognized tick-borne viruses in the tropical areas of Asia, Africa and America of importance to human health, and that these will be brought to light as virological studies of diseases of now obscure etiology are pursued. PMID:14043753

  18. Molecular identification of tick-borne pathogens in Nigerian ticks.

    PubMed

    Ogo, Ndudim Isaac; de Mera, Isabel G Fernández; Galindo, Ruth C; Okubanjo, Oluyinka O; Inuwa, Hauwa Mairo; Agbede, Rowland I S; Torina, Alessandra; Alongi, Angelina; Vicente, Joaquín; Gortázar, Christian; de la Fuente, José

    2012-07-06

    A molecular epidemiology investigation was undertaken in two Nigerian states (Plateau and Nassarawa) to determine the prevalence of pathogens of veterinary and public health importance associated with ticks collected from cattle and dogs using PCR, cloning and sequencing or reverse line blot techniques. A total of 218 tick samples, Amblyomma variegatum (N=153), Rhipicephalus (Boophilus) decoloratus (N=45), and Rhipicephalus sanguineus (N=20) were sampled. Pathogens identified in ticks included piroplasmids (Babesia spp., Babesia bigemina and Babesia divergens), Anaplasma marginale and Rickettsia africae. Piroplasmids were identified in A. variegatum, A. marginale was found in R. decoloratus, while R. africae was detected in all tick species examined. Ehrlichia spp. and Theileria spp. were not identified in any of the ticks examined. Of the 218 ticks examined, 33 (15.1%) contained pathogen DNA, with the presence of B. divergens and R. africae that are zoonotic pathogens of public health and veterinary importance. The variety of tick-borne pathogens identified in this study suggests a risk for the emergence of tick-borne diseases in domestic animals and humans, especially amongst the Fulani pastoralists in Plateau and Nassarawa states of Nigeria.

  19. 7 CFR 97.154 - Government employees.

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... 7 Agriculture 3 2011-01-01 2011-01-01 false Government employees. 97.154 Section 97.154... PLANT VARIETY AND PROTECTION Attorneys and Agents § 97.154 Government employees. Officers and employees... attorneys or agents in proceedings or other matters before government departments or agencies, shall not...

  20. 7 CFR 97.154 - Government employees.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... 7 Agriculture 3 2014-01-01 2014-01-01 false Government employees. 97.154 Section 97.154... PLANT VARIETY AND PROTECTION Attorneys and Agents § 97.154 Government employees. Officers and employees... attorneys or agents in proceedings or other matters before government departments or agencies, shall not...

  1. 7 CFR 97.154 - Government employees.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Government employees. 97.154 Section 97.154... PLANT VARIETY AND PROTECTION Attorneys and Agents § 97.154 Government employees. Officers and employees... attorneys or agents in proceedings or other matters before government departments or agencies, shall not...

  2. 7 CFR 97.154 - Government employees.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... 7 Agriculture 3 2013-01-01 2013-01-01 false Government employees. 97.154 Section 97.154... PLANT VARIETY AND PROTECTION Attorneys and Agents § 97.154 Government employees. Officers and employees... attorneys or agents in proceedings or other matters before government departments or agencies, shall not...

  3. 7 CFR 97.154 - Government employees.

    Code of Federal Regulations, 2012 CFR

    2012-01-01

    ... 7 Agriculture 3 2012-01-01 2012-01-01 false Government employees. 97.154 Section 97.154... PLANT VARIETY AND PROTECTION Attorneys and Agents § 97.154 Government employees. Officers and employees... attorneys or agents in proceedings or other matters before government departments or agencies, shall not...

  4. Transport of ixodid ticks and tick-borne pathogens by migratory birds.

    PubMed

    Hasle, Gunnar

    2013-01-01

    Birds, particularly passerines, can be parasitized by Ixodid ticks, which may be infected with tick-borne pathogens, like Borrelia spp., Babesia spp., Anaplasma, Rickettsia/Coxiella, and tick-borne encephalitis virus. The prevalence of ticks on birds varies over years, season, locality and different bird species. The prevalence of ticks on different species depends mainly on the degree of feeding on the ground. In Europe, the Turdus spp., especially the blackbird, Turdus merula, appears to be most important for harboring ticks. Birds can easily cross barriers, like fences, mountains, glaciers, desserts and oceans, which would stop mammals, and they can move much faster than the wingless hosts. Birds can potentially transport tick-borne pathogens by transporting infected ticks, by being infected with tick-borne pathogens and transmit the pathogens to the ticks, and possibly act as hosts for transfer of pathogens between ticks through co-feeding. Knowledge of the bird migration routes and of the spatial distribution of tick species and tick-borne pathogens is crucial for understanding the possible impact of birds as spreaders of ticks and tick-borne pathogens. Successful colonization of new tick species or introduction of new tick-borne pathogens will depend on suitable climate, vegetation and hosts. Although it has never been demonstrated that a new tick species, or a new tick pathogen, actually has been established in a new locality after being seeded there by birds, evidence strongly suggests that this could occur.

  5. Transport of ixodid ticks and tick-borne pathogens by migratory birds

    PubMed Central

    Hasle, Gunnar

    2013-01-01

    Birds, particularly passerines, can be parasitized by Ixodid ticks, which may be infected with tick-borne pathogens, like Borrelia spp., Babesia spp., Anaplasma, Rickettsia/Coxiella, and tick-borne encephalitis virus. The prevalence of ticks on birds varies over years, season, locality and different bird species. The prevalence of ticks on different species depends mainly on the degree of feeding on the ground. In Europe, the Turdus spp., especially the blackbird, Turdus merula, appears to be most important for harboring ticks. Birds can easily cross barriers, like fences, mountains, glaciers, desserts and oceans, which would stop mammals, and they can move much faster than the wingless hosts. Birds can potentially transport tick-borne pathogens by transporting infected ticks, by being infected with tick-borne pathogens and transmit the pathogens to the ticks, and possibly act as hosts for transfer of pathogens between ticks through co-feeding. Knowledge of the bird migration routes and of the spatial distribution of tick species and tick-borne pathogens is crucial for understanding the possible impact of birds as spreaders of ticks and tick-borne pathogens. Successful colonization of new tick species or introduction of new tick-borne pathogens will depend on suitable climate, vegetation and hosts. Although it has never been demonstrated that a new tick species, or a new tick pathogen, actually has been established in a new locality after being seeded there by birds, evidence strongly suggests that this could occur. PMID:24058903

  6. Habitat and Vegetation Variables Are Not Enough When Predicting Tick Populations in the Southeastern United States.

    PubMed

    Trout Fryxell, R T; Moore, J E; Collins, M D; Kwon, Y; Jean-Philippe, S R; Schaeffer, S M; Odoi, A; Kennedy, M; Houston, A E

    2015-01-01

    Two tick-borne diseases with expanding case and vector distributions are ehrlichiosis (transmitted by Amblyomma americanum) and rickettiosis (transmitted by A. maculatum and Dermacentor variabilis). There is a critical need to identify the specific habitats where each of these species is likely to be encountered to classify and pinpoint risk areas. Consequently, an in-depth tick prevalence study was conducted on the dominant ticks in the southeast. Vegetation, soil, and remote sensing data were used to test the hypothesis that habitat and vegetation variables can predict tick abundances. No variables were significant predictors of A. americanum adult and nymph tick abundance, and no clustering was evident because this species was found throughout the study area. For A. maculatum adult tick abundance was predicted by NDVI and by the interaction between habitat type and plant diversity; two significant population clusters were identified in a heterogeneous area suitable for quail habitat. For D. variabilis no environmental variables were significant predictors of adult abundance; however, D. variabilis collections clustered in three significant areas best described as agriculture areas with defined edges. This study identified few landscape and vegetation variables associated with tick presence. While some variables were significantly associated with tick populations, the amount of explained variation was not useful for predicting reliably where ticks occur; consequently, additional research that includes multiple sampling seasons and locations throughout the southeast are warranted. This low amount of explained variation may also be due to the use of hosts for dispersal, and potentially to other abiotic and biotic variables. Host species play a large role in the establishment, maintenance, and dispersal of a tick species, as well as the maintenance of disease cycles, dispersal to new areas, and identification of risk areas.

  7. Habitat and Vegetation Variables Are Not Enough When Predicting Tick Populations in the Southeastern United States

    PubMed Central

    Trout Fryxell, R. T.; Moore, J. E.; Collins, M. D.; Kwon, Y.; Jean-Philippe, S. R.; Schaeffer, S. M.; Odoi, A.; Kennedy, M.; Houston, A. E.

    2015-01-01

    Two tick-borne diseases with expanding case and vector distributions are ehrlichiosis (transmitted by Amblyomma americanum) and rickettiosis (transmitted by A. maculatum and Dermacentor variabilis). There is a critical need to identify the specific habitats where each of these species is likely to be encountered to classify and pinpoint risk areas. Consequently, an in-depth tick prevalence study was conducted on the dominant ticks in the southeast. Vegetation, soil, and remote sensing data were used to test the hypothesis that habitat and vegetation variables can predict tick abundances. No variables were significant predictors of A. americanum adult and nymph tick abundance, and no clustering was evident because this species was found throughout the study area. For A. maculatum adult tick abundance was predicted by NDVI and by the interaction between habitat type and plant diversity; two significant population clusters were identified in a heterogeneous area suitable for quail habitat. For D. variabilis no environmental variables were significant predictors of adult abundance; however, D. variabilis collections clustered in three significant areas best described as agriculture areas with defined edges. This study identified few landscape and vegetation variables associated with tick presence. While some variables were significantly associated with tick populations, the amount of explained variation was not useful for predicting reliably where ticks occur; consequently, additional research that includes multiple sampling seasons and locations throughout the southeast are warranted. This low amount of explained variation may also be due to the use of hosts for dispersal, and potentially to other abiotic and biotic variables. Host species play a large role in the establishment, maintenance, and dispersal of a tick species, as well as the maintenance of disease cycles, dispersal to new areas, and identification of risk areas. PMID:26656122

  8. Tick-Borne Diseases

    MedlinePlus

    ... Publications Hazards to Outdoor Workers Related Topics Agriculture Avian Influenza Protective Clothing NIOSH Homepage NIOSH A-Z Workplace ... Publications Hazards to Outdoor Workers Related Topics Agriculture Avian Influenza Protective Clothing NIOSH Homepage NIOSH A-Z Workplace ...

  9. Ticks and tick-borne diseases: a One Health perspective.

    PubMed

    Dantas-Torres, Filipe; Chomel, Bruno B; Otranto, Domenico

    2012-10-01

    Tick-borne diseases are common occurrences in both the medical and veterinary clinical settings. In addition to the constraints related to their diagnosis and clinical management, the control and prevention of these diseases is often difficult, because it requires the disruption of a complex transmission chain, involving vertebrate hosts and ticks, which interact in a constantly changing environment. We provide a contemporary review of representative tick-borne diseases of humans and discuss aspects linked to their medical relevance worldwide. Finally, we emphasize the importance of a One Health approach to tick-borne diseases, calling physicians and veterinarians to unify their efforts in the management of these diseases, several of which are zoonoses.

  10. Comparative Metagenomic Profiling of Symbiotic Bacterial Communities Associated with Ixodes persulcatus, Ixodes pavlovskyi and Dermacentor reticulatus Ticks.

    PubMed

    Kurilshikov, Alexander; Livanova, Natalya N; Fomenko, Nataliya V; Tupikin, Alexey E; Rar, Vera A; Kabilov, Marsel R; Livanov, Stanislav G; Tikunova, Nina V

    2015-01-01

    Ixodes persulcatus, Ixodes pavlovskyi, and Dermacentor reticulatus ticks inhabiting Western Siberia are responsible for the transmission of a number of etiological agents that cause human and animal tick-borne diseases. Because these ticks are abundant in the suburbs of large cities, agricultural areas, and popular tourist sites and frequently attack people and livestock, data regarding the microbiomes of these organisms are required. Using metagenomic 16S profiling, we evaluate bacterial communities associated with I. persulcatus, I. pavlovskyi, and D. reticulatus ticks collected from the Novosibirsk region of Russia. A total of 1214 ticks were used for this study. DNA extracted from the ticks was pooled according to tick species and sex. Sequencing of the V3-V5 domains of 16S rRNA genes was performed using the Illumina Miseq platform. The following bacterial genera were prevalent in the examined communities: Acinetobacter (all three tick species), Rickettsia (I. persulcatus and D. reticulatus) and Francisella (D. reticulatus). B. burgdorferi sensu lato and B. miyamotoi sequences were detected in I. persulcatus and I. pavlovskyi but not in D. reticulatus ticks. The pooled samples of all tick species studied contained bacteria from the Anaplasmataceae family, although their occurrence was low. DNA from A. phagocytophilum and Candidatus Neoehrlichia mikurensis was first observed in I. pavlovskyi ticks. Significant inter-species differences in the number of bacterial taxa as well as intra-species diversity related to tick sex were observed. The bacterial communities associated with the I. pavlovskyi ticks displayed a higher biodiversity compared with those of the I. persulcatus and D. reticulatus ticks. Bacterial community structure was also diverse across the studied tick species, as shown by permutational analysis of variance using the Bray-Curtis dissimilarity metric (p = 0.002). Between-sex variation was confirmed by PERMANOVA testing in I. persulcatus (p = 0

  11. Detecting ticks on light versus dark clothing.

    PubMed

    Stjernberg, Louise; Berglund, Johan

    2005-01-01

    It is a common belief that ticks are more visible and easier to detect on light clothing in comparison with dark clothing. We studied which of the clothing, light or dark, had the least attractive effect on Ixodes ricinus, thus minimizing exposure and thereby in theory helping to prevent tick-borne diseases in humans. 10 participants, exposed by walking in tick endemic areas, wore alternately light and dark clothing before every new exposure. Nymphal and adult ticks on the clothing were collected and counted. In total, 886 nymphal ticks were collected. The overall mean in found ticks between both groups differed significantly, with 20.8 more ticks per person on light clothing. All participants had more ticks on light clothing in all periods of exposure. Dark clothing seems to attract fewer ticks.

  12. Hey! A Tick Bit Me!

    MedlinePlus

    ... of the arachnid family, which also includes mites, spiders, and scorpions . A tick attaches itself to the ... MORE ON THIS TOPIC Hey! A Brown Recluse Spider Bit Me! Hey! A Bedbug Bit Me! Going ...

  13. It's Open Season on Ticks

    MedlinePlus

    ... ticks (which can carry the organisms which cause Rocky Mountain spotted fever and tularemia). Many tickborne diseases, such as Lyme disease, babesiosis, ehrlichiosis and Rocky Mountain spotted fever can be treated effectively if caught early. Be ...

  14. Tick-Borne Encephalitis (TBE)

    MedlinePlus

    ... sick sheep (e.g., veterinarians, butchers). In the USA and Russia, another tick-borne flavivirus, Powassan virus, ... OIG 1600 Clifton Road Atlanta , GA 30329-4027 USA 800-CDC-INFO (800-232-4636) , TTY: 888- ...

  15. Employee relations.

    PubMed

    Demann, Eric T K; Stein, Pamela S; Levitt, Christine; Shelton, Keith E

    2008-07-01

    This review highlights some of the more important employee relation aspects involved in starting, establishing, or expanding an existing dental practice. Despite a competitive compensation package, staff-related conflicts can sometimes hamper the progress of a dental practice. Such conflicts can be reduced by having policies and procedures in place for each employee that set expectations concerning the hours of operation, professional manner, dress code, job tasks, performance evaluations, disciplinary actions, and termination if violations occur. Understanding the legal requirements set by various governmental agencies such as OSHA can help ensure that the rights and well-being of every employee are protected.

  16. A new tick-borne encephalitis-like virus infecting New England deer ticks, Ixodes dammini.

    PubMed Central

    Telford, S. R.; Armstrong, P. M.; Katavolos, P.; Foppa, I.; Garcia, A. S.; Wilson, M. L.; Spielman, A.

    1997-01-01

    To determine if eastern North American Ixodes dammini, like related ticks in Eurasia, maintain tick-borne encephalitis group viruses, we analyzed ticks collected from sites where the agent of Lyme disease is zoonotic. Two viral isolates were obtained by inoculating mice with homogenates from tick salivary glands. The virus, which was described by reverse transcriptase polymerase chain reaction and direct sequencing of the amplification products, was similar to, but distinct from, Powassan virus and is provisionally named "deer tick virus." Enzootic tick-borne encephalitis group viruses accompany the agents of Lyme disease, babesiosis, and granulocytic ehrlichiosis in a Holarctic assemblage of emergent deer tick pathogens. PMID:9204297

  17. Looking in ticks for human bacterial pathogens.

    PubMed

    Mediannikov, O; Fenollar, F

    2014-12-01

    Ticks are considered to be second worldwide to mosquitoes as vectors of human diseases and the most important vectors of disease-causing pathogens in domestic and wild animals. A number of emerging tick-borne pathogens are already discovered; however, the proportion of undiagnosed infectious diseases, especially in tropical regions, may suggest that there are still more pathogens associated with ticks. Moreover, the identification of bacteria associated with ticks may provide new tool for the control of ticks and tick-borne diseases. Described here molecular methods of screening of ticks, extensive use of modern culturomics approach, newly developed artificial media and different cell line cultures may significantly improve our knowledge about the ticks as the agents of human and animal pathology.

  18. Protect Yourself against Tick-Borne Disease

    MedlinePlus

    ... Linkedin Pin it Email Print Commonly called a "deer tick," this tick can transmit Lyme disease and ... entering the human body, live and grow inside red blood cells. In the study of the elderly, ...

  19. Tick Infestation of Eyelid: Two Case Reports

    PubMed Central

    Uzun, Aslıhan; Gök, Mustafa; İşcanlı, Murat Doğan

    2016-01-01

    Tick infestation of the eyelid is a rare but serious condition that can lead to Crimean-Congo hemorrhagic fever. In this report, we describe two cases who presented with tick infestation of the eyelid. Neither patient developed systemic disease or adverse sequelae after tick extraction. Complete mechanical removal of ticks located on the eyelid with blunt forceps is a safe and effective treatment method. PMID:28058170

  20. Vaccinomics, the new road to tick vaccines.

    PubMed

    de la Fuente, José; Merino, Octavio

    2013-12-05

    Ticks are a threat to human and animal health worldwide. Ticks are considered to be second worldwide to mosquitoes as vectors of human diseases, the most important vectors of diseases that affect cattle industry worldwide and important vectors of diseases affecting pets. Tick vaccines are a cost-effective and environmentally friendly alternative to protect against tick-borne diseases through the control of vector infestations and reducing pathogen infection and transmission. These premises stress the need for developing improved tick vaccines in a more efficient way. In this context, development of improved vaccines for tick-borne diseases will be greatly enhanced by vaccinomics approaches starting from the study of tick–host–pathogen molecular interactions and ending in the characterization and validation of vaccine formulations. The discovery of new candidate vaccine antigens for the control of tick infestations and pathogen infection and transmission requires the development of effective screening platforms and algorithms that allow the analysis and validation of data produced by systems biology approaches to tick research. Tick vaccines that affect both tick infestations and pathogen transmission could be used to vaccinate human and animal populations at risk and reservoir species to reduce host exposure to ticks while reducing the number of infected ticks and their vectorial capacity for pathogens that affect human and animal health worldwide.

  1. The mitochondrial genome of a Texas outbreak strain of the cattle tick, Rhipicephalus (Boophilus) microplus, derived from whole genome sequencing Pacific Biosciences and Illumina reads

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The cattle fever tick, Rhipicephalus (Boophilus) microplus is one of the most significant medical veterinary pests in the world, vectoring several serious livestock diseases negatively impacting agricultural economies of tropical and subtropical countries around the world. We assembled the complete ...

  2. Ticks infesting humans in Northern Misiones, Argentina.

    PubMed

    Lamattina, Daniela; Nava, Santiago

    2016-01-01

    This work presents records of ticks infesting humans in northern Misiones Province, Argentina. Also, notes on potential transmission of tick-borne pathogens are included. A total of 282 ticks attached to researchers were collected and identified by their morphological characters. Eight tick species were found: Amblyomma brasiliense, Amblyomma coelebs, Amblyomma dubitatum, Amblyomma incisum, Amblyomma ovale, Haemaphysalis juxtakochi, Rhipicephalus sanguineus and Rhipicephalus microplus. Some of these species as A. dubitatum, A. ovale and R. sanguineus have been found infected with spotted fever group rickettsiae pathogenic to humans in Brazil and Argentina. The potential role as vectors of humans pathogens of the ticks found attached to humans in this study is discussed.

  3. Employee Handbook

    SciTech Connect

    Bello, Madelyn

    2008-09-05

    Welcome to Berkeley Lab. You are joining or are already a part of a laboratory with a sterling tradition of scientific achievement, including eleven Nobel Laureates and thirteen National Medal of Science winners. No matter what job you do, you make Berkeley Lab the outstanding organization that it is. Without your hard work and dedication, we could not achieve all that we have. We value you and thank you for choosing to be part of our community. This Employee Handbook is designed to help you navigate the Lab. With over 3,000 employees, an additional 3,000 guests visiting from countries around the world, a 200-acre campus and many policies and procedures, learning all the ins and outs may seem overwhelming, especially if you're a new employee. However, even if you have been here for a while, this Handbook should be a useful reference tool. It is meant to serve as a guide, highlighting and summarizing what you need to know and informing you where you can go for more detailed information. The general information provided in this Handbook serves only as a brief description of many of the Lab's policies. Policies, procedures and information are found in the Lab's Regulations and Procedures Manual (RPM), Summary Plan Descriptions, University of California policies, and provisions of Contract 31 between the Regents of the University and the U.S. Department of Energy. In addition, specific terms and conditions for represented employees are found in applicable collective bargaining agreements. Nothing in this Handbook is intended to supplant, change or conflict with the previously mentioned documents. In addition, the information in this Handbook does not constitute a contract or a promise of continued employment and may be changed at any time by the Lab. We believe employees are happier and more productive if they know what they can expect from their organization and what their organization expects from them. The Handbook will familiarize you with the privileges, benefits

  4. Tick species and tick-borne infections identified in population from a rural area of Spain.

    PubMed Central

    Merino, Francisco Jesús; Nebreda, Teresa; Serrano, Jose Luis; Fernández-Soto, Pedro; Encinas, Antonio; Pérez-Sánchez, Ricardo

    2005-01-01

    To determine the tick species that bite humans in the province of Soria (Spain) and ascertain the tick-borne pathogens that threaten people's health in that province, 185 tick specimens were collected from 179 patients who sought medical advice at health-care centres. The ticks were identified, and their DNA examined by PCR for pathogens. Most ticks were collected in autumn and spring (59 and 57 respectively). Nine species of ticks were identified, the most frequent being Dermacentor marginatus (55.7%), Ixodes ricinus (12.4%) and Rhipicephalus bursa (11.9%). Ninety-seven females, 66 males, 21 nymphs and one larva were identified. Twenty-six ticks carried DNA from Rickettsia spp. (11 Rickettsia slovaca, 6 Rickettsia spp. RpA4/DnS14, 1 Rickettsia massiliae/Bar29, and 8 unidentified); two ticks carried DNA from Borrelia burgdorferi sensu lato and seven ticks harboured DNA from Anaplasma phagocytophilum. PMID:16181517

  5. Strategies for new and improved vaccines against ticks and tick-borne diseases.

    PubMed

    de la Fuente, J; Kopáček, P; Lew-Tabor, A; Maritz-Olivier, C

    2016-12-01

    Ticks infest a variety of animal species and transmit pathogens causing disease in both humans and animals worldwide. Tick-host-pathogen interactions have evolved through dynamic processes that accommodated the genetic traits of the hosts, pathogens transmitted and the vector tick species that mediate their development and survival. New approaches for tick control are dependent on defining molecular interactions between hosts, ticks and pathogens to allow for discovery of key molecules that could be tested in vaccines or new generation therapeutics for intervention of tick-pathogen cycles. Currently, tick vaccines constitute an effective and environmentally sound approach for the control of ticks and the transmission of the associated tick-borne diseases. New candidate protective antigens will most likely be identified by focusing on proteins with relevant biological function in the feeding, reproduction, development, immune response, subversion of host immunity of the tick vector and/or molecules vital for pathogen infection and transmission. This review addresses different approaches and strategies used for the discovery of protective antigens, including focusing on relevant tick biological functions and proteins, reverse genetics, vaccinomics and tick protein evolution and interactomics. New and improved tick vaccines will most likely contain multiple antigens to control tick infestations and pathogen infection and transmission.

  6. Hard Tick Factors Implicated in Pathogen Transmission

    PubMed Central

    Liu, Xiang Ye; Bonnet, Sarah I.

    2014-01-01

    Ticks are the most common arthropod vector, after mosquitoes, and are capable of transmitting the greatest variety of pathogens. For both humans and animals, the worldwide emergence or re-emergence of tick-borne disease is becoming increasingly problematic. Despite being such an important issue, our knowledge of pathogen transmission by ticks is incomplete. Several recent studies, reviewed here, have reported that the expression of some tick factors can be modulated in response to pathogen infection, and that some of these factors can impact on the pathogenic life cycle. Delineating the specific tick factors required for tick-borne pathogen transmission should lead to new strategies in the disruption of pathogen life cycles to combat emerging tick-borne disease. PMID:24498444

  7. Hypersensitivity to ticks and Lyme disease risk.

    PubMed

    Burke, Georgine; Wikel, Stephen K; Spielman, Andrew; Telford, Sam R; McKay, Kathleen; Krause, Peter J

    2005-01-01

    Although residents of Lyme disease-endemic regions describe frequent exposure to ticks, Lyme disease develops in relatively few. To determine whether people who experience cutaneous hypersensitivity against tick bite have fewer episodes of Lyme disease than those who do not, we examined several factors that might restrict the incidence of Lyme disease among residents of Block Island, Rhode Island. Of 1,498 study participants, 27% (95% confidence interval [CI] 23%-31%) reported > or = 1 tick bites, and 17% (95% CI 13%-21%) reported itch associated with tick bite in the previous year. Borrelia burgdorferi infected 23% (95% CI 20%-26%) of 135 nymphal Ixodes scapularis (I. dammini) ticks. The likelihood of Lyme disease infection decreased with >3 reports of tick-associated itch (odds ratio 0.14, 95% CI 0.94-0.03, p = 0.01). Prior exposure to uninfected vector ticks protects residents of disease-endemic sites from Lyme disease.

  8. Delivering ideal employee experiences.

    PubMed

    Weiss, Marjorie D; Tyink, Steve; Kubiak, Curt

    2009-05-01

    Employee-centric strategies have moved from employee satisfaction and brand awareness to employee "affinity" or "attachment." In today's marketplace, occupational health nurses understand that differentiation (i.e., the perception of uniqueness) is the direct result of superior employee interactions, which lead to better employee care, enduring employee relationships, loyal employees, and satisfied employers. What drives employees to occupational health nurse attachment? The answer is a passion for rising above the competition to create ideal employee experiences.

  9. Tick-borne relapsing fever: an interstate outbreak originating at Grand Canyon National Park.

    PubMed

    Boyer, K M; Munford, R S; Maupin, G O; Pattison, C P; Fox, M D; Barnes, A M; Jones, W L; Maynard, J E

    1977-05-01

    During the 1973 summer season, 27 employees and 35 overnight guests at the North Rim, Grand Canyon National Park, Arizona, acquired febrile illnesses compatibel with relapsing fever. Sixteen cases were confirmed by finding Borrelia spirochetes in peripheral blood smears or inoculated Swiss mice. Retrospective surveys of 278 employees and 7247 guests at the park revealed that acquisition of illness was significantly associated with the persons sleeping in rustic log cabins and acquiring bites of "unknown" insects. From rodent nesting materials found in the walls and attics of cabins where cases had occurred, infective Ornithodoros hermsi ticks were recovered. Exceptional activity of ticks in human populations appeared to have resulted from a decreased population of the ticks' usual rodent hosts. Vector control activities consisted of spraying the cabins with residual insecticide, removing nesting materials, and "rodent proofing." This outbreak, the largest yet identified in North America, extends the known range of a principal vector and establishes the North Rim as an endemic source of tick-borne relapsing fever.

  10. Tick size and stock returns

    NASA Astrophysics Data System (ADS)

    Onnela, Jukka-Pekka; Töyli, Juuso; Kaski, Kimmo

    2009-02-01

    Tick size is an important aspect of the micro-structural level organization of financial markets. It is the smallest institutionally allowed price increment, has a direct bearing on the bid-ask spread, influences the strategy of trading order placement in electronic markets, affects the price formation mechanism, and appears to be related to the long-term memory of volatility clustering. In this paper we investigate the impact of tick size on stock returns. We start with a simple simulation to demonstrate how continuous returns become distorted after confining the price to a discrete grid governed by the tick size. We then move on to a novel experimental set-up that combines decimalization pilot programs and cross-listed stocks in New York and Toronto. This allows us to observe a set of stocks traded simultaneously under two different ticks while holding all security-specific characteristics fixed. We then study the normality of the return distributions and carry out fits to the chosen distribution models. Our empirical findings are somewhat mixed and in some cases appear to challenge the simulation results.

  11. Soft tick sampling and collection

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Several soft tick species in the genus Ornithodoros are vectors of African swine fever virus (ASFV) in nature, or known to be susceptible to infection. African swine fever (ASF) caused by ASFV is considered one of the most serious transboundary swine diseases because of its high lethality for pigs, ...

  12. Cattle Fever Ticks in the U.S.: Back to 1906?

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Keeping cattle fever ticks (CFT), Rhipicephalus (Boophilus) microplus and R. annulatus, eradicated from the United States and thus keeping the national cattle herd free of bovine babesiosis is a current and critical agricultural biosecurity issue of national relevance. Also known as “Texas fever”, ...

  13. Research project for integrated control of the southern cattle fever tick in Puerto Rico

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Puerto Rico (PR) is infested with the southern cattle fever tick (SCFT), Rhipicephalus (Boophilus) microplus, which is considered the most economically important external parasite of livestock worldwide. A research coalition involving the livestock industry in PR, the PR Department of Agriculture (...

  14. 7 CFR 1940.960 - Federal employee panel members.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... 7 Agriculture 13 2010-01-01 2009-01-01 true Federal employee panel members. 1940.960 Section 1940... § 1940.960 Federal employee panel members. (a) The State Director will appoint one FmHA or its successor agency under Public Law 103-354 employee to serve as a voting member of the panel established in §...

  15. Virus Discovery Using Tick Cell Lines

    PubMed Central

    Bell-Sakyi, Lesley; Attoui, Houssam

    2016-01-01

    While ticks have been known to harbor and transmit pathogenic arboviruses for over 80 years, the application of high-throughput sequencing technologies has revealed that ticks also appear to harbor a diverse range of endogenous tick-only viruses belonging to many different families. Almost nothing is known about these viruses; indeed, it is unclear in most cases whether the identified viral sequences are derived from actual replication-competent viruses or from endogenous virus elements incorporated into the ticks’ genomes. Tick cell lines play an important role in virus discovery and isolation through the identification of novel viruses chronically infecting such cell lines and by acting as host cells to aid in determining whether or not an entire replication-competent, infective virus is present in a sample. Here, we review recent progress in tick-borne virus discovery and comment on the actual and potential applications for tick cell lines in this emerging research area. PMID:27679414

  16. Tick Bite by Nymphal Amblyomma testudinarium

    PubMed Central

    Kim, Yeong Ho; Lee, Ji Hyun; Park, Young Min

    2016-01-01

    Ticks are parasites that usually suck the blood of wild or domestic animals; rarely, they ingest human blood and spread various febrile infectious diseases along with skin problems. Out of 40 cases of tick bite reported in Korea, only 3 were caused by nymphal ticks, and tick bites by nymphal Amblyomma testudinarium have not been reported previously. Herein, we report a rare case of tick bite by nymphal A. testudinarium. A 57-year-old woman presented with an asymptomatic solitary erythematous nodule on the left thigh that had been present for 6 days. The tick, which the patient removed from the lesion and brought to the hospital, was identified as a nymphal A. testudinarium. Doxycycline (200 mg) was used as treatment, and after seven days of use, the patient improved and no other lesions were detected. PMID:27904278

  17. Tick-borne Diseases in Animals and USDA Research on Tick Control

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Tick-borne diseases represent a major threat to animal health in the United States. The cattle industry in the United States has benefited greatly from the continued USDA efforts through the Cattle Fever Tick Eradication Program in preventing the re-introduction of cattle ticks and associated pathog...

  18. Tick Genome Assembled: New Opportunities for Research on Tick-Host-Pathogen Interactions

    PubMed Central

    de la Fuente, José; Waterhouse, Robert M.; Sonenshine, Daniel E.; Roe, R. Michael; Ribeiro, Jose M.; Sattelle, David B.; Hill, Catherine A.

    2016-01-01

    As tick-borne diseases are on the rise, an international effort resulted in the sequence and assembly of the first genome of a tick vector. This result promotes research on comparative, functional and evolutionary genomics and the study of tick-host-pathogen interactions to improve human, animal and ecosystem health on a global scale. PMID:27695689

  19. Ticks on Deer and Cattle in the Cattle Fever Tick Permanent Quarantine Zone, 2012

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Ticks were sampled from hosts in the cattle fever tick permanent quarantine zone along the Texas-Mexico border on five occasions in 2012. Three sample events involved white-tailed deer populations in Zapata and Starr Counties and two were from a cattle herd in Kinney County. Six species of ticks (n ...

  20. Ixodid ticks parasitizing wild carnivores in Romania.

    PubMed

    D'Amico, Gianluca; Dumitrache, Mirabela Oana; Matei, Ioana Adriana; Ionică, Angela Monica; Gherman, Călin Mircea; Sándor, Attila David; Modrý, David; Mihalca, Andrei Daniel

    2017-02-01

    In Romania, data regarding hard-tick diversity and tick-host associations in wild carnivores are scarce. We aimed to identify tick species in wild carnivores and to establish reliable data on tick-host associations. The study was conducted in various Romanian localities from all five ecoregions found in the country. Fourteen species of wild carnivores were examined. Immature and adult ticks were collected and identified using the morphological keys. The frequency and mean intensity of tick infestation, overall and differentiated by species, developmental stage and host were calculated. Of 202 wild carnivores, 68 were parasitized by seven tick species (predominantly Ixodes ricinus, I. hexagonus and Dermacentor reticulatus). The mean intensity of tick infestation was similar in males (6.97, BCa 95% CI 5.15-9.88) and females (5.76, BCa 95% CI 4.15-9.17). The highest prevalence of infested animals was recorded in the pannonian and steppic ecoregions, 66.7 and 52.7%, respectively. In the continental ecoregion the prevalence was 26.7%, whereas in the pontic ecoregion it was 28%. The lowest value, 16.7% was recorded in the alpine ecoregion. In total 430 ticks were collected, and 24.8% (n = 50) of the animals were infested with more than one tick species. Fourteen new tick-host associations were recorded. Our results suggest that anthropogenic changes of the environment lead to the diminishing of the boundaries, between wild and domestic animals, increasing the exposure for both animals and humans, to infective agents, including tick-borne pathogens.

  1. A tick from a prehistoric Arizona coprolite.

    PubMed

    Johnson, Keith L; Reinhardt, Karl J; Sianto, Luciana; Araújo, Adauto; Gardner, Scott L; Janovy, John

    2008-02-01

    Ticks have never been reported in archaeological analyses. Here, we present the discovery of a tick from a coprolite excavated from Antelope Cave in extreme northwest Arizona. Dietary analysis indicates that the coprolite has a human origin. This archaeological occupation is associated with the Ancestral Pueblo culture (Anasazi). This discovery supports previous hypotheses that ticks were a potential source of disease and that ectoparasites were eaten by ancient people.

  2. Ticks and Tickborne Diseases Affecting Military Personnel

    DTIC Science & Technology

    1989-09-01

    by disease transmission. Various bacteria , rickettsiae , viruses, and protozoans are transmitted to people via tick bites (see Chapter 4). Relatively...Ticks may harbor and transmit to people various disease agents such as protozoa, viruses, bacteria , rickettsiae , and toxins. Several factors are...Natural history. The causative agent of RMSF, Rickettsia rickettsii , is transmitted to man by several species of ticks. In the U.S., 2 of the most

  3. TICK: Transparent Incremental Checkpointing at Kernel Level

    SciTech Connect

    Petrini, Fabrizio; Gioiosa, Roberto

    2004-10-25

    TICK is a software package implemented in Linux 2.6 that allows the save and restore of user processes, without any change to the user code or binary. With TICK a process can be suspended by the Linux kernel upon receiving an interrupt and saved in a file. This file can be later thawed in another computer running Linux (potentially the same computer). TICK is implemented as a Linux kernel module, in the Linux version 2.6.5

  4. THE EXPERIMENTAL TRANSMISSION OF COLORADO TICK FEVER.

    PubMed

    Florio, L; Stewart, M O; Mugrage, E R

    1944-09-01

    1. The symptoms, history of tick bite, characteristic fever curve, and white blood cell picture should enable the physician to make a diagnosis of Colorado tick fever in nearly every case. 2. The typical white blood cell picture is a depression of the total leucocytes with a shift to the left of the granulocytes. Basophilic cytoplasmic bodies appear occasionally in lymphocytes 3 to 4 days after clinical recovery. 3. The disease can be transmitted serially in human beings by parenteral injection of blood or serum. Such transfers have not resulted in decreased or increased virulence. 4. The naturally acquired and experimental cases of Colorado tick fever are identical in their manifestations. 5. An attack of Colorado tick fever confers a degree of definite immunity to the disease. 6. Colorado tick fever is not a mild form of Rocky Mountain spotted fever since individuals immunized with ground tick vaccine against Rocky Mountain spotted fever are still susceptible to Colorado tick fever. 7. Adult Dermacentor andersoni ticks allowed to feed on typical cases, then carried through to a new generation and fed on susceptible adults, failed to transmit the disease. 8. Colorado tick fever has been successfully transmitted to an experimental animal, the golden hamster.

  5. The mitochondrial genome of a Texas outbreak strain of the cattle tick, Rhipicephalus (Boophilus) microplus, derived from whole genome sequencing Pacific Biosciences and Illumina reads.

    PubMed

    McCooke, John K; Guerrero, Felix D; Barrero, Roberto A; Black, Michael; Hunter, Adam; Bell, Callum; Schilkey, Faye; Miller, Robert J; Bellgard, Matthew I

    2015-10-15

    The cattle fever tick, Rhipicephalus (Boophilus) microplus is one of the most significant medical veterinary pests in the world, vectoring several serious livestock diseases negatively impacting agricultural economies of tropical and subtropical countries around the world. In our study, we assembled the complete R. microplus mitochondrial genome from Illumina and Pac Bio sequencing reads obtained from the ongoing R. microplus (Deutsch strain from Texas, USA) genome sequencing project. We compared the Deutsch strain mitogenome to the mitogenome from a Brazilian R. microplus and from an Australian cattle tick that has recently been taxonomically designated as Rhipicephalus australis after previously being considered R. microplus. The sequence divergence of the Texas and Australia ticks is much higher than the divergence between the Texas and Brazil ticks. This is consistent with the idea that the Australian ticks are distinct from the R. microplus of the Americas.

  6. Research on the ecology of ticks and tick-borne pathogens—methodological principles and caveats

    PubMed Central

    Estrada-Peña, Agustín; Gray, Jeremy S.; Kahl, Olaf; Lane, Robert S.; Nijhof, Ard M.

    2013-01-01

    Interest in tick-transmitted pathogens has experienced an upsurge in the past few decades. Routine application of tools for the detection of fragments of foreign DNA in ticks, together with a high degree of interest in the quantification of disease risk for humans, has led to a marked increase in the number of reports on the eco-epidemiology of tick-borne diseases. However, procedural errors continue to accumulate in the scientific literature, resulting in misleading information. For example, unreliable identification of ticks and pathogens, erroneous interpretations of short-term field studies, and the hasty acceptance of some tick species as vectors have led to ambiguities regarding the vector role of these arthropods. In this review, we focus on the ecological features driving the life cycle of ticks and the resulting effects on the eco-epidemiology of tick-transmitted pathogens. We review the factors affecting field collections of ticks, and we describe the biologically and ecologically appropriate procedures for describing tick host-seeking activity and its correlation with environmental traits. We detail the climatic variables that have biological importance on ticks and explain how they should be properly measured and analyzed. We also provide evidence to critically reject the use of some environmental traits that are being increasingly reported as the drivers of the behavior of ticks. With the aim of standardization, we propose unambiguous definitions of the status of hosts and ticks regarding their ability to maintain and spread a given pathogen. We also describe laboratory procedures and standards for evaluating the vectorial capacity of a tick or the reservoir role of a host. This approach should provide a coherent framework for the reporting of research findings concerning ticks and tick-borne diseases. PMID:23964348

  7. Tick-induced allergies: mammalian meat allergy, tick anaphylaxis and their significance

    PubMed Central

    2015-01-01

    Serious tick-induced allergies comprise mammalian meat allergy following tick bites and tick anaphylaxis. Mammalian meat allergy is an emergent allergy, increasingly prevalent in tick-endemic areas of Australia and the United States, occurring worldwide where ticks are endemic. Sensitisation to galactose-α-1,3-galactose (α-Gal) has been shown to be the mechanism of allergic reaction in mammalian meat allergy following tick bite. Whilst other carbohydrate allergens have been identified, this allergen is unique amongst carbohydrate food allergens in provoking anaphylaxis. Treatment of mammalian meat anaphylaxis involves avoidance of mammalian meat and mammalian derived products in those who also react to gelatine and mammalian milks. Before initiating treatment with certain therapeutic agents (e.g., cetuximab, gelatine-containing substances), a careful assessment of the risk of anaphylaxis, including serological analysis for α-Gal specific-IgE, should be undertaken in any individual who works, lives, volunteers or recreates in a tick endemic area. Prevention of tick bites may ameliorate mammalian meat allergy. Tick anaphylaxis is rare in countries other than Australia. Tick anaphylaxis is secondarily preventable by prevention and appropriate management of tick bites. Analysis of tick removal techniques in tick anaphylaxis sufferers offers insights into primary prevention of both tick and mammalian meat anaphylaxis. Recognition of the association between mammalian meat allergy and tick bites has established a novel cause and effect relationship between an environmental exposure and subsequent development of a food allergy, directing us towards examining environmental exposures as provoking factors pivotal to the development of other food allergies and refocusing our attention upon causation of allergy in general. PMID:25653915

  8. Research on the ecology of ticks and tick-borne pathogens--methodological principles and caveats.

    PubMed

    Estrada-Peña, Agustín; Gray, Jeremy S; Kahl, Olaf; Lane, Robert S; Nijhof, Ard M

    2013-01-01

    Interest in tick-transmitted pathogens has experienced an upsurge in the past few decades. Routine application of tools for the detection of fragments of foreign DNA in ticks, together with a high degree of interest in the quantification of disease risk for humans, has led to a marked increase in the number of reports on the eco-epidemiology of tick-borne diseases. However, procedural errors continue to accumulate in the scientific literature, resulting in misleading information. For example, unreliable identification of ticks and pathogens, erroneous interpretations of short-term field studies, and the hasty acceptance of some tick species as vectors have led to ambiguities regarding the vector role of these arthropods. In this review, we focus on the ecological features driving the life cycle of ticks and the resulting effects on the eco-epidemiology of tick-transmitted pathogens. We review the factors affecting field collections of ticks, and we describe the biologically and ecologically appropriate procedures for describing tick host-seeking activity and its correlation with environmental traits. We detail the climatic variables that have biological importance on ticks and explain how they should be properly measured and analyzed. We also provide evidence to critically reject the use of some environmental traits that are being increasingly reported as the drivers of the behavior of ticks. With the aim of standardization, we propose unambiguous definitions of the status of hosts and ticks regarding their ability to maintain and spread a given pathogen. We also describe laboratory procedures and standards for evaluating the vectorial capacity of a tick or the reservoir role of a host. This approach should provide a coherent framework for the reporting of research findings concerning ticks and tick-borne diseases.

  9. A case of tick bite.

    PubMed

    Hara, S; Takei, Y; Shiga, N

    1982-01-01

    A 30-year-old women suffered from right superior eyelid infestation of Ixodes ovatus Neumann, which was mechanically removed with forceps after application of benzine. No mouth parts were retained in the eyelid. Removed mouth parts were examined by a scanning electron microscope. There were no complications except focal trichotylosis in the involved area. The mode of attachment of the tick to the host and the method of removal were discussed.

  10. Tick-Borne Diseases in Turkey: A Review Based on One Health Perspective

    PubMed Central

    Yildirim, Alparslan; Duzlu, Onder; Doganay, Mehmet; Aksoy, Serap

    2016-01-01

    The importance of tick-borne diseases is increasing all over the world, including Turkey. Global warming, environmental and ecological changes and the existence of suitable habitats increase the impact of ticks and result in frequent emergence or re-emergence of tick-borne diseases (TBDs) with zoonotic characteristics. In Turkey, almost 19 TBDs have been reported in animals and men, involving four protozoa (babesiosis, theileriosis, cytauxzoonosis, hepatozoonosis), one filarial nematode (acanthocheilonemasis), ten bacterial agents (anaplasmosis, ehrlichiosis, aegyptianellosis, tick-borne typhus, Candidatus Rickettsia vini, Lyme borreliosis, tick-borne relapsing fever [TBRF], tularaemia, bartonellosis, and hemoplasmosis), and four viral infections (tick-borne encephalitis [TBE], Crimean-Congo Haemorrhagic Fever [CCHF], louping-ill [LI], and lumpy skin disease [LSD]). The growing number of TBD cases, in particular the fatal viral epidemics in humans, have led to increased public awareness and concern against TBDs in recent years. The World Health Organization (WHO) has developed a new political concept, called the “One Health” initiative, which is especially relevant for developing strategies against tick infestations and TBD control in humans and animals. It would be beneficial for Turkey to adopt this new strategy and establish specific research and control programs in coordination with international organizations like WHO, the World Organization for Animal Health (OIE), the Food and Agriculture Organization (FAO), the Centers for Disease Control and Prevention (CDC), and the European Center for Disease Prevention and Control (ECDC) to combat TBDs based on the “One Health Initiative” concept. In this article, we review the occurrence of primary TBDs in man and animals in Turkey in light of the “One Health” perspective. PMID:27977689

  11. Molecular survey of hard ticks in endemic areas of tick-borne diseases in China.

    PubMed

    Lu, Xin; Lin, Xian-Dan; Wang, Jian-Bo; Qin, Xin-Cheng; Tian, Jun-Hua; Guo, Wen-Ping; Fan, Fei-Neng; Shao, Renfu; Xu, Jianguo; Zhang, Yong-Zhen

    2013-06-01

    Over the past several years, there was a substantial increase in the number of cases of known and novel tick-borne infections in humans in China. To better understand the ticks associated with these infections, we collected hard ticks from animals or around livestock shelters in 29 localities in 5 provinces (Beijing, Henan, Hubei, Inner Mongolia, and Zhejiang) where cases of tick-borne illness were reported. We collected 2950 hard ticks representing 7 species of 4 genera (Dermacentor sinicus, Haemaphysalis flava, Haemaphysalis longicornis, Ixodes granulatus, Ixodes persulcatus, Rhipicephalus microplus, and Rhipicephalus sanguineus). These ticks were identified to species using morphological characters initially. We then sequenced the mitochondrial small subunit rRNA (12S rRNA) gene, cytochrome oxidase subunit 1 (COI) gene, and the second internal transcribed spacer (ITS2) gene of these ticks, and conducted phylogenetic analyses. Our analyses showed that the molecular and morphological data are consistent in the identification of the 7 tick species. Furthermore, all these 7 tick species from China were genetically closely related to the same species or related species found outside China. Rapid and accurate identification and long-term monitoring of these ticks will be of significance to the prevention and control of tick-borne diseases in China.

  12. Urban Breeding Corvids as Disseminators of Ticks and Emerging Tick-Borne Pathogens.

    PubMed

    Sándor, Attila D; Kalmár, Zsuzsa; Matei, Ioana; Ionică, Angela Monica; Mărcuţan, Ioan-Daniel

    2017-02-01

    Crows (Corvidae) are common city dwellers worldwide and are increasingly important subjects of epidemiology studies. Although their importance as hosts and transmitters of a number of zoonotic parasites and pathogens is well known, there are no studies on their importance as tick hosts. After mosquitoes, ticks are the most important vectors of zoonotic pathogens, especially for those causing emerging zoonotic diseases. Pathogenic bacteria, especially Borrelia spp., Rickettsia spp., and Anaplasma spp., vectored by ticks, are the cause for most vector-borne diseases in Europe. Here we report on ticks and tick-borne pathogens harbored by urban breeding crows. A total of 36 birds (33.33%, n = 108) hosted ticks, with 91 individual ticks belonging to 6 species (Haemaphysalis concinna, Haemaphysalis parva, Haemaphysalis punctata, Hyalomma marginatum, Ixodes arboricola, and Ixodes ricinus). Rickettsia spp. DNA was found in 6.6% of ticks and 1.9% of bird tissues, whereas Anaplasma phagocytophilum was found in 5.9% of ticks and 0.9% of birds. Two rickettsial genospecies were located, Rickettsia helvetica and Rickettsia monacensis. This is the first study to determine such a diverse tick spectrum feeding on urban corvids, while highlighting their importance as tick hosts and raising concerns about their potential risk to human health.

  13. Metabolomics of the tick-Borrelia interaction during the nymphal tick blood meal

    PubMed Central

    Hoxmeier, J. Charles; Fleshman, Amy C.; Broeckling, Corey D.; Prenni, Jessica E.; Dolan, Marc C.; Gage, Kenneth L.; Eisen, Lars

    2017-01-01

    The causal agents of Lyme disease in North America, Borrelia burgdorferi and Borrelia mayonii, are transmitted primarily by Ixodes scapularis ticks. Due to their limited metabolic capacity, spirochetes rely on the tick blood meal for nutrients and metabolic intermediates while residing in the tick vector, competing with the tick for nutrients in the blood meal. Metabolomics is an effective methodology to explore dynamics of spirochete survival and multiplication in tick vectors before transmission to a vertebrate host via tick saliva. Using gas chromatography coupled to mass spectrometry, we identified statistically significant differences in the metabolic profile among uninfected I. scapularis nymphal ticks, B. burgdorferi-infected nymphal ticks and B. mayonii-infected nymphal ticks by measuring metabolism every 24 hours over the course of their up to 96 hour blood meals. Specifically, differences in the abundance of purines, amino acids, carbohydrates, and fatty acids during the blood meal among the three groups of nymphal ticks suggest that B. mayonii and B. burgdorferi may have different metabolic capabilities, especially during later stages of nymphal feeding. Understanding mechanisms underlying variable metabolic requirements of different Lyme disease spirochetes within tick vectors could potentially aid development of novel methods to control spirochete transmission. PMID:28287618

  14. Tick-borne rickettsial pathogens in questing ticks, removed from humans and animals in Mexico

    PubMed Central

    Vargas-Sandoval, Margarita; Torres, Javier

    2016-01-01

    Tick-borne rickettsial diseases (TBRD) are commonly encountered in medical and veterinary clinical settings. The control of these diseases is difficult, requiring disruption of a complex transmission chain involving a vertebrate host and ticks. The geographical distribution of the diseases is related to distribution of the vector, which is an indicator of risk for the population. A total of 1,107 ticks were collected by tick dragging from forests, ecotourism parks and hosts at 101 sites in 22 of the 32 states of Mexico. Collected ticks were placed in 1.5 mL cryovials containing 70% ethanol and were identified to species. Ticks were pooled according to location/host of collection, date of collection, sex, and stage of development. A total of 51 ticks were assayed by polymerase chain reaction (PCR) to confirm species identification using morphological methods. A total of 477 pools of ticks were assayed using PCR techniques for selected tick-borne pathogens. Anaplasma phagocytophilum was the most commonly detected pathogen (45 pools), followed by, Ehrlichia (E.) canis (42), Rickettsia (R.) rickettsii (11), E. chaffeensis (8), and R. amblyommii (1). Rhipicephalus sanguineus was the tick most frequently positive for selected pathogens. Overall, our results indicate that potential tick vectors positive for rickettsial pathogens are distributed throughout the area surveyed in Mexico. PMID:26726019

  15. Molecular investigation of tick-borne pathogens in ticks from grazing cattle in Korea.

    PubMed

    Kang, Seung Won; Doan, Huong Thi Thanh; Choe, Se Eun; Noh, Jin Hyeong; Yoo, Mi Sun; Reddy, Kondreddy Eswar; Kim, Young Ha; Kweon, Chang Hee; Jung, Suk Chan; Chang, Ki Yoon

    2013-06-01

    This study was carried out to identify the tick species that infest grazing cattle and to determine the presence of tick-borne pathogens transmitted by these ticks in Korea. A total of 903 ticks (categorized into 566 tick pools) were collected from five provinces during 2010-2011. The most prevalent tick species was Haemaphysalis longicornis, followed by three Ixodes spp. ticks. The collected ticks were infected with both rickettsial and protozoan pathogens. In all, 469 (82.9%) tick pools tested positive for the Anaplasma/Ehrlichia 16S rRNA gene, whereas 67 (11.8%) were positive for the Babesia/Theileria 18S rRNA gene. Among the rickettsial pathogens, E. canis was detected with the highest rate (22.3%), followed by A. platys (20%), E. chaffeensis (19.4%), E. ewingii (19.3%), Rickettsia sp. (12.4%), A. phagocytophilum (5.5%) and E. muris (0.5%). Among the protozoan pathogens, T. equi was detected with the highest rate (7.2%), followed by T. sergenti/T. buffeli (3.7%) and B. caballi (0.35%). Simultaneous infections with up to seven pathogens were also identified. In particular, ticks infected with rickettsial pathogens were also infected with protozoan pathogens (22 samples). All five provinces investigated infected with tick-borne pathogens.

  16. Control of Hyalomma lusitanicum (Acari: Ixodidade) Ticks Infesting Oryctolagus cuniculus (Lagomorpha: Leporidae) Using the Entomopathogenic Fungus Beauveria bassiana (Hyocreales: Clavicipitaceae) in Field Conditions.

    PubMed

    González, J; Valcárcel, F; Pérez-Sánchez, J L; Tercero-Jaime, J M; Cutuli, M T; Olmeda, A S

    2016-11-01

    Entomopathogenic fungi are widely used to control arthropods not just in agricultural settings but also in Veterinary Medicine and Public Health. These products have been employed to control tick populations and tick-borne diseases. The effectiveness of these control measures not only depends on the fungi, but also on the tick species and environmental conditions. In Mesomediterranean areas, tick species are adapted to extreme climatic conditions and it is therefore especially important to develop suitable tick control strategies. The aim of this study was to evaluate the effectiveness of a new method of tick control which entails the application of a commercial strain of Beauveria bassiana (Balsamo, Vuillemin) on wild rabbit burrows under field conditions. Aqueous solutions of the product were applied using a mist blower sprayer into 1,717 burrows. Two trials were performed, one in spring and the other in summer. The parasitic index (PI) was calculated for 10 rabbits per treatment per time point on day +30, +60, and +90 posttreatment and efficiency was calculated by comparing the PI for ticks in treated and untreated rabbits. A total of 20,234 ixodid ticks were collected. Hyalomma lusitanicum Koch, 1844 was the most abundant tick feeding on rabbits. Treatment significantly reduced the PI in spring (by 78.63% and 63.28% on day +30 and +60, respectively; P < 0.05), but appeared to be less effective in summer, with a marginally significant tick reduction of 35.72% on day +30 (P = 0.05). Results suggest that the efficacy of applications inside burrows could be temperature-dependent and that such applications could be an economic alternative to rabbit tick control during at least two months using a diluted solution of B. bassiana conidia.

  17. Rickettsial and other tick-borne infections.

    PubMed

    Flicek, Barbara Fouts

    2007-03-01

    Tick bites are best prevented by people avoiding tick-infested areas. When this is not possible, tick bites may be prevented by the wearing of long trousers that are tucked into boots. The best method to avoid tick bites is twofold: application of a topical deet (N,N-diethyl-m-toluamide) repellent to exposed skin, and treatment of clothing with permethrin. This system is currently used by the US Army to protect soldiers. Ticks can crawl underneath clothing and bite untreated portions of the body; therefore, treating clothing is imperative. Permethrin is nontoxic to humans, and can be used in any age group. Permethrin is commercially available. Checking clothing regularly while in tick-infested areas is highly recommended to back up the few hours of protection provided by the insect repellents. It is also recommended that the entire body be carefully screened for ticks and other parasites by campers and hunters while they are staying in and after leaving infested areas. Any tick found should be removed immediately. Removing ticks may not be easy. It is best to use blunt, rounded forceps, and a magnifying glass to remove ticks, especially when immature ticks are found. The forceps are used to grasp the mouthparts of the tick as close as possible to the skin, and then the tick is pulled upward, perpendicular to the skin, with a continuous and steady action. Usually any mouth parts of the tick retained in the skin are eliminated uneventfully by the body. Other methods of removing ticks, such as using fingers, lighted cigarettes, petroleum jelly, or suntan oil, should be avoided. Killing the tick in situ may increase the risk of regurgitation by the tick and the transmission of infectious agents. Most stick bites are uncomplicated, and result only in benign cutaneous inflammatory reactions that may be pruritic for a few days. As a result of mouthparts being retained at the feeding site, a granuloma may rarely develop. There are no data to indicate that antimicrobial

  18. Modern advances in sustainable tick control

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Ticks are the vector of the many different organisms responsible for both animal and human diseases. Understanding the progress we have made and new directions in tick control is critical to the sustainability of human and animal health. The integration of vaccines, acaricides, and new acaricide ap...

  19. Chemical ecology of tick-host interactions

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Ticks impact the health of livestock and humans world-wide through their roles as pests and vectors of diseases such as heartwater, theileriosis, anaplasmosis, babesiosis, Lyme disease, erhlichiosis, tick-borne encephalitis and Crimean Congo Haemorrhagic fever. Intrinsic to their capacity to serve ...

  20. Rickettsia rickettsii in Rhipicephalus ticks, Mexicali, Mexico.

    PubMed

    Eremeeva, Marina E; Zambrano, Maria L; Anaya, Luis; Beati, Lorenza; Karpathy, Sandor E; Santos-Silva, Maria Margarida; Salceda, Beatriz; MacBeth, Donald; Olguin, Hector; Dasch, Gregory A; Aranda, Celia Alpuche

    2011-03-01

    Circulation of a unique genetic type of Rickettsia rickettsii in ticks of the Rhipicephalus sanguineus complex was detected in Mexicali, Baja California, Mexico. The Mexican R. rickettsii differed from all isolates previously characterized from the endemic regions of Rocky Mountain spotted fever in northern, central, and southern Americas. Rhipicephalus ticks in Mexicali are genetically different from Rh. sanguineus found in the United States.

  1. [Lyme disease: prophylaxis after tick bite].

    PubMed

    Patey, O

    2007-01-01

    Lyme disease is a bacterial infection caused by Borrelia burgdorferi, which is transmitted by infected ticks. The transmission depends on several factors, especially on the duration of the tick's presence in the host body (the nymph which is smaller than the adults and thus less visible, is in this case the most frequently involved) and on whether the tick is infected or not. The interpretation of results in the few available studies is made difficult by the lack of information obtained (due to difficulty to collect information and examination costs). The comparison is made even more difficult by the difference between Borrelia ticks species in various regions. Today, the best methods are preventive: protective clothing, tick repellents, checking and removal of ticks after a journey in an endemic zone, and in case of tick bite, regular examination of the bite site during the following weeks in order to initiate an early curative treatment if ECM is diagnosed. The currently available data seems to be insufficient to suggest systematic antimicrobial prophylaxis in case of tick bite.

  2. Agricultural Animal Pest Control. Bulletin 767.

    ERIC Educational Resources Information Center

    Nolan, Maxcy P., Jr.

    Included in this training manual are descriptions and pictures of the following agricultural animal pests: mosquitoes, stable flies, horse flies and deer or yellow flies, house flies, horn flies, wound-infesting larvae, lice, mites, ticks, and bots and grubs. Information is given on the life-cycle and breeding habits of the pests. Methods of…

  3. Borrelia Diversity and Co-infection with Other Tick Borne Pathogens in Ticks

    PubMed Central

    Raileanu, Cristian; Moutailler, Sara; Pavel, Ionuţ; Porea, Daniela; Mihalca, Andrei D.; Savuta, Gheorghe; Vayssier-Taussat, Muriel

    2017-01-01

    Identifying Borrelia burgdorferi as the causative agent of Lyme disease in 1981 was a watershed moment in understanding the major impact that tick-borne zoonoses can have on public health worldwide, particularly in Europe and the USA. The medical importance of tick-borne diseases has long since been acknowledged, yet little is known regarding the occurrence of emerging tick-borne pathogens such as Borrelia spp., Anaplasma phagocytophilum, Rickettsia spp., Bartonella spp., “Candidatus Neoehrlichia mikurensis”, and tick-borne encephalitis virus in questing ticks in Romania, a gateway into Europe. The objective of our study was to identify the infection and co-infection rates of different Borrelia genospecies along with other tick-borne pathogens in questing ticks collected from three geographically distinct areas in eastern Romania. We collected 557 questing adult and nymph ticks of three different species (534 Ixodes ricinus, 19 Haemaphysalis punctata, and 4 Dermacentor reticulatus) from three areas in Romania. We analyzed ticks individually for the presence of eight different Borrelia genospecies with high-throughput real-time PCR. Ticks with Borrelia were then tested for possible co-infections with A. phagocytophilum, Rickettsia spp., Bartonella spp., “Candidatus Neoehrlichia mikurensis”, and tick-borne encephalitis virus. Borrelia spp. was detected in I. ricinus ticks from all sampling areas, with global prevalence rates of 25.8%. All eight Borrelia genospecies were detected in I. ricinus ticks: Borrelia garinii (14.8%), B. afzelii (8.8%), B. valaisiana (5.1%), B. lusitaniae (4.9%), B. miyamotoi (0.9%), B. burgdorferi s.s (0.4%), and B. bissettii (0.2%). Regarding pathogen co-infection 64.5% of infected I. ricinus were positive for more than one pathogen. Associations between different Borrelia genospecies were detected in 9.7% of ticks, and 6.9% of I. ricinus ticks tested positive for co-infection of Borrelia spp. with other tick-borne pathogens. The

  4. Tick-borne rickettsial pathogens in questing ticks, removed from humans and animals in Mexico.

    PubMed

    Sosa-Gutierrez, Carolina G; Vargas-Sandoval, Margarita; Torres, Javier; Gordillo-Pérez, Guadalupe

    2016-09-30

    Tick-borne rickettsial diseases (TBRD) are commonly encountered in medical and veterinary clinical settings. The control of these diseases is difficult, requiring disruption of a complex transmission chain involving a vertebrate host and ticks. The geographical distribution of the diseases is related to distribution of the vector, which is an indicator of risk for the population. A total of 1107 were collected by tick drag from forests, ecotourism parks and hosts at 101 sites in 22 of the 32 states of Mexico. Collected ticks were placed in 1.5 mL cryovials containing 70% ethanol and were identified to species. Ticks were pooled according to location/host of collection, date of collection, sex, and stage of development. A total of 51 ticks were assayed by polymerase chain reaction (PCR) to confirm species identification using morphological methods. A total of 477 pools of ticks were assayed using PCR techniques for selected tick-borne pathogens. Anaplasma phagocytophilum was the most commonly detected pathogen (45 pools), followed by, Ehrlichia (E.) canis (42), Rickettsia (R.) rickettsii (11), E. chaffeensis (8), and R. amblyommii (1). Rhipicephalus sanguineus was the tick most frequently positive for selected pathogens. Overall, our results indicate that potential tick vectors positive for rickettsial pathogens are distributed throughout the area surveyed in Mexico.

  5. Tick-borne pathogens and the vector potential of ticks in China.

    PubMed

    Yu, Zhijun; Wang, Hui; Wang, Tianhong; Sun, Wenying; Yang, Xiaolong; Liu, Jingze

    2015-01-14

    Ticks, as obligate blood-sucking ectoparasites, attack a broad range of vertebrates and transmit a great diversity of pathogenic microorganisms. They are considered second only to mosquitoes as vectors of human disease, and the most important vector of pathogens of domestic and wild animals. Of the 117 described species in the Chinese tick fauna, 60 are known to transmit one or more diseases: 36 species isolated within China and 24 species isolated outside China. Moreover, 38 of these species carry multiple pathogens, indicating the potentially vast role of these vectors in transmitting pathogens. Spotted fever is the most common tick-borne disease, and is carried by at least 27 tick species, with Lyme disease and human granulocytic anaplasmosis ranked as the second and third most widespread tick-borne diseases, carried by 13 and 10 species, respectively. Such knowledge provides us with clues for the identification of tick-associated pathogens and suggests ideas for the control of tick-borne diseases in China. However, the numbers of tick-associated pathogens and tick-borne diseases in China are probably underestimated because of the complex distribution and great diversity of tick species in this country.

  6. Detection of tick-borne encephalitis virus in I. ricinus ticks collected from autumn migratory birds in Latvia.

    PubMed

    Kazarina, Alisa; Japiņa, Kristīne; Keišs, Oskars; Salmane, Ineta; Bandere, Dace; Capligina, Valentina; Ranka, Renāte

    2015-03-01

    Birds have a potential of spreading ticks via bird migration routes. In this study, we screened 170 ticks removed during autumn 2010 from 55 birds belonging to 10 species for the presence of tick-borne encephalitis virus (TBEV). In total, TBEV RNA was detected in 14% of I. ricinus tick samples obtained from different birds species. The results of this study indicate the possible role of migrating birds in the dispersal of TBEV-infected ticks along the southward migration route.

  7. Tick-borne zoonotic bacteria in ticks collected from central Spain.

    PubMed

    Toledo, Alvaro; Olmeda, A Sonia; Escudero, Raquel; Jado, Isabel; Valcárcel, Félix; Casado-Nistal, Miguel A; Rodríguez-Vargas, Manuela; Gil, Horacio; Anda, Pedro

    2009-07-01

    The prevalence of tick-borne and related bacteria infecting adult ticks in central Spain was assessed by molecular methods. Six areas were sampled monthly during a 2-year longitudinal study. A total of 1,038 questing and 442 feeding ticks, belonging to eight different species, were tested. The most abundant species were Hyalomma lusitanicum (54% of captures), followed by Dermacentor marginatus (23%) and Rhipicephalus sanguineus (10%). Four human pathogens, including seven Rickettsia species, Anaplasma phagocytophilum, Borrelia burgdorferi, and Francisella tularensis, were detected at percentages of 19.0, 2.2, 1.7, and 0.5, respectively, whereas Bartonella spp. was never detected. In terms of infection and tick abundance, H. lusitanicum seems to be the most significant tick species in the area, carrying three of the five agents tested, and the anthropophilic tick, D. marginatum, infected with Rickettsia spp. and F. tularensis, is the most relevant in terms of public health. The significance of these data is discussed.

  8. Molecular evidence for tick-borne encephalitis virus in ticks in South Korea.

    PubMed

    Kim, S Y; Jeong, Y E; Yun, S-M; Lee, I Y; Han, M G; Ju, Y R

    2009-03-01

    To investigate whether tick-borne encephalitis viruses (TBEVs) are present in South Korea, Korean ixodid ticks were tested for TBEV RNA. Ticks (n = 2460) were collected from wild and domestic animals or by flagging at forest and grassland in 12 regions of five provinces in 2005-06. Four species in two genera were identified, yielding 197 sample pools (1-20 ticks per pool); from these, 12 envelope protein gene fragments of TBEV were amplified by reverse transcriptase-nested polymerase chain reaction (RT-nested PCR). Ten of the 2104 adult ticks (0.4%) and two of the 356 nymph ticks (0.2%) were positive for the envelope (E) gene of TBEV. Twelve TBEV RNA-positive samples were detected in Gyeonggi and Gangwon provinces. Phylogenetic analysis showed that the E genes of the TBEV isolates were clustered with the Western European subtype (98% identity). This study suggests that TBEVs may exist in Korea.

  9. Survival dynamics of tick-borne encephalitis virus in Ixodes ricinus ticks.

    PubMed

    Slovák, Mirko; Kazimírová, Mária; Siebenstichová, Marta; Ustaníková, Katarína; Klempa, Boris; Gritsun, Tamara; Gould, Ernest A; Nuttall, Patricia A

    2014-10-01

    Biotic factors contributing to the survival of tick-borne viruses in nature are poorly understood. Using tick-borne encephalitis virus (TBEV) and its principal European vector, Ixodes ricinus, we examined the relative roles of salivary gland infection, co-feeding transmission, and moulting in virus survival. Virus titres in the salivary glands increased after blood-feeding in a time- and dose-dependent manner. This was observed in ticks infected by inoculation but not in ticks infected by the natural route of co-feeding. Amplification of infection prevalence occurred via co-feeding. However, when larvae or nymphs subsequently moulted, the infection prevalence dramatically declined although this was not observed when ticks were infected by inoculation. Trans-stadial survival is a hitherto overlooked parameter that may contribute to the low incidence of TBEV infection in field-collected I. ricinus ticks.

  10. Ticks associated with wild mammals in Ghana.

    PubMed

    Ntiamoa-Baidu, Y; Carr-Saunders, C; Matthews, B E; Preston, P M; Walker, A R

    2005-06-01

    The host ranges of a collection of 21 tick species found on wild mammals in the savanna, forests and coastal zone of Ghana suggested that most species were adapted to feeding mainly on host species within a single mammalian order, i.e. on artiodactyls (bovids/suids), carnivores, rodents or pholidotes (pangolins). Only a few species were dispersed evenly across a range of orders. Seven out of ten of the most common ticks on forest mammals were significantly associated with a particular host species or a group of closely related host species, which could be viewed as their major host or hosts, but they were also recorded much less frequently on a wide range of host species. Two other species were confined to their major hosts. Only one species appeared to be widely dispersed on forest mammals and to lack a particular major host. The majority of tick species therefore occurred on hosts with very distinctive biological, behavioural and ecological characteristics. The study provided no evidence to support the view that host specificity is an artefact of sampling. Finding that the tick species on Ghanaian wild mammals occurred on particular hosts, as well as in distinct habitats, indicated that tick-host associations are important for tick survival and confirmed the importance of climate and vegetation in tick distribution.

  11. Novel phleboviruses detected in ticks, Greece.

    PubMed

    Papa, Anna; Kontana, Anastasia; Tsioka, Katerina; Chaligiannis, Ilias; Sotiraki, Smaragda

    2016-07-01

    Since 2009, when severe fever with thrombocytopenia syndrome virus and Heartland virus have been identified and associated with disease in humans, the interest on tick-borne phleboviruses is increasing rapidly. The aim of the present study was to investigate the presence of tick-borne phleboviruses in Greece and compare them with respective ones detected worldwide. Ticks collected from goats and sheep in 60 sites of 13 regional units of Greece were grouped in pools (1-3 ticks per pool) and tested for the presence of phleboviral RNA. Six of 210 pools were positive; they consisted of Rhipicephalus sanguineus ticks collected from sheep in 3 regional units of Greece: Pella (2/30, 6.7%), Imathia (2/21, 9.5%), and Ioannina (2/28, 7.1%). The overall tick minimum infection rate was 2.1%. The sequences of the Greek phlebovirus (provisionally named Antigone virus) form a distinct clade in the tick-borne phleboviruses, differing by >40% from the currently known phleboviruses. Any probable implication of these viruses to public health remains to be elucidated.

  12. A list of the 70 species of Australian ticks; diagnostic guides to and species accounts of Ixodes holocyclus (paralysis tick), Ixodes cornuatus (southern paralysis tick) and Rhipicephalus australis (Australian cattle tick); and consideration of the place of Australia in the evolution of ticks with comments on four controversial ideas.

    PubMed

    Barker, Stephen C; Walker, Alan R; Campelo, Dayana

    2014-10-15

    Seventy species of ticks are known from Australia: 14 soft ticks (family Argasidae) and 56 hard ticks (family Ixodidae). Sixteen of the 70 ticks in Australia may feed on humans and domestic animals (Barker and Walker 2014). The other 54 species of ticks in Australia feed only on wild mammals, reptiles and birds. At least 12 of the species of ticks in Australian also occur in Papua New Guinea. We use an image-matching system much like the image-matching systems of field guides to birds and flowers to identify Ixodes holocyclus (paralysis tick), Ixodes cornuatus (southern paralysis tick) and Rhipicephalus (Boophilus) australis (Australian cattle tick). Our species accounts have reviews of the literature on I. holocyclus (paralysis tick) from the first paper on the biology of an Australian tick by Bancroft (1884), on paralysis of dogs by I. holocyclus, to papers published recently, and of I. cornuatus (southern paralysis tick) and Rhipicephalus (Boophilus) australis (Australian cattle tick). We comment on four controversial questions in the evolutionary biology of ticks: (i) were labyrinthodont amphibians in Australia in the Devonian the first hosts of soft, hard and nuttalliellid ticks?; (ii) are the nuttalliellid ticks the sister-group to the hard ticks or the soft ticks?; (iii) is Nuttalliella namaqua the missing link between the soft and hard ticks?; and (iv) the evidence for a lineage of large bodied parasitiform mites (ticks plus the holothyrid mites plus the opiliocarid mites).

  13. Different tick-borne encephalitis virus (TBEV) prevalences in unfed versus partially engorged ixodid ticks--evidence of virus replication and changes in tick behavior.

    PubMed

    Belova, Oxana A; Burenkova, Ludmila A; Karganova, Galina G

    2012-09-01

    There is some evidence that tick-borne encephalitis virus (TBEV) prevalence in ticks, removed from humans, is higher than that in field-collected ticks from the same area. There are two possible explanations: (i) Infected ticks are more active and aggressive and can be found on humans more often. (ii) Some questing ticks are infected with TBEV in a low, undetectable concentration; during tick feeding, virus replicates and reaches the titers that can be detected. The aim of our work was to evaluate both hypotheses. Using unfed adult Ixodes ricinus, we compared three methods of tick infection with TBEV: (i) injection of the virus under the tick's 4th coxa (percoxal method), (ii) injection through anus (rectal method), and (iii) immersion of ticks in virus-containing medium. The percoxal method showed the best results and was used in further experiments. We compared the dynamics of virus reproduction in ticks that remain unfed after inoculation and in partially engorged ticks fed on mice. When ticks fed for 15 h, the titer of the virus increased in 3 log(10)PFU/tick since inoculation, while in unfed ticks it did not change. We also studied the reaction on the repellent DEET of uninfected versus TBEV-infected Ixodes ricinus ticks of the physiological age levels III and IV. We investigated ticks movements upwards in the direction of the bait on the cotton tape, impregnated with an increasing concentration of DEET. Obtained data showed that infected ticks were more active and tolerant to DEET. About 70% of the non-infected ticks and only 13% of the infected ticks did not get over the lowest concentration of the repellent (0.1%). Only infected ticks (5.6%) got over 1% concentration of DEET. Ticks of the physiological age level IV from both infected and uninfected groups were the most active and tolerant to the repellent. Both above-mentioned hypotheses were approved and can be used to explain higher virus prevalences in partially engorged ticks than in field

  14. Coendangered hard-ticks: threatened or threatening?

    PubMed Central

    2011-01-01

    The overwhelming majority of animal conservation projects are focused on vertebrates, despite most of the species on Earth being invertebrates. Estimates state that about half of all named species of invertebrates are parasitic in at least one stage of their development. The dilemma of viewing parasites as biodiversity or pest has been discussed by several authors. However, ticks were omitted. The latest taxonomic synopses of non-fossil Ixodidae consider valid 700 species. Though, how many of them are still extant is almost impossible to tell, as many of them are known only from type specimens in museums and were never collected since their original description. Moreover, many hosts are endangered and as part of conservation efforts of threatened vertebrates, a common practice is the removal of, and treatment for external parasites, with devastating impact on tick populations. There are several known cases when the host became extinct with subsequent coextinction of their ectoparasites. For our synoptic approach we have used the IUCN status of the host in order to evaluate the status of specifically associated hard-ticks. As a result, we propose a number of 63 coendangered and one extinct hard-tick species. On the other side of the coin, the most important issue regarding tick-host associations is vectorial transmission of microbial pathogens (i.e. viruses, bacteria, protozoans). Tick-borne diseases of threatened vertebrates are sometimes fatal to their hosts. Mortality associated with pathogens acquired from ticks has been documented in several cases, mostly after translocations. Are ticks a real threat to their coendangered host and should they be eliminated? Up to date, there are no reliable proofs that ticks listed by us as coendangered are competent vectors for pathogens of endangered animals. PMID:21554736

  15. Host specialization in ticks and transmission of tick-borne diseases: a review.

    PubMed

    McCoy, Karen D; Léger, Elsa; Dietrich, Muriel

    2013-01-01

    Determining patterns of host use, and the frequency at which these patterns change, are of key importance if we are to understand tick population dynamics, the evolution of tick biodiversity, and the circulation and evolution of associated pathogens. The question of whether ticks are typically host specialists or host generalists has been subject to much debate over the last half-century. Indeed, early research proposed that morphological diversity in ticks was linked to host specific adaptations and that most ticks were specialists. Later work disputed this idea and suggested that ticks are largely limited by biogeographic conditions and tend to use all locally available host species. The work presented in this review suggests that the actual answer likely lies somewhere between these two extremes. Although recent observational studies support the view that phylogenetically diverse host species share ticks when found on similar ecological ranges, theory on host range evolution predicts that host specialization should evolve in ticks given their life history characteristics. Contemporary work employing population genetic tools to examine host-associated population structure in several tick systems support this prediction and show that simple species records are not enough to determine whether a parasite is a true host generalist; host specialization does evolve in ticks at local scales, but may not always lead to speciation. Ticks therefore seem to follow a pattern of being global generalists, local specialists. Given this, the notion of host range needs to be modified from an evolutionary perspective, where one simply counts the number of hosts used across the geographic distribution, to a more ecological view, where one considers host use at a local scale, if we are to better understand the circulation of tick-borne pathogens and exposure risks for humans and livestock.

  16. Host specialization in ticks and transmission of tick-borne diseases: a review

    PubMed Central

    McCoy, Karen D.; Léger, Elsa; Dietrich, Muriel

    2013-01-01

    Determining patterns of host use, and the frequency at which these patterns change, are of key importance if we are to understand tick population dynamics, the evolution of tick biodiversity, and the circulation and evolution of associated pathogens. The question of whether ticks are typically host specialists or host generalists has been subject to much debate over the last half-century. Indeed, early research proposed that morphological diversity in ticks was linked to host specific adaptations and that most ticks were specialists. Later work disputed this idea and suggested that ticks are largely limited by biogeographic conditions and tend to use all locally available host species. The work presented in this review suggests that the actual answer likely lies somewhere between these two extremes. Although recent observational studies support the view that phylogenetically diverse host species share ticks when found on similar ecological ranges, theory on host range evolution predicts that host specialization should evolve in ticks given their life history characteristics. Contemporary work employing population genetic tools to examine host-associated population structure in several tick systems support this prediction and show that simple species records are not enough to determine whether a parasite is a true host generalist; host specialization does evolve in ticks at local scales, but may not always lead to speciation. Ticks therefore seem to follow a pattern of being global generalists, local specialists. Given this, the notion of host range needs to be modified from an evolutionary perspective, where one simply counts the number of hosts used across the geographic distribution, to a more ecological view, where one considers host use at a local scale, if we are to better understand the circulation of tick-borne pathogens and exposure risks for humans and livestock. PMID:24109592

  17. Tick infestation in birds and prevalence of pathogens in ticks collected from different places in Germany.

    PubMed

    Klaus, Christine; Gethmann, Jörn; Hoffmann, Bernd; Ziegler, Ute; Heller, Martin; Beer, Martin

    2016-07-01

    The importance of ticks and tick-borne pathogens for human and animal health has been increasing over the past decades. For their transportation and dissemination, birds may play a more important role than wingless hosts. In this study, tick infestation of birds in Germany was examined. Eight hundred ninety-two captured birds were infested with ticks and belonged to 48 different species, of which blackbirds (Turdus merula) and song thrushes (Turdus philomelos) were most strongly infested. Ground feeders were more strongly infested than non-ground feeders, sedentary birds more strongly than migratory birds, and short-distance migratory birds more strongly than long-distance migratory birds. Mean tick infestation per bird ranged between 2 (long-distance migratory bird) and 4.7 (sedentary bird), in some single cases up to 55 ticks per bird were found. With the exception of three nymphs of Haemaphysalis spp., all ticks belonged to Ixodes spp., the most frequently detected tick species was Ixodes ricinus. Birds were mostly infested by nymphs (65.1 %), followed by larvae (32.96 %). Additionally, ticks collected from birds were examined for several pathogens: Tick-borne encephalitis virus (TBEV) and Sindbisvirus with real-time RT-PCR, Flaviviruses, Simbuviruses and Lyssaviruses with broad-range standard RT-PCR-assays, and Borrelia spp. with a Pan-Borrelia real-time PCR. Interestingly, no viral pathogens could be detected, but Borrelia spp. positive ticks were collected from 76 birds. Borrelia (B.) garinii, B. valaisiaina, B. burgdorferi s.s. and B. afzelii were determined. The screening of ticks and birds for viral pathogens with broad range PCR-assays was tested and the use as an "early warning system" is discussed.

  18. Tick-borne pathogens in ticks collected from breeding and migratory birds in Switzerland.

    PubMed

    Lommano, Elena; Dvořák, Charles; Vallotton, Laurent; Jenni, Lukas; Gern, Lise

    2014-10-01

    From 2007 to 2010, 4558 migrating and breeding birds of 71 species were caught and examined for ticks in Switzerland. A total of 1205 specimens were collected; all were Ixodes ricinus ticks except one Ixodes frontalis female, which was found on a common chaffinch (Fringilla coelebs) for the first time in Switzerland. Each tick was analysed individually for the presence of Borrelia spp., Rickettsia spp., Anaplasma phagocytophilum and tick-borne encephalitis virus (TBEV). Altogether, 11.4% of birds (22 species) were infested by ticks and 39.8% of them (15 species) were carrying infected ticks. Bird species belonging to the genus Turdus were the most frequently infested with ticks and they were also carrying the most frequently infected ticks. Each tick-borne pathogen for which we tested was identified within the sample of bird-feeding ticks: Borrelia spp. (19.5%) and Rickettsia helvetica (10.5%) were predominantly detected whereas A. phagocytophilum (2%), Rickettsia monacensis (0.4%) and TBEV (0.2%) were only sporadically detected. Among Borrelia infections, B. garinii and B. valaisiana were largely predominant followed by B. afzelii, B. bavariensis, B. miyamotoi and B. burgdorferi ss. Interestingly, Candidatus Neoehrlichia mikurensis was identified in a few ticks (3.3%), mainly from chaffinches. Our study emphasizes the role of birds in the natural cycle of tick-borne pathogens that are of human medical and veterinary relevance in Europe. According to infection detected in larvae feeding on birds we implicate the common blackbird (Turdus merula) and the tree pipit (Anthus trivialis) as reservoir hosts for Borrelia spp., Rickettsia spp. and A. phagocytophilum.

  19. Species, developmental stage and infection with microbial pathogens of engorged ticks removed from dogs and questing ticks.

    PubMed

    Leschnik, M W; Khanakah, G; Duscher, G; Wille-Piazzai, W; Hörweg, C; Joachim, A; Stanek, G

    2012-12-01

    Research into tick-borne diseases implies vector sampling and the detection and identification of microbial pathogens. Ticks were collected simultaneously from dogs that had been exposed to tick bites and by flagging the ground in the area in which the dogs had been exposed. In total, 200 ticks were sampled, of which 104 came from dogs and 96 were collected by flagging. These ticks were subsequently examined for DNA of Borrelia burgdorferi sensu lato, Anaplasma phagocytophilum, Rickettsia spp. and Babesia canis. A mixed sample of adult ticks and nymphs of Ixodes ricinus (Ixodida: Ixodidae) and Haemaphysalis concinna (Ixodida: Ixodidae) was obtained by flagging. Female I. ricinus and adult Dermacentor reticulatus (Ixodida: Ixodidae) ticks dominated the engorged ticks removed from dogs. Rickettsia spp. were detected in 17.0% of the examined ticks, A. phagocytophilum in 3.5%, B. canis in 1.5%, and B. burgdorferi s.l. in 16.0%. Ticks with multiple infections were found only among the flagging sample. The ticks removed from the dogs included 22 infected ticks, whereas the flagging sample included 44 infected ticks. The results showed that the method for collecting ticks influences the species composition of the sample and enables the detection of a different pattern of pathogens. Sampling strategies should be taken into consideration when interpreting studies on tick-borne pathogens.

  20. Tick-borne encephalitis in the USSR*

    PubMed Central

    Graščenkov, N. I.

    1964-01-01

    The author gives the history of the study of tick-borne encephalitis in the USSR, following it up with a description of the etiological and epidemiological aspects and of the pathology, symptomology, diagnosis, treatment, and prevention of the disease. He stresses that other ticks as well as the main vectors of the virus, Ixodes, transmit the disease, in particular Dermacentor and Haemaphysalis. A detailed account of tick-borne encephalitis in the USSR may be of value in the study of the rather similar forms of the disease now being encountered more and more frequently in countries of South-East Asia as well as of northern and eastern Europe. PMID:14153408

  1. Integrated control of the southern cattle fever tick, Rhipicephalus (Boophilus) microplus, in Puerto Rico using new and alternative products

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Puerto Rico (PR) is plagued by the southern cattle fever tick (SCFT), Rhipicephalus microplus, which is considered the most economically important external parasite of livestock worldwide. A research coalition involving the livestock industry in PR, the PR Department of Agriculture (PR-DA), and the...

  2. Transmission of tick-borne pathogens between co-feeding ticks: Milan Labuda's enduring paradigm.

    PubMed

    Randolph, Sarah E

    2011-12-01

    During the 1990s, Milan Labuda's experimental results established a new paradigm for the study of tick-borne viruses that has since been strengthened by its demonstrated effectiveness in explaining the epidemiology of tick-borne encephalitis (TBE). This brief review summarizes the essential features of the transmission of tick-borne pathogens such as TBE virus. Leukocytes migrate between tick feeding sites, bearing infective virions and providing a transport route for the virus between co-feeding ticks independent of a systemic viraemia. Such tick-borne pathogens are thus transmitted from tick to tick via vertebrates; the ticks are the reservoirs as well as the vectors, while the vertebrate is the transient bridge. The aim is to bring the related but non-synonymous terms (co-feeding and non-systemic) to the attention of workers who use simple PCR screening to identify additional vertebrate reservoir hosts of vector-borne pathogens that are not in fact maintained in nature through systemic transmission.

  3. Prevalence of tick-borne pathogens in ticks collected from migratory birds in Latvia.

    PubMed

    Capligina, Valentina; Salmane, Ineta; Keišs, Oskars; Vilks, Karlis; Japina, Kristine; Baumanis, Viesturs; Ranka, Renate

    2014-02-01

    Migratory birds act as hosts and long-distance vectors for several tick-borne infectious agents. Here, feeding Ixodes ticks were collected from migratory birds during the autumn migration period in Latvia and screened for the presence of epidemiologically important non-viral pathogens. A total of 93 DNA samples of ticks (37 larvae and 56 nymphs) removed from 41 birds (order Passeriformes, 9 species) was tested for Lyme borreliosis spirochaetes, Anaplasma phagocytophilum, Rickettsia spp., and Babesia spp. Borrelia burgdorferi DNA was detected in 18% of the tick samples, and a majority of infected ticks were from thrush (Turdus spp.) birds. Among the infected ticks, Borrelia valaisiana was detected in 41% of cases, Borrelia garinii in 35%, and mixed Bo. valaisiana and Bo. garinii infection in 24%. Anaplasma phagocytophilum DNA was detected in 2% of ticks, R. helvetica in 12%, and Babesia spp. pathogens in 4% of ticks. Among these samples, 3 Babesia species were identified: Ba. divergens, Ba. microti, and Ba. venatorum. Coinfection with different pathogens that included mixed infections with different Borrelia genospecies was found in 20% of nymphal and 3% of larval Ixodes ticks. These results suggest that migratory birds may support the circulation and spread of medically significant zoonoses in Europe.

  4. 7 CFR 15a.7 - Designation of responsible employee and adoption of grievance procedures.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Designation of responsible employee and adoption of grievance procedures. 15a.7 Section 15a.7 Agriculture Office of the Secretary of Agriculture EDUCATION... Designation of responsible employee and adoption of grievance procedures. (a) Designation of...

  5. Problem of ticks and tick-borne diseases in India with special emphasis on progress in tick control research: a review.

    PubMed

    Ghosh, Srikant; Nagar, Gaurav

    2014-12-01

    Ticks, as vectors of several zoonotic diseases, are ranked second only to mosquitoes as vectors. The diseases spread by ticks are a major constraint to animal productivity while causing morbidity and mortality in both animals and humans. A number of tick species have been recognised since long as vectors of lethal pathogens, viz. Crimean-Congo haemorrhagic fever virus (CCHFV), Kyasanur forest disease virus (KFDV), Babesia spp, Theileria, Rickettsia conorii, Anaplasma marginale, etc. and the damages caused by them are well-recognised. There is a need to reassess the renewed threat posed by the tick vectors and to prioritize the tick control research programme. This review is focused on the major tick-borne human and animal diseases in India and the progress in vector control research with emphasis on acaricide resistance, tick vaccine and the development of potential phytoacaricides as an integral part of integrated tick control programme.

  6. [Behavioral therapy of ticks with negative reinforcement in children].

    PubMed

    Nabieva, T N; Mukhin, E I

    2003-01-01

    Thirty-two children suffering from motor and vocal ticks exhibited weakness and distonia of ticks-prone muscles were examined. Based on the results obtained earlier, a complex of physical exercises has been worked out and conducted for 20 days. The patients were divided into 3 groups: 1st (n = 10) group did the exercises daily for training the ticks-prone muscles; the 2nd one (n = 10) exercised only after tick's appearance--negative reinforcement; 3rd group (n = 12) did exercises after tick's appearance as well but on irregular basis--probable negative reinforcement. In the 1st group, the exercising resulted in muscle strengthening and decrease of tick's number. The patients of the 2nd group got rid of ticks for 20 days. The probable tick's reinforcement in children of the 3rd group did not change pathological muscle activity. The central mechanisms of cortical plasticity in behavioral therapy of ticks are discussed.

  7. Anti-tick biological control agents: assessment and future perspectives

    USGS Publications Warehouse

    Samish, M.; Ginsberg, H.S.; Glazer, I.; Bowman, Alan. S.; Nuttall, Patricia A.

    2008-01-01

    Widespread and increasing resistance to most available acaracides threatens both global livestock industries and public health. This necessitates better understanding of ticks and the diseases they transmit in the development of new control strategies. Ticks: Biology, Disease and Control is written by an international collection of experts and covers in-depth information on aspects of the biology of the ticks themselves, various veterinary and medical tick-borne pathogens, and aspects of traditional and potential new control methods. A valuable resource for graduate students, academic researchers and professionals, the book covers the whole gamut of ticks and tick-borne diseases from microsatellites to satellite imagery and from exploiting tick saliva for therapeutic drugs to developing drugs to control tick populations. It encompasses the variety of interconnected fields impinging on the economically important and biologically fascinating phenomenon of ticks, the diseases they transmit and methods of their control.

  8. Interaction of the tick immune system with transmitted pathogens

    PubMed Central

    Hajdušek, Ondřej; Šíma, Radek; Ayllón, Nieves; Jalovecká, Marie; Perner, Jan; de la Fuente, José; Kopáček, Petr

    2013-01-01

    Ticks are hematophagous arachnids transmitting a wide variety of pathogens including viruses, bacteria, and protozoans to their vertebrate hosts. The tick vector competence has to be intimately linked to the ability of transmitted pathogens to evade tick defense mechanisms encountered on their route through the tick body comprising midgut, hemolymph, salivary glands or ovaries. Tick innate immunity is, like in other invertebrates, based on an orchestrated action of humoral and cellular immune responses. The direct antimicrobial defense in ticks is accomplished by a variety of small molecules such as defensins, lysozymes or by tick-specific antimicrobial compounds such as microplusin/hebraein or 5.3-kDa family proteins. Phagocytosis of the invading microbes by tick hemocytes is likely mediated by the primordial complement-like system composed of thioester-containing proteins, fibrinogen-related lectins and convertase-like factors. Moreover, an important role in survival of the ingested microbes seems to be played by host proteins and redox balance maintenance in the tick midgut. Here, we summarize recent knowledge about the major components of tick immune system and focus on their interaction with the relevant tick-transmitted pathogens, represented by spirochetes (Borrelia), rickettsiae (Anaplasma), and protozoans (Babesia). Availability of the tick genomic database and feasibility of functional genomics based on RNA interference greatly contribute to the understanding of molecular and cellular interplay at the tick-pathogen interface and may provide new targets for blocking the transmission of tick pathogens. PMID:23875177

  9. Ticks and Tick Bites Presenting as “Funny Moles”: A Review of Different Presentations and a Focus on Tick-borne Diseases

    PubMed Central

    Kallini, Joseph R.

    2017-01-01

    Purpose: To describe a man with an adherent tick mimicking a melanoma, summarize the salient features of this condition, and review other cases of ticks mistaken for dermatoses. Background: Ticks are obligatory ectoparasites. Disease-causing ticks belong to two families: Ixodidae (hard ticks) and Argasidae (soft ticks). Ticks thrive by consuming blood from animal hosts, and the transfer of infected blood from one host to the next is the method by which ticks spread disease. Materials and methods: The authors describe a man who presented to their dermatology clinic in New York with an unusual black pigmented lesion on the right zygomatic region of his face. He was worried about how rapidly the lesion had developed and the tingling of the skin surrounding it. Since the patient had a history of nonmelanoma skin cancer, he was concerned that the lesion was a melanoma. An excisional biopsy of the lesion revealed a non-Ixodes tick with a surrounding tick-bite reaction. Results: Ticks cause cutaneous manifestations through physical trauma and their salivary contents. A number of reports describe a similar phenomenon of a persistent tick being mistaken for a nodule or tumor. Management includes complete removal of a tick, either mechanically or surgically, along with the appropriate work-up for tick-borne diseases in the relevant geographic location. The decision to test for systemic disease depends on the clinical presentation of the patient and geographic location of the tick bite. Conclusion: A patient presented to the authors’ dermatology clinic with a pigmented lesion suspicious for a melanoma, but the lesion was actually an adherent non-Ixodes tick. This case illustrates the importance of keeping insects and arthropods in the differential diagnosis of a sudden- and recent-onset pigmented skin lesion. PMID:28360969

  10. 20 CFR 404.1095 - Agricultural trade or business.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 20 Employees' Benefits 2 2012-04-01 2012-04-01 false Agricultural trade or business. 404.1095... Income § 404.1095 Agricultural trade or business. (a) An agricultural trade or business is one in which, if the trade or business were carried on entirely by employees, the major portion of the...

  11. 20 CFR 404.1095 - Agricultural trade or business.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Agricultural trade or business. 404.1095... Income § 404.1095 Agricultural trade or business. (a) An agricultural trade or business is one in which, if the trade or business were carried on entirely by employees, the major portion of the...

  12. Determinants of employee punctuality.

    PubMed

    Dishon-Berkovits, Miriam; Koslowsky, Meni

    2002-12-01

    Although researchers have studied employee lateness empirically (e.g., S. Adler & J. Golan, 1981; C. W. Clegg, 1983), few have attempted to describe the punctual employee. In the present study, results of a discriminant analysis on employees in Israel indicated that a personality characteristic, time urgency, a subcomponent of Type A behavioral pattern, distinguished between punctual and late employees. Organizational commitment and age of employee's youngest child also distinguished between the groups.

  13. Molecular Ecological Insights into Neotropical Bird-Tick Interactions.

    PubMed

    Miller, Matthew J; Esser, Helen J; Loaiza, Jose R; Herre, Edward Allen; Aguilar, Celestino; Quintero, Diomedes; Alvarez, Eric; Bermingham, Eldredge

    2016-01-01

    In the tropics, ticks parasitize many classes of vertebrate hosts. However, because many tropical tick species are only identifiable in the adult stage, and these adults usually parasitize mammals, most attention on the ecology of tick-host interactions has focused on mammalian hosts. In contrast, immature Neotropical ticks are often found on wild birds, yet difficulties in identifying immatures hinder studies of birds' role in tropical tick ecology and tick-borne disease transmission. In Panama, we found immature ticks on 227 out of 3,498 individually-sampled birds representing 93 host species (24% of the bird species sampled, and 13% of the Panamanian land bird fauna). Tick parasitism rates did not vary with rainfall or temperature, but did vary significantly with several host ecological traits. Likewise, Neotropical-Nearctic migratory birds were significantly less likely to be infested than resident species. Using a molecular library developed from morphologically-identified adult ticks specifically for this study, we identified eleven tick species parasitizing birds, indicating that a substantial portion of the Panamanian avian species pool is parasitized by a diversity of tick species. Tick species that most commonly parasitized birds had the widest diversity of avian hosts, suggesting that immature tick species are opportunistic bird parasites. Although certain avian ecological traits are positively associated with parasitism, we found no evidence that individual tick species show specificity to particular avian host ecological traits. Finally, our data suggest that the four principal vectors of Rocky Mountain Spotted Fever in the Neotropics rarely, if ever, parasitize Panamanian birds. However, other tick species that harbor newly-discovered rickettsial parasites of unknown pathogenicity are frequently found on these birds. Given our discovery of broad interaction between Panamanian tick and avian biodiversity, future work on tick ecology and the dynamics of

  14. Molecular Ecological Insights into Neotropical Bird–Tick Interactions

    PubMed Central

    Esser, Helen J.; Loaiza, Jose R.; Herre, Edward Allen; Aguilar, Celestino; Quintero, Diomedes; Alvarez, Eric; Bermingham, Eldredge

    2016-01-01

    In the tropics, ticks parasitize many classes of vertebrate hosts. However, because many tropical tick species are only identifiable in the adult stage, and these adults usually parasitize mammals, most attention on the ecology of tick-host interactions has focused on mammalian hosts. In contrast, immature Neotropical ticks are often found on wild birds, yet difficulties in identifying immatures hinder studies of birds’ role in tropical tick ecology and tick-borne disease transmission. In Panama, we found immature ticks on 227 out of 3,498 individually–sampled birds representing 93 host species (24% of the bird species sampled, and 13% of the Panamanian land bird fauna). Tick parasitism rates did not vary with rainfall or temperature, but did vary significantly with several host ecological traits. Likewise, Neotropical–Nearctic migratory birds were significantly less likely to be infested than resident species. Using a molecular library developed from morphologically–identified adult ticks specifically for this study, we identified eleven tick species parasitizing birds, indicating that a substantial portion of the Panamanian avian species pool is parasitized by a diversity of tick species. Tick species that most commonly parasitized birds had the widest diversity of avian hosts, suggesting that immature tick species are opportunistic bird parasites. Although certain avian ecological traits are positively associated with parasitism, we found no evidence that individual tick species show specificity to particular avian host ecological traits. Finally, our data suggest that the four principal vectors of Rocky Mountain Spotted Fever in the Neotropics rarely, if ever, parasitize Panamanian birds. However, other tick species that harbor newly–discovered rickettsial parasites of unknown pathogenicity are frequently found on these birds. Given our discovery of broad interaction between Panamanian tick and avian biodiversity, future work on tick ecology and the

  15. Tick control: trapping, biocontrol, host management and other alternative strategies

    USGS Publications Warehouse

    Ginsberg, Howard S.; Edited by Sonenshine, Daniel E.; Roe, R. Michael

    2014-01-01

    Biology of Ticks is the most comprehensive work on tick biology and tick-borne diseases. This second edition is a multi-authored work, featuring the research and analyses of renowned experts across the globe. Spanning two volumes, the book examines the systematics, biology, structure, ecological adaptations, evolution, genomics and the molecular processes that underpin the growth, development and survival of these important disease-transmitting parasites. Also discussed is the remarkable array of diseases transmitted (or caused) by ticks, as well as modern methods for their control. This book should serve as a modern reference for students, scientists, physicians, veterinarians and other specialists. Volume I covers the biology of the tick and features chapters on tick systematics, tick life cycles, external and internal anatomy, and others dedicated to specific organ systems, specifically, the tick integument, mouthparts and digestive system, salivary glands, waste removal, salivary glands, respiratory system, circulatory system and hemolymph, fat body, the nervous and sensory systems and reproductive systems. Volume II includes chapters on the ecology of non-nidicolous and nidicolous ticks, genetics and genomics (including the genome of the Lyme disease vector Ixodes scapularis) and immunity, including host immune responses to tick feeding and tick-host interactions, as well as the tick's innate immune system that prevents and/or controls microbial infections. Six chapters cover in depth the many diseases caused by the major tick-borne pathogens, including tick-borne protozoa, viruses, rickettsiae of all types, other types of bacteria (e.g., the Lyme disease agent) and diseases related to tick paralytic agents and toxins. The remaining chapters are devoted to tick control using vaccines, acaricides, repellents, biocontrol, and, finally, techniques for breeding ticks in order to develop tick colonies for scientific study.

  16. Tick Bite Alopecia: A Report and Review.

    PubMed

    Lynch, Michael C; Milchak, Marissa A; Parnes, Herbert; Ioffreda, Michael D

    2016-11-01

    Tick bites can cause a number of local inflammatory reactions, which are often difficult to differentiate from those induced by other arthropod bites or stings. These include erythematous nodular or pustular lesions, erosive plaques, annular lesions of erythema chronicum migrans, and both scarring and nonscarring inflammatory alopecia. We report a case of nonscarring alopecia in a 21-year-old male who reported a recent history of tick bite to the scalp. The biopsy demonstrated a dense pseudolymphomatous inflammatory infiltrate with numerous eosinophils associated with hair follicle miniaturization and an elevated catagen-telogen count. Signs of external rubbing, including lichen simplex chronicus and the "hamburger sign", were also visualized and are indicative of the associated pruritus. To the authors' knowledge, this is the fifth report of nonscarring tick bite alopecia in the literature and the first in an adult patient. This text will review the classic clinical presentation, histologic findings, and proposed mechanism of tick bite alopecia.

  17. Metarhizium anisopliae conidial responses to lipids from tick cuticle and tick mammalian host surface.

    PubMed

    Ment, Dana; Gindin, Galina; Soroker, Victoria; Glazer, Itamar; Rot, Asael; Samish, Michael

    2010-02-01

    Conidial germination and the formation of appressoria are important events in the interactions between entomopathogenic fungi and their arthropod hosts. In this study, we demonstrate the effects of lipids extracted from tick epicuticle and the surface of a mammalian host (calf) on conidial germination and the development of appressoria in two subspecies of Metarhizium anisopliae, M. anisopliae var. anisopliae (M.an.an.-7) and M. anisopliae var. acridum (M.an.ac.-5), which have different levels of virulence toward ticks. Pentane extracts of epicuticles of ticks susceptible and resistant to fungal infection always stimulated the germination of M.an.an.-7 conidia and the development of their appressoria; whereas the effects of dichloromethane (DCM) extracts of tick epicuticle varied depending on the tick. The DCM extracts from most of the tick species and developmental stages stimulated conidial germination and/or the formation of appressoria in M.an.an.-7. However, a DCM extract of lipids from the most resistant tick, engorged Hyalomma excavatum female, inhibited the germination of M.an.an.-7 conidia. Conidia of the non-virulent M.an.ac.-5 did not germinate on agarose amended with any of the examined tick extracts. However, when the tick extracts were placed on bactoagar, conidial germination increased 7- to 8-fold. Extracts from the skin, hair and ear secretions of a calf stimulated conidial germination and the formation of appressoria in M.an.an.-7, but not M.an.ac.-5. This study demonstrates that lipids from tick epicuticles and mammalian skin selectively affect the germination of conidia of entomopathogenic fungi. The effects of these lipids may explain the variability in tick control these fungi provide for different hosts.

  18. Scouts, forests, and ticks: Impact of landscapes on human-tick contacts.

    PubMed

    De Keukeleire, Mathilde; Vanwambeke, Sophie O; Somassè, Elysée; Kabamba, Benoît; Luyasu, Victor; Robert, Annie

    2015-07-01

    Just as with forest workers or people practicing outdoor recreational activities, scouts are at high risk for tick bites and tick-borne infections. The risk of a tick bite is shaped not only by environmental and climatic factors but also by land management. The aim of this study was to assess which environmental conditions favour scout-tick contacts, and thus to better understand how these factors and their interactions influence the two components of risk: hazard (related to vector and host ecology) and exposure of humans to disease vectors. A survey was conducted in the summer of 2009 on the incidence of tick bites in scout camps taking place in southern Belgium. Joint effects of landscape composition and configuration, weather, climate, forest and wildlife management were examined using a multiple gamma regression with a log link. The landscape was characterized by buffers of varying sizes around the camps using a detailed land use map, and accounting for climate and weather variables. Landscape composition and configuration had a significant influence on scout-tick contacts: the risk was high when the camp was surrounded by a low proportion of arable land and situated in a complex and fragmented landscape. The distance to the nearest forest patch, the composition of the forest ecotone as well as weather and climatic factors were all significantly associated with scout-tick contacts. Both hazard- and exposure-related variables significantly contributed to the frequency of scout-tick contact. Our results show that environmental conditions favour scout-tick contacts. For example, we emphasize the impact of accessibility of environments suitable for ticks on the risk of contact. We also highlight the significant effect of both hazard and exposure. Our results are consistent with current knowledge, but further investigations on the effect of forest management, e.g. through its impact on forest structure, on the tick-host-pathogen system, and on humans exposure, is

  19. Wild birds and urban ecology of ticks and tick-borne pathogens, Chicago, Illinois, USA, 2005-2010.

    PubMed

    Hamer, Sarah A; Goldberg, Tony L; Kitron, Uriel D; Brawn, Jeffrey D; Anderson, Tavis K; Loss, Scott R; Walker, Edward D; Hamer, Gabriel L

    2012-10-01

    Bird-facilitated introduction of ticks and associated pathogens is postulated to promote invasion of tick-borne zoonotic diseases into urban areas. Results of a longitudinal study conducted in suburban Chicago, Illinois, USA, during 2005-2010 show that 1.6% of 6,180 wild birds captured in mist nets harbored ticks. Tick species in order of abundance were Haemaphysalis leporispalustris, Ixodes dentatus, and I. scapularis, but 2 neotropical tick species of the genus Amblyomma were sampled during the spring migration. I. scapularis ticks were absent at the beginning of the study but constituted the majority of ticks by study end and were found predominantly on birds captured in areas designated as urban green spaces. Of 120 ticks, 5 were infected with Borrelia burgdorferi, spanning 3 ribotypes, but none were infected with Anaplasma phagocytophilum. Results allow inferences about propagule pressure for introduction of tick-borne diseases and emphasize the large sample sizes required to estimate this pressure.

  20. Ticks imported to Europe with exotic reptiles.

    PubMed

    Mihalca, Andrei Daniel

    2015-09-30

    It is known that traded exotic animals carry with them an immense number of associated symbionts, including parasites. Reptiles are no exception. Most of the imported reptiles originate from tropical countries and their possibility to carry potentially dangerous pathogens is high. According to CITES, Europe is currently the main reptile importer in the world. Despite this, there is no review or analysis available for the risk related to the importation of tick-borne diseases with traded reptile to the EU. The main aim of the manuscript is to provide a review on the available literature on ticks introduced to and exchanged between European countries via the live reptile trade. So far, the published reports of ticks imported on reptiles are limited to few European countries: Italy, Poland, Spain, Netherlands, Belgium, Slovenia and UK. The following species have been reported: Hyalomma aegyptium, Amblyomma dissimile, Amblyomma exornatum, Amblyomma flavomaculatum, Amblyomma fuscolineatum, Amblyomma latum, Amblyomma quadricavum, Amblyomma marmoreum, Amblyomma nuttalli, Amblyomma sparsum, Amblyomma sphenodonti, Amblyomma transversale and Amblyomma varanense. The majority of species are of African origin, followed by American and Asian species. All groups of reptiles (chelonians, snakes, lizards, crocodiles, tuataras) were involved. However, it seems that certain groups (i.e. tortoises of genus Testudo, monitor lizards of genus Varanus, snakes of genus Python) are more important as host for imported ticks, but this may be related to higher levels of international trade. Even fewer are the reports of tick-borne pathogens associated with imported reptile ticks. Despite the diversity of tick species reported on imported reptiles, the situations of truly invasive species are atypical and are limited in natural environments to maximum two cases where H. aegyptium was involved. Otherwise, the risk associated with reptile trade for introduction of invasive tick to Europe is low

  1. Ecology of tick vectors of American spotted fever.

    PubMed

    Burgdorfer, W

    1969-01-01

    The author reviews the natural history of the tick vectors of American spotted fever. The discussion concerns the ecology of the Rocky Mountain wood tick, Dermacentor andersoni, the American dog tick, Dermacentor variabilis, and the lone-star tick, Amblyomma americanum, all of which are proven vectors of Rocky Mountain spotted fever to man. Also included are the rabbit tick, Haemaphysalis leporispalustris and Dermacentor parumapertus, which very rarely bite man but which are considered of importance in maintaining and distributing Rickettsia rickettsi, the etiological agent of Rocky Mountain spotted fever, in nature. Brief reference is also made to recently developed techniques for studying the ecology of tick vectors.

  2. Ticks as vectors: taxonomy, biology and ecology.

    PubMed

    Estrada-Peña, A

    2015-04-01

    Ticks are prominent parasites and competent vectors of pathogens that affect both humans and animals. This review outlines and illustrates the main features of the morphology of ticks of the families Ixodidae and Argasidae, and summarises the basic components of their life cycles. It focuses mainly on development processes and mortality among tick populations so as to provide an overview of how they are regulated in nature and how pathogens can be transmitted under such a framework. The effects of the weather on these life cycles are reviewed. The author also examines how landscape structure and biotic factors, such as the presence and abundance of hosts, may shape the density of tick populations. The uncertainty inherent in dealing with the transmission of pathogens by ticks is highlighted; this results from the sometimes complex relationships among the vectors, the climate and the presence and density of host populations. The need to obtain reliable field estimations of such relationships before drawing conclusions about the effects of the isolated components of the system is stressed. A section is devoted to addressing the expected (and not yet totally understood) effects of trends in climate on the spread of ticks, and how these can be analysed and tracked.

  3. Hard ticks (Acari, Ixodidae) of Croatia

    PubMed Central

    Krčmar, Stjepan

    2012-01-01

    Abstract The present paper is based on original and literature data. In Croatia the first studies on the occurrence of ixodid species were made about 80 years ago. The number of tick species recorded in Croatia considerably increased during the 1950s, 60s, 70s and 80s of the past century. A total of 21 species of hard tick belonging to 5 genera have been recorded in Croatia. Ixodes is the best represented genus, with seven species recorded. Haemaphysalis is represented by six species, followed by Rhipicephalus with four species. Dermacentor and Hyalomma are represented by two species each. The ticks were collected on 47 different host species. Eleven tick species were collected on Bos taurus and Ovis aries, followed by Capra hircus and Equus caballus with 8 species and Canis lupus familiaris with 6 species. On the remaining 42 host species one, two or three tick species were collected. The most widespread tick is Ixodes ricinus which was found on 25 different host species. PMID:23372407

  4. THE ROLE OF SALIVA IN TICK FEEDING

    PubMed Central

    Francischetti, Ivo M.B; Sá-Nunes, Anderson; Mans, Ben J.; Santos, Isabel M.; Ribeiro, José M.C.

    2009-01-01

    When attempting to feed on their hosts, ticks face the problem of host hemostasis (the vertebrate mechanisms that prevent blood loss), inflammation (that can produce itching or pain and thus initiate defensive behavior on their hosts) and immunity (by way of both cellular and humoral responses). Against these barriers, ticks evolved a complex and sophisticated pharmacological armamentarium, consisting of bioactive lipids and proteins, to assist blood feeding. Recent progress in transcriptome research has uncovered that hard ticks have hundreds of different proteins expressed in their salivary glands, the majority of which have no known function, and include many novel protein families (e.g., their primary structure is unique to ticks). This review will address the vertebrate mechanisms of these barriers as a guide to identify the possible targets of these large numbers of known salivary proteins with unknown function. We additionally provide a supplemental table that catalogues over 3,500 putative salivary proteins from various tick species, which might assist the scientific community in the process of functional identification of these unique proteins. This supplemental file is accessble from http://exon.niaid.nih.gov/transcriptome/tick_review/Sup-Table-1.xls.gz. PMID:19273185

  5. Tick control: thoughts on a research agenda.

    PubMed

    Willadsen, Peter

    2006-05-31

    Tick control is critical to the control of tick borne disease, while the direct impact of ticks on livestock productivity is also well known. For livestock, tick control today rests overwhelmingly on the twin approaches of genetics and chemical acaricides, although the disadvantages and limitations of both are recognized. The achievement of the full potential of vaccination, the application of biocontrol agents and the coordinated management of the existing technologies all pose challenging research problems. Progress in many areas has been steady over the last decade, while the acquisition of molecular information has now reached a revolutionary stage. This is likely to have immediate impact on the identification of potential antigens for improved vaccines and novel targets for acaricide action. In many circumstances, the rate limiting step in making scientific progress will remain unchanged, namely the resource constraint on evaluating these appropriately in large animals. For other approaches, such as the use of biocontrol agents, the limitation is likely to be less in the identification of suitable agents than in their delivery in an efficient and cost effective way. Our scientific understanding of the molecular basis for the tick vector-tick borne disease interaction is in its infancy but the area is both challenging and, in the long term, likely to be of great practical importance. What is arguably the most difficult problem of all remains: the translation of laboratory research into the extremely diverse parasite control requirements of farming systems in a way that is practically useful.

  6. Nomuraea rileyi as biological control agents of Rhipicephalus microplus tick.

    PubMed

    Perinotto, W M S; Terra, A L M; Angelo, I C; Fernandes, É K K; Golo, P S; Camargo, M G; Bittencourt, V R E P

    2012-10-01

    Nomuraea rileyi, a fungus pathogenic to insects, has been widely used for biological control of agricultural pests in Brazil. This study investigates the effects of N. rileyi, isolates Nr 138, Nr 151, and Nr 177, to eggs, larvae, and engorged females of Rhipicephalus microplus tick. Specimens were immersed in 1 ml of conidial suspension for 3 min, whereas the control group was immersed in 0.01% Tween 80 water solution. The isolate Nr 138 controlled 67.37% of ticks when the highest conidial concentration was used, 10(8) conidia ml(-1). The isolate Nr 177 significantly reduced the percentage of hatch of larvae from eggs treated with 10(8) conidia ml(-1). Conversely, the isolate Nr 151 was not virulent to eggs, larvae, or adults. Variability in virulence was observed among the N. rileyi isolates investigated in the current study-Nr 138 was more virulent to engorged females, while Nr 177 was more virulent to unfed larvae. Although N. rileyi proved to be virulent to several stages of R. microplus, the results obtained in this study indicate that N. rileyi does not appear to be a remarkable biological control agent for R. microplus.

  7. Advancing integrated tick management to mitigate burden of tick-borne diseases

    Technology Transfer Automated Retrieval System (TEKTRAN)

    More than half of the world’s population is at risk of exposure to vector-borne pathogens. Annually, more than 1 billion people are infected and more than 1 million die from vector-borne diseases, including those caused by pathogens transmitted by ticks. The problem with tick borne diseases (TBD) is...

  8. Diagnosis of Queensland tick typhus and African tick bite fever by PCR of lesion swabs.

    PubMed

    Wang, Jin Mei; Hudson, Bernard J; Watts, Matthew R; Karagiannis, Tom; Fisher, Noel J; Anderson, Catherine; Roffey, Paul

    2009-06-01

    We report 3 cases of Queensland tick typhus (QTT) and 1 case of African tick bite fever in which the causative rickettsiae were detected by PCR of eschar and skin lesions in all cases. An oral mucosal lesion in 1 QTT case was also positive.

  9. Effects of Climate Change on Ticks and Tick-Borne Diseases in Europe

    PubMed Central

    Gray, J. S.; Dautel, H.; Estrada-Peña, A.; Kahl, O.; Lindgren, E.

    2009-01-01

    Zoonotic tick-borne diseases are an increasing health burden in Europe and there is speculation that this is partly due to climate change affecting vector biology and disease transmission. Data on the vector tick Ixodes ricinus suggest that an extension of its northern and altitude range has been accompanied by an increased prevalence of tick-borne encephalitis. Climate change may also be partly responsible for the change in distribution of Dermacentor reticulatus. Increased winter activity of I. ricinus is probably due to warmer winters and a retrospective study suggests that hotter summers will change the dynamics and pattern of seasonal activity, resulting in the bulk of the tick population becoming active in the latter part of the year. Climate suitability models predict that eight important tick species are likely to establish more northern permanent populations in a climate-warming scenario. However, the complex ecology and epidemiology of such tick-borne diseases as Lyme borreliosis and tick-borne encephalitis make it difficult to implicate climate change as the main cause of their increasing prevalence. Climate change models are required that take account of the dynamic biological processes involved in vector abundance and pathogen transmission in order to predict future tick-borne disease scenarios. PMID:19277106

  10. Failure of ticks to transmit Scopulariopsis brevicaulis (Deuteromycota), a common filamentous fungal commensal of ticks.

    PubMed

    Yoder, Jay A; Benoit, Joshua B; Rellinger, Eric J; Telford, Sam R

    2005-05-01

    The capacity of ticks to transmit a fungus was examined by analyzing tick saliva, host tissue from feeding sites, and host blood for presence of Scopulariopsis brevicaulis (Sacc.) Bainier, an internal mycosymbiont of the American dog tick, Dermacentor variabilis (Say), and lone star tick, Amnblyomma americanum (L.). Although >85% of ticks were infected with S. brevicaulis, conidia presence was low (0-5% of samples) in microscopic observations and mycological culturing of saliva expressed from larvae, nymphs, and adults. Additionally, the recovery of S. brevicaulis from blood and tissue feeding sites from a rabbit where S. brevicaulis-positive adult ticks had attached and fed was not increased compared with control tissue where no feeding occurred, indicating that transmission does not occur by the blood-feeding route. Tick mouthparts were found to contain S. brevicaulis in addition to Penicillium glabrum (Wehmer) Westling, but these agents were sparse in isolations from the feeding sites, which makes it unlikely that ticks act frequently as a mechanical fungal vector.

  11. Endogenous tick viruses and modulation of tick-borne pathogen growth

    PubMed Central

    Bell-Sakyi, Lesley; Attoui, Houssam

    2013-01-01

    Ticks transmit a wide range of viral, bacterial and protozoan pathogens, many of which can establish persistent infections of lifelong duration in the vector tick and in some cases are transmitted transovarially to the next generation. In addition many ixodid and argasid tick cell lines and, by inference the parent ticks from which they were derived, harbor endogenous viruses (ETV) of which almost nothing is known. In general, low level persistent infections with viral pathogens (arboviruses) are not known to have a deleterious effect on tick survival and fitness, suggesting that they can strike a balance with the tick innate immune response. This tolerance of arbovirus infection may be modulated by the permanent presence of ETV in the host cell. In mosquito cells, temporary or permanent silencing of the genes of an endogenous virus by RNA interference can result in changes in replication rate of a co-infecting arbovirus. We propose that tick cell lines offer a useful model system for in vitro investigation of the modulatory effect of ETV on superinfecting pathogen survival and replication in ticks, using the molecular manipulation techniques applied to insect cells. PMID:23875176

  12. Ticks and tick-borne pathogens in wild birds in Greece.

    PubMed

    Diakou, Anastasia; Norte, Ana Cláudia; Lopes de Carvalho, Isabel; Núncio, Sofia; Nováková, Markéta; Kautman, Matej; Alivizatos, Haralambos; Kazantzidis, Savas; Sychra, Oldřich; Literák, Ivan

    2016-05-01

    Wild birds are common hosts of ticks and can transport them for long distances, contributing to the spreading of tick-borne pathogens. The information about ticks on birds and tick-borne pathogens in Greece is limited. The present study aimed to evaluate the prevalence and species of ticks infesting wild resident birds (mostly small passerines) in Greece, and to assess Borrelia and Rickettsia infection in the collected ticks. Detection of Borrelia burgdorferi s.l. was performed by nested PCR targeting the flaB gene. Rickettsia spp. were detected by PCR targeting the gltA and ompA genes. Seven (2 %) out of 403 birds examined in northern Greece in 2013 were infested with 15 ticks, identified as Ixodes frontalis, Ixodes acuminatus, Hyalomma marginatum, Hyalomma aegyptium and Hyalomma sp. All ticks were negative for Borrelia spp. while four of them were positive for rickettsiae (Rickettsia aeschlimannii in H. aegyptium and Rickettsia sp. in I. frontalis, H. aegyptium and H. marginatum). Ixodes acuminatus is reported for the first time in Greece and Sylvia borin is reported as a new host record for I. acuminatus.

  13. Ticks

    MedlinePlus

    ... Diagnosis and Management of Tickborne Rickettsial Diseases: Rocky Mountain Spotted Fever and Other Spotted Fever Group Rickettsioses, ... tickborne diseases Anaplasmosis Babesiosis Ehrlichiosis Lyme disease Rocky Mountain spotted fever Other tickborne diseases CDC Expert Commentary ...

  14. Prevention and control strategies for ticks and pathogen transmission.

    PubMed

    de La Fuente, J; Kocan, K M; Contreras, M

    2015-04-01

    Ticks and tick-borne pathogens have evolved together, resulting in a complex relationship in which the pathogen's life cycle is perfectly coordinated with the tick's feeding cycle, and the tick can harbour high pathogen levels without affecting its biology. Tick-borne diseases (TBDs) continue to emerge and/or spread, and pose an increasing threatto human and animal health. The disruptive impacts of global change have resulted in ecosystem instability and the future outcomes of management and control programmes for ticks and TBDs are difficult to predict. In particular, the selection of acaricide-resistant ticks has reduced the value of acaricides as a sole means of tick control. Vaccines provide an alternative control method, but the use of tick vaccines has not advanced since the first vaccines were registered in the early 1990s. An understanding of the complex molecular relationship between hosts, ticks and pathogens and the use of systems biology and vaccinomics approaches are needed to discover proteins with the relevant biological function in tick feeding, reproduction, development, immune response, the subversion of host immunity and pathogen transmission, all of which mediate tick and pathogen success. The same approaches will also be required to characterise candidate protective antigens and to validate vaccine formulations. Tick vaccines with a dual effect on tick infestations and pathogen transmission could reduce both tick infestations and their vector capacity for humans, animals and reservoir hosts. The development of integrated tick control strategies, including vaccines and synthetic and botanical acaricides, in combination with managing drug resistance and educating producers, should lead to the sustainable control of ticks and TBDs.

  15. Distribution pattern and number of ticks on lizards.

    PubMed

    Dudek, Krzysztof; Skórka, Piotr; Sajkowska, Zofia Anna; Ekner-Grzyb, Anna; Dudek, Monika; Tryjanowski, Piotr

    2016-02-01

    The success of ectoparasites depends primarily on the site of attachment and body condition of their hosts. Ticks usually tend to aggregate on vertebrate hosts in specific areas, but the distribution pattern may depend on host body size and condition, sex, life stage or skin morphology. Here, we studied the distribution of ticks on lizards and tested the following hypothesis: occurrence or high abundance of ticks is confined with body parts with smaller scales and larger interscalar length because such sites should provide ticks with superior attachment conditions. This study was performed in field conditions in central Poland in 2008-2011. In total, 500 lizards (Lacerta agilis) were caught and 839 ticks (Ixodes ricinus, larvae and nymphs) were collected from them. Using generalised linear mixed models, we found that the ticks were most abundant on forelimbs and their axillae, with 90% of ticks attached there. This part of the lizard body and the region behind the hindlimb were covered by the smallest scales with relatively wide gaps between them. This does not fully support our hypothesis that ticks prefer locations with easy access to skin between scales, because it does not explain why so few ticks were in the hindlimb area. We found that the abundance of ticks was positively correlated with lizard body size index (snout-vent length). Tick abundance was also higher in male and mature lizards than in female and young individuals. Autotomy had no effect on tick abundance. We found no correlation between tick size and lizard morphology, sex, autotomy and body size index. The probability of occurrence of dead ticks was positively linked with the total number of ticks on the lizard but there was no relationship between dead tick presence and lizard size, sex or age. Thus lizard body size and sex are the major factors affecting the abundance of ticks, and these parasites are distributed nearly exclusively on the host's forelimbs and their axillae.

  16. Widespread Rickettsia spp. Infections in Ticks (Acari: Ixodoidea) in Taiwan.

    PubMed

    Kuo, Chi-Chien; Shu, Pei-Yun; Mu, Jung-Jung; Lee, Pei-Lung; Wu, Yin-Wen; Chung, Chien-Kung; Wang, Hsi-Chieh

    2015-09-01

    Ticks are second to mosquitoes as the most important disease vectors, and recent decades have witnessed the emergence of many novel tick-borne rickettsial diseases, but systematic surveys of ticks and tick-borne rickettsioses are generally lacking in Asia. We collected and identified ticks from small mammal hosts between 2006 and 2010 in different parts of Taiwan. Rickettsia spp. infections in ticks were identified by targeting ompB and gltA genes with nested polymerase chain reaction. In total, 2,732 ticks were collected from 1,356 small mammals. Rhipicephalus haemaphysaloides Supino (51.8% of total ticks), Haemaphysalis bandicota Hoogstraal & Kohls (28.0%), and Ixodes granulatus Supino (20.0%) were the most common tick species, and Rattus losea Swinhoe (44.7% of total ticks) and Bandicota indica Bechstein (39.9%) were the primary hosts. The average Rickettsia infective rate in 329 assayed ticks was 31.9% and eight Rickettsia spp. or closely related species were identified. This study shows that rickettsiae-infected ticks are widespread in Taiwan, with a high diversity of Rickettsia spp. circulating in the ticks. Because notifiable rickettsial diseases in Taiwan only include mite-borne scrub typhus and flea-borne murine typhus, more studies are warranted for a better understanding of the real extent of human risks to rickettsioses in Taiwan.

  17. Attachment site selection of ticks on roe deer, Capreolus capreolus.

    PubMed

    Kiffner, C; Lödige, C; Alings, M; Vor, T; Rühe, F

    2011-01-01

    The spatio-temporal attachment site patterns of ticks feeding on their hosts can be of significance if co-feeding transmission (i.e. from tick to tick without a systemic infection of the host) of pathogens affects the persistence of a given disease. Using tick infestation data on roe deer, we analysed preferred attachment sites and niche width of Ixodes ticks (larvae, nymphs, males, females) and investigated the degree of inter- and intrastadial aggregation. The different development stages showed rather consistent attachment site patterns and relative narrow feeding site niches. Larvae were mostly found on the head and on the front legs of roe deer, nymphs reached highest densities on the head and highest adult densities were found on the neck of roe deer. The tick stages feeding (larvae, nymphs, females) on roe deer showed high degrees of intrastadial spatial aggregation, whereas males did not. Male ticks showed large feeding site overlap with female ticks. Feeding site overlap between larval-female and larval-nymphal ticks did occur especially during the months May-August on the head and front legs of roe deer and might allow pathogen transmission via co-feeding. Tick density, niche width and niche overlap on roe deer are mainly affected by seasonality, reflecting seasonal activity and abundance patterns of ticks. Since different tick development stages occur spatially and temporally clustered on roe deer, transmission experiments of tick-borne pathogens are urgently needed.

  18. Fibrinogen-related proteins in ixodid ticks

    PubMed Central

    2011-01-01

    Background Fibrinogen-related proteins with lectin activity are believed to be part of the tick innate immune system. Several fibrinogen-related proteins have been described and characterised mainly on the basis of their cDNA sequences while direct biochemical evidence is missing. One of them, the haemolymph lectin Dorin M from the tick Ornithodoros moubata was isolated and characterised in more depth. Results Several fibrinogen-related proteins were detected in the haemolymph of ixodid ticks Dermacentor marginatus, Rhipicephalus appendiculatus, R. pulchellus, and R. sanguineus. These proteins were recognised by sera directed against the tick lectin Dorin M and the haemagglutination activity of the ticks R. appendiculatus and D. marginatus. Cross-reactivity of the identified proteins with antibodies against the fibrinogen domain of the human ficolin was also shown. The carbohydrate-binding ability of tick haemolymph was confirmed by haemagglutination activity assays, and this activity was shown to be inhibited by neuraminic acid and sialylated glycoproteins as well as by N-acetylated hexosamines. The fibrinogen-related proteins were shown to be glycosylated and they were localised in salivary glands, midguts, and haemocytes of D. marginatus. Hemelipoglycoprotein was also recognised by sera directed against the fibrinogen-related proteins in all three Rhipicephalus species as well as in D. marginatus. However, this protein does not contain the fibrinogen domain and thus, the binding possibly results from the structure similarity between hemelipoglycoprotein and the fibrinogen domain. Conclusions The presence of fibrinogen-related proteins was shown in the haemolymph of four tick species in high abundance. Reactivity of antibodies directed against ficolin or fibrinogen-related proteins with proteins which do not contain the fibrinogen domain points out the importance of sequence analysis of the identified proteins in further studies. Previously observed expression of

  19. Avian Migrants Facilitate Invasions of Neotropical Ticks and Tick-Borne Pathogens into the United States

    PubMed Central

    Auckland, Lisa D.; Marra, Peter P.

    2015-01-01

    Migratory birds have the potential to transport exotic vectors and pathogens of human and animal health importance across vast distances. We systematically examined birds that recently migrated to the United States from the Neotropics for ticks. We screened both ticks and birds for tick-borne pathogens, including Rickettsia species and Borrelia burgdorferi. Over two spring seasons (2013 and 2014), 3.56% of birds (n = 3,844) representing 42.35% of the species examined (n = 85) were infested by ticks. Ground-foraging birds with reduced fuel stores were most commonly infested. Eight tick species were identified, including seven in the genus Amblyomma, of which only Amblyomma maculatum/Amblyomma triste is known to be established in the United States. Most ticks on birds (67%) were neotropical species with ranges in Central and South America. Additionally, a single Ixodes genus tick was detected. A total of 29% of the ticks (n = 137) and no avian blood samples (n = 100) were positive for infection with Rickettsia species, including Rickettsia parkeri, an emerging cause of spotted fever in humans in the southern United States, a species in the group of Rickettsia monacensis, and uncharacterized species and endosymbionts of unknown pathogenicity. No avian tick or blood samples tested positive for B. burgdorferi, the etiologic agent of Lyme disease. An extrapolation of our findings suggests that anywhere from 4 to 39 million exotic neotropical ticks are transported to the United States annually on migratory songbirds, with uncertain consequences for human and animal health if the current barriers to their establishment and spread are overcome. PMID:26431964

  20. Avian migrants facilitate invasions of neotropical ticks and tick-borne pathogens into the United States.

    PubMed

    Cohen, Emily B; Auckland, Lisa D; Marra, Peter P; Hamer, Sarah A

    2015-12-01

    Migratory birds have the potential to transport exotic vectors and pathogens of human and animal health importance across vast distances. We systematically examined birds that recently migrated to the United States from the Neotropics for ticks. We screened both ticks and birds for tick-borne pathogens, including Rickettsia species and Borrelia burgdorferi. Over two spring seasons (2013 and 2014), 3.56% of birds (n = 3,844) representing 42.35% of the species examined (n = 85) were infested by ticks. Ground-foraging birds with reduced fuel stores were most commonly infested. Eight tick species were identified, including seven in the genus Amblyomma, of which only Amblyomma maculatum/Amblyomma triste is known to be established in the United States. Most ticks on birds (67%) were neotropical species with ranges in Central and South America. Additionally, a single Ixodes genus tick was detected. A total of 29% of the ticks (n = 137) and no avian blood samples (n = 100) were positive for infection with Rickettsia species, including Rickettsia parkeri, an emerging cause of spotted fever in humans in the southern United States, a species in the group of Rickettsia monacensis, and uncharacterized species and endosymbionts of unknown pathogenicity. No avian tick or blood samples tested positive for B. burgdorferi, the etiologic agent of Lyme disease. An extrapolation of our findings suggests that anywhere from 4 to 39 million exotic neotropical ticks are transported to the United States annually on migratory songbirds, with uncertain consequences for human and animal health if the current barriers to their establishment and spread are overcome.

  1. Ticks and tick-borne pathogens in livestock from nomadic herds in the Somali Region, Ethiopia.

    PubMed

    Tomassone, Laura; Grego, E; Callà, G; Rodighiero, P; Pressi, G; Gebre, S; Zeleke, B; De Meneghi, D

    2012-04-01

    Between May 2006 and January 2007, blood samples and ticks were randomly collected from 220 nomadic animals from Filtu and Dollo Odo districts, Libaan zone, in the Somali Region of Ethiopia. Overall, 81.5% cattle, 98.2% camels, 53.4% goats and 61.1% sheep were infested by ixodid ticks. Collected ticks (n = 1,036) were identified as Rhipicephalus pulchellus (40.1%), R. pravus (25.8%), Amblyomma gemma (9.4%), Hyalomma rufipes (13.3%), H. truncatum (2.8%), H. impeltatum (1.2%) and H. dromedarii (0.5%); immature stages (6.1%) belonged to the genera Rhipicephalus and Amblyomma. Tick infestation burden was evaluated by the Tick Abundance Score method on 57 animals from Dollo Odo in August 2006, and it was significantly higher in cattle and camels than in small ruminants (p < 0.001). Reverse Line Blot Hybridisation was applied to detect Theileria, Babesia, Ehrlichia and Anaplasma spp. Five out of 50 blood samples from Filtu, four from cattle and, surprisingly, one from a camel, were positive for Theileria mutans and two from cattle for T. velifera. Adult ticks (n = 104) from both districts were tested and A. gemma from cattle were positive to T. velifera (1) and Ehrlichia ruminantium (5 samples). Positive E. ruminantium samples were also tested by PCR targeting pCS20 and 16S rRNA genes and submitted to DNA sequencing. The phylogenetic reconstruction of pCS20 fragment showed the presence of the Somali region sequences in the East-South African group. Our results are the first available on ticks and selected tick-borne diseases from the Somali region of Ethiopia and could be used as preliminary information for planning sustainable control strategies for tick and tick-borne pathogens in the study area and in neighbouring areas with similar socio-ecological features.

  2. Identification of tick-borne encephalitis virus in ticks collected in southeastern Hungary.

    PubMed

    Pintér, Réka; Madai, Mónika; Vadkerti, Edit; Németh, Viktória; Oldal, Miklós; Kemenesi, Gábor; Dallos, Bianka; Gyuranecz, Miklós; Kiss, Gábor; Bányai, Krisztián; Jakab, Ferenc

    2013-09-01

    Tick-borne encephalitis virus (TBEV) is an arthropod-borne viral pathogen causing infections in Europe and is responsible for most arbovirus central nervous system infections in Hungary. Assessing the TBEV prevalence in ticks through detection of genomic RNA is a broadly accepted approach to estimate the transmission risk from a tick bite. For this purpose, 2731 ticks were collected from the neighboring area of the town of Dévaványa, located in southeastern Hungary, which is considered a low-risk-transmission area for TBEV. Altogether, 2300 ticks were collected from the vegetation, while 431 were collected from rodents. Samples were pooled and then screened for TBEV with a newly designed semi-nested RT-PCR (RT-snPCR) targeting the NS1 genomic region. PCR results were confirmed by direct sequencing of the second round amplicons. Among the 3 different collected tick species (Ixodes ricinus, Haemaphysalis concinna, Dermacentor marginatus), I. ricinus was the only species that tested positive for TBEV. TBEV-positive ticks were collected from small mammals or from the vegetation. One nymphal pool and 4 larval pools tested positive for TBEV. The only positive nymphal pool was unfed and came from vegetation, while ticks of the 4 positive larval pools were collected from rodents. Minimal TBEV prevalence in ticks was 0.08% for unfed nymphs and 0.78% for feeding larvae. Our results indicate that further long-term investigations on the occurrence of TBEV are needed to better describe the geographic distribution and the prevalence of infected ticks in Hungary.

  3. Grooming in impala: role of oral grooming in removal of ticks and effects of ticks in increasing grooming rate.

    PubMed

    Mooring, M S; McKenzie, A A; Hart, B L

    1996-01-01

    In Experiment 1, five adult female impala were fitted with harnesses that restrained oral self-grooming of the anterior part of the body. At the same time, six cohoused female impala were fitted with control harnesses that allowed normal oral grooming. The impala were allowed to habituate to the harnesses for 10 days, and both groups were then exposed to larval ticks (Boophilus decoloratus) by herding them into a tick-seeding corral. During the third week following tick seeding, when female ticks were estimated to have developed into engorging adults, the impala were immobilized, tick numbers on the animals sampled by patch sampling, and the harnesses removed. Observations continued for 5 days following removal of the harnesses. Twenty-minute focal observations were conducted daily on each impala during the habituation, tick-seeded, and postharness phases. Restrained impala had a median of 20 times more adult female ticks (both engorged and unengorged) than control impala. Oral grooming, which had been suppressed in the restrained impala during habituation and tick-seeded phases, increased 10-fold once the harnesses were removed and occurred 2.5 times more frequently than in control impala during the postharness phase. In Experiment 2, 15 adult female impala were seeded with larval ticks as in Experiment 1; in week 3 after tick seeding all ticks were removed from animals by application of an acaricide. Grooming was recorded during 3 weeks of baseline observations prior to tick seeding, 3 weeks after tick seeding, and then for 3 weeks beginning 1 week after acaricide treatment. Oral grooming and scratch grooming significantly increased from baseline during tick seeding and significantly declined following removal of the ticks with acaracide. Taken together, the two experiments demonstrate that oral grooming is very effective and important in removing fitness-compromising ticks in free-ranging impala. Correspondingly, exposure to, and subsequent infestation by, ticks

  4. Tick Removal: A Step-by-Step Guide (For Parents)

    MedlinePlus

    ... do? First, don't panic. It's true that Lyme disease is the most common tick-borne disease in ... United States, but your child's risk of developing Lyme disease after being bitten by a tick is very ...

  5. Experimental Infection of Amblyomma aureolatum Ticks with Rickettsia rickettsii

    PubMed Central

    Ogrzewalska, Maria; Soares, João F.; Martins, Thiago F.; Soares, Herbert S.; Moraes-Filho, Jonas; Nieri-Bastos, Fernanda A.; Almeida, Aliny P.; Pinter, Adriano

    2011-01-01

    We experimentally infected Amblyomma aureolatum ticks with the bacterium Rickettsia rickettsii, the etiologic agent of Rocky Mountain spotted fever (RMSF). These ticks are a vector for RMSF in Brazil. R. rickettsii was efficiently conserved by both transstadial maintenance and vertical (transovarial) transmission to 100% of the ticks through 4 laboratory generations. However, lower reproductive performance and survival of infected females was attributed to R. rickettsii infection. Therefore, because of the high susceptibility of A. aureolatum ticks to R. rickettsii infection, the deleterious effect that the bacterium causes in these ticks may contribute to the low infection rates (<1%) usually reported among field populations of A. aureolatum ticks in RMSF-endemic areas of Brazil. Because the number of infected ticks would gradually decrease after each generation, it seems unlikely that A. aureolatum ticks could sustain R. rickettsii infection over multiple successive generations solely by vertical transmission. PMID:21529391

  6. Experimental infection of Amblyomma aureolatum ticks with Rickettsia rickettsii.

    PubMed

    Labruna, Marcelo B; Ogrzewalska, Maria; Soares, João F; Martins, Thiago F; Soares, Herbert S; Moraes-Filho, Jonas; Nieri-Bastos, Fernanda A; Almeida, Aliny P; Pinter, Adriano

    2011-05-01

    We experimentally infected Amblyomma aureolatum ticks with the bacterium Rickettsia rickettsii, the etiologic agent of Rocky Mountain spotted fever (RMSF). These ticks are a vector for RMSF in Brazil. R. rickettsii was efficiently conserved by both transstadial maintenance and vertical (transovarial) transmission to 100% of the ticks through 4 laboratory generations. However, lower reproductive performance and survival of infected females was attributed to R. rickettsii infection. Therefore, because of the high susceptibility of A. aureolatum ticks to R. rickettsii infection, the deleterious effect that the bacterium causes in these ticks may contribute to the low infection rates (<1%) usually reported among field populations of A. aureolatum ticks in RMSF-endemic areas of Brazil. Because the number of infected ticks would gradually decrease after each generation, it seems unlikely that A. aureolatum ticks could sustain R. rickettsii infection over multiple successive generations solely by vertical transmission.

  7. 9 CFR 3.57 - Employees.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... 9 Animals and Animal Products 1 2014-01-01 2014-01-01 false Employees. 3.57 Section 3.57 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE STANDARDS Specifications for the Humane Handling, Care, Treatment and Transportation of...

  8. 9 CFR 3.57 - Employees.

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... 9 Animals and Animal Products 1 2011-01-01 2011-01-01 false Employees. 3.57 Section 3.57 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE STANDARDS Specifications for the Humane Handling, Care, Treatment and Transportation of...

  9. 9 CFR 3.57 - Employees.

    Code of Federal Regulations, 2012 CFR

    2012-01-01

    ... 9 Animals and Animal Products 1 2012-01-01 2012-01-01 false Employees. 3.57 Section 3.57 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE STANDARDS Specifications for the Humane Handling, Care, Treatment and Transportation of...

  10. 9 CFR 3.57 - Employees.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... 9 Animals and Animal Products 1 2013-01-01 2013-01-01 false Employees. 3.57 Section 3.57 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE STANDARDS Specifications for the Humane Handling, Care, Treatment and Transportation of...

  11. 9 CFR 3.32 - Employees.

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... 9 Animals and Animal Products 1 2011-01-01 2011-01-01 false Employees. 3.32 Section 3.32 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE STANDARDS Specifications for the Humane Handling, Care, Treatment, and Transportation of...

  12. 9 CFR 3.85 - Employees.

    Code of Federal Regulations, 2012 CFR

    2012-01-01

    ... 9 Animals and Animal Products 1 2012-01-01 2012-01-01 false Employees. 3.85 Section 3.85 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE STANDARDS Specifications for the Humane Handling, Care, Treatment, and Transportation of...

  13. 9 CFR 3.85 - Employees.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... 9 Animals and Animal Products 1 2013-01-01 2013-01-01 false Employees. 3.85 Section 3.85 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE STANDARDS Specifications for the Humane Handling, Care, Treatment, and Transportation of...

  14. 9 CFR 3.85 - Employees.

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... 9 Animals and Animal Products 1 2011-01-01 2011-01-01 false Employees. 3.85 Section 3.85 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE STANDARDS Specifications for the Humane Handling, Care, Treatment, and Transportation of...

  15. 9 CFR 3.32 - Employees.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... 9 Animals and Animal Products 1 2014-01-01 2014-01-01 false Employees. 3.32 Section 3.32 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE STANDARDS Specifications for the Humane Handling, Care, Treatment, and Transportation of...

  16. 9 CFR 3.32 - Employees.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... 9 Animals and Animal Products 1 2013-01-01 2013-01-01 false Employees. 3.32 Section 3.32 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE STANDARDS Specifications for the Humane Handling, Care, Treatment, and Transportation of...

  17. 9 CFR 3.32 - Employees.

    Code of Federal Regulations, 2012 CFR

    2012-01-01

    ... 9 Animals and Animal Products 1 2012-01-01 2012-01-01 false Employees. 3.32 Section 3.32 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE STANDARDS Specifications for the Humane Handling, Care, Treatment, and Transportation of...

  18. 9 CFR 3.85 - Employees.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... 9 Animals and Animal Products 1 2014-01-01 2014-01-01 false Employees. 3.85 Section 3.85 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE STANDARDS Specifications for the Humane Handling, Care, Treatment, and Transportation of...

  19. 9 CFR 416.5 - Employee hygiene.

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE REGULATORY... Employee hygiene. (a) Cleanliness. All persons working in contact with product, food-contact surfaces, and product-packaging materials must adhere to hygienic practices while on duty to prevent adulteration...

  20. 9 CFR 416.5 - Employee hygiene.

    Code of Federal Regulations, 2012 CFR

    2012-01-01

    ... Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE REGULATORY... Employee hygiene. (a) Cleanliness. All persons working in contact with product, food-contact surfaces, and product-packaging materials must adhere to hygienic practices while on duty to prevent adulteration...

  1. 9 CFR 416.5 - Employee hygiene.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE REGULATORY... Employee hygiene. (a) Cleanliness. All persons working in contact with product, food-contact surfaces, and product-packaging materials must adhere to hygienic practices while on duty to prevent adulteration...

  2. 9 CFR 416.5 - Employee hygiene.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE REGULATORY... Employee hygiene. (a) Cleanliness. All persons working in contact with product, food-contact surfaces, and product-packaging materials must adhere to hygienic practices while on duty to prevent adulteration...

  3. 9 CFR 416.5 - Employee hygiene.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE REGULATORY... Employee hygiene. (a) Cleanliness. All persons working in contact with product, food-contact surfaces, and product-packaging materials must adhere to hygienic practices while on duty to prevent adulteration...

  4. 9 CFR 3.132 - Employees.

    Code of Federal Regulations, 2012 CFR

    2012-01-01

    ... Warmblooded Animals Other Than Dogs, Cats, Rabbits, Hamsters, Guinea Pigs, Nonhuman Primates, and Marine... 9 Animals and Animal Products 1 2012-01-01 2012-01-01 false Employees. 3.132 Section 3.132 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE...

  5. 9 CFR 3.132 - Employees.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... Warmblooded Animals Other Than Dogs, Cats, Rabbits, Hamsters, Guinea Pigs, Nonhuman Primates, and Marine... 9 Animals and Animal Products 1 2013-01-01 2013-01-01 false Employees. 3.132 Section 3.132 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE...

  6. 9 CFR 3.132 - Employees.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... Warmblooded Animals Other Than Dogs, Cats, Rabbits, Hamsters, Guinea Pigs, Nonhuman Primates, and Marine... 9 Animals and Animal Products 1 2014-01-01 2014-01-01 false Employees. 3.132 Section 3.132 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE...

  7. 9 CFR 3.132 - Employees.

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... Warmblooded Animals Other Than Dogs, Cats, Rabbits, Hamsters, Guinea Pigs, Nonhuman Primates, and Marine... 9 Animals and Animal Products 1 2011-01-01 2011-01-01 false Employees. 3.132 Section 3.132 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE...

  8. 9 CFR 3.132 - Employees.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... Warmblooded Animals Other Than Dogs, Cats, Rabbits, Hamsters, Guinea Pigs, Nonhuman Primates, and Marine... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Employees. 3.132 Section 3.132 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE...

  9. 9 CFR 3.85 - Employees.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Employees. 3.85 Section 3.85 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE STANDARDS Specifications for the Humane Handling, Care, Treatment, and Transportation of...

  10. 9 CFR 3.57 - Employees.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... shall be under the supervision of an animal caretaker who has a background in animal husbandry or care. ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Employees. 3.57 Section 3.57 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE...

  11. Ticks and tick-borne pathogens at the cutaneous interface: host defenses, tick countermeasures, and a suitable environment for pathogen establishment

    PubMed Central

    Wikel, Stephen

    2013-01-01

    Ticks are unique among hematophagous arthropods by continuous attachment to host skin and blood feeding for days; complexity and diversity of biologically active molecules differentially expressed in saliva of tick species; their ability to modulate the host defenses of pain and itch, hemostasis, inflammation, innate and adaptive immunity, and wound healing; and, the diverse array of infectious agents they transmit. All of these interactions occur at the cutaneous interface in a complex sequence of carefully choreographed host defense responses and tick countermeasures resulting in an environment that facilitates successful blood feeding and establishment of tick-borne infectious agents within the host. Here, we examine diverse patterns of tick attachment to host skin, blood feeding mechanisms, salivary gland transcriptomes, bioactive molecules in tick saliva, timing of pathogen transmission, and host responses to tick bite. Ticks engage and modulate cutaneous and systemic immune defenses involving keratinocytes, natural killer cells, dendritic cells, T cell subpopulations (Th1, Th2, Th17, Treg), B cells, neutrophils, mast cells, basophils, endothelial cells, cytokines, chemokines, complement, and extracellular matrix. A framework is proposed that integrates tick induced changes of skin immune effectors with their ability to respond to tick-borne pathogens. Implications of these changes are addressed. What are the consequences of tick modulation of host cutaneous defenses? Does diversity of salivary gland transcriptomes determine differential modulation of host inflammation and immune defenses and therefore, in part, the clades of pathogens effectively transmitted by different tick species? Do ticks create an immunologically modified cutaneous environment that enhances specific pathogen establishment? Can tick saliva molecules be used to develop vaccines that block pathogen transmission? PMID:24312085

  12. Novel Rickettsia and emergent tick-borne pathogens: A molecular survey of ticks and tick-borne pathogens in Shimba Hills National Reserve, Kenya.

    PubMed

    Mwamuye, Micky M; Kariuki, Edward; Omondi, David; Kabii, James; Odongo, David; Masiga, Daniel; Villinger, Jandouwe

    2017-02-01

    Ticks are important vectors of emerging and re-emerging zoonoses, the majority of which originate from wildlife. In recent times, this has become a global public health concern that necessitates surveillance of both known and unknown tick-borne pathogens likely to be future disease threats, as well as their tick vectors. We carried out a survey of the diversity of ticks and tick-borne pathogens in Kenya's Shimba Hills National Reserve (SHNR), an area with intensified human-livestock-wildlife interactions, where we collected 4297 questing ticks (209 adult ticks, 586 nymphs and 3502 larvae). We identified four tick species of two genera (Amblyomma eburneum, Amblyomma tholloni, Rhipicephalus maculatus and a novel Rhipicephalus sp.) based on both morphological characteristics and molecular analysis of 16S rRNA, internal transcribed spacer 2 (ITS 2) and cytochrome oxidase subunit 1 (CO1) genes. We pooled the ticks (3-8 adults, 8-15 nymphs or 30 larvae) depending on species and life-cycle stages, and screened for bacterial, arboviral and protozoal pathogens using PCR with high-resolution melting analysis and sequencing of unique melt profiles. We report the first molecular detection of Anaplasma phagocytophilum, a novel Rickettsia-like and Ehrlichia-like species, in Rh. maculatus ticks. We also detected Ehrlichia chaffeensis, Coxiella sp., Rickettsia africae and Theileria velifera in Am. eburneum ticks for the first time. Our findings demonstrate previously unidentified tick-pathogen relationships and a unique tick diversity in the SHNR that may contribute to livestock, and possibly human, morbidity in the region. This study highlights the importance of routine surveillance in similar areas to elucidate disease transmission dynamics, as a critical component to inform the development of better tick-borne disease diagnosis, prevention and control measures.

  13. Theme: Employee Ownership.

    ERIC Educational Resources Information Center

    Gordon, Michael E.; And Others

    1991-01-01

    Includes "Introduction" (Gordon); "Employee Ownership: Opportunities for Unions" (Blasi, Kruse); "Participation, Control, and Performance" (Rosen); Beyond the Contract: Taking on Ownership" (Mackin); "Worker Participation on Boards of Directors" (Hammer); and "Case Study of Employee Ownership and…

  14. 29 CFR 570.123 - Agriculture.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... 29 Labor 3 2011-07-01 2011-07-01 false Agriculture. 570.123 Section 570.123 Labor Regulations... Provisions of the Fair Labor Standards Act of 1938, as Amended Exemptions § 570.123 Agriculture. (a) Section... agriculture outside of school hours for the school district where such employee is living while he is...

  15. 29 CFR 570.123 - Agriculture.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Agriculture. 570.123 Section 570.123 Labor Regulations... Provisions of the Fair Labor Standards Act of 1938, as Amended Exemptions § 570.123 Agriculture. (a) Section... agriculture outside of school hours for the school district where such employee is living while he is...

  16. 29 CFR 570.123 - Agriculture.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... 29 Labor 3 2012-07-01 2012-07-01 false Agriculture. 570.123 Section 570.123 Labor Regulations... Provisions of the Fair Labor Standards Act of 1938, as Amended Exemptions § 570.123 Agriculture. (a) Section... agriculture outside of school hours for the school district where such employee is living while he is...

  17. 29 CFR 570.123 - Agriculture.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... 29 Labor 3 2013-07-01 2013-07-01 false Agriculture. 570.123 Section 570.123 Labor Regulations... Provisions of the Fair Labor Standards Act of 1938, as Amended Exemptions § 570.123 Agriculture. (a) Section... agriculture outside of school hours for the school district where such employee is living while he is...

  18. 29 CFR 570.123 - Agriculture.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... 29 Labor 3 2014-07-01 2014-07-01 false Agriculture. 570.123 Section 570.123 Labor Regulations... Provisions of the Fair Labor Standards Act of 1938, as Amended Exemptions § 570.123 Agriculture. (a) Section... agriculture outside of school hours for the school district where such employee is living while he is...

  19. Methods to Prevent Tick Bites and Lyme Disease.

    PubMed

    Ogden, Nick H; Lindsay, L Robbin; Schofield, Steven W

    2015-12-01

    Current approaches for prevention of tick bites, Lyme disease, and other tick-borne diseases are described. Particular attention is paid to 4 risk-reduction strategies: (i) avoiding risk areas; (ii) personal protective measures that reduce the risk of tick bites or transmission of the agent of Lyme disease, Borrelia burgdorferi; (iii) reducing the number of infected ticks in the environment; and (iv) use of prophylactic antibiotic treatments following a bite to prevent clinical Lyme disease.

  20. Tick repellents and acaricides of botanical origin: a green roadmap to control tick-borne diseases?

    PubMed

    Benelli, Giovanni; Pavela, Roman; Canale, Angelo; Mehlhorn, Heinz

    2016-07-01

    Arthropods are dangerous vectors of agents of deadly diseases, which may hit as epidemics or pandemics in the increasing world population of humans and animals. Among them, ticks transmit more pathogen species than any other group of blood-feeding arthropods worldwide. Thus, the effective and eco-friendly control of tick vectors in a constantly changing environment is a crucial challenge. A number of novel routes have been attempted to prevent and control tick-borne diseases, including the development of (i) vaccines against viruses vectored by ticks; (ii) pheromone-based control tools, with special reference to the "lure and kill" techniques; (iii) biological control programmes relying on ticks' natural enemies and pathogens; and (iv) the integrated pest management practices aimed at reducing tick interactions with livestock. However, the extensive employment of acaricides and tick repellents still remains the two most effective and ready-to-use strategies. Unfortunately, the first one is limited by the rapid development of resistance in ticks, as well as by serious environmental concerns. On the other hand, the exploitation of plants as sources of effective tick repellents is often promising. Here, we reviewed current knowledge concerning the effectiveness of plant extracts as acaricides or repellents against tick vectors of public health importance, with special reference to Ixodes ricinus, Ixodes persulcatus, Amblyomma cajennense, Haemaphysalis bispinosa, Haemaphysalis longicornis, Hyalomma anatolicum, Hyalomma marginatum rufipes, Rhipicephalus appendiculatus, Rhipicephalus (Boophilus) microplus, Rhipicephalus pulchellus, Rhipicephalus sanguineus and Rhipicephalus turanicus. Eighty-three plant species from 35 botanical families were selected. The most frequent botanical families exploited as sources of acaricides and repellents against ticks were Asteraceae (15 % of the selected studies), Fabaceae (9 %), Lamiaceae (10 %), Meliaceae (5 %), Solanaceae (6

  1. Documenting Employee Conduct

    ERIC Educational Resources Information Center

    Dalton, Jason

    2009-01-01

    One of the best ways for a child care program to lose an employment-related lawsuit is failure to document the performance of its employees. Documentation of an employee's performance can provide evidence of an employment-related decision such as discipline, promotion, or discharge. When properly implemented, documentation of employee performance…

  2. The bacterial microbiome of dermacentor andersoni ticks influences pathogen susceptibility

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Ticks are of medical and veterinary importance due to their ability to transmit pathogens to humans and animals. The Rocky Mountain wood tick, Dermacentor andersoni, is a vector of a number of pathogens, including Anaplasma marginale, which is the most widespread tick-borne pathogen of livestock. Al...

  3. Ticks associated with domestic dogs and cats in Florida, USA

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Voluntary collections of ticks from domestic dogs and cats by veterinary practitioners across Florida were conducted over a 10 month period. Of the 1,337 ticks submitted, five species of ixodid ticks were identified and included Rhipicephalus sanguineus, Amblyomma americanum, A. maculatum, Dermacen...

  4. Plane of nutrition by tick-burden interaction in cattle: effect on growth and metabolism.

    PubMed

    Tolleson, D R; Carstens, G E; Welsh, T H; Teel, P D; Strey, O F; Longnecker, M T; Prince, S D; Banik, K K

    2012-10-01

    Ticks are external parasites, which pose a significant economic burden to domestic animal agriculture. The effects of ticks on grazing animals may be exacerbated during periods of low nutrition, such as those encountered during drought. It is not completely understood how plane of nutrition and tick burden interact to affect metabolism in cattle. The objective of the current research was to examine the plane of nutrition by tick-burden interaction in cattle and determine the effects of this interaction on physiological indicators of growth and metabolism. Eight-month-old Angus cross steers (n = 28, 194 ± 3.0 kg) were stratified by pretrial BW and DMI into 1 of 4 groups (n = 7/group) in a 2 × 2 factorial arrangement. Categories were: moderate (14.0 ± 1.0% CP, 60 ± 1.5% TDN) vs. low (9.0 ± 1.0% CP, 58 ± 1.5% TDN) plane of nutrition and control (no tick) vs. tick treatment (300 pair of adult Amblyomma americanum per treated animal). Steers were individually fed their respective experimental diets ad libitum and feed intake was monitored for 35 d before and 21 d after the start of tick infestation (d 0). Blood samples were harvested via coccygeal venipuncture on d -7, 0, 7, 8, 9, 10, 11, 13, 17, and 21. Plasma cortisol and IGF-I were determined by RIA. Metabolic indicators were determined by colorimetric assay. Steers weighed 195 ± 6 kg on d -35, but on d -7 and d 21, the moderate steers weighed more than the low steers (244.1 ± 8.7 vs. 227.7 ± 8.4 kg, P < 0.07; and 283.4 ± 8.0 vs. 244.0 ± 7.9 kg, P < 0.001, respectively). Cortisol was affected by plane of nutrition and treatment (P < 0.08). Insulin-like growth factor-I was greater (P < 0.01) in moderate than in low and control animals (P < 0.02), compared with tick-treated animals. Tick treatment had no effect (P > 0.05) on any of the metabolites measured in this study. Plane of nutrition affected (P < 0.02) albumin, blood urea nitrogen, and glucose in that values from the moderate group animals were

  5. Bacteria associated with Amblyomma cajennense tick eggs

    PubMed Central

    Machado-Ferreira, Erik; Vizzoni, Vinicius Figueiredo; Piesman, Joseph; Gazeta, Gilberto Salles; Soares, Carlos Augusto Gomes

    2015-01-01

    Abstract Ticks represent a large group of pathogen vectors that blood feed on a diversity of hosts. In the Americas, the Ixodidae ticks Amblyomma cajennense are responsible for severe impact on livestock and public health. In the present work, we present the isolation and molecular identification of a group of culturable bacteria associated with A. cajennense eggs from females sampled in distinct geographical sites in southeastern Brazil. Additional comparative analysis of the culturable bacteria from Anocentor nitens, Rhipicephalus sanguineus and Ixodes scapularis tick eggs were also performed. 16S rRNA gene sequence analyses identified 17 different bacterial types identified as Serratia marcescens, Stenotrophomonas maltophilia, Pseudomonas fluorescens, Enterobacter spp., Micrococcus luteus, Ochrobactrum anthropi, Bacillus cereus and Staphylococcus spp., distributed in 12 phylogroups. Staphylococcus spp., especially S. sciuri, was the most prevalent bacteria associated with A. cajennense eggs, occurring in 65% of the samples and also frequently observed infecting A. nitens eggs. S. maltophilia, S. marcescens and B. cereus occurred infecting eggs derived from specific sampling sites, but in all cases rising almost as pure cultures from infected A. cajennense eggs. The potential role of these bacterial associations is discussed and they possibly represent new targets for biological control strategies of ticks and tick borne diseases. PMID:26537602

  6. Detection of Ehrlichia phagocytophila DNA in Ixodes ricinus Ticks from Areas in Switzerland Where Tick-Borne Fever Is Endemic

    PubMed Central

    Pusterla, Nicola; Huder, Jon B.; Lutz, Hans; Braun, Ueli

    1998-01-01

    A total of 1,523 adult Ixodes ricinus ticks were collected from regions where bovine ehrlichiosis is endemic and were examined for Ehrlichia phagocytophila via PCR. Of the ticks from cattle with ehrlichiosis, the ticks from healthy cattle, and the free-living ticks, 26.5% (18 of 68), 4.4% (35 of 802), and 0.8% (5 of 653), respectively, were positive. PMID:9705425

  7. Tick-borne encephalitis virus in ticks detached from humans and follow-up of serological and clinical response.

    PubMed

    Lindblom, Pontus; Wilhelmsson, Peter; Fryland, Linda; Sjöwall, Johanna; Haglund, Mats; Matussek, Andreas; Ernerudh, Jan; Vene, Sirkka; Nyman, Dag; Andreassen, Ashild; Forsberg, Pia; Lindgren, Per-Eric

    2014-02-01

    The risk of tick-borne encephalitis virus (TBEV) infection after a tick bite remains largely unknown. To address this, we investigated the presence of TBEV in ticks detached from humans in an attempt to relate viral copy number, TBEV subtype, and tick feeding time with the serological and clinical response of the tick-bitten participants. Ticks, blood samples, and questionnaires were collected from tick-bitten humans at 34 primary health care centers in Sweden and in the Åland Islands (Finland). A total of 2167 ticks was received from 1886 persons in 2008-2009. Using a multiplex quantitative real-time PCR, 5 TBEV-infected ticks were found (overall prevalence 0.23%, copy range <4×10(2)-7.7×10(6)per tick). One unvaccinated person bitten by a tick containing 7.7×10(6) TBEV copies experienced symptoms. Another unvaccinated person bitten by a tick containing 1.8×10(3) TBEV copies developed neither symptoms nor TBEV antibodies. The remaining 3 persons were protected by vaccination. In contrast, despite lack of TBEV in the detached ticks, 2 persons developed antibodies against TBEV, one of whom reported symptoms. Overall, a low risk of TBEV infection was observed, and too few persons got bitten by TBEV-infected ticks to draw certain conclusions regarding the clinical outcome in relation to the duration of the blood meal and virus copy number. However, this study indicates that an antibody response may develop without clinical symptoms, that a bite by an infected tick not always leads to an antibody response or clinical symptoms, and a possible correlation between virus load and tick feeding time.

  8. Recent cases of invasive alien mites and ticks in Japan: why is a regulatory framework needed?

    PubMed

    Goka, Koichi; Okabe, Kimiko; Takano, Ai

    2013-02-01

    Japan's economy depends on the importation of natural resources, and as a result, Japan is subjected to a high risk of biological invasion. Although Japan has quarantine systems to protect ecosystems, agriculture, forestry, fisheries, and human health against alien species, economic globalization has resulted in an ever-increasing risk of invasion. Mite invasion is no exception. Alien species that impact natural ecosystems are regulated in Japan by the Invasive Alien Species Act. However, the law focuses only on visibly recognizable species, so that species too small to see, such as viruses, bacteria, fungi, and mites, are beyond the scope of this law. The Plant Protection Law has limited the introduction of alien pests, including mites, that are harmful to agricultural crops. Recently, the liberalization of global trade policies have increased pressure to loosen regulations on various pests, including spider mites. Infectious diseases and their causative species are quarantined under the Rabies Prevention Law, the Domestic Animal Infectious Diseases Control Law, and the Human Infectious Diseases Control Law, but these laws do not cover wildlife diseases. The most serious problem is that wild reptiles, which can be carriers of ticks and tick-borne diseases, can be freely introduced to Japan. These loopholes in Japan's regulatory system have resulted in mite and tick invasions, which affect not only wildlife communities and human society but also endemism and biological diversity of natural mite populations.

  9. Ticks parasitizing reptiles in the Bahamas.

    PubMed

    Durden, L A; Knapp, C R

    2005-09-01

    Two species of reptile ticks, Amblyomma dissimile Koch and Amblyomma torrei Pérez Vigueras (Acari: Ixodidae), are reported from the Bahama Islands for the first time. The widespread neotropical (including the Caribbean and southern Florida) A. dissimile was recovered on Andros Island from three species of reptiles all for the first time: the Andros iguana Cyclura cychlura cychlura Cuvier, the Andros curly tail lizard Leiocephalus carinatus coryi Schmidt, and the Andros boa Epicrates striatus fowleri Sheplan and Schwartz. The iguana tick A. torrei, previously known only from Cuba, Puerto Rico and the Cayman Islands, was recovered in the Exuma Islands from the Exuma iguana Cyclura cychlura figginsi Barbour. Mean numbers of ticks per host were as high as 36.6 on Mangrove Cay, Andros Island, and 25.8 on Pasture Cay in the Exuma Islands.

  10. Virus investigation in ticks from migratory birds in Italy.

    PubMed

    Mancini, Fabiola; Toma, Luciano; Ciervo, Alessandra; Di Luca, Marco; Faggioni, Giovanni; Lista, Forigio; Rezza, Giovanni

    2013-10-01

    The role of migratory birds in circulation tick-borne viruses needs to be better defined. In order to assess the potential role of migratory birds in exotic virus spread, we conducted a study to identify ticks collected from migratory birds in the Central Region of Italy, and performed molecular investigation for Crimea-Congo Hemorrhagic Fever (CCHFV), West Nile fever (WNFV) and Usutu (USUV) in the vectors. A total of 137 competent ticks were collected with predominance of Hyalomma species. Although, negative results were obtained for all viruses considered, the high proportion of Hyalomma ticks highlights the potential risk for the dissemination of tick-borne viruses through infested migratory birds.

  11. The tick (Acari: Ixodidae) fauna of Herald's Beacon Islet, Australia.

    PubMed

    Kwak, Mackenzie L; Mintram, Kate

    2017-01-01

    A rare opportunity to travel to Herald's Beacon Islet with permission from the Australian government to collect ticks allowed for a survey of the tick fauna of the island to be undertaken for the first time. The avian fauna of the island, which serve as hosts, was also recorded and includes one new species record for the island. The seabird soft tick Ornithodoros capensis Neumann and the seabird hard tick Amblyomma loculosum Neumann were found to be present on the island. Images of the ticks present on the island are presented along with morphological characters for their identification.

  12. 7 CFR 56.72 - Interfering with a grader or employee of the AMS.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Interfering with a grader or employee of the AMS. 56... a grader or employee of the AMS. Any interference with or obstruction or any attempted interference or obstruction of or assault upon any graders, licensees, or employees of the AMS in the...

  13. Tick-borne encephalitis in children.

    PubMed

    Rostasy, Kevin

    2012-06-01

    This review is a summary of the most important clinical findings and implications of tick-borne encephalitis (TBE) in children. It is based on a Pubmed search with the terms "tick-borne encephalitis", "children", "infection", "meningitis", "meningoencephalitis", and "outcome". TBE in children shares several features with their adult counterpart but has overall a better prognosis. Nevertheless, TBE is associated with substantial morbidity and mortality in a small group of children and seems to cause cognitive dysfunctions, which needs to be studied in further detail.

  14. Ixodid ticks on domestic animals in Samut Prakan Province, Thailand.

    PubMed

    Nithikathkul, C; Polseela, P; Changsap, B; Leemingsawat, S

    2002-01-01

    The prevalence of tick-harboring domestic animals, tick density, and the species of ticks were studied throughout the year 2000, in Muang Samut Prakan, Bang Phli and Phra Pradaeng districts of Samut Prakan Province. The animals examined were Canis lupus familiaris (450), Bos indicus (cross-bred) (189), Bos taurus (30), Bubalus bubalis (171) and Sus scrofa domestica (450). The total number of collected ticks was 1,491. The pigs did not harbor ticks. The stages of ticks collected were larvae, nymphs and adults. The prevalence rates of tick-harboring were 46% (Canis lupus familiaris), 42.86% (Bos indicus, cross-bred), 33.33% (Bos taurus) and 9.35% (Bubalus bubalis). The tick densities were 2.22 (Bos indicus, cross-bred), 2.16 (Canis lupus familiaris), 1.16 (Bos taurus) and 0.36 (Bubalus bubalis). Only 2 species of ixodid ticks, Boophilus microplus and Rhipicephalus sanguineus, were found. R. sanguineus was the dominant species of tick. The percentage of R. sanguineus was 65.2% and B. microplus was 34.8%. In Muang district, R. sanguineus was the dominant species in C. lupus familiaris; in Bang Phli district, B. microplus was the dominant species in Bos indicus (cross-bred). The density of B. microplus was high in the summer season; the density of R. sanguineus was high in the winter season. The number of ticks depended on the geographic location, animal host and season.

  15. Primary report on distribution of tick fauna in Iran.

    PubMed

    Rahbari, Sadegh; Nabian, Sedighe; Shayan, Parviz

    2007-09-01

    A tick survey was carried out in four different geographical areas of Iran, where the majority of the domestic ruminants in Iran exist. About 1,500 sheep, 1,200 goats and 500 cattle of 12 herds in different provinces lying in the corresponding zones were inspected for tick infestation. The occurrence of ticks on cattle, sheep and goats were 62, 55 and 57%, respectively, with no differences between the zones. The mean number of ticks on each animal was low (10-20 ticks per animal). Ixodid ticks were found throughout the year, whereas the soft tick Ornithodoros sp., which occurred in mountainous area with a significant difference in abundance, showed a clear pattern of seasonality, being generally present from November to March. The largest numbers of adult ixodid ticks were generally present from April to August. Rhipicephalus, Haemaphysalis and Dermacentor ticks occurred in the mountainous area, whereas Boophilus and Ixodes ticks were only present in the Caspian region. Hyalomma were very abundant in each zone but especially in the mountainous area, whereas Ixodes ticks were the minor genus.

  16. Conjunctival attachment of a tick: clinicopathologic report of a case.

    PubMed

    Willen, Christi; Mullen, Gary R; Yee, Jeff; Read, Russell W

    2011-03-01

    Attachment by ticks to ocular surfaces is uncommon, but has been reported. The objective of this article is to describe a case of conjunctival tick attachment and a method for removal by conjunctival excision. A 39-year-old man presented to the Emergency Department with a complaint of foreign-body sensation in his right eye. He was found to have a live tick embedded in his conjunctiva. The tick was removed en bloc with surrounding conjunctiva by an ophthalmologist. The arthropod was identified as the larval stage of the Lone Star tick (Amblyomma americanum). The patient did not experience any systemic illnesses or adverse sequelae. Attachment of ticks to the conjunctiva is unlikely to result in disease transmission when the larval stage is involved. However, removal by excision of a surrounding block of conjunctiva is recommended to ensure complete removal of all tick body parts.

  17. A Clinical Review of Tick-Borne Diseases in Arkansas.

    PubMed

    Montales, Maria Theresa; Beebe, Alexandria; Chaudhury, Arun; Haselow, Dirk; Patil, Sowmya; Weinstein, Sue; Taffner, Richard; Patil, Naveen

    2016-05-01

    Tick-borne diseases are illnesses transmitted by ticks harboring wide variety of pathogens. Arkansas is reported as one of the states with a high incidence of tick-borne diseases. In Arkansas the four most frequently occurring tick-borne diseases are Rocky Mountain Spotted Fever (RMSF, also known as Spotted Fever Rickettsiosis), Ehrlichiosis, Tularemia and Anaplasmosis. Lyme disease, on the other hand, is not acquired in Arkansas and is only acquired by traveling to states where Lyme disease is endemic. The majority of tick-borne diseases are diagnosed based on a history of tick bite or exposure and the individual's clinical presentation. The recognition of specific symptoms requires prompt treatment to prevent long-term sequelae. Hence, knowledge of tick-borne diseases and preventive measures can help reduce the risks associated with the infection.

  18. Biochemical perspectives on paralysis and other forms of toxicoses caused by ticks.

    PubMed

    Mans, B J; Gothe, R; Neitz, A W H

    2004-01-01

    Tick toxicoses, of which paralysis is the most widespread and dominant form, are important elements of pathogenesis induced by ticks. Tick paralysis is the most widespread and dominant form of tick toxicoses. Non-paralytic forms of tick toxicoses do occur and evidence suggests that these forms of toxicoses are not evolutionary related. While functional significance has been suggested for tick toxins, the advantages for tick survival in general are not clear. This review considers the molecular nature of tick toxins, the possibility that tick toxins have originated more than once independently and whether these toxins could have unrecognized benign functions.

  19. 26 CFR 301.6103(j)(5)-1 - Disclosures of return information reflected on returns to officers and employees of the...

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... returns to officers and employees of the Department of Agriculture for conducting the census of agriculture. 301.6103(j)(5)-1 Section 301.6103(j)(5)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT... officers and employees of the Department of Agriculture for conducting the census of agriculture....

  20. 26 CFR 301.6103(j)(5)-1 - Disclosures of return information reflected on returns to officers and employees of the...

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... returns to officers and employees of the Department of Agriculture for conducting the census of agriculture. 301.6103(j)(5)-1 Section 301.6103(j)(5)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT... officers and employees of the Department of Agriculture for conducting the census of agriculture....

  1. 26 CFR 301.6103(j)(5)-1 - Disclosures of return information reflected on returns to officers and employees of the...

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... returns to officers and employees of the Department of Agriculture for conducting the census of agriculture. 301.6103(j)(5)-1 Section 301.6103(j)(5)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT... officers and employees of the Department of Agriculture for conducting the census of agriculture....

  2. 26 CFR 301.6103(j)(5)-1 - Disclosures of return information reflected on returns to officers and employees of the...

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... returns to officers and employees of the Department of Agriculture for conducting the census of agriculture. 301.6103(j)(5)-1 Section 301.6103(j)(5)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT... officers and employees of the Department of Agriculture for conducting the census of agriculture....

  3. 26 CFR 301.6103(j)(5)-1 - Disclosures of return information reflected on returns to officers and employees of the...

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... returns to officers and employees of the Department of Agriculture for conducting the census of agriculture. 301.6103(j)(5)-1 Section 301.6103(j)(5)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT... officers and employees of the Department of Agriculture for conducting the census of agriculture....

  4. Tick-Borne Pathogens in Ticks Feeding on Migratory Passerines in Western Part of Estonia

    PubMed Central

    Geller, Julia; Nazarova, Lidia; Katargina, Olga; Leivits, Agu; Järvekülg, Lilian

    2013-01-01

    Abstract During southward migration in the years 2006–2009, 178 migratory passerines of 24 bird species infested with ticks were captured at bird stations in Western Estonia. In total, 249 nymphal ticks were removed and analyzed individually for the presence of Borrelia burgdorferi sensu lato (s.l.), tick-borne encephalitis virus (TBEV), and Anaplasma phagocytophilum. The majority of ticks were collected from Acrocephalus (58%), Turdus (13%), Sylvia (8%), and Parus (6%) bird species. Tick-borne pathogens were detected in nymphs removed from Acrocephalus, Turdus, and Parus bird species. TBEV of the European subtype was detected in 1 I. ricinus nymph removed from A. palustris. B. burgdorferi s.l. DNA was found in 11 ticks (4.4%) collected from Turdus and Parus species. Bird-associated B. garinii and B. valaisiana were detected in I. ricinus nymphs removed from T. merula. Rodent-associated B. afzelii was detected in 3 I. ricinus nymphs from 2 P. major birds. One of the B. afzelii-positive nymphs was infected with a mix of 2 B. afzelii strains, whereas 1 of these strains was also detected in another nymph feeding on the same great tit. The sharing of the same B. afzelii strain by 2 nymphs indicates a possible transmission of B. afzelii by co-feeding on a bird. A. phagocytophilum DNA was detected in 1 I. ricinus nymph feeding on a T. iliacus. The results of the study confirm the possible role of migratory birds in the dispersal of ticks infected with tick-borne pathogens along the southward migration route via Estonia. PMID:23590318

  5. Tick-borne pathogens in ticks feeding on migratory passerines in Western part of Estonia.

    PubMed

    Geller, Julia; Nazarova, Lidia; Katargina, Olga; Leivits, Agu; Järvekülg, Lilian; Golovljova, Irina

    2013-07-01

    During southward migration in the years 2006-2009, 178 migratory passerines of 24 bird species infested with ticks were captured at bird stations in Western Estonia. In total, 249 nymphal ticks were removed and analyzed individually for the presence of Borrelia burgdorferi sensu lato (s.l.), tick-borne encephalitis virus (TBEV), and Anaplasma phagocytophilum. The majority of ticks were collected from Acrocephalus (58%), Turdus (13%), Sylvia (8%), and Parus (6%) bird species. Tick-borne pathogens were detected in nymphs removed from Acrocephalus, Turdus, and Parus bird species. TBEV of the European subtype was detected in 1 I. ricinus nymph removed from A. palustris. B. burgdorferi s.l. DNA was found in 11 ticks (4.4%) collected from Turdus and Parus species. Bird-associated B. garinii and B. valaisiana were detected in I. ricinus nymphs removed from T. merula. Rodent-associated B. afzelii was detected in 3 I. ricinus nymphs from 2 P. major birds. One of the B. afzelii-positive nymphs was infected with a mix of 2 B. afzelii strains, whereas 1 of these strains was also detected in another nymph feeding on the same great tit. The sharing of the same B. afzelii strain by 2 nymphs indicates a possible transmission of B. afzelii by co-feeding on a bird. A. phagocytophilum DNA was detected in 1 I. ricinus nymph feeding on a T. iliacus. The results of the study confirm the possible role of migratory birds in the dispersal of ticks infected with tick-borne pathogens along the southward migration route via Estonia.

  6. Seasonal activity and tick-borne pathogen infection rates of Ixodes ricinus ticks in Hungary.

    PubMed

    Egyed, László; Elő, Péter; Sréter-Lancz, Zsuzsanna; Széll, Zoltán; Balogh, Zsuzsanna; Sréter, Tamás

    2012-04-01

    Ixodes ricinus is the most important tick species in Europe as it is most widely distributed and transmits the majority of tick-borne zoonotic pathogens. As limited data are available for Hungary, the aim of the present study was to investigate the seasonal timing of questing by I. ricinus and the infection rate of this tick species with all major tick-borne zoonotic pathogens. Monthly collections of I. ricinus were carried out over 3 consecutive years by dragging a blanket in 6 biotopes representing different areas of Hungary. Altogether, 1800 nymphs (300 per collection point) were screened as pooled samples (each of 5 specimens) by PCR-based methods for tick-borne pathogens. I. ricinus larvae, nymphs, and adults had bimodal activity patterns with a major peak in the spring. As newly moulted ticks of all stages are thought to emerge in the autumn of each year, it appears that most newly emerged ticks delayed their questing until the following spring. The minimum prevalence of Borrelia burgdorferi sensu lato was 2.5%. Borr. afzelii, Borr. burgdorferi sensu stricto, Borr. garinii, Borr. lusitaniae, and Borr. valaisiana were identified by hybridization. The minimum infection rate with spotted fever group rickettsiae was 1.9%. Rickettsia helvetica was identified in all biotopes. The minimum prevalence of Anaplasma phagocytophilum, Babesia divergens and Bab. microti was low (0.3-0.5%). Bartonella spp.-, Francisella tularensis-, and TBE virus-specific amplification products were not detected. Relative to the results of comparable studies carried out in the Carpathian Basin, the prevalence of tick-borne pathogens was low in Hungary. This might be attributed to the climatic difference between the lowland areas of Hungary and submountain areas of the surrounding countries involved in the studies.

  7. Ticks of Australia. The species that infest domestic animals and humans.

    PubMed

    Barker, Stephen C; Walker, Alan R

    2014-06-18

    The book Australian Ticks by F.H.S. Roberts (1970) is a land-mark in Australian tick biology. But it is time for a new and improved book on the ticks of Australia. The present book has identification guides and accounts of the biology and diseases associated with the 16 species of ticks that may feed on domestic animals and humans in Australia. These comprise five argasid (soft) ticks: Argas persicus (poultry tick), Argas robertsi (Robert's bird tick), Ornithodoros capensis (seabird soft tick), O. gurneyi (kangaroo soft tick), Otobius megnini (spinose ear tick); and 11 ixodid (hard) ticks, Amblyomma triguttatum (ornate kangaroo tick), Bothriocroton auruginans (wombat tick), B. hydrosauri (southern reptile tick), Haemaphysalis bancrofti (wallaby tick), H. longicornis (bush tick), Ixodes cornuatus (southern paralysis tick), I. hirsti (Hirst's marsupial tick), I. holocyclus (paralysis tick), I. tasmani (common marsupial tick), Rhipicephalus (Boophilus) australis (Australian cattle tick) and R. sanguineus (brown dog tick).  We use an image-matching system to identify ticks, much like the image-matching systems used in field-guides for birds and flowers. Ticks may be identified by drawings that emphasise unique matrices of uniformly defined morphological characters that, together, allow these 16 ticks to be identified by morphology unequivocally. The species accounts have seven sections: (i) General; (ii)  Differential diagnosis; (iii) Hosts; (iv) Life-cycle and seasonality; (v) Disease; (vi) Habitat and geographic distribution; (vii) Genes and genomes; and (viii) Other information. There are 71 figures and tables, including a glossary character matrices, drawings of life-cycles, drawings of genera, species, and colour photographs of tick biology.

  8. Changing geographic ranges of ticks and tick-borne pathogens: drivers, mechanisms and consequences for pathogen diversity

    PubMed Central

    Ogden, Nick H.; Mechai, Samir; Margos, Gabriele

    2013-01-01

    The geographic ranges of ticks and tick-borne pathogens are changing due to global and local environmental (including climatic) changes. In this review we explore current knowledge of the drivers for changes in the ranges of ticks and tick-borne pathogen species and strains via effects on their basic reproduction number (R0), and the mechanisms of dispersal that allow ticks and tick-borne pathogens to invade suitable environments. Using the expanding geographic distribution of the vectors and agent of Lyme disease as an example we then investigate what could be expected of the diversity of tick-borne pathogens during the process of range expansion, and compare this with what is currently being observed. Lastly we explore how historic population and range expansions and contractions could be reflected in the phylogeography of ticks and tick-borne pathogens seen in recent years, and conclude that combined study of currently changing tick and tick-borne pathogen ranges and diversity, with phylogeographic analysis, may help us better predict future patterns of invasion and diversity. PMID:24010124

  9. Changing geographic ranges of ticks and tick-borne pathogens: drivers, mechanisms and consequences for pathogen diversity.

    PubMed

    Ogden, Nick H; Mechai, Samir; Margos, Gabriele

    2013-01-01

    The geographic ranges of ticks and tick-borne pathogens are changing due to global and local environmental (including climatic) changes. In this review we explore current knowledge of the drivers for changes in the ranges of ticks and tick-borne pathogen species and strains via effects on their basic reproduction number (R 0), and the mechanisms of dispersal that allow ticks and tick-borne pathogens to invade suitable environments. Using the expanding geographic distribution of the vectors and agent of Lyme disease as an example we then investigate what could be expected of the diversity of tick-borne pathogens during the process of range expansion, and compare this with what is currently being observed. Lastly we explore how historic population and range expansions and contractions could be reflected in the phylogeography of ticks and tick-borne pathogens seen in recent years, and conclude that combined study of currently changing tick and tick-borne pathogen ranges and diversity, with phylogeographic analysis, may help us better predict future patterns of invasion and diversity.

  10. Worldwide distribution and diversity of seabird ticks: implications for the ecology and epidemiology of tick-borne pathogens.

    PubMed

    Dietrich, Muriel; Gómez-Díaz, Elena; McCoy, Karen D

    2011-05-01

    The ubiquity of ticks and their importance in the transmission of pathogens involved in human and livestock diseases are reflected by the growing number of studies focusing on tick ecology and the epidemiology of tick-borne pathogens. Likewise, the involvement of wild birds in dispersing pathogens and their role as reservoir hosts are now well established. However, studies on tick-bird systems have mainly focused on land birds, and the role of seabirds in the ecology and epidemiology of tick-borne pathogens is rarely considered. Seabirds typically have large population sizes, wide geographic distributions, and high mobility, which make them significant potential players in the maintenance and dispersal of disease agents at large spatial scales. They are parasitized by at least 29 tick species found across all biogeographical regions of the world. We know that these seabird-tick systems can harbor a large diversity of pathogens, although detailed studies of this diversity remain scarce. In this article, we review current knowledge on the diversity and global distribution of ticks and tick-borne pathogens associated with seabirds. We discuss the relationship between seabirds, ticks, and their pathogens and examine the interesting characteristics of these relationships from ecological and epidemiological points of view. We also highlight some future research directions required to better understand the evolution of these systems and to assess the potential role of seabirds in the epidemiology of tick-borne pathogens.

  11. 7 CFR 1900.3 - State, district, and county office employees.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... 7 Agriculture 12 2013-01-01 2013-01-01 false State, district, and county office employees. 1900.3 Section 1900.3 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE... AGRICULTURE PROGRAM REGULATIONS GENERAL Delegations of Authority § 1900.3 State, district, and county...

  12. Tick-borne flavivirus infection in Ixodes scapularis larvae: development of a novel method for synchronous viral infection of ticks

    PubMed Central

    Mitzel, Dana N.; Wolfinbarger, James B.; Daniel Long, R.; Masnick, Max; Best, Sonja M.; Bloom, Marshall E.

    2007-01-01

    Following a bite from an infected tick, tick-borne flaviviruses cause encephalitis, meningitis and hemorrhagic fever in humans. Although these viruses spend most of their time in the tick, little is known regarding the virus-vector interactions. We developed a simple method for synchronously infecting Ixodes scapularis larvae with Langat virus (LGTV) by immersion in media containing the virus. This technique resulted in approximately 96% of ticks becoming infected. LGTV infection and replication were demonstrated by both viral antigen expression and the accumulation of viral RNA. Furthermore, ticks transmitted LGTV to 100% of the mice and maintained the virus through molting into the next life stage. This technique circumvents limitations present in the current methods by mimicking the natural route of infection and by using attenuated virus strains to infect ticks; thereby, making this technique a powerful tool to study both virus and tick determinants of replication, pathogenesis and transmission. PMID:17490700

  13. Tick-borne flavivirus infection in Ixodes scapularis larvae: development of a novel method for synchronous viral infection of ticks.

    PubMed

    Mitzel, Dana N; Wolfinbarger, James B; Long, R Daniel; Masnick, Max; Best, Sonja M; Bloom, Marshall E

    2007-09-01

    Following a bite from an infected tick, tick-borne flaviviruses cause encephalitis, meningitis and hemorrhagic fever in humans. Although these viruses spend most of their time in the tick, little is known regarding the virus-vector interactions. We developed a simple method for synchronously infecting Ixodes scapularis larvae with Langat virus (LGTV) by immersion in media containing the virus. This technique resulted in approximately 96% of ticks becoming infected. LGTV infection and replication were demonstrated by both viral antigen expression and the accumulation of viral RNA. Furthermore, ticks transmitted LGTV to 100% of the mice and maintained the virus through molting into the next life stage. This technique circumvents limitations present in the current methods by mimicking the natural route of infection and by using attenuated virus strains to infect ticks, thereby making this technique a powerful tool to study both virus and tick determinants of replication, pathogenesis and transmission.

  14. Prevalence of tick-borne encephalitis virus in Ixodes ricinus ticks from three islands in north-western Norway.

    PubMed

    Paulsen, Katrine M; Pedersen, Benedikte N; Soleng, Arnulf; Okbaldet, Yohannes B; Pettersson, John H-O; Dudman, Susanne G; Ottesen, Preben; Vik, Inger Sofie Samdal; Vainio, Kirsti; Andreassen, Åshild

    2015-09-01

    Tick-borne encephalitis (TBE) is the most important viral tick-borne disease in Europe and can cause severe disease in humans. In Norway, human cases have been reported only from the southern coast. The aim of this study was to investigate the prevalence of tick-borne encephalitis virus (TBEV) in questing Ixodes ricinus ticks from the north-western part of Norway. A total of 4509 ticks were collected by flagging in May and June 2014. A subpopulation of 2220 nymphs and 162 adult ticks were analysed by real-time PCR and positive samples were confirmed by pyrosequencing. The estimated prevalence of TBEV was 3.08% among adult ticks from Sekken in Møre og Romsdal County and 0.41% among nymphs from both Hitra and Frøya in Sør-Trøndelag County. This study indicates that TBEV might be more widespread than the distribution of reported human cases suggests.

  15. Ticks threatening lineage of Anatolian wild sheep (Ovis gmelinii anatolica) and determination of their tick-borne pathogens.

    PubMed

    Orkun, Ömer; Emir, Hasan; Karaer, Zafer

    2016-09-15

    We aimed to determine the ticks of the Anatolian wild sheep and to define their tick-borne pathogens while molecularly studying their relationships with those of the domestic sheep. Furthermore, another aim of this study is to investigate tick paralysis resulting in the death of the Anatolian wild sheep. Ticks and blood samples were collected from the wild sheep whilst tick samples were also collected from hares, guinea fowls, chickens, and a turkey living in the Anatolian wild sheep breeding area. While PCR amplification was carried out for the detection of Babesia spp., Theileria spp. and Anaplasma spp. in blood samples, CCHF virus was screened in the tick samples in addition to the above-mentioned pathogens. Theileria spp. was detected in blood samples of 45 wild sheep. A total of 3494 ticks were collected from 52 Anatolian wild sheep, 5 hares, 5 guinea fowls, 2 chickens, and 1 turkey whereas 98 ticks were collected from the ground. B. ovis and T. ovis were detected in tick pools (Rh. bursa and H. excavatum) that were collected from the wild sheep. The paralysis was diagnosed in both of the hind legs of the newborn lambs infested with a great number of ticks. We also report that the tick species (H. excavatum and Rh. bursa) are determined to cause tick paralysis and tick toxicosis, which are associated with mortality especially in lambs. T. ovis and B. ovis were detected and studied for the first time in Anatolian wild sheep and in their ticks. The results of phylogenetic analyses showed that T. ovis and B. ovis isolates are genetically very close to the isolates that were previously obtained from the domestic small ruminants. We show that the Anatolian wild sheep can play the role of a reservoir for T. ovis. The presence of the CCHF virus has also been clearly shown and it has been observed that this virus, which is very pathogenic for humans, is anywise circulating in the region.

  16. Molecular Detection of Tick-Borne Pathogens in Humans with Tick Bites and Erythema Migrans, in the Netherlands

    PubMed Central

    Jahfari, Setareh; Hofhuis, Agnetha; Fonville, Manoj; van der Giessen, Joke; van Pelt, Wilfrid; Sprong, Hein

    2016-01-01

    Background Tick-borne diseases are the most prevalent vector-borne diseases in Europe. Knowledge on the incidence and clinical presentation of other tick-borne diseases than Lyme borreliosis and tick-borne encephalitis is minimal, despite the high human exposure to these pathogens through tick bites. Using molecular detection techniques, the frequency of tick-borne infections after exposure through tick bites was estimated. Methods Ticks, blood samples and questionnaires on health status were collected from patients that visited their general practitioner with a tick bite or erythema migrans in 2007 and 2008. The presence of several tick-borne pathogens in 314 ticks and 626 blood samples of this cohort were analyzed using PCR-based methods. Using multivariate logistic regression, associations were explored between pathogens detected in blood and self-reported symptoms at enrolment and during a three-month follow-up period. Results Half of the ticks removed from humans tested positive for Borrelia burgdorferi sensu lato, Anaplasma phagocytophilum, Candidatus Neoehrlichia mikurensis, Rickettsia helvetica, Rickettsia monacensis, Borrelia miyamotoi and several Babesia species. Among 92 Borrelia burgdorferi s. l. positive ticks, 33% carried another pathogen from a different genus. In blood of sixteen out of 626 persons with tick bites or erythema migrans, DNA was detected from Candidatus Neoehrlichia mikurensis (n = 7), Anaplasma phagocytophilum (n = 5), Babesia divergens (n = 3), Borrelia miyamotoi (n = 1) and Borrelia burgdorferi s. l. (n = 1). None of these sixteen individuals reported any overt symptoms that would indicate a corresponding illness during the three-month follow-up period. No associations were found between the presence of pathogen DNA in blood and; self-reported symptoms, with pathogen DNA in the corresponding ticks (n = 8), reported tick attachment duration, tick engorgement, or antibiotic treatment at enrolment. Conclusions Based on molecular

  17. The US Air Force Tick Identification Service

    DTIC Science & Technology

    1990-05-22

    Haemaphysal i s concinna - - - - - - - V STT l-e achir- - - - - - - spin gera - - - - - - - - KFD Hyal omma anatolicum - - - - - - - - CCHF asiaticum...STT minaiitumh - - - - - - - - CCHF Ixodes d-ammnini Y - - - - - - - AB holocyclus M - - - - V - - pacacifcus Y...American babesiosis, BF =boutonneuse fever, CTF = Colorado tick fever, 10 TU = tularemia, CCHF = Crimean-Congo hemorrhagic fever, HE = human ehrlichio

  18. Novel rickettsia in ticks, Tasmania, Australia.

    PubMed

    Izzard, Leonard; Graves, Stephen; Cox, Erika; Fenwick, Stan; Unsworth, Nathan; Stenos, John

    2009-10-01

    A novel rickettsia was detected in Ixodes tasmani ticks collected from Tasmanian devils. A total of 55% were positive for the citrate synthase gene by quantitative PCR. According to current criteria for rickettsia speciation, this new rickettsia qualifies as Candidatus Rickettsia tasmanensis, named after the location of its detection.

  19. Ticks Take Cues from Mammalian Interferon.

    PubMed

    de Silva, Aravinda M

    2016-07-13

    Interferons are considered a first line of immune defense restricted to vertebrates. In this issue of Cell Host & Microbe, Smith et al. (2016) demonstrate that mammalian interferon γ activates an antimicrobial response within ticks feeding on blood. The study suggests that arthropods have a parallel interferon-like defense system.

  20. The mitochondrial genome of a Texas outbreak strain of the cattle tick, Rhipicephalus (Boophilus) microplus, derived from whole genome sequencing Pacific Biosciences and Illumina reads

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The cattle fever tick, Rhipicephalus (Boophilus) microplus is one of the most significant medical veterinary pests in the world, vectoring several serious livestock diseases negatively impacting agricultural economies of tropical and subtropical countries around the world. In our study, we assembled...

  1. Employees as Customers: Exploring Service Climate, Employee Patronage, and Turnover

    ERIC Educational Resources Information Center

    Abston, Kristie A.; Kupritz, Virginia W.

    2011-01-01

    The role of retail employees as customers was explored by quantitatively examining the influence of service climate and employee patronage on employee turnover intentions. Employees representing all shifts in two stores of a national retailer participated. Results indicated that employee patronage partially mediates the effects of service climate…

  2. Coxiella Detection in Ticks from Wildlife and Livestock in Malaysia

    PubMed Central

    Khoo, Jing-Jing; Lim, Fang-Shiang; Chen, Fezshin; Phoon, Wai-Hong; Khor, Chee-Sieng; Pike, Brian L.; Chang, Li-Yen

    2016-01-01

    Abstract Recent studies have shown that ticks harbor Coxiella-like bacteria, which are potentially tick-specific endosymbionts. We recently described the detection of Coxiella-like bacteria and possibly Coxiella burnetii in ticks found from rural areas in Malaysia. In the present study, we collected ticks, including Haemaphysalis bispinosa, Haemaphysalis hystricis, Dermacentor compactus, Dermacentor steini, and Amblyomma sp. from wildlife and domesticated goats from four different locations in Malaysia. Coxiella 16s rRNA genomic sequences were detected by PCR in 89% of ticks tested. Similarity analysis and phylogenetic analyses of the 16s rRNA and rpoB partial sequences were performed for 10 representative samples selected based on the tick species, sex, and location. The findings here suggested the presence of C. burnetii in two samples, each from D. steini and H. hystricis. The sequences of both samples clustered with published C. burnetii sequences. The remaining eight tick samples were shown to harbor 16s rRNA sequences of Coxiella-like bacteria, which clustered phylogenetically according to the respective tick host species. The findings presented here added to the growing evidence of the association between Coxiella-like bacteria and ticks across species and geographical boundaries. The importance of C. burnetii found in ticks in Malaysia warrants further investigation. PMID:27763821

  3. Thirty years of tick population genetics: a comprehensive review.

    PubMed

    Araya-Anchetta, Ana; Busch, Joseph D; Scoles, Glen A; Wagner, David M

    2015-01-01

    Population genetic studies provide insights into the basic biology of arthropod disease vectors by estimating dispersal patterns and their potential to spread pathogens. In wingless vectors, such as ticks, gene flow will be defined in large part by the mobility of their hosts. However, tick behaviors and life cycle strategies can limit their dispersal even on highly mobile hosts and lead to an increase in genetic structure. In this review we synthesize the published literature from three decades of tick population genetic studies. Based on studies from 22 tick species (including representatives from Amblyomma, Bothriocroton, Dermacentor, Ixodes, Ornithodoros, and Rhipicephalus), observed levels of population genetic structure in ticks varied from no structure to very high levels. In about half of the species (including representatives from Amblyomma, Bothriocroton, Dermacentor, and Ornithodoros), tick genetic structure appeared to be determined primarily by the movement capacity of hosts, with low gene flow observed in ticks that use smaller bodied less mobile hosts and high gene flow in ticks using highly mobile hosts. In a number of other species (primarily from Ixodes, Ornithodoros, and Rhipicephalus), behavioral limitations to gene flow appeared to result in greater genetic structure than expected based upon host movement capability alone. We also discuss the strengths and limitations of genetic markers and their applicability to ticks and suggest possible analyses when planning population genetic studies for ticks.

  4. Tick burden on European roe deer (Capreolus capreolus)

    PubMed Central

    Kiffner, Christian; Hagedorn, Peter; Niedrig, Matthias; Rühe, Ferdinand

    2010-01-01

    In our study we assessed the tick burden on roe deer (Capreolus capreolus L.) in relation to age, physical condition, sex, deer density and season. The main objective was to find predictive parameters for tick burden. In September 2007, May, July, and September 2008, and in May and July 2009 we collected ticks on 142 culled roe deer from nine forest departments in Southern Hesse, Germany. To correlate tick burden and deer density we estimated deer density using line transect sampling that accounts for different detectability in March 2008 and 2009, respectively. We collected more than 8,600 ticks from roe deer heads and necks, 92.6% of which were Ixodes spp., 7.4% Dermacentor spp. Among Ixodes, 3.3% were larvae, 50.5% nymphs, 34.8% females and 11.4% males, with significant seasonal deviation. Total tick infestation was high, with considerable individual variation (from 0 to 270 ticks/deer). Adult tick burden was positively correlated with roe deer body indices (body mass, age, hind foot length). Significantly more nymphs were found on deer from forest departments with high roe deer density indices, indicating a positive correlation with deer abundance. Overall, tick burden was highly variable. Seasonality and large scale spatial characteristics appeared to be the most important factors affecting tick burden on roe deer. PMID:20099011

  5. Tick burden on European roe deer (Capreolus capreolus).

    PubMed

    Vor, Torsten; Kiffner, Christian; Hagedorn, Peter; Niedrig, Matthias; Rühe, Ferdinand

    2010-08-01

    In our study we assessed the tick burden on roe deer (Capreolus capreolus L.) in relation to age, physical condition, sex, deer density and season. The main objective was to find predictive parameters for tick burden. In September 2007, May, July, and September 2008, and in May and July 2009 we collected ticks on 142 culled roe deer from nine forest departments in Southern Hesse, Germany. To correlate tick burden and deer density we estimated deer density using line transect sampling that accounts for different detectability in March 2008 and 2009, respectively. We collected more than 8,600 ticks from roe deer heads and necks, 92.6% of which were Ixodes spp., 7.4% Dermacentor spp. Among Ixodes, 3.3% were larvae, 50.5% nymphs, 34.8% females and 11.4% males, with significant seasonal deviation. Total tick infestation was high, with considerable individual variation (from 0 to 270 ticks/deer). Adult tick burden was positively correlated with roe deer body indices (body mass, age, hind foot length). Significantly more nymphs were found on deer from forest departments with high roe deer density indices, indicating a positive correlation with deer abundance. Overall, tick burden was highly variable. Seasonality and large scale spatial characteristics appeared to be the most important factors affecting tick burden on roe deer.

  6. Efficiency of flagging and dragging for tick collection.

    PubMed

    Dantas-Torres, Filipe; Lia, Riccardo Paolo; Capelli, Gioia; Otranto, Domenico

    2013-09-01

    It is acknowledged that data from field studies on tick ecology might be biased by collection methods, but actually comparative studies are still limited. Herein we assessed whether the efficiency of flagging and dragging varies according to tick developmental stage, species, season and habitat. Ticks were collected in three sites bordered by an oak forest. The abundance of ticks collected by each collection method varied according to tick species, developmental stage, season, and habitat. Flagging was in general more efficient in collecting adult ticks, especially in spring and winter. Females were more frequently collected by flagging in the meadow and grassland habitats and males in the man-made trail. Flagging collected significantly more adults of Dermacentor marginatus, Hyalomma marginatum, Haemaphysalis inermis and Ixodes ricinus. Flagging was more efficient in collecting D. marginatus and I. ricinus in spring, and H. inermis and I. ricinus females in both spring and winter. In summer and autumn tick abundances were generally similar, with the exception of D. marginatus female in autumn. Flagging was more efficient in collecting D. marginatus adults in the meadow habitat and in the man-made trail, and I. ricinus adults in the meadow and grassland habitats. Dragging was more efficient in grassland for R. turanicus. Our results suggest that variations in terms of collection method performance are associated to factors linked to tick behaviour, habitat characteristics, and climate. Field studies employing these collection methods should take this into account to avoid misleading conclusions about tick population dynamics and tick-borne pathogen transmission risk.

  7. The role of cystatins in tick physiology and blood feeding

    PubMed Central

    Schwarz, Alexandra; Valdés, James J.; Kotsyfakis, Michalis

    2012-01-01

    Summary Ticks, as obligate hematophagous ectoparasites, impact greatly on animal and human health because they transmit various pathogens worldwide. Over the last decade, several cystatins from different hard and soft ticks were identified and biochemically analyzed for their role in the physiology and blood feeding lifestyle of ticks. All these cystatins are potent inhibitors of papain-like cysteine proteases, but not of legumain. Tick cystatins were either detected in the salivary glands and/or the midgut, key tick organs responsible for blood digestion and the expression of pharmacologically potent salivary proteins for blood feeding. For example, the transcription of two cystatins named HlSC-1 and Sialostatin L2 was highly upregulated in these tick tissues during feeding. Vaccinating hosts against Sialostatin L2 and Om-cystatin 2 as well as silencing of a cystatin gene from Amblyomma americanum significantly inhibited the feeding ability of ticks. Additionally, Om-cystatin 2 and Sialostatin L possessed strong host immunosuppressive properties by inhibiting dendritic cell maturation due to their interaction with cathepsin S. These two cystatins, together with Sialostatin L2 are the first tick cystatins with resolved three-dimensional structure. Sialostatin L, furthermore, showed preventive properties against autoimmune diseases. In the case of the cystatin Hlcyst-2, experimental evidence showed its role in tick innate immunity, since increased Hlcyst-2 transcript levels were detected in Babesia gibsoni-infected larval ticks and the protein inhibited Babesia growth. Other cystatins, such as Hlcyst-1 or Om-cystatin 2 are assumed to be involved in regulating blood digestion. Only for Bmcystatin was a role in tick embryogenesis suggested. Finally, all the biochemically analyzed tick cystatins are powerful protease inhibitors, and some may be novel antigens for developing anti-tick vaccines and drugs of medical importance due to their stringent target specificity

  8. Presence of Chlamydiales DNA in ticks and fleas suggests that ticks are carriers of Chlamydiae.

    PubMed

    Croxatto, Antony; Rieille, Nadia; Kernif, Tahar; Bitam, Idir; Aeby, Sébastien; Péter, Olivier; Greub, Gilbert

    2014-06-01

    The Chlamydiales order includes the Chlamydiaceae, Parachlamydiaceae, Waddliaceae, Simkaniaceae, Criblamydiaceae, Rhabdochlamydiaceae, Clavichlamydiaceae, and Piscichlamydiaceae families. Members of the Chlamydiales order are obligate intracellular bacteria that replicate within eukaryotic cells of different origins including humans, animals, and amoebae. Many of these bacteria are pathogens or emerging pathogens of both humans and animals, but their true diversity is largely underestimated, and their ecology remains to be investigated. Considering their potential threat on human health, it is important to expand our knowledge on the diversity of Chlamydiae, but also to define the host range colonized by these bacteria. Thus, using a new pan-Chlamydiales PCR, we analyzed the prevalence of Chlamydiales DNA in ticks and fleas, which are important vectors of several viral and bacterial infectious diseases. To conduct this study, 1340 Ixodes ricinus ticks prepared in 192 pools were collected in Switzerland and 55 other ticks belonging to different tick species and 97 fleas belonging to different flea species were harvested in Algeria. In Switzerland, the prevalence of Chlamydiales DNA in the 192 pools was equal to 28.1% (54/192) which represents an estimated prevalence in the 1340 individual ticks of between 4.0% and 28.4%. The pan-Chlamydiales qPCR was positive for 45% (25/55) of tick samples collected in Algeria. The sequencing of the positive qPCR amplicons revealed a high diversity of Chlamydiales species. Most of them belonged to the Rhabdochlamydiaceae and Parachlamydiaceae families. Thus, ticks may carry Chlamydiales and should thus be considered as possible vectors for Chlamydiales propagation to both humans and animals.

  9. Climate change, biodiversity, ticks and tick-borne diseases: The butterfly effect.

    PubMed

    Dantas-Torres, Filipe

    2015-12-01

    We have killed wild animals for obtaining food and decimated forests for many reasons. Nowadays, we are burning fossil fuels as never before and even exploring petroleum in deep waters. The impact of these activities on our planet is now visible to the naked eye and the debate on climate change is warming up in scientific meetings and becoming a priority on the agenda of both scientists and policy decision makers. On the occasion of the Impact of Environmental Changes on Infectious Diseases (IECID) meeting, held in the 2015 in Sitges, Spain, I was invited to give a keynote talk on climate change, biodiversity, ticks and tick-borne diseases. The aim of the present article is to logically extend my rationale presented on the occasion of the IECID meeting. This article is not intended to be an exhaustive review, but an essay on climate change, biodiversity, ticks and tick-borne diseases. It may be anticipated that warmer winters and extended autumn and spring seasons will continue to drive the expansion of the distribution of some tick species (e.g., Ixodes ricinus) to northern latitudes and to higher altitudes. Nonetheless, further studies are advocated to improve our understanding of the complex interactions between landscape, climate, host communities (biodiversity), tick demography, pathogen diversity, human demography, human behaviour, economics, and politics, also considering all ecological processes (e.g., trophic cascades) and other possible interacting effects (e.g., mutual effects of increased greenhouse gas emissions and increased deforestation rates). The multitude of variables and interacting factors involved, and their complexity and dynamism, make tick-borne transmission systems beyond (current) human comprehension. That is, perhaps, the main reason for our inability to precisely predict new epidemics of vector-borne diseases in general.

  10. Climate change, biodiversity, ticks and tick-borne diseases: The butterfly effect

    PubMed Central

    Dantas-Torres, Filipe

    2015-01-01

    We have killed wild animals for obtaining food and decimated forests for many reasons. Nowadays, we are burning fossil fuels as never before and even exploring petroleum in deep waters. The impact of these activities on our planet is now visible to the naked eye and the debate on climate change is warming up in scientific meetings and becoming a priority on the agenda of both scientists and policy decision makers. On the occasion of the Impact of Environmental Changes on Infectious Diseases (IECID) meeting, held in the 2015 in Sitges, Spain, I was invited to give a keynote talk on climate change, biodiversity, ticks and tick-borne diseases. The aim of the present article is to logically extend my rationale presented on the occasion of the IECID meeting. This article is not intended to be an exhaustive review, but an essay on climate change, biodiversity, ticks and tick-borne diseases. It may be anticipated that warmer winters and extended autumn and spring seasons will continue to drive the expansion of the distribution of some tick species (e.g., Ixodes ricinus) to northern latitudes and to higher altitudes. Nonetheless, further studies are advocated to improve our understanding of the complex interactions between landscape, climate, host communities (biodiversity), tick demography, pathogen diversity, human demography, human behaviour, economics, and politics, also considering all ecological processes (e.g., trophic cascades) and other possible interacting effects (e.g., mutual effects of increased greenhouse gas emissions and increased deforestation rates). The multitude of variables and interacting factors involved, and their complexity and dynamism, make tick-borne transmission systems beyond (current) human comprehension. That is, perhaps, the main reason for our inability to precisely predict new epidemics of vector-borne diseases in general. PMID:26835253

  11. Molecular Detection and Characterization of Tick-borne Pathogens in Dogs and Ticks from Nigeria

    PubMed Central

    Kamani, Joshua; Baneth, Gad; Mumcuoglu, Kosta Y.; Waziri, Ndadilnasiya E.; Eyal, Osnat; Guthmann, Yifat; Harrus, Shimon

    2013-01-01

    Background Only limited information is currently available on the prevalence of vector borne and zoonotic pathogens in dogs and ticks in Nigeria. The aim of this study was to use molecular techniques to detect and characterize vector borne pathogens in dogs and ticks from Nigeria. Methodology/Principal Findings Blood samples and ticks (Rhipicephalus sanguineus, Rhipicephalus turanicus and Heamaphysalis leachi) collected from 181 dogs from Nigeria were molecularly screened for human and animal vector-borne pathogens by PCR and sequencing. DNA of Hepatozoon canis (41.4%), Ehrlichia canis (12.7%), Rickettsia spp. (8.8%), Babesia rossi (6.6%), Anaplasma platys (6.6%), Babesia vogeli (0.6%) and Theileria sp. (0.6%) was detected in the blood samples. DNA of E. canis (23.7%), H. canis (21.1%), Rickettsia spp. (10.5%), Candidatus Neoehrlichia mikurensis (5.3%) and A. platys (1.9%) was detected in 258 ticks collected from 42 of the 181 dogs. Co- infections with two pathogens were present in 37% of the dogs examined and one dog was co-infected with 3 pathogens. DNA of Rickettsia conorii israelensis was detected in one dog and Rhipicephalus sanguineus tick. DNA of another human pathogen, Candidatus N. mikurensis was detected in Rhipicephalus sanguineus and Heamaphysalis leachi ticks, and is the first description of Candidatus N. mikurensis in Africa. The Theileria sp. DNA detected in a local dog in this study had 98% sequence identity to Theileria ovis from sheep. Conclusions/Significance The results of this study indicate that human and animal pathogens are abundant in dogs and their ticks in Nigeria and portray the potential high risk of human exposure to infection with these agents. PMID:23505591

  12. Molecular detection of tick-borne pathogens in Rhipicephalus sanguineus group ticks.

    PubMed

    Latrofa, Maria Stefania; Dantas-Torres, Filipe; Giannelli, Alessio; Otranto, Domenico

    2014-10-01

    The Rhipicephalus sanguineus group includes some of the most widespread dog ticks, whose identification currently represents a difficult task due to the morphological similarities of these ixodid species. Recently, following the morphological and molecular characterization of tick specimens collected from dogs in all continents, Rhipicephalus sanguineus sensu lato (s.l.), Rhipicephalus turanicus and three different operational taxonomic units (namely Rhipicephalus sp. I-III) have been identified. Therefore, a comprehensive molecular study has been herein carried out to detect selected canine vector-borne pathogens (i.e., Anaplasma platys, Cercopithifilaria spp., Ehrlichia canis and Hepatozoon canis) in ticks belonging to the R. sanguineus group. A total of 204 tick specimens from dogs were examined and identified as R. sanguineus s.l. (n=81), R. turanicus (n=17), Rhipicephalus sp. I (n=66), Rhipicephalus sp. II (n=37), and Rhipicephalus sp. III (n=3). PCR assays were performed to detect mitochondrial and ribosomal target genes of Cercopithifilaria spp., A. platys, E. canis and H. canis. Out of 204 specimens examined, 2.5%, 7.4% and 21.6% scored positive to A. platys, H. canis and Cercopithifilaria spp., respectively. In addition, co-infections with two pathogens (i.e., Cercopithifilaria bainae and A. platys or H. canis) were detected in four tick specimens. This study suggests a relationship between ticks belonging to the R. sanguineus group and the geographical distribution of A. platys, H. canis and Cercopithifilaria spp. However, the role of each representative tick species within the R. sanguineus group in the transmission of these canine pathogens needs to be further investigated.

  13. Phylogeographic characterization of tick-borne encephalitis virus from patients, rodents and ticks in Slovenia.

    PubMed

    Fajs, Luka; Durmiši, Emina; Knap, Nataša; Strle, Franc; Avšič-Županc, Tatjana

    2012-01-01

    Tick-borne encephalitis virus (TBEV) is the most important arboviral agent causing infections of the central nervous system in central Europe. Previous studies have shown that TBEV exhibits pronounced genetic variability, which is often correlated to the geographical origin of TBEV. Genetic variability of TBEV has previously been studied predominantly in rodents and ticks, while information about the variability in patients is scarce. In order to understand the molecular relationships of TBEV between natural hosts, vectors and humans, as well as correlation between phylogenetic and geographical clustering, sequences of TBEV E and NS5 protein genes, were obtained by direct sequencing of RT-PCR products from TBE-confirmed patients as well as from rodents and ticks collected from TBE-endemic regions in Slovenia. A total of 27 partial E protein gene sequences representing 15 human, 4 rodent and 8 tick samples and 30 partial NS5 protein gene sequences representing 17 human, 5 rodent and 8 tick samples were obtained. The complete genome sequence of TBEV strain Ljubljana I was simultaneously obtained. Phylogenetic analysis of the E and NS5 protein gene sequences revealed a high degree of TBEV variability in patients, ticks and rodents. Furthermore, an evident correlation between geographical and phylogenetic clustering was shown that was independent of the TBEV host. Moreover, we show the presence of a possible recombination event in the TBEV genome obtained from a patient sample, which was supported with multiple recombination event detection methods. This is the first study that simultaneously analyzed the genetic relationships of directly sequenced TBEV samples from patients, ticks and rodents and provides the largest set of patient-derived TBEV sequences up to date. In addition, we have confirmed the geographical clustering of TBEV sequences in Slovenia and have provided evidence of a possible recombination event in the TBEV genome, obtained from a patient.

  14. A survey of tick-borne pathogens in dogs and their ticks in the Pantanal biome, Brazil.

    PubMed

    Melo, A L T; Witter, R; Martins, T F; Pacheco, T A; Alves, A S; Chitarra, C S; Dutra, V; Nakazato, L; Pacheco, R C; Labruna, M B; Aguiar, D M

    2016-03-01

    Tick and blood samples collected from domestic dogs in the Brazilian Pantanal were tested by molecular methods for the presence of tick-borne protozoa and bacteria. Among 320 sampled dogs, 3.13% were infected by Babesia vogeli (Piroplasmida: Babesiidae), 8.75% by Hepatozoon canis (Eucoccidiorida: Hepatozoidae), 7.19% by Anaplasma platys (Rickettsiales: Anaplasmataceae), and 0.94% by an unclassified Anaplasma sp. In three tick species collected from dogs, the following tick-borne agents were detected: (a) B. vogeli, An. platys and Ehrlichia canis (Rickettsiales: Anaplasmataceae), infecting Rhipicephalus sanguineus sensu lato (Ixodida: Ixodidae) ticks; (b) H. canis, an unclassified Anaplasma sp. and Rickettsia amblyommii (Rickettsiales: Rickettsiaceae), infecting Amblyomma cajennense sensu lato (Ixodida: Ixodidae) ticks, and (c) Rickettsia sp. strain Atlantic rainforest, an emerging human pathogen, infecting Amblyomma ovale ticks. Molecular analysis, based on a mitochondrial gene, revealed that the Am. cajennense s.l. ticks of the present study corresponded to Amblyomma sculptum, a member of the Am. cajennense species complex, and that Rh. sanguineus s.l. belonged to the tropical lineage. Whereas dogs are exposed to a number of tick-borne bacterial and protozoan agents in the Pantanal biome, humans are potentially exposed to infection by spotted fever group rickettsiae (e.g. R. amblyommii and Rickettsia sp. strain Atlantic rainforest) because both Am. sculptum and Am. ovale are among the most important human-biting ticks in Brazil.

  15. Altitudinal patterns of tick and host abundance: a potential role for climate change in regulating tick-borne diseases?

    PubMed

    Gilbert, Lucy

    2010-01-01

    The impact of climate change on vector-borne infectious diseases is currently controversial. In Europe the primary arthropod vectors of zoonotic diseases are ticks, which transmit Borrelia burgdorferi sensu lato (the agent of Lyme disease), tick-borne encephalitis virus and louping ill virus between humans, livestock and wildlife. Ixodes ricinus ticks and reported tick-borne disease cases are currently increasing in the UK. Theories for this include climate change and increasing host abundance. This study aimed to test how I. ricinus tick abundance might be influenced by climate change in Scotland by using altitudinal gradients as a proxy, while also taking into account the effects of hosts, vegetation and weather effects. It was predicted that tick abundance would be higher at lower altitudes (i.e. warmer climates) and increase with host abundance. Surveys were conducted on nine hills in Scotland, all of open moorland habitat. Tick abundance was positively associated with deer abundance, but even after taking this into account, there was a strong negative association of ticks with altitude. This was probably a real climate effect, with temperature (and humidity, i.e. saturation deficit) most likely playing an important role. It could be inferred that ticks may become more abundant at higher altitudes in response to climate warming. This has potential implications for pathogen prevalence such as louping ill virus if tick numbers increase at elevations where competent transmission hosts (red grouse Lagopus lagopus scoticus and mountain hares Lepus timidus) occur in higher numbers.

  16. Ixodid ticks of road-killed wildlife species in southern Italy: new tick-host associations and locality records.

    PubMed

    Lorusso, Vincenzo; Lia, Riccardo Paolo; Dantas-Torres, Filipe; Mallia, Egidio; Ravagnan, Silvia; Capelli, Gioia; Otranto, Domenico

    2011-11-01

    The present study aimed to identify ticks collected from road-killed wildlife species retrieved in several localities of southern Italy and to assess the presence of Borrelia burgdorferi sensu lato, Anaplasma phagocytophilum and Rickettsia spp. DNA in ticks. Collections were carried out from January 2000 to December 2009 on wild animals found dead within the territories of 11 municipalities from three regions (i.e., Apulia, Basilicata, and Calabria). In total, 189 carcasses of wild animals belonging to 10 species were checked for tick infestation, and 40 animals belonging to seven species were found parasitized. One hundred and twenty-five ixodid ticks (11 larvae, 14 nymphs, 77 males, and 23 females) were collected and identified as belonging to nine species, namely Dermacentor marginatus, Haemaphysalis erinacei, Hyalomma marginatum, Ixodes acuminatus, Ixodes canisuga, Ixodes hexagonus, Ixodes ricinus, Rhipicephalus bursa, and Rhipicephalus turanicus. None of the 36 tick specimens tested by PCR was positive for tick-borne pathogens. The results add new information on the tick fauna associated with wild animals in Italy, reporting new tick-host associations. Further field studies are still needed to ascertain the suitability of certain wildlife species as hosts for some tick species, particularly for those implicated in the transmission of pathogens to domestic animals and humans. Finally, from a conservation perspective, it would be interesting to assess whether these wild animals (e.g., Lepus corsicanus) are exposed to tick-borne pathogens, investigating the possible implications for their health and behavior.

  17. Artificial feeding of Rhipicephalus microplus female ticks with anti calreticulin serum do not influence tick and Babesia bigemina acquisition.

    PubMed

    Antunes, Sandra; Merino, Octávio; Lérias, Joana; Domingues, Nuno; Mosqueda, Juan; de la Fuente, José; Domingos, Ana

    2015-02-01

    Ticks are obligate haematophagous ectoparasites considered the principal vectors of disease among animals. Rhipicephalus microplus and R. annulatus ticks are the most important vectors for Babesia bigemina and B. bovis, two of the most important intraerythrocytic protozoan parasites species in cattle, responsible for babesiosis which together with anaplasmosis account for substantial economic losses in the livestock industry worldwide. Anti-tick vaccines are a proved alternative to traditional tick and tick borne diseases control methods but are still limited primarily due to the lack of effective antigens. Subsequently to the identification of antigens the validation is a laborious work often expensive. Tick artificial feeding, is a low cost alternative to test antigens allowing achieving critical data. Herein, R. microplus females were successfully artificially fed using capillary tubes. Calreticulin (CRT) protein, which in a previous study has been identified as being involved in B. bigemina infection in R. annulatus ticks, was expressed as recombinant protein (rCRT) in an E. coli expression system and antibodies raised against rCRT. Anti-rCRT serum was supplemented to a blood meal, offered to partially engorged R. microplus females and their effect in feeding process as well as infection by B. bigemina was analyzed. No significant reductions in tick and egg weight were observed when ticks fed with anti-rCRT serum. Furthermore, B. bigemina infection levels did not show a statistically significant decrease when ticks fed with anti-rCRT antibodies. Results suggest that CRT is not a suitable candidate for cattle vaccination trials.

  18. Managing employee performance.

    PubMed

    McConnell, Charles R

    2004-01-01

    Performance management consists of significantly more than periodic evaluation of performance. It is the art and science of dealing with employees in a manner intended to positively influence their thinking and behavior to achieve a desired level of performance. It is essential for the manager to always model positive behavior concerning performance; what one does or says as a manager always has an influence on others. The kinds of employee behavior most likely encountered relative to performance management efforts stem from resistance to change and lack of complete understanding of what is expected. Employee participation must be elicited whenever possible for performance improvement; as far as the inner working details of a specific job are concerned, there is no one who knows the job better than the person who does it everyday. For each task to be done, an employee needs to know what output is expected, how this output will be measured, and what standards are applied in assessing the output. Managing employee performance requires ongoing contact with each employee, regular feedback, and whatever coaching, counseling, and training are necessary to bring an employee back on track when a problem appears. Sustaining efficient and effective employee performance requires the manager's ongoing attention and involvement.

  19. Employee Exit Interviews.

    ERIC Educational Resources Information Center

    Paulk, Larry J.

    1984-01-01

    Describes an exit interview procedure for employees leaving the school system designed to identify potential personnel problems, maintain good employee relations, provide statistics on reasons for turnover, and provide assessment data for inservice education programs. Reports statistical data based on interview implementation, 1981-83. (TE)

  20. Ticks as the main target of human tick-borne disease control: Russian practical experience and its lessons.

    PubMed

    Uspensky, I

    1999-06-01

    For several decades, the emphasis in human tick-borne disease control has been on the epidemiologically-based preventive (non-specific) approach where tick vectors were the main target of control impact. A long-term, large-scale campaign for controlling the taiga tick Ixodes persulcatus, the main vector of tick-borne encephalitis, was carried out in Russia in the 1950s to 1970s. The practical experience accumulated during that campaign could be of great value for the current development of strategies of tick-borne disease control. A general scheme of human protection from tick-borne diseases is presented where the required investment into protection is proportional to the risk of human infection and particular strategies of control and protection are differentiated. The critical point in the preventive approach is the necessity of radical tick suppression in the areas with the highest risk of human infection that can be successfully achieved only through chemical treatment directed at the eradication of the entire tick population. The following aspects are considered: the tick population (or a group of populations) as a desirable target of any acaricidal impact (biological and geographic aspects, the fate of the population after treatment); the advantage of long-term planning for control campaigns; and the influence of acaricidal impact on foci of tick-borne diseases. The conception of losses of potential pesticidal impact efficacy provides much room for the improvement of conventional tick control strategies making them more efficient and safe to the environment. The current tendency to make humans the main target of control through vaccination and/or medical treatment (specific approach) does not fit the objectives of effective human protection from tick-borne diseases, especially because of a tick population's ability to carry and transmit more than one pathogen over the same area.

  1. Effects of deer density on tick infestation of rodents and the hazard of tick-borne encephalitis. I: empirical assessment.

    PubMed

    Cagnacci, F; Bolzoni, L; Rosà, R; Carpi, G; Hauffe, H C; Valent, M; Tagliapietra, V; Kazimirova, M; Koci, J; Stanko, M; Lukan, M; Henttonen, H; Rizzoli, A

    2012-04-01

    Tick borne encephalitis (TBE) is endemic to eastern and central Europe with broad temporal and spatial variation in infection risk. Although many studies have focused on understanding the environmental and socio-economic factors affecting exposure of humans to TBE, comparatively little research has been devoted to assessing the underlying ecological mechanisms of TBE occurrence in enzootic cycles, and therefore TBE hazard. The aim of this study was to evaluate the effect of the main ungulate tick hosts on the pattern of tick infestation in rodents and TBE occurrence in rodents and questing adult ticks. In this empirical study, we considered three areas where endemic human TBE occurs and three control sites having no reported human TBE cases. In these six sites located in Italy and Slovakia, we assessed deer density using the pellet group count-plot sampling technique, collected questing ticks, live-trapped rodents (primarily Apodemus flavicollis and Myodes glareolus) and counted ticks feeding on rodents. Both rodents and questing ticks were screened for TBE infection. TBE infection in ticks and rodents was positively associated with the number of co-feeding ticks on rodents and negatively correlated with deer density. We hypothesise that the negative relationship between deer density and TBE occurrence on a local scale (defined by the minimum overlapping area of host species) could be attributed to deer (incompetent hosts) diverting questing ticks from rodents (competent hosts), know as the 'dilution effect hypothesis'. We observed that, after an initial increase, the number of ticks feeding on rodents reached a peak for an intermediate value of estimated deer density and then decreased. Therefore, while at a regional scale, tick host availability has already been shown to be directly correlated with TBE distribution, our results suggest that the interactions between deer, rodents and ticks are much more complex on a local scale, supporting the possibility of a

  2. A quantitative synthesis of the role of birds in carrying ticks and tick-borne pathogens in North America.

    PubMed

    Loss, Scott R; Noden, Bruce H; Hamer, Gabriel L; Hamer, Sarah A

    2016-12-01

    Birds play a central role in the ecology of tick-borne pathogens. They expand tick populations and pathogens across vast distances and serve as reservoirs that maintain and amplify transmission locally. Research into the role of birds for supporting ticks and tick-borne pathogens has largely been descriptive and focused in small areas. To expand inference beyond these studies, we conducted a quantitative review at the scale of North America to identify avian life history correlates of tick infestation and pathogen prevalence, calculate species-level indices of importance for carrying ticks, and identify research gaps limiting understanding of tick-borne pathogen transmission. Across studies, 78 of 162 bird species harbored ticks, yielding an infestation prevalence of 1981 of 38,929 birds (5.1 %). Avian foraging and migratory strategies interacted to influence infestation. Ground-foraging species, especially non-migratory ground foragers, were disproportionately likely to have high prevalence and intensity of tick infestation. Studies largely focused on Borrelia burgdorferi, the agent of Lyme disease, and non-migratory ground foragers were especially likely to carry B. burgdorferi-infected ticks, a finding that highlights the potential importance of resident birds in local pathogen transmission. Based on infestation indices, all "super-carrier" bird species were passerines. Vast interior areas of North America, many bird and tick species, and most tick-borne pathogens, remain understudied, and research is needed to address these gaps. More studies are needed that quantify tick host preferences, host competence, and spatiotemporal variation in pathogen prevalence and vector and host abundance. This information is crucial for predicting pathogen transmission dynamics under future global change.

  3. Federal Employees' Compensation Act.

    PubMed

    Ladou, Joseph

    2009-01-01

    The Federal Employees' Compensation Act (FECA) program provides wage loss compensation and payments for medical treatment to federal civilian employees. Administered by the Department of Labor (DOL), FECA covers over 2.7 million federal employees in more than 70 different agencies. FECA costs rose from $1.4 billion in 1990 to $2.6 in 2006, while the federal workforce remained essentially unchanged. While federal civilian employees represent only 2.1% of all workers eligible for workers' compensation benefits, federal programs account for 6% of the benefits paid. Disability benefits under FECA are far greater than those in the state workers' compensation programs. The benefit payments often exceed the former salary of the injured employee. The last congressional hearings on the FECA program were held over thirty years ago. It is unlikely that Congressional review will occur any time soon, as the entrenched bureaucracy that benefits from the FECA program defines and protects its future.

  4. Assessment of bacterial diversity in the cattle tick Rhipicephalus (Boophilus) microplus through tag-encoded pyrosequencing

    PubMed Central

    2011-01-01

    Background Ticks are regarded as the most relevant vectors of disease-causing pathogens in domestic and wild animals. The cattle tick, Rhipicephalus (Boophilus) microplus, hinders livestock production in tropical and subtropical parts of the world where it is endemic. Tick microbiomes remain largely unexplored. The objective of this study was to explore the R. microplus microbiome by applying the bacterial 16S tag-encoded FLX-titanium amplicon pyrosequencing (bTEFAP) technique to characterize its bacterial diversity. Pyrosequencing was performed on adult males and females, eggs, and gut and ovary tissues from adult females derived from samples of R. microplus collected during outbreaks in southern Texas. Results Raw data from bTEFAP were screened and trimmed based upon quality scores and binned into individual sample collections. Bacteria identified to the species level include Staphylococcus aureus, Staphylococcus chromogenes, Streptococcus dysgalactiae, Staphylococcus sciuri, Serratia marcescens, Corynebacterium glutamicum, and Finegoldia magna. One hundred twenty-one bacterial genera were detected in all the life stages and tissues sampled. The total number of genera identified by tick sample comprised: 53 in adult males, 61 in adult females, 11 in gut tissue, 7 in ovarian tissue, and 54 in the eggs. Notable genera detected in the cattle tick include Wolbachia, Coxiella, and Borrelia. The molecular approach applied in this study allowed us to assess the relative abundance of the microbiota associated with R. microplus. Conclusions This report represents the first survey of the bacteriome in the cattle tick using non-culture based molecular approaches. Comparisons of our results with previous bacterial surveys provide an indication of geographic variation in the assemblages of bacteria associated with R. microplus. Additional reports on the identification of new bacterial species maintained in nature by R. microplus that may be pathogenic to its vertebrate hosts

  5. Infection Prevalences of Common Tick-borne Pathogens in Adult Lone Star Ticks (Amblyomma americanum) and American Dog Ticks (Dermacentor variabilis) in Kentucky

    PubMed Central

    Fritzen, Charissa M.; Huang, Junjun; Westby, Kathleen; Freye, James D.; Dunlap, Brett; Yabsley, Michael J.; Schardein, Mike; Dunn, John R.; Jones, Timothy F.; Moncayo, Abelardo C.

    2011-01-01

    Rocky Mountain spotted fever, Lyme disease, and ehrlichiosis are tick-borne diseases that are reported annually in Kentucky. We conducted a survey to describe infection prevalence of tick-borne pathogens in Amblyomma americanum and Dermacentor variabilis ticks collected in Kentucky. During 2007–2008, we collected 287 ticks (179 D. variabilis and 108 A. americanum) from canine, feral hog, horse, raccoon, white-tailed deer, and human hosts in six counties in Kentucky. Ticks were screened for Rickettsia spp., Borrelia spp., and Ehrlichia spp. by using polymerase chain reaction. Forty-one (14.3%) ticks (31 A. americanum and 10 D. variabilis) were polymerase chain reaction–positive for a Rickettsia spp. Fourteen (4.9%) ticks (6 A. americanum and 8 D. variabilis) were positive for E. chaffeensis, and 4 A. americanum (1.4%) were positive for E. ewingii. One (0.4%) A. americanum was positive for Borrelia lonestari. Although Rocky Mountain spotted fever is diagnosed in Kentucky, no R. rickettsii was found in ticks in this study. PMID:21976578

  6. Infection prevalences of common tick-borne pathogens in adult lone star ticks (Amblyomma americanum) and American dog ticks (Dermacentor variabilis) in Kentucky.

    PubMed

    Fritzen, Charissa M; Huang, Junjun; Westby, Kathleen; Freye, James D; Dunlap, Brett; Yabsley, Michael J; Schardein, Mike; Dunn, John R; Jones, Timothy F; Moncayo, Abelardo C

    2011-10-01

    Rocky Mountain spotted fever, Lyme disease, and ehrlichiosis are tick-borne diseases that are reported annually in Kentucky. We conducted a survey to describe infection prevalence of tick-borne pathogens in Amblyomma americanum and Dermacentor variabilis ticks collected in Kentucky. During 2007-2008, we collected 287 ticks (179 D. variabilis and 108 A. americanum) from canine, feral hog, horse, raccoon, white-tailed deer, and human hosts in six counties in Kentucky. Ticks were screened for Rickettsia spp., Borrelia spp., and Ehrlichia spp. by using polymerase chain reaction. Forty-one (14.3%) ticks (31 A. americanum and 10 D. variabilis) were polymerase chain reaction-positive for a Rickettsia spp. Fourteen (4.9%) ticks (6 A. americanum and 8 D. variabilis) were positive for E. chaffeensis, and 4 A. americanum (1.4%) were positive for E. ewingii. One (0.4%) A. americanum was positive for Borrelia lonestari. Although Rocky Mountain spotted fever is diagnosed in Kentucky, no R. rickettsii was found in ticks in this study.

  7. Detection of Rickettsia and Anaplasma from hard ticks in Thailand.

    PubMed

    Malaisri, Premnika; Hirunkanokpun, Supanee; Baimai, Visut; Trinachartvanit, Wachareeporn; Ahantarig, Arunee

    2015-12-01

    We collected a total of 169 adult hard ticks and 120 nymphs from under the leaves of plants located along tourist nature trails in ten localities. The results present data examining the vector competence of ticks of different genera and the presence of Rickettsia and Anaplasma species. The ticks belonged to three genera, Amblyomma, Dermacentor, and Haemaphysalis, comprising 11 species. Rickettsia bacteria were detected at three collection sites, while Anaplasma bacteria were detected at only one site. Phylogenetic analysis revealed new rickettsia genotypes from Thailand that were closely related to Rickettsia tamurae, Rickettsia monacensis, and Rickettsia montana. This study was also the first to show that Anaplasma bacteria are found in Haemaphysalis shimoga ticks and are closely related evolutionarily to Anaplasma bovis. These results provide additional information for the geographical distribution of tick species and tick-borne bacteria in Thailand and can therefore be applied for ecotourism management.

  8. The mitochondrial genome of the lone star tick (Amblyomma americanum).

    PubMed

    Williams-Newkirk, Amanda J; Burroughs, Mark; Changayil, Shankar S; Dasch, Gregory A

    2015-09-01

    Amblyomma americanum is an abundant tick in the southeastern, midwestern, and northeastern United States. It is a vector of multiple diseases, but limited genomic resources are available for it. We sequenced the complete mitochondrial genome of a single female A. americanum collected in Georgia using the Illumina platform. The consensus sequence was 14,709 bp long, and the mean coverage across the assembly was >12,000×. All expected tick genomic features were present, including two "Tick-Box" motifs, and in the expected order for the Metastriata. Heteroplasmy rates were low compared to the most closely related tick for which data are available, Amblyomma cajennense. The phylogeny derived from the concatenated protein coding and rRNA genes from the 33 available tick mitochondrial genomes was consistent with those previously proposed for the Acari. This is the first complete mitochondrial sequence for A. americanum, which provides a useful reference for future studies of A. americanum population genetics and tick phylogeny.

  9. Methods for control of tick vectors of Lyme Borreliosis

    USGS Publications Warehouse

    Jaenson, T.G.T.; Fish, D.; Ginsberg, H.S.; Gray, J.S.; Mather, T.N.; Piesman, J.

    1991-01-01

    During the IVth International Conference on Lyme Borreliosis in Stockholm, 1990, a workshop on control of Lyme disease vectors briefly reviewed: basic ecological principles for tick control; biocontrol of ticks; chemical control, including the use of repellents and use of permethrin-treated rodent nest material; tick control by habitat modification; and reduction of tick host availability. It was concluded that, although much research work remains, Lyme borreliosis is to a large extent a preventable infection. Avoidance of heavily tick-infested areas, personal protection using proper clothing, and prompt removal of attached ticks remain the most effective protective measures. Many other prophylactic measures are available and could be efficiently integrated into schemes to reduce the abundance of vectors. However, since the ecology of the infection varies greatly between different localities it may be necessary to apply different combinations of control methods in different endemic regions.

  10. Ticks and tick-borne pathogens in South Bohemia (Czech Republic)--Spatial variability in Ixodes ricinus abundance, Borrelia burgdorferi and tick-borne encephalitis virus prevalence.

    PubMed

    Hönig, V; Svec, P; Halas, P; Vavruskova, Z; Tykalova, H; Kilian, P; Vetiskova, V; Dornakova, V; Sterbova, J; Simonova, Z; Erhart, J; Sterba, J; Golovchenko, M; Rudenko, N; Grubhoffer, L

    2015-07-01

    Spatial distribution of Ixodes ricinus tick host-seeking activity, as well as prevalence of Borrelia burgdorferi sensu lato and tick-borne encephalitis virus (TBEV) were studied in the TBE endemic area of South Bohemia (Czech Republic). High variability in tick abundance detected in a network of 30 study sites was most closely associated with characteristics of vegetation cover. Of 11,182 tested tick samples, 12% carried DNA of spirochete from B. burgdorferi s.l. complex. B. afzelii and B. garinii prevailed among spirochete species. The presence of B. spielmanii in the region was confirmed. The median number of borrelial genome copies in positive samples reached 6.6 × 10(3) by real-time PCR. The total prevalence of TBEV in pooled samples reached 0.32% (20,057 samples tested), at least one TBEV positive tick was present in 21 out of 30 sampling sites.

  11. Ticks and spotted fever group rickettsiae of southeastern Virginia.

    PubMed

    Nadolny, Robyn M; Wright, Chelsea L; Sonenshine, Daniel E; Hynes, Wayne L; Gaff, Holly D

    2014-02-01

    The incidence of tick-borne rickettsial disease in the southeastern United States has been rising steadily through the past decade, and the range expansions of tick species and tick-borne infectious agents, new and old, has resulted in an unprecedented mix of vectors and pathogens. The results of an ongoing 4-year surveillance project describe the relative abundance of questing tick populations in southeastern Virginia. Since 2009, more than 66,000 questing ticks of 7 species have been collected from vegetation in a variety of habitats, with Amblyomma americanum constituting over 95% of ticks collected. Other species represented included Ixodes scapularis, Dermacentor variabilis, Amblyomma maculatum, Ixodes affinis, Haemaphysalis leporispalustris, and Ixodes brunneus. We found that 26.9-54.9% of A. americanum ticks tested were positive for Rickettsia amblyommii, a non-pathogenic symbiont of this tick species. We also found no evidence of R. rickettsii in D. variabilis ticks, although they did show low infection rates of R. montanensis (1.5-2.0%). Rickettsia parkeri and Candidatus R. andeanae were found in 41.8-55.7% and 0-1.5% A. maculatum ticks, respectively. The rate of R. parkeri in A. maculatum ticks is among the highest in the literature and has increased in the 2 years since R. parkeri and A. maculatum were first reported in southeastern Virginia. We conclude that tick populations in southeastern Virginia have recently undergone dramatic changes in species and abundance and that these populations support a variety of rickettsial agents with the potential for increased risk to human health.

  12. Borrelia lonestari DNA in adult Amblyomma americanum ticks, Alabama.

    PubMed Central

    Burkot, T. R.; Mullen, G. R.; Anderson, R.; Schneider, B. S.; Happ, C. M.; Zeidner, N. S.

    2001-01-01

    Polymerase chain reaction analysis of 204 Amblyomma americanum and 28 A. maculatum ticks collected in August 1999 near the homes of patients with southern tick-associated rash illness and in control areas in Choctaw County, Alabama, showed Borrelia lonestari flagellin gene sequence from two adult A. americanum. The presence of B. lonestari in A. americanum ticks from Alabama suggests that this suspected pathogen may be widespread in the southeastern United States. PMID:11384533

  13. Prevalence of tick-borne encephalitis virus in ticks from southern Korea.

    PubMed

    Ko, Sungjin; Kang, Jun Gu; Kim, Su Yeon; Kim, Heung Chul; Klein, Terry A; Chong, Sung Tae; Sames, William J; Yun, Seok Min; Ju, Young Ran; Chae, Joon Seok

    2010-09-01

    The prevalence of tick-borne encephalitis virus (TBEV) in southern Korea was determined by collecting ticks using tick drags. A total of 4,077 of 6,788 ticks collected were pooled (649 pools) according to collection site, species, and developmental stage and assayed for TBEV. The TBEV protein E and NS5 gene fragments were detected using RT-nested PCR in six pools of nymphs collected from Jeju Island (2,491 ticks). The minimum field detection rates for TBEV were 0.17% and 0.14% for Haemaphysalis longicornis and Haemayphysalis. flava nymphs, respectively. The 252 bp NS5 and 477 bp protein E gene amplicons were sequenced. Phylogenetic analysis showed that the NS5 and protein E genes of the Jeju strain were clustered with Western subtype (98.0% and 99.4% identity, respectively). The Western subtype of TBEV is endemic in Korea, including Jeju Island. The study of vector and zoonotic host susceptibility to TBEV is required to better understand its potential impact on public health.

  14. Cascading effect of economic globalization on human risks of scrub typhus and tick-borne rickettsial diseases.

    PubMed

    Kuo, Chi-Chien; Huang, Jing-Lun; Shu, Pei-Yun; Lee, Pei-Lung; Kelt, Douglas A; Wang, Hsi-Chieh

    2012-09-01

    The increase in global travel and trade has facilitated the dissemination of disease vectors. Globalization can also indirectly affect vector-borne diseases through the liberalization of cross-border trade, which has far-reaching, worldwide effects on agricultural practices and may in turn influence vectors through the modification of the ecological landscape. While the cascading effect of economic globalization on vector-borne diseases, sometimes acting synergistically with regional agricultural policy, could be substantial and have significant economic, agricultural, and public health implications, research into this remains very limited. We evaluated how abandonment of rice paddies in Taiwan after joining the World Trade Organization, along with periodic plowing, an agricultural policy to reduce farm pests in abandoned fields can unexpectedly influence risks to diseases transmitted by ticks and chiggers (larval trombiculid mites), which we collected from their small-mammal hosts. Sampling was limited to abandoned (fallow) and plowed fields due to the challenge of trapping small mammals in flooded rice paddies. Striped field mice (Apodemus agrarius) are the main hosts for both vectors. They harbored six times more ticks and three times more chiggers in fallow than in plowed plots. The proportion of ticks infected with Rickettsia spp. (etiologic agent of spotted fever) was three times higher in fallow plots, while that of Orientia tsutsugamushi (scrub typhus) in chiggers was similar in both treatments. Fallow plots had more ground cover and higher vegetation than plowed ones. Moreover, ticks and chiggers in both field types were dominated by species known to infest humans. Because ticks and chiggers should exhibit very low survival in flooded rice paddies, we propose that farm abandonment in Taiwan, driven by globalization, may have inadvertently led to increased risks of spotted fever and scrub typhus. However, periodic plowing can unintentionally mitigate vector

  15. The microbiome of neotropical ticks parasitizing on passerine migratory birds.

    PubMed

    Budachetri, Khemraj; Williams, Jaclyn; Mukherjee, Nabanita; Sellers, Michael; Moore, Frank; Karim, Shahid

    2017-01-01

    Seasonal migration of passerine birds between temperate North America and tropical Central and South America is an ecological phenomenon. Migration of birds has been associated with the introduction of ectoparasites like ticks or tick-borne pathogens across the avian migration routes. In this study, the microbial diversity was determined in the ticks and bird DNA samples using 454 pyrosequencing of bacterial 16S rRNA gene. Tick DNA samples showed the dominance of genera Lactococcus, Francisella, Raoultella, Wolbachia and Rickettsia across all the ticks, but birds DNA did not share common microbial diversity with ticks. Furthermore, "Candidatus Rickettsia amblyommii" infection in the 91 ticks collected off the songbirds was also quantified by qPCR assay. Interestingly, "Candidatus R. amblyommii" was tested positive in 24 ticks (26% infection), and infection varied from as low as three copies to thousands of copies, but bird blood samples showed no amplification. Our results provide evidence that songbirds serve as transport carrier for immature ticks, and less likely to be a reservoir for "Candidatus R. amblyommii".

  16. Amblyomma variegatum ticks and heartwater on three Caribbean Islands.

    PubMed

    Vachiéry, Nathalie; Jeffery, Helena; Pegram, Rupert; Aprelon, Rosalie; Pinarello, Valérie; Kandassamy, Ranleen Lloyd Yane; Raliniaina, Modestine; Molia, Sophie; Savage, Hazel; Alexander, Randolph; Frebling, Mathieu; Martinez, Dominique; Lefrançois, Thierry

    2008-12-01

    Amblyomma variegatum tick infestation, tick infection by Ehrlichia ruminantium (ER), and ER genetic diversity were studied in the Caribbean Islands of Guadeloupe, Marie-Galante, and Antigua between 2003 and 2005. Nested PCR for pCS20 was used to detect ER, while ER strains were characterized by sequencing or by restriction fragment length polymorphism (RFLP) profiles of map-1 PCR products. In 2003 in Guadeloupe, the prevalence of tick-infested herds was 35.6%. In Marie-Galante 79.1% of herds in 2003 and 73.8% in 2005 were infested, while only an average of 2.2% of the herds were infected in Antigua between this same period. In Marie-Galante, 19.1% of ticks were ER positive, and ER-infected ticks were found in 33.3% of the herds. In Antigua only 5.8% of the ticks were ER positive. High ER tick infection rate combined with a very high level of tick infestation highlight the risk of heartwater in Marie-Galante and Guadeloupe more than in Antigua. The three islands still represent a reservoir for tick and heartwater in the Caribbean. Nine different African and Caribbean map-1 ER genotypes were identified. This diversity was observed even in restricted areas, and identical map-1 genotypes were observed on all three islands. This high genetic diversity of ER strains suggests that there was a simultaneous introduction of several strains from African countries into the Caribbean region.

  17. Tick bites and Lyme disease: the need for timely treatment.

    PubMed

    Overstreet, Maria L

    2013-06-01

    In the United States, 30,158 people were reported as having contracted Lyme disease during 2010; 96% of the cases in 2011 were reported from 13 northeast and north-central states. Time of tick attachment is a critical factor. Prolonged attachment allows time for a bacterium to move from tick to human. Patient history and meticulous skin inspection are the most important elements used in diagnosis of Lyme disease. The most common drug for treatment is doxycycline. Ticks find their hosts by several senses: odor, moisture, heat, and vibration. Avoidance of tick-infested areas, such as wooded areas and leaf piles, is paramount in preventing Lyme disease.

  18. Establishment of a novel tick-Babesia experimental infection model

    PubMed Central

    Maeda, Hiroki; Hatta, Takeshi; Alim, M Abdul; Tsubokawa, Daigo; Mikami, Fusako; Matsubayashi, Makoto; Miyoshi, Takeharu; Umemiya-Shirafuji, Rika; Kawazu, Shin-ichiro; Igarashi, Ikuo; Mochizuki, Masami; Tsuji, Naotoshi; Tanaka, Tetsuya

    2016-01-01

    Ticks are potent vectors of many deadly human and animal pathogens. Tick-borne babesiosis is a well-recognized malaria-like disease that occurs worldwide and recently has attracted increased attention as an emerging zoonosis. Although the proliferation of Babesia organisms is essential in the vectors, their detailed lifecycle with time information for migration in ticks remains unknown. A novel study model for the elucidation of the migration speed of Babesia parasites in their vector tick, Haemaphysalis longicornis, has been developed using an artificial feeding system with quantitative PCR method. The detectable DNA of Babesia parasites gradually disappeared in the tick midgut at 1 day post engorgement (DPE), and in contrary increased in other organs. The results indicated that the Babesia parasite passed the H. longicornis midgut within 24 hours post engorgement, migrated to the hemolymph, and then proliferated in the organs except the midgut. This time point may be an important curfew for Babesia parasites to migrate in the tick lumen. We also visualized the Babesia parasites in the experimentally infected ticks and in their eggs using IFAT for detecting their cytoskeletal structure, which suggested the successful tick infection and transovarial transmission of the parasite. This model will shed light on the further understanding of tick-Babesia interactions. PMID:27841321

  19. Borrelia hermsii acquisition order in superinfected ticks determines transmission efficiency.

    PubMed

    Policastro, Paul F; Raffel, Sandra J; Schwan, Tom G

    2013-08-01

    Multilocus sequence typing of Borrelia hermsii isolates reveals its divergence into two major genomic groups (GG), but no differences in transmission efficiency or host pathogenicity are associated with these genotypes. To compare GGI and GGII in the tick-host infection cycle, we first determined if spirochetes from the two groups could superinfect the tick vector Ornithodoros hermsi. We infected mice with isolates from each group and fed ticks sequentially on these mice. We then fed the infected ticks on naive mice and measured GGI and GGII spirochete densities in vector and host, using quantitative PCR of genotype-specific chromosomal DNA sequences. Sequential feedings resulted in dual tick infections, showing that GGI or GGII primary acquisition did not block superinfection by a secondary agent. On transmission to naive mice at short intervals after acquisition, ticks with primary GGI and secondary GGII spirochete infections caused mixed GGI and GGII infections in mice. However, ticks with primary GGII and secondary GGI spirochete infections caused only GGII infections with all isolate pairs examined. At longer intervals after acquisition, the exclusion of GGI by GGII spirochetes declined and cotransmission predominated. We then examined GGI and GGII spirochetemia in mice following single inoculation and coinoculation by needle and found that GGI spirochete densities were reduced on multiple days when coinoculated with GGII. These findings indicate that dual GGI-GGII spirochete infections can persist in ticks and that transmission to a vertebrate host is dependent on the order of tick acquisition and the interval between acquisition and transmission events.

  20. Tick paralysis in Australia caused by Ixodes holocyclus Neumann

    PubMed Central

    Hall-Mendelin, S; Craig, S B; Hall, R A; O’Donoghue, P; Atwell, R B; Tulsiani, S M; Graham, G C

    2011-01-01

    Ticks are obligate haematophagous ectoparasites of various animals, including humans, and are abundant in temperate and tropical zones around the world. They are the most important vectors for the pathogens causing disease in livestock and second only to mosquitoes as vectors of pathogens causing human disease. Ticks are formidable arachnids, capable of not only transmitting the pathogens involved in some infectious diseases but also of inducing allergies and causing toxicoses and paralysis, with possible fatal outcomes for the host. This review focuses on tick paralysis, the role of the Australian paralysis tick Ixodes holocyclus, and the role of toxin molecules from this species in causing paralysis in the host. PMID:21396246

  1. Potential risk of pathogen transmission by acaricide-poisoned ticks.

    PubMed

    Uspensky, Igor; Ioffe-Uspensky, Inna

    2006-05-01

    Many aspects of tick poisoning with acaricides have yet to be elucidated. One of them is the influence of acaricide poisoning on tick infectivity to their hosts. To clarify this problem, we should know how tick poisoning develops after acaricide application. Data obtained during more than three decades of work with ticks of various species and with acaricides of different groups are presented in the paper. The first important phenomenon found was the gradual and progressive development of toxic symptoms after acaricide application, with death of the treated ticks delayed for days or even weeks ('slow-death syndrome'). The development of symptoms was much faster after the application of fenthion, an organophosphorous acaricide, when compared to DDT, a chlorinated hydrocarbon. The larger the adult ticks of a particular species, the more refractory they were to acaricide action. The duration of the development of toxic symptoms directly correlates with the degree of species-specific refractoriness. A special index T(LD(50)) (T(LC(50)) was introduced for comparing the duration of the poisoning development between different tick species, populations etc. The index determines the time when the final mortality is reached after using the LD(50) of a particular acaricide. Another index , T(LD(90)), was used for practical purposes. The values of these indices decreased with increasing age of tick populations. The prolonged duration of poisoning was also observed in nymphal ticks of species with a prolonged life-span and the ability to over-winter (Ixodes, Haemaphysalis) but not in ticks characterized by a short life-span (Dermacentor). During the entire period of poisoning, from acaricide application until tick death, the individual tick passes through six stages defined by its locomotor capabilities. The stages are the same for nymphs and adults of both hard and soft ticks after treatment with various acaricides. When ticks are at the initial stages of poisoning (1st to 3rd

  2. NONFARM AGRICULTURAL EMPLOYMENT IN NORTHEAST LOUISIANA--AREA II--WITH IMPLICATIONS FOR DEVELOPING TRAINING PROGRAMS.

    ERIC Educational Resources Information Center

    MONDART, C.L., SR.; AND OTHERS

    AS PART OF A STATEWIDE STUDY OF NONFARM AGRICULTURAL OCCUPATIONS IN LOUISIANA, 480 FIRMS IN 14 PARISHES WERE SURVEYED TO DETERMINE THE NUMBER OF EMPLOYEES, THE AGRICULTURAL COMPETENCIES NEEDED, AND JOB CHARACTERISTICS. OF THE 6,087 EMPLOYEES, 3,119 NEEDED AGRICULTURAL COMPETENCIES IN 597 DIFFERENT JOB TITLES. NEARLY 60 PERCENT OF THE EMPLOYEES…

  3. Experimental Transmission of Karshi and Langat (Tick-Borne Encephalitis Virus Complex) Viruses by Ornithodoros Ticks (Acari: Argasidae)

    DTIC Science & Technology

    2004-01-01

    encephalitis virus complex) viruses by Onithodoros ticks (Acari: Argasidae), Journal of Medical Entomology 41:973 - 977 5a. CONTRACT NUMBER 5b. GRANT NUMBER...mosquitoes and Ornithodoros ticks were evaluated for their potential to transmit Karshi and Langat (tick-borne encephalitis virus complex) viruses in the...suckling mice. In addition, female O. tartakovskyi transmitted Karshi virus vertically to their progeny. In a continuation of a previous study, O. sonrai

  4. Experiences in Tick Control by Acaricide in the Traditional Cattle Sector in Zambia and Burkina Faso: Possible Environmental and Public Health Implications

    PubMed Central

    De Meneghi, Daniele; Stachurski, Frédéric; Adakal, Hassane

    2016-01-01

    Livestock, especially cattle, play a paramount role in agriculture production systems, particularly in poor countries throughout the world. Ticks and tick-borne diseases (TBDs) have an important impact on livestock and agriculture production in sub-Saharan Africa. The authors review the most common methods used for the control of ticks and TBDs. Special emphasis is given to the direct application of acaricides to the host animals. The possible environmental and public health adverse effects (i.e., risks for the workers, residues in the environment and in food products of animal origin) are mentioned. The authors present two case studies, describing different field experiences in controlling ticks in two African countries. In Zambia (Southern Africa), a strategic dipping regime was used to control Rhipicephalus appendiculatus ticks, vectors of theileriosis, a deadly disease affecting cattle in the traditional livestock sector in Southern Province. The dipping regime adopted allowed to reduce the tick challenge and cattle mortally rate and, at the same time, to employ less acaricide as compared to the intensive dipping used so far, without disrupting the building-up of enzootic stability. In Burkina Faso (West Africa), where dipping was never used for tick control, an acaricide footbath was employed as an alternative method to the traditional technique used locally (portable manual sprayers). This was developed from field observations on the invasion/attachment process of the Amblyomma variegatum ticks – vector of cowdriosis – on the animal hosts, leading to a control method aimed to kill ticks temporarily attached to the interdigital areas before their permanent attachment to the predilection sites. This innovative method has been overall accepted by the local farmers. It has the advantage of greatly reducing costs of treatments and has a minimal environmental impact, making footbath a sustainable and replicable method, adoptable also in other West African

  5. Virus detection in questing ticks is not a sensitive indicator for risk assessment of tick-borne encephalitis in humans.

    PubMed

    Stefanoff, P; Pfeffer, M; Hellenbrand, W; Rogalska, J; Rühe, F; Makówka, A; Michalik, J; Wodecka, B; Rymaszewska, A; Kiewra, D; Baumann-Popczyk, A; Dobler, G

    2013-05-01

    Tick-borne encephalitis virus (TBEV) is the most important tick-transmitted arbovirus causing human disease in Europe, but information on its endemic occurrence varies between countries because of differences in surveillance systems. Objective data are necessary to ascertain the disease risk for vaccination recommendations and other public health interventions. In two independent, separately planned projects, we used real-time RT-PCR to detect TBE virus in questing ticks. In Poland, 32 sampling sites were selected in 10 administrative districts located in regions where sporadic TBE cases were reported. In Germany, 18 sampling sites were selected in two districts located in a region with high TBE incidence. Altogether, >16,000 ticks were tested by real-time RT-PCR, with no sample testing positive for TBEV. A systematic search for published studies on TBEV prevalence in ticks in Poland and Germany also suggested that testing large numbers of collected ticks could not consistently assure virus detection in known endemic foci. Although assignment of results to administrative regions is essential for TBE risk mapping, this was possible in only 10 (investigating 22,417 ticks) of 15 published studies (>50,000 ticks) identified. We conclude that the collection and screening of ticks by real-time RT-PCR cannot be recommended for assessment of human TBE risk. Alternative methods of environmental TBEV monitoring should be considered, such as serological monitoring of rodents or other wildlife.

  6. The climate system as a ticking clock

    SciTech Connect

    Kerr, R.A.

    1990-09-14

    Climate researchers are picking up a more or less regular 2-year beat to the global climate system - one that seems to be heard from every quarter. The most recently discovered example of this climatic ticking - and perhaps the most intriguing - comes from the very core of El Nino. Researchers have found that some aspects of this cycle of alternating warm and relatively cold waters along the equatorial Pacific have a tendency to repeat every 2 years. The overlying winds pulsate at the same pace, as do the globe-girdling effects of the El Nino cycle, from winter warmth in Alaska to heavy rains in Peru and drought in Australia. The climatic ticking in the tropical Pacific is hardly as reliable as the changing of the seasons. Sometimes it is muted, and occasionally it skips a beat. But some researchers nevertheless see hope of using it in the prediction of El Nino and its global effects. In any case, climate researchers are eager to determine what makes El Nino tick. The answer could be an underlying pacemaker of this crucial atmospheric cycle.

  7. Hiring the right employees.

    PubMed

    Reigle, Dale A

    2014-01-01

    Current employees provide the best examples of the type of aptitude, attitude, motivation, and fit we are looking for, or not looking for, in new employees. All four of these attributes are present in star employees. Using what we know about our best and worst employees can assist us in developing questions and scoring templates that will help us categorize current applicants. Hiring managers should formulate questions in a way that elicits informative responses from candidates about past performance in situations similar to those they will face on the job. Nonverbal clues can help provide insight beyond the simple verbal answer given by candidates. Practice, critique, and critical review of the outcomes of our hiring decisions improve our ability to become good hiring managers.

  8. Employees with Sleep Disorders

    MedlinePlus

    ... essential functions Allow the employee to listen to music or white noise with a headset Memory Deficits: ... sleep disorders, and how anxiety and diet may influence rest. Retrieved September 5, 2008, from http://www. ...

  9. Employees with Chronic Pain

    MedlinePlus

    ... Home | Accommodation and Compliance Series: Employees with Chronic Pain By Beth Loy, Ph.D. Preface Introduction Information ... at http://AskJAN.org/soar. Information about Chronic Pain How prevalent is chronic pain? Chronic pain has ...

  10. Employees Who Use Wheelchairs

    MedlinePlus

    ... of Disabilities Publications Resources Home | Accommodation and Compliance Series: Employees Who Use Wheelchairs By Linda Carter Batiste, ... Audio Version Share Introduction JAN’s Accommodation and Compliance Series is designed to help employers determine effective accommodations ...

  11. Uukuniemi Virus as a Tick-Borne Virus Model

    PubMed Central

    Mazelier, Magalie; Rouxel, Ronan Nicolas; Zumstein, Michael; Mancini, Roberta; Bell-Sakyi, Lesley

    2016-01-01

    ABSTRACT In the last decade, novel tick-borne pathogenic phleboviruses in the family Bunyaviridae, all closely related to Uukuniemi virus (UUKV), have emerged on different continents. To reproduce the tick-mammal switch in vitro, we first established a reverse genetics system to rescue UUKV with a genome close to that of the authentic virus isolated from the Ixodes ricinus tick reservoir. The IRE/CTVM19 and IRE/CTVM20 cell lines, both derived from I. ricinus, were susceptible to the virus rescued from plasmid DNAs and supported production of the virus over many weeks, indicating that infection was persistent. The glycoprotein GC was mainly highly mannosylated on tick cell-derived viral progeny. The second envelope viral protein, GN, carried mostly N-glycans not recognized by the classical glycosidases peptide-N-glycosidase F (PNGase F) and endoglycosidase H (Endo H). Treatment with β-mercaptoethanol did not impact the apparent molecular weight of GN. On viruses originating from mammalian BHK-21 cells, GN glycosylations were exclusively sensitive to PNGase F, and the electrophoretic mobility of the protein was substantially slower after the reduction of disulfide bonds. Furthermore, the amount of viral nucleoprotein per focus forming unit differed markedly whether viruses were produced in tick or BHK-21 cells, suggesting a higher infectivity for tick cell-derived viruses. Together, our results indicate that UUKV particles derived from vector tick cells have glycosylation and structural specificities that may influence the initial infection in mammalian hosts. This study also highlights the importance of working with viruses originating from arthropod vector cells in investigations of the cell biology of arbovirus transmission and entry into mammalian hosts. IMPORTANCE Tick-borne phleboviruses represent a growing threat to humans globally. Although ticks are important vectors of infectious emerging diseases, previous studies have mainly involved virus stocks

  12. Dynamics of tick infestations in foxes in Thuringia, Germany.

    PubMed

    Meyer-Kayser, Elisabeth; Hoffmann, Lothar; Silaghi, Cornelia; Pfister, Kurt; Mahling, Monia; Passos, Lygia M F

    2012-09-01

    This study aimed to provide up-to-date information on the dynamics of tick infestations on foxes in Thuringia, as the most recent information available was published in 1997. Fox carcasses that had been sent to the Thuringian State Authority for Food Safety and Consumer Protection (Thüringer Landesamt für Lebensmittelsicherheit und Verbraucherschutz - TLLV), between January 1st and December 31st, 2009, were examined for the presence of ticks. All ticks collected were stored at -20 °C before being identified and classified according to their developmental stage and sex. Out of a total of 1286 foxes examined, 989 (76.9%) were infested with ticks. A total of 13,227 ticks were collected from the foxes. The stage most frequently found was the larva (48.1%), followed by the adult (34.1%), and the nymphal stage (17.8%). Regarding the adult stage, Ixodes ricinus was the most frequent tick species detected (82.2%), followed by I. canisuga (10.8%) and I. hexagonus (6.7%). Dermacentor reticulatus ticks were very rare (0.3%). With regard to nymphs, I. canisuga and I. hexagonus were the most frequent tick species found, and this was also assumed for the larval stage. The results indicate the occurrence of tick infestations in foxes throughout the year, mainly by I. ricinus, I. canisuga, and I. hexagonus, with seasonal variations. Foxes were infested by I. ricinus ticks significantly more frequently from April to September. This applied to all tick developmental stages, but especially to adults. In contrast to I. ricinus, the infestation of foxes with I. canisuga and I. hexagonus was significantly higher from January to March and from October to December, especially with the immature developmental stages.

  13. PCR detection of Babesia ovata from questing ticks in Japan.

    PubMed

    Sivakumar, Thillaiampalam; Tattiyapong, Muncharee; Okubo, Kazuhiro; Suganuma, Keisuke; Hayashida, Kyoko; Igarashi, Ikuo; Zakimi, Satoshi; Matsumoto, Kotaro; Inokuma, Hisashi; Yokoyama, Naoaki

    2014-04-01

    Babesia ovata is a tick-transmitted hemoprotozoan parasite of cattle. In the present study, we analyzed tick DNA samples (n=1459) prepared from questing ticks collected from various cattle pastures in Hokkaido (Shibecha, Taiki, Otofuke, Memuro, and Shin-Hidaka districts) and Okinawa (Yonaguni Island) prefectures of Japan for B. ovata. When all the tick DNA samples were screened by a previously described B. ovata-specific apical membrane antigen-1 (AMA-1) gene-based polymerase chain reaction (PCR) assay, none of the DNA samples was positive. Therefore, we developed a PCR assay based on the protozoan beta-tubulin (β-tubulin) gene to detect B. ovata from ticks in Japan. In the specificity test, the PCR assay amplified the expected 444-bp target gene fragment from B. ovata DNA. No PCR products were amplified from DNA samples from other blood pathogens, bovine blood, or ticks. In addition, the PCR assay detected 100 fg of B. ovata-genomic DNA extracted from an in vitro culture of the parasites. Subsequently, when all the tick DNA samples were screened by this new PCR assay, 18 were positive for B. ovata. Positive samples were found only in the Yonaguni and Memuro areas. In Okinawa, where all the ticks were identified as Haemaphysalis longicornis, 9.7% of the samples were PCR-positive, while a single tick (Ixodes ovatus) from Memuro was infected with B. ovata. When the nucleotide sequences of the PCR amplicons were phylogenetically analyzed, they formed a separate clade containing a previously described β-tubulin gene sequence from B. ovata (Miyake strain), confirming that the PCR assay had detected only B. ovata from the tick DNA samples. This is the first report that describes the PCR detection of B. ovata in ticks. The findings warrant transmission experiments to evaluate I. ovatus as a potential vector of B. ovata.

  14. Immunization of Cattle with Tick Salivary Gland Extracts

    PubMed Central

    Nikpay, Ali; Nabian, Sedigheh

    2016-01-01

    Background: Rhipicephalus (Boophilus) annulatus tick is one of the most important ectoparasite of cattle. Recently, several laboratories in the world have been concentrated on immunizing cattle against tick using various types of tissue extracts of ticks. The aim of this study was to evaluate the effect of immunization of cattle with tick salivary gland extract on biological parameters of ticks and humoral immune responses of cattle. Methods: Fourteen more dominant protein bands identified as immunogenic by Western-blot analysis were eluted from polyacrylamide gel. Test and control groups were injected three times with eluted proteins and sterile PBS (pH= 7.2) respectively with equivalent amount of adjuvant. After four weeks a tick challenge was performed. Finally, biological parameters of collected engorged female ticks were recorded and humoral immune responses to immunization measured by ELISA. Results: The results indicated immunization of cattle resulted in reduction in mean tick counts, attachment, engorgement weights, feeding index, egg mass weight, hatchability and fertility index (respectively 63.1%, 62.6%, 30.2%, 36.4%, 40%, 78.7% and 13.3%) and increased duration of feeding, preoviposition and incubation period of eggs (respectively 8.6%, 45 and 31.34%). All changes were statistically significant (P< 0.05). Results showed an increase in antibody production of test group from the first week after immunization. The antibody level was boosted following tick infestation. Conclusion: This investigation indicates that immunization of cattle with these antigens could induce a protective immune response against Rh. (B.) annulatus tick that would be expected to provide a safe non-chemical means of tick control. PMID:27308287

  15. Development of vaccines against Ornithodoros soft ticks: An update.

    PubMed

    Díaz-Martín, Verónica; Manzano-Román, Raúl; Obolo-Mvoulouga, Prosper; Oleaga, Ana; Pérez-Sánchez, Ricardo

    2015-04-01

    Ticks are parasites of great medical and veterinary importance since they are vectors of numerous pathogens that affect humans, livestock and pets. Among the argasids, several species of the genus Ornithodoros transmit serious diseases such as tick-borne human relapsing fever (TBRF) and African Swine Fever (ASF). In particular, Ornithodoros erraticus is the main vector of these two diseases in the Mediterranean while O. moubata is the main vector in Africa. The presence of these Ornithodoros ticks in domestic and peridomestic environments may greatly hinder the eradication of TBRF and ASF from endemic areas. In addition, there is a constant threat of reintroduction and spreading of ASF into countries from where it has been eradicated (Spain and Portugal) or where it was never present (the Caucasus, Russia and Eastern Europe). In these countries, the presence of Ornithodoros vectors could have a tremendous impact on ASF transmission and long-term maintenance. Therefore, elimination of these ticks from at least synanthropic environments would contribute heavily to the prevention and control of the diseases they transmit. Tick control is a difficult task and although several methods for such control have been used, none of them has been fully effective against all ticks and the problems they cause. Nevertheless, immunological control using anti-tick vaccines offers an attractive alternative to the traditional use of acaricides. The aim of the present paper is to offer a brief overview of the current status in control measure development for Ornithodoros soft ticks, paying special attention to the development of vaccines against O. erraticus and O. moubata. Thus, our contribution includes an analysis of the chief attributes that the ideal antigens for an anti-tick vaccine should have, an exhaustive compilation and analysis of the scant anti-soft tick vaccine trials carried out to date using both concealed and salivary antigens and, finally, a brief description of the

  16. Tick salivary compounds: their role in modulation of host defences and pathogen transmission

    PubMed Central

    Kazimírová, Mária; Štibrániová, Iveta

    2013-01-01

    Ticks require blood meal to complete development and reproduction. Multifunctional tick salivary glands play a pivotal role in tick feeding and transmission of pathogens. Tick salivary molecules injected into the host modulate host defence responses to the benefit of the feeding ticks. To colonize tick organs, tick-borne microorganisms must overcome several barriers, i.e., tick gut membrane, tick immunity, and moulting. Tick-borne pathogens co-evolved with their vectors and hosts and developed molecular adaptations to avoid adverse effects of tick and host defences. Large gaps exist in the knowledge of survival strategies of tick-borne microorganisms and on the molecular mechanisms of tick-host-pathogen interactions. Prior to transmission to a host, the microorganisms penetrate and multiply in tick salivary glands. As soon as the tick is attached to a host, gene expression and production of salivary molecules is upregulated, primarily to facilitate feeding and avoid tick rejection by the host. Pathogens exploit tick salivary molecules for their survival and multiplication in the vector and transmission to and establishment in the hosts. Promotion of pathogen transmission by bioactive molecules in tick saliva was described as saliva-assisted transmission (SAT). SAT candidates comprise compounds with anti-haemostatic, anti-inflammatory and immunomodulatory functions, but the molecular mechanisms by which they mediate pathogen transmission are largely unknown. To date only a few tick salivary molecules associated with specific pathogen transmission have been identified and their functions partially elucidated. Advanced molecular techniques are applied in studying tick-host-pathogen interactions and provide information on expression of vector and pathogen genes during pathogen acquisition, establishment and transmission. Understanding the molecular events on the tick-host-pathogen interface may lead to development of new strategies to control tick-borne diseases. PMID

  17. Intrapreneurship: tapping employee creativity.

    PubMed

    Marszalek-Gaucher, E; Elsenhans, V D

    1988-12-01

    Seeking ways to produce new products, processes, and programs that would result in cost savings or increased revenue for nursing services and the institution, as well as attracting and retaining bright, creative nursing employees, the authors developed a pilot program to allow intrapreneurs to "run with" their ideas. The authors discuss the mechanics of their program development, implementation, and evaluation as well as examples of innovative projects under development by nursing employees.

  18. Risk of exposure to ticks (Ixodidae) and the prevalence of tick-borne encephalitis virus (TBEV) in ticks in Southern Poland.

    PubMed

    Cuber, Piotr; Andreassen, Åshild; Vainio, Kirsti; Asman, Marek; Dudman, Susanne; Szilman, Piotr; Szilman, Ewa; Ottesen, Preben; Ånestad, Gabriel; Cieśla-Nobis, Sabina; Solarz, Krzysztof

    2015-04-01

    The article presents the results of the first study on seasonal activity of ticks and prevalence of tick-borne encephalitis virus (TBEV) in nymphs from the Silesian Province (Southern Poland). Previous studies on the prevalence of TBEV in ticks in Poland have been conducted mostly in northern and eastern regions, but none in the Silesian Province itself. The aims of this study were to analyse the seasonal variation in tick populations and compare TBEV prevalence in nymphs from different geographical locations in the Silesia. A total of 5160 questing Ixodes ricinus ticks were collected by the flagging method from 23 localities in southern Poland in 2010. Micro-climatic parameters (air temperature and humidity) were measured in order to estimate their influence on tick population. The highest tick activity was recorded in spring and was positively correlated with relative air humidity (RH). TBEV in the Silesian Province was analysed in 1750 nymphs and an overall prevalence was 0.11% (2 pools out of 175 analysed). The results of this study show that TBEV pool prevalence in nymphs is low in accordance with the low number of TBE cases reported within the region.

  19. 29 CFR 516.13 - Livestock auction employees exempt from overtime pay requirements under section 13(b)(13) of the...

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Livestock auction employees exempt from overtime pay....13 Livestock auction employees exempt from overtime pay requirements under section 13(b)(13) of the... employee is employed both in agriculture and in connection with livestock auction operations: (a) The...

  20. Importation of exotic ticks and tick-borne spotted fever group rickettsiae into the United States by migrating songbirds.

    PubMed

    Mukherjee, Nabanita; Beati, Lorenza; Sellers, Michael; Burton, Laquita; Adamson, Steven; Robbins, Richard G; Moore, Frank; Karim, Shahid

    2014-03-01

    Birds are capable of carrying ticks and, consequently, tick-transmitted microorganisms over long distances and across geographical barriers such as oceans and deserts. Ticks are hosts for several species of spotted fever group rickettsiae (SFGR), which can be transmitted to vertebrates during blood meals. In this study, the prevalence of this group of rickettsiae was examined in ticks infesting migratory songbirds by using polymerase chain reaction (PCR). During the 2009 and 2010 spring migration season, 2064 northward-migrating passerine songbirds were examined for ticks at Johnson Bayou, Louisiana. A total of 91 ticks was removed from 35 individual songbirds for tick species identification and spotted fever group rickettsia detection. Ticks were identified as Haemaphysalis juxtakochi (n=38, 42%), Amblyomma longirostre (n=22, 24%), Amblyomma nodosum (n=17, 19%), Amblyomma calcaratum (n=11, 12%), Amblyomma maculatum (n=2, 2%), and Haemaphysalis leporispalustris (n=1, 1%) by comparing their 12S rDNA gene sequence to homologous sequences in GenBank. Most of the identified ticks were exotic species originating outside of the United States. The phylogenetic analysis of the 71 ompA gene sequences of the rickettsial strains detected in the ticks revealed the occurrence of 6 distinct rickettsial genotypes. Two genotypes (corresponding to a total of 28 samples) were included in the Candidatus Rickettsia amblyommii clade (less than 1% divergence), 2 of them (corresponding to a total of 14 samples) clustered with Rickettsia sp. "Argentina" with less than 0.2% sequence divergence, and 2 of them (corresponding to a total of 27 samples), although closely related to the R. parkeri-R. africae lineage (2.50-3.41% divergence), exhibited sufficient genetic divergence from its members to possibly constitute a new rickettsial genotype. Overall, there does not seem to be a specific relationship between exotic tick species, the rickettsiae they harbor, or the reservoir competence of the

  1. Surveillance of tick-borne encephalitis virus in wild birds and ticks in Tomsk city and its suburbs (Western Siberia).

    PubMed

    Mikryukova, Tamara P; Moskvitina, Nina S; Kononova, Yulia V; Korobitsyn, Igor G; Kartashov, Mikhail Y; Tyuten Kov, Oleg Y; Protopopova, Elena V; Romanenko, Vladimir N; Chausov, Evgeny V; Gashkov, Sergey I; Konovalova, Svetlana N; Moskvitin, Sergey S; Tupota, Natalya L; Sementsova, Alexandra O; Ternovoi, Vladimir A; Loktev, Valery B

    2014-03-01

    To study the role of wild birds in the transmission of tick borne encephalitis virus (TBEV), we investigated randomly captured wild birds bearing ixodid ticks in a very highly endemic TBE region located in Tomsk city and its suburbs in the south of Western Siberia, Russia. The 779 wild birds representing 60 species were captured carrying a total of 841 ticks, Ixodes pavlovskyi Pom., 1946 (n=531), Ixodes persulcatus P. Sch., 1930 (n=244), and Ixodes plumbeus Leach. 1815 (n=66). The highest average number of ticks per bird in a particular species was found for the fieldfare (Turdus pilaris Linnaeus, 1758) (5.60 ticks/bird) and the tree pipit (Anthus trivialis Linnaeus, 1758) (13.25 ticks/bird). Samples from wild birds and ticks collected in highly endemic periods from 2006 to 2011 were tested for the TBEV markers using monoclonal modified enzyme immunoassay (EIA) and RT-PCR. TBEV RNA and antigen were found in 9.7% and 22.8% samples collected from wild birds, respectively. TBEV markers were also detected in 14.1% I. persulcatus ticks, 5.2% I. pavlovskyi, and 4.2% I. plumbeus ticks collected from wild birds. Two TBEV strains were also isolated on PKE (pig kidney embryo) cells from fieldfare and Blyth's reed warbler (Acrocephalus dumetorum Blyth, 1849). Sequencing of 5'-NCR of TBEV revealed that all TBEV isolates belong to Far Eastern (dominate) and Siberian genotypes. Several phylogenetic subgroups included TBEV sequences novel for the Tomsk region. Our data suggest that wild birds are potential disseminators of TBEV, TBEV-infected ixodid ticks, and possibly other tick-borne infections.

  2. Evolutionary changes in symbiont community structure in ticks.

    PubMed

    Duron, Olivier; Binetruy, Florian; Noël, Valérie; Cremaschi, Julie; McCoy, Karen D; Arnathau, Céline; Plantard, Olivier; Goolsby, John; Pérez de León, Adalberto A; Heylen, Dieter J A; Van Oosten, A Raoul; Gottlieb, Yuval; Baneth, Gad; Guglielmone, Alberto A; Estrada-Peña, Agustin; Opara, Maxwell N; Zenner, Lionel; Vavre, Fabrice; Chevillon, Christine

    2017-03-09

    Ecological specialization to restricted diet niches is driven by obligate, and often maternally inherited, symbionts in many arthropod lineages. These heritable symbionts typically form evolutionarily stable associations with arthropods that can last for millions of years. Ticks were recently found to harbour such an obligate symbiont, Coxiella-LE, that synthesizes B vitamins and cofactors not obtained in sufficient quantities from blood diet. In this study, the examination of 81 tick species shows that some Coxiella-LE symbioses are evolutionarily stable with an ancient acquisition followed by codiversification as observed in ticks belonging to the Rhipicephalus genus. However, many other Coxiella-LE symbioses are characterized by low evolutionary stability with frequent host shifts and extinction events. Further examination revealed the presence of nine other genera of maternally inherited bacteria in ticks. Although these nine symbionts were primarily thought to be facultative, their distribution among tick species rather suggests that at least four may have independently replaced Coxiella-LE and likely represent alternative obligate symbionts. Phylogenetic evidence otherwise indicates that cocladogenesis is globally rare in these symbioses as most originate via horizontal transfer of an existing symbiont between unrelated tick species. As a result, the structure of these symbiont communities is not fixed and stable across the tick phylogeny. Most importantly, the symbiont communities commonly reach high levels of diversity with up to six unrelated maternally inherited bacteria coexisting within host species. We further conjecture that interactions among coexisting symbionts are pivotal drivers of community structure both among and within tick species.

  3. Anaplasma marginale and Theileria annulata in questing ticks from Portugal.

    PubMed

    Antunes, S; Ferrolho, J; Domingues, N; Santos, A S; Santos-Silva, M M; Domingos, A

    2016-09-01

    Ticks are ubiquitous arthropods and vectors of several pathogenic agents in animals and humans. Monitoring questing ticks is of great importance to ascertain the occurrence of pathogens and the potential vector species, offering an insight into the risk of disease transmission in a given area. In this study 428 host-seeking ticks, belonging to nine species of Ixodidae and collected from 17 of the 23 Portuguese mainland subregions, were screened for several tick-borne agents with veterinary relevance: Anaplasma marginale, Anaplasma ovis, Anaplasma centrale, Babesia spp., Coxiella burnetii and Theileria spp. Prevalence was assessed by PCR and amplified amplicons sequenced for validation of results. Twenty ticks, in a total of 428, were found positive: one Ixodes ventalloi for Theileria annulata and four Dermacentor marginatus, one Haemaphysalis punctata, five Ixodes ricinus, five I. ventalloi, and four Rhipicephalus sanguineus sensu lato for A. marginale. According to the reviewed literature, this is the first report of A. marginale and T. annulata detection in I. ventalloi. Furthermore, the amplification of A. marginale DNA in several tick species suggests a broad range for this agent in Portugal that might include other uncommon species as R. sanguineus s.l. This work provides new data towards a better understanding of tick-pathogen associations and also contributes to the surveillance of tick-borne agents in geographic areas with limited information.

  4. Rickettsia rickettsii transmission by a lone star tick, North Carolina.

    PubMed

    Breitschwerdt, Edward B; Hegarty, Barbara C; Maggi, Ricardo G; Lantos, Paul M; Aslett, Denise M; Bradley, Julie M

    2011-05-01

    Only indirect or circumstantial evidence has been published to support transmission of Rickettsia rickettsii by Amblyomma americanum (lone star) ticks in North America. This study provides molecular evidence that A. americanum ticks can function, although most likely infrequently, as vectors of Rocky Mountain spotted fever for humans.

  5. Ticks Carrying Lyme Disease Confirmed in Eastern National Parks

    MedlinePlus

    ... html Ticks Carrying Lyme Disease Confirmed in Eastern National Parks U.S. National Park Service and CDC advise using insect repellents on ... Planning a hiking trip in an eastern U.S. national park? Better pack tick repellent -- a new study found ...

  6. Genome Sequence of the Tick-Borne Pathogen Rickettsia raoultii.

    PubMed

    El Karkouri, Khalid; Mediannikov, Oleg; Robert, Catherine; Raoult, Didier; Fournier, Pierre-Edouards

    2016-04-21

    ITALIC! Rickettsia raoultiiis a tick-associated spotted fever group (SFG) organism, causing scalp eschar and neck lymphadenopathy after tick bite (SENLAT) in humans. We report here the genome sequence of ITALIC! R. raoultiistrain Khabarovsk(T)(CSUR R3(T), ATCC VR-1596(T)), which was isolated from a ITALIC! Dermacentor silvarumtick collected in Russia.

  7. Ticks infesting bats (Mammalia: Chiroptera) in the Brazilian Pantanal.

    PubMed

    Muñoz-Leal, Sebastián; Eriksson, Alan; Santos, Carolina Ferreira; Fischer, Erich; de Almeida, Juliana Cardoso; Luz, Hermes R; Labruna, Marcelo B

    2016-05-01

    Ticks associated with bats have been poorly documented in the Neotropical Zoogeographical Region. In this study, a total of 1028 bats were sampled for tick infestations in the southern portion of the Brazilian Pantanal. A total of 368 ticks, morphologically identified as Ornithodoros hasei (n = 364) and O. mimon (n = 4), were collected from the following bat species: Artibeus planirostris, Platyrrhinus lineatus, Phyllostomus hastatus, Mimon crenulatum and Noctilio albiventris. Morphological identification of O. hasei was confirmed by molecular analysis. Regarding the most abundant bat species, only 40 (6.2%) out of 650 A. planirostris were infested by O. hasei, with a mean intensity of 7.2 ticks per infested bat, or a mean abundance of 0.44 ticks per sampled bat. Noteworthy, one single P. hastatus was infested by 55 O. hasei larvae, in contrast to the 2.5-7.2 range of mean intensity values for the whole study. As a complement to the present study, a total of 8 museum bat specimens (6 Noctilio albiventris and 2 N. leporinus), collected in the northern region of Pantanal, were examined for tick infestations. These bats contained 176 ticks, which were all morphologically identified as O. hasei larvae. Mean intensity of infestation was 22, with a range of 1-46 ticks per infested bat. Our results suggest that A. planirostris might play an important role in the natural life cycle of O. hasei in the Pantanal.

  8. 7 CFR 15a.7 - Designation of responsible employee and adoption of grievance procedures.

    Code of Federal Regulations, 2012 CFR

    2012-01-01

    ... 7 Agriculture 1 2012-01-01 2012-01-01 false Designation of responsible employee and adoption of grievance procedures. 15a.7 Section 15a.7 Agriculture Office of the Secretary of Agriculture EDUCATION PROGRAMS OR ACTIVITIES RECEIVING OR BENEFITTING FROM FEDERAL FINANCIAL ASSISTANCE Introduction §...

  9. 7 CFR 15a.7 - Designation of responsible employee and adoption of grievance procedures.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... 7 Agriculture 1 2013-01-01 2013-01-01 false Designation of responsible employee and adoption of grievance procedures. 15a.7 Section 15a.7 Agriculture Office of the Secretary of Agriculture EDUCATION PROGRAMS OR ACTIVITIES RECEIVING OR BENEFITTING FROM FEDERAL FINANCIAL ASSISTANCE Introduction §...

  10. 7 CFR 15a.7 - Designation of responsible employee and adoption of grievance procedures.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... 7 Agriculture 1 2014-01-01 2014-01-01 false Designation of responsible employee and adoption of grievance procedures. 15a.7 Section 15a.7 Agriculture Office of the Secretary of Agriculture EDUCATION PROGRAMS OR ACTIVITIES RECEIVING OR BENEFITTING FROM FEDERAL FINANCIAL ASSISTANCE Introduction §...

  11. 7 CFR 15a.7 - Designation of responsible employee and adoption of grievance procedures.

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... 7 Agriculture 1 2011-01-01 2011-01-01 false Designation of responsible employee and adoption of grievance procedures. 15a.7 Section 15a.7 Agriculture Office of the Secretary of Agriculture EDUCATION PROGRAMS OR ACTIVITIES RECEIVING OR BENEFITTING FROM FEDERAL FINANCIAL ASSISTANCE Introduction §...

  12. Integrated Strategy for Sustainable Cattle Fever Tick Eradication in USA is Required to Mitigate the Impact of Global Change

    PubMed Central

    Pérez de León, Adalberto A.; Teel, Pete D.; Auclair, Allan N.; Messenger, Matthew T.; Guerrero, Felix D.; Schuster, Greta; Miller, Robert J.

    2012-01-01

    The ticks Rhipicephalus (Boophilus) annulatus and R. (B.) microplus, commonly known as cattle and southern cattle tick, respectively, impede the development and sustainability of livestock industries throughout tropical and other world regions. They affect animal productivity and wellbeing directly through their obligate blood-feeding habit and indirectly by serving as vectors of the infectious agents causing bovine babesiosis and anaplasmosis. The monumental scientific discovery of certain arthropod species as vectors of infectious agents is associated with the history of research on bovine babesiosis and R. annulatus. Together, R. microplus and R. annulatus are referred to as cattle fever ticks (CFT). Bovine babesiosis became a regulated foreign animal disease in the United States of America (U.S.) through efforts of the Cattle Fever Tick Eradication Program (CFTEP) established in 1906. The U.S. was declared free of CFT in 1943, with the exception of a permanent quarantine zone in south Texas along the border with Mexico. This achievement contributed greatly to the development and productivity of animal agriculture in the U.S. The permanent quarantine zone buffers CFT incursions from Mexico where both ticks and babesiosis are endemic. Until recently, the elimination of CFT outbreaks relied solely on the use of coumaphos, an organophosphate acaricide, in dipping vats or as a spray to treat livestock, or the vacation of pastures. However, ecological, societal, and economical changes are shifting the paradigm of systematically treating livestock to eradicate CFT. Keeping the U.S. CFT-free is a critical animal health issue affecting the economic stability of livestock and wildlife enterprises. Here, we describe vulnerabilities associated with global change forces challenging the CFTEP. The concept of integrated CFT eradication is discussed in reference to global change. PMID:22712018

  13. Rickettsia spp. in seabird ticks from western Indian Ocean islands, 2011-2012.

    PubMed

    Dietrich, Muriel; Lebarbenchon, Camille; Jaeger, Audrey; Le Rouzic, Céline; Bastien, Matthieu; Lagadec, Erwan; McCoy, Karen D; Pascalis, Hervé; Le Corre, Matthieu; Dellagi, Koussay; Tortosa, Pablo

    2014-05-01

    We found a diversity of Rickettsia spp. in seabird ticks from 6 tropical islands. The bacteria showed strong host specificity and sequence similarity with strains in other regions. Seabird ticks may be key reservoirs for pathogenic Rickettsia spp., and bird hosts may have a role in dispersing ticks and tick-associated infectious agents over large distances.

  14. 9 CFR 72.1 - Ticks [Boophilus annulatus (Margaropus annulatus), Boophilus microplus, or Rhipicephalus evertsi...

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Ticks ; interstate movement of... POULTRY) AND ANIMAL PRODUCTS TEXAS (SPLENETIC) FEVER IN CATTLE § 72.1 Ticks ; interstate movement of infested or exposed animals prohibited. No animals infested with ticks or exposed to tick infestation...

  15. 9 CFR 72.1 - Ticks [Boophilus annulatus (Margaropus annulatus), Boophilus microplus, or Rhipicephalus evertsi...

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... 9 Animals and Animal Products 1 2011-01-01 2011-01-01 false Ticks ; interstate movement of... POULTRY) AND ANIMAL PRODUCTS TEXAS (SPLENETIC) FEVER IN CATTLE § 72.1 Ticks ; interstate movement of infested or exposed animals prohibited. No animals infested with ticks or exposed to tick infestation...

  16. 9 CFR 72.1 - Ticks [Boophilus annulatus (Margaropus annulatus), Boophilus microplus, or Rhipicephalus evertsi...

    Code of Federal Regulations, 2012 CFR

    2012-01-01

    ... 9 Animals and Animal Products 1 2012-01-01 2012-01-01 false Ticks ; interstate movement of... POULTRY) AND ANIMAL PRODUCTS TEXAS (SPLENETIC) FEVER IN CATTLE § 72.1 Ticks ; interstate movement of infested or exposed animals prohibited. No animals infested with ticks or exposed to tick infestation...

  17. 9 CFR 72.1 - Ticks [Boophilus annulatus (Margaropus annulatus), Boophilus microplus, or Rhipicephalus evertsi...

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... 9 Animals and Animal Products 1 2013-01-01 2013-01-01 false Ticks ; interstate movement of... POULTRY) AND ANIMAL PRODUCTS TEXAS (SPLENETIC) FEVER IN CATTLE § 72.1 Ticks ; interstate movement of infested or exposed animals prohibited. No animals infested with ticks or exposed to tick infestation...

  18. Genetic identification of rickettsiae isolated from ticks in Japan.

    PubMed

    Fournier, Pierre-Edouard; Fujita, Hiromi; Takada, Nobuhiro; Raoult, Didier

    2002-06-01

    Following the description in Japan of Japanese spotted fever, caused by Rickettsia japonica, a search for the vector of this disease led to the isolation of several rickettsiae from various tick species. Sixty-three rickettsial isolates were obtained from six different tick species, and six type strains were described by PCR and monoclonal antibody testing. We identified these six strains by amplification and sequencing of the genes encoding 16S rRNA and citrate synthase. We confirmed that the isolates from Dermacentor taiwanensis and Haemaphysalis flava ticks were R. japonica isolates. In Ixodes ovatus, Ixodes persulcatus, and Ixodes monospinosus, we identified a Rickettsia identical or closely related to Rickettsia helvetica, a species that is pathogenic for humans and that to date has only been found in Europe. Finally, we identified a new genotype of unknown pathogenicity, genotype AT, that was isolated from Amblyomma testudinarium ticks and that is closely related to a Slovakian genotype obtained from Ixodes ricinus ticks.

  19. How ticks get under your skin: insertion mechanics of the feeding apparatus of Ixodes ricinus ticks.

    PubMed

    Richter, Dania; Matuschka, Franz-Rainer; Spielman, Andrew; Mahadevan, L

    2013-12-22

    The tick Ixodes ricinus uses its mouthparts to penetrate the skin of its host and to remain attached for about a week, during which time Lyme disease spirochaetes may pass from the tick to the host. To understand how the tick achieves both tasks, penetration and attachment, with the same set of implements, we recorded the insertion events by cinematography, interpreted the mouthparts' function by scanning electron microscopy and identified their points of articulation by confocal microscopy. Our structural dynamic observations suggest that the process of insertion and attachment occurs via a ratchet-like mechanism with two distinct stages. Initially, the two telescoping chelicerae pierce the skin and, by moving alternately, generate a toehold. Subsequently, a breaststroke-like motion, effected by simultaneous flexure and retraction of both chelicerae, pulls in the barbed hypostome. This combination of a flexible, dynamic mechanical ratchet and a static holdfast thus allows the tick to solve the problem of how to penetrate skin and also remain stuck for long periods of time.

  20. How ticks get under your skin: insertion mechanics of the feeding apparatus of Ixodes ricinus ticks

    PubMed Central

    Richter, Dania; Matuschka, Franz-Rainer; Spielman, Andrew; Mahadevan, L.

    2013-01-01

    The tick Ixodes ricinus uses its mouthparts to penetrate the skin of its host and to remain attached for about a week, during which time Lyme disease spirochaetes may pass from the tick to the host. To understand how the tick achieves both tasks, penetration and attachment, with the same set of implements, we recorded the insertion events by cinematography, interpreted the mouthparts’ function by scanning electron microscopy and identified their points of articulation by confocal microscopy. Our structural dynamic observations suggest that the process of insertion and attachment occurs via a ratchet-like mechanism with two distinct stages. Initially, the two telescoping chelicerae pierce the skin and, by moving alternately, generate a toehold. Subsequently, a breaststroke-like motion, effected by simultaneous flexure and retraction of both chelicerae, pulls in the barbed hypostome. This combination of a flexible, dynamic mechanical ratchet and a static holdfast thus allows the tick to solve the problem of how to penetrate skin and also remain stuck for long periods of time. PMID:24174106

  1. Quantification of brown dog tick repellents, 2-hexanone and benzaldehyde, and release from tick-resistant beagles, Canis lupus familiaris

    Technology Transfer Automated Retrieval System (TEKTRAN)

    We have recently shown that repellency of the tick Rhipicephalus sanguineus sensu lato by the tick resistant dog breed Beagle is mediated by volatile organic compounds 2-hexanone and benzaldehyde present in Beagle dog odour. Ectoparasite location on animal hosts is affected by variation in odour com...

  2. Molecular detection of zoonotic tick-borne pathogens from ticks collected from ruminants in four South African provinces

    PubMed Central

    MTSHALI, Khethiwe; KHUMALO, Zamantungwa T. H.; NAKAO, Ryo; GRAB, Dennis J.; SUGIMOTO, Chihiro; THEKISOE, Oriel M. M.

    2015-01-01

    Ticks carry and transmit a remarkable array of pathogens including bacteria, protozoa and viruses, which may be of veterinary and/or of medical significance. With little to no information regarding the presence of tick-borne zoonotic pathogens or their known vectors in southern Africa, the aim of our study was to screen for Anaplasma phagocytophilum, Borrelia burgdorferi, Coxiella burnetii, Rickettsia species and Ehrlichia ruminantium in ticks collected and identified from ruminants in the Eastern Cape, Free State, KwaZulu-Natal and Mpumalanga Provinces of South Africa. The most abundant tick species identified in this study were Rhipicephalus evertsi evertsi (40%), Rhipicephalus species (35%), Amblyomma hebraeum (10%) and Rhipicephalus decoloratus (14%). A total of 1634 ticks were collected. DNA was extracted, and samples were subjected to PCR amplification and sequencing. The overall infection rates of ticks with the target pathogens in the four Provinces were as follows: A. phagocytophilum, 7%; C. burnetii, 7%; E. ruminantium, 28%; and Rickettsia spp., 27%. The presence of B. burgdorferi could not be confirmed. The findings of this study show that zoonotic pathogens are present in ticks in the studied South African provinces. This information will aid in the epidemiology of tick-borne zoonotic diseases in the country as well as in raising awareness about such diseases in the veterinary, medical and tourism sectors, as they may be the most affected. PMID:26227797

  3. Molecular detection of zoonotic tick-borne pathogens from ticks collected from ruminants in four South African provinces.

    PubMed

    Mtshali, Khethiwe; Khumalo, Zth; Nakao, Ryo; Grab, Dennis J; Sugimoto, Chihiro; Thekisoe, Omm

    2016-01-01

    Ticks carry and transmit a remarkable array of pathogens including bacteria, protozoa and viruses, which may be of veterinary and/or of medical significance. With little to no information regarding the presence of tick-borne zoonotic pathogens or their known vectors in southern Africa, the aim of our study was to screen for Anaplasma phagocytophilum, Borrelia burgdorferi, Coxiella burnetii, Rickettsia species and Ehrlichia ruminantium in ticks collected and identified from ruminants in the Eastern Cape, Free State, KwaZulu-Natal and Mpumalanga Provinces of South Africa. The most abundant tick species identified in this study were Rhipicephalus evertsi evertsi (40%), Rhipicephalus species (35%), Amblyomma hebraeum (10%) and Rhipicephalus decoloratus (14%). A total of 1634 ticks were collected. DNA was extracted, and samples were subjected to PCR amplification and sequencing. The overall infection rates of ticks with the target pathogens in the four Provinces were as follows: A. phagocytophilum, 7%; C. burnetii, 7%; E. ruminantium, 28%; and Rickettsia spp., 27%. The presence of B. burgdorferi could not be confirmed. The findings of this study show that zoonotic pathogens are present in ticks in the studied South African provinces. This information will aid in the epidemiology of tick-borne zoonotic diseases in the country as well as in raising awareness about such diseases in the veterinary, medical and tourism sectors, as they may be the most affected.

  4. Research Strategies to Reduce Tick Densities and the Risk of Tick-borne Disease Transmission through Host-Targeted Control

    Technology Transfer Automated Retrieval System (TEKTRAN)

    While white-tailed deer are not reservoir hosts for the Lyme disease agent, Borrelia burgdorferi, they are the keystone host animal on which adult female blacklegged ticks engorge on blood that is essential to production of tick eggs and completion of the life cycle. This session explores current re...

  5. Research update on the potential use of anti-tick vaccines to support the USDA Cattle Fever Tick Eradication Program

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The USDA APHIS VS Cattle Fever Tick Eradication program (CFTEP) was established in 1906 to eliminate populations of the cattle fever ticks (CFT) Rhipicephalus (Boophilus) annulatus and R. microplus as a way to eradicate bovine babesiosis from the continental United States, which is a high-impact dis...

  6. Distribution of borreliae among ticks collected from eastern states.

    PubMed

    Taft, Sarah C; Miller, Melissa K; Wright, Stephen M

    2005-01-01

    Lyme disease is the most commonly reported vector-borne disease in the United States and is transmitted by Borrelia burgdorferi-infected Ixodes species. The disease is typically characterized by an erythema migrans (EM) rash at the site of tick feeding. EM rashes have also been associated with feeding by Amblyomma americanum ticks despite evidence suggesting that they are incompetent vectors for Lyme disease. In 1996, a Borrelia organism only recently cultivated in the laboratory was described in A. americanum ticks and designated B. lonestari. This Borrelia is believed to be the etiologic agent of a novel Lyme-like disease, southern tick associated rash illness (STARI). This study examined ticks collected from eight eastern states to evaluate the epidemiology of B. lonestari, B. burgdorferi, and their tick hosts. Three hundred individual or small pool samples were evaluated from tick genera that included Amblyomma, Ixodes, and Dermacentor. DNA was extracted following tick homogenization and the polymerase chain reaction (PCR) was performed using primers derived from the flagellin gene that amplify sequences from both B. burgdorferi and B. lonestari. Species specific digoxigenin labeled probes were designed and used to differentiate between B. burgdorferi and B. lonestari. Borrelia DNA was detected in approximately 10% of the A. americanum and I. scapularis tick samples, but none was present in any of the Dermacentor samples tested. Positive samples were detected in ticks collected from Kentucky, Maryland, Massachusetts, New Jersey, New York, and Virginia. This is the first known report of B. lonestari from Massachusetts and New York and the first detection in I. scapularis. This suggests that B. lonestari and its putative association with STARI may be more widespread than previously thought.

  7. Displaced tick-parasite interactions at the host interface.

    PubMed

    Nuttall, P A

    1998-01-01

    Reciprocal interactions of parasites transmitted by blood-sucking arthropod vectors have been studied primarily at the parasite-host and parasite-vector interface. The third component of this parasite triangle, the vector-host interface, has been largely ignored. Now there is growing realization that reciprocal interactions between arthropod vectors and their vertebrate hosts play a pivotal role in the survival of arthropod-borne viruses, bacteria, and protozoa. The vector-host interface is the site where the haematophagous arthropods feeds. To obtain a blood meal, the vector must overcome the host's inflammatory, haemostatic, and immune responses. This problem is greatest for ixodid ticks which may imbibe as much as 15 ml blood whilst continuously attached to their host for 10 days or more. To feed successfully, the interface between tick and host becomes a battle between the host's mechanisms for combating the tick and the tick's armoury of bioactive proteins and other chemicals which it secrets, via saliva, into the feeding lesion formed in the host's skin. Parasites entering this battlefield encounter a privileged site in their vertebrate host that has been profoundly modified by the pharmacological activities of their vector's saliva. For example, ticks suppress natural killer cells and interferons, both of which have potent antiviral activities. Not surprisingly, vector-bone parasites exploit the immunomodulated feeding site to promote their transmission and infection. Certain tick-bone viruses are so successful at this that they are transmitted from one infected tick, through the vertebrate host to a co-feeding uninfected tick, without a detectable viraemia (virus circulating in the host's blood), and with no untoward effect on the host. When such viruses do have an adverse effect on the host, they may impede their vectors' feeding. Thus important interactions between ticks and tick-borne parasites are displaced to the interface with their vertebrate host

  8. Identification of 24h Ixodes scapularis immunogenic tick saliva proteins.

    PubMed

    Lewis, Lauren A; Radulović, Željko M; Kim, Tae K; Porter, Lindsay M; Mulenga, Albert

    2015-04-01

    Ixodes scapularis is arguably the most medically important tick species in the United States. This tick transmits 5 of the 14 human tick-borne disease (TBD) agents in the USA: Borrelia burgdorferi, Anaplasma phagocytophilum, B. miyamotoi, Babesia microti, and Powassan virus disease. Except for the Powassan virus disease, I. scapularis-vectored TBD agents require more than 24h post attachment to be transmitted. This study describes identification of 24h immunogenic I. scapularis tick saliva proteins, which could provide opportunities to develop strategies to stop tick feeding before transmission of the majority of pathogens. A 24h fed female I. scapularis phage display cDNA expression library was biopanned using rabbit antibodies to 24h fed I. scapularis female tick saliva proteins, subjected to next generation sequencing, de novo assembly, and bioinformatic analyses. A total of 182 contigs were assembled, of which ∼19% (35/182) are novel and did not show identity to any known proteins in GenBank. The remaining ∼81% (147/182) of contigs were provisionally identified based on matches in GenBank including ∼18% (27/147) that matched protein sequences previously annotated as hypothetical and putative tick saliva proteins. Others include proteases and protease inhibitors (∼3%, 5/147), transporters and/or ligand binding proteins (∼6%, 9/147), immunogenic tick saliva housekeeping enzyme-like (17%, 25/147), ribosomal protein-like (∼31%, 46/147), and those classified as miscellaneous (∼24%, 35/147). Notable among the miscellaneous class include antimicrobial peptides (microplusin and ricinusin), myosin-like proteins that have been previously found in tick saliva, and heat shock tick saliva protein. Data in this study provides the foundation for in-depth analysis of I. scapularis feeding during the first 24h, before the majority of TBD agents can be transmitted.

  9. Identification of 24 h Ixodes scapularis immunogenic tick saliva proteins

    PubMed Central

    Lewis, Lauren A.; Radulović, Željko M.; Kim, Tae K.; Porter, Lindsay M.; Mulenga, Albert

    2015-01-01

    Ixodes scapularis is arguably the most medically important tick species in the United States. This tick transmits 5 of the 14 human tick-borne disease (TBD) agents in the USA: Borrelia burgdorferi, Anaplasma phagocytophilum, B. miyamotoi, Babesia microti, and Powassan virus disease. Except for the Powassan virus disease, I. scapularis-vectored TBD agents require more than 24 h post attachment to be transmitted. This study describes identification of 24 h immunogenic I. scapularis tick saliva proteins, which could provide opportunities to develop strategies to stop tick feeding before transmission of the majority of pathogens. A 24 h fed female I. scapularis phage display cDNA expression library was biopanned using rabbit antibodies to 24 h fed I. scapularis female tick saliva proteins, subjected to next generation sequencing, de novo assembly, and bioinformatic analyses. A total of 182 contigs were assembled, of which ~19% (35/182) are novel and did not show identity to any known proteins in GenBank. The remaining ~81% (147/182) of contigs were provisionally identified based on matches in GenBank including ~18% (27/147) that matched protein sequences previously annotated as hypothetical and putative tick saliva proteins. Others include proteases and protease inhibitors (~3%, 5/147), transporters and/or ligand binding proteins (~6%, 9/147), immunogenic tick saliva housekeeping enzyme-like (17%, 25/147), ribosomal protein-like (~31%, 46/147), and those classified as miscellaneous (~24%, 35/147). Notable among the miscellaneous class include antimicrobial peptides (microplusin and ricinusin), myosin-like proteins that have been previously found in tick saliva, and heat shock tick saliva protein. Data in this study provides the foundation for in-depth analysis of I. scapularis feeding during the first 24 h, before the majority of TBD agents can be transmitted. PMID:25825233

  10. Agriculture: Newsroom

    EPA Pesticide Factsheets

    Agriculture Newsroom. News releases, reports, and other documents from around EPA that are of interest or direct importance to the environmental management or compliance efforts of the agricultural community.

  11. Grassland agriculture

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Agriculture in grassland environments is facing multiple stresses from: shifting demographics, declining and fragmented agricultural landscapes, declining environmental quality, variable and changing climate, volatile and increasing energy costs, marginal economic returns, and globalization. Degrad...

  12. Occurrence of Ticks in Cattle in the New Pastoral Farming Areas in Rufiji District, Tanzania.

    PubMed

    Mamiro, Kamilius A; Magwisha, Henry B; Rukambile, Elpidius J; Ruheta, Martin R; Kimboka, Expery J; Malulu, Deusdedit J; Malele, Imna I

    2016-01-01

    Ticks and tick-borne diseases plus trypanosomosis are a constraint to cattle rearing in Tanzania. Rufiji district was not known for important ticks infesting cattle because inhabitants were not engaged in keeping livestock. Not only has settlement of pastoralists and cattle in Rufiji increased the number of cattle but also cattle have been the source of bringing in and spreading of ticks. This study investigated tick species that have been introduced and managed to establish themselves in the new livestock farming areas in cattle in Rufiji. Tick distribution study was undertaken in three villages of Chumbi ward seasonally in 2009, 2011, and 2012. The identified ticks were Amblyomma variegatum (56.10%), Rhipicephalus evertsi (10.25%), R. microplus (27.40%), and R. appendiculatus (6.19%) out of 12940 ticks. Results indicate that ticks are present in the new livestock settlement areas. The occurrence of ticks is correlated with the recent settlement of cattle in the district.

  13. Survey of ixodid ticks and two tick-borne pathogens in African buffaloes, Syncerus caffer, from the Caprivi Strip, Namibia.

    PubMed

    Pascucci, Ilaria; Capobianco Dondona, Andrea; Cammà, Cesare; Marcacci, Maurilia; Di Domenico, Marco; Lelli, Rossella; Scacchia, Massimo; Jago, Mark; Khaiseb, Siegfried; Hager, Anna Laure; Tjipura-Zaire, Georgina; Caporale, Vincenzo

    2011-12-01

    A capture operation to ascertain health status in free-ranging buffaloes from six different areas in the Caprivi Strip in the northeast corner of Namibia was conducted in October 2009. Basic information on the ticks and tick-borne pathogens normally found in wildlife from this area are scarce. The objective of this study was to assess the host status of African buffaloes, Syncerus caffer, for ixodid ticks and two selected tick-borne pathogens in the Caprivi Strip, a key area bordering Angola, Zambia, Botswana, and Zimbabwe. Four different tick species have been identified among the 233 collected specimens, and, of 95 tested buffaloes, 54 (57%) were positive for Theileria parva, whereas only 3 (3%) showed evidence of being infected with Ehrlichia ruminantium.

  14. Detection of tick-borne pathogens in ticks from migratory birds in the Baltic region of Russia.

    PubMed

    Movila, A; Alekseev, A N; Dubinina, H V; Toderas, I

    2013-03-01

    We report the finding of tick-borne encephalitis (TBE)-virus in indigenous Ixodes ricinus (L.), 'Candidatus Neoehrlichia mikurensis' in exotic Ixodes frontalis (Panzer) and Rickettsia aeshlimannii in exotic Hyalomma marginatum Koch subadult ticks detached from 18.5% (107/577) infested migratory birds in the Baltic region of Russia. This is the first record of human pathogenic 'Candidatus N. mikurensis' in I. frontalis ticks. Moreover, seven other pathogens were identified in I. ricinus ticks. Spotted Fever Group rickettsiae were the predominant pathogen group and were detected only in nymphs. Future investigations are warranted to further characterize the role of birds in the epizootiology of tick-borne pathogens in this region.

  15. Prevalence of tick-borne pathogens in adult Dermacentor spp. ticks from nine collection sites in France.

    PubMed

    Bonnet, S; de la Fuente, J; Nicollet, P; Liu, X; Madani, N; Blanchard, B; Maingourd, C; Alongi, A; Torina, A; Fernández de Mera, I G; Vicente, J; George, J-C; Vayssier-Taussat, M; Joncour, G

    2013-04-01

    The importance of Dermacentor spp. in the transmission of tick-borne pathogens is not well recognized in Europe. To investigate the role of Dermacentor spp. in the transmission of tick-borne pathogens, questing ticks were collected in 9 sites from southern to northwestern France (Camargue Delta to Eastern Brittany) where Dermacentor spp. exist and tick-borne diseases had occurred previously. Three tick species were collected during the spring and autumn of 2009. Collected ticks (both males and females) included D. marginatus (n=377), D. reticulatus (n=74), and I. ricinus (n=45). All ticks were analyzed by PCR or reverse line blot for the presence of pathogens' DNA. Pathogens analyzed were based on veterinarian reports and included Anaplasma phagocytophilum, Coxiella burnetii, Anaplasma marginale, Borrelia burgdorferi, Bartonella spp., Babesia spp., Theileria spp., and Francisella sp. Francisella tularensis was not detected in any of the analyzed ticks. In D. marginatus, infection prevalence for A. phagocytophilum (3%) was similar to that found in I. ricinus in Europe. Other pathogens present in D. marginatus included A. marginale (0.5%), Bartonella spp. (9%), C. burnetii (12%), F. philomiragia (1.3%), and Theileria annulata/Babesia bovis (0.3%), which were detected for the first time in France. Pathogens detected in D. reticulatus included A. marginale (1%), Bartonella spp. (12%), C. burnetii (16%), Borrelia spp. (1.5%), and F. philomiragia (19%). Pathogens detected in I. ricinus included A. phagocytophilum (41%), Bartonella spp. (9%), C. burnetii (18%), A. marginale (1%), Borrelia spp. (4.5%), and Babesia sp. (7%). This study represents the first epidemiological approach to characterize tick-borne pathogens infecting Dermacentor spp. in France and that may be transmitted by ticks from this genus. Further experiments using experimental infections and transmission may be now conducted to analyze vector competency of Dermacentor spp. for these pathogens and to

  16. [Total atrioventricular block following a tick bite].

    PubMed

    Verbunt, R J A M; Visser, R F

    2007-09-01

    A 40-year-old man was referred to the cardiology outpatient clinic with dizziness, palpitations and shortness of breath. He remembered being bitten by a tick two to three years previously, but had not noticed a characteristic skin rash. The ECG showed a prominent first degree atrioventricular (AV) block and ambulatory electrocardiographic monitoring showed an intermittent complete AV block. A definitive pacemaker was implanted. Antibodies to Borrelia were found. The patient was treated with ceftriaxone. In the weeks and months following implantation, the AV block disappeared completely. The reversibility of the AV block secured the diagnosis 'Lyme carditis with secondary AV block', and the pacemaker was explanted.

  17. [Tick borne encephalitis and enviromental changes].

    PubMed

    Zajkowska, Joanna; Malzahn, Elzbieta; Kondrusik, Maciej; Grygorczuk, Sambor; Pancewicz, Sławomir S; Kuśmierczyk, Justyna; Czupryna, Piotr; Hermanowska-Szpakowicz, Teresa

    2006-01-01

    Currently observed markedly increased incidence of various tick borne diseases in many parts of Europe is due to documented climatic changes as well anthropogenic influence on habitat structure. One of the analyzed factors is tendency to increase of the spring temperatures, especially in the third decade of the April. Such conditions (spring temperatures above 7-10 degrees C) let the nymphs and larvae of Ixodes ricinus to feed simultaneously on rodents. This increases the risk of infection of Ixodes ricinus with TBE virus, so dangerous for humans.

  18. Risk of encountering ticks and tick-borne pathogens in a rapidly growing metropolitan area in the U.S. Great Plains.

    PubMed

    Noden, Bruce H; Loss, Scott R; Maichak, Courtney; Williams, Faithful

    2017-01-01

    The prevalence of tick-borne diseases has increased dramatically in many urban areas of the U.S., yet little is known about the ecology of ticks and tick-borne pathogens in relation to characteristics of North American urban and suburban landscapes. This study aimed to begin identification of the risk of encountering ticks and tick-borne pathogens within a rapidly expanding metropolitan area in the U.S. Great Plains region. Ten sites across Oklahoma City, Oklahoma were selected for tick sampling based on presence of tick habitat and level of urbanization intensity. Sampling was conducted using CO2 traps and flagging in June, July and October 2015. A total of 552 ticks were collected from eight of the ten sampled greenspaces. The majority of ticks collected in summer were Amblyomma americanum (N=534 (97.8%)), followed by Dermacentor variabilis (N=10 (1.8%)) and Amblyomma maculatum (N=2 (0.3%)). Ixodes scapularis adult females (N=4) and nymphal A. americanum (N=2) were also collected in October 2015. Tick species diversity was highest in sites with >15% of the surrounding landscape composed of undeveloped land. Rickettsia sp. (including R. amblyommii and 'Candidatus R. andeanae'), Ehrlichia chaffeensis and/or E. ewingii were detected in tick pools from all eight sites where ticks were found. Our data suggest that the risk of encountering ticks and tick-borne pathogens exists throughout the Oklahoma City metropolitan area and that tick populations are likely influenced by urbanization intensity. Continued research is needed to clarify the full range of abiotic and biotic features of urban landscapes that influence the risk of encountering ticks and transmitting tick-borne diseases.

  19. Crimean-Congo Hemorrhagic Fever Virus Clade IV (Asia 1) in Ticks of Western Iran.

    PubMed

    Kayedi, Mohammad Hassan; Chinikar, Sadegh; Mostafavi, Ehsan; Khakifirouz, Sahar; Jalali, Tahmineh; Hosseini-Chegeni, Asadolah; Naghizadeh, Ali; Niedrig, Matthias; Fooks, Anthony R; Shahhosseini, Nariman

    2015-09-01

    Crimean-Congo Hemorrhagic Fever virus (CCHFV) is transmitted through the bite of an infected tick, or by direct contact with CCHFV-infected patients' blood or the products of infected livestock. In 2012, ticks were collected in eight regions of Lorestan Province, Iran. In total, 434 ticks were collected. Reverse transcriptase polymerase chain reaction was used for the detection of CCHFV RNA. Of 434 ticks, 419 (96.6%) ticks were from the family Ixodidae (hard ticks) and 15 (3.5%) ticks were from the family Argasidae (soft ticks). The presence of CCHFV RNA was detected in 29 (6.7%) of 434 ticks. The infected tick species include Hyalomma asiaticum (n = 7, 7.4%), Hyalomma anatolicum (n = 12, 13.2%), Hyalomma marginatum (n = 1, 16.7%), and Rhipicephalus sanguineus (n = 9, 4.3%). These empirical data demonstrated that the majority of CCHFV-positive ticks belonged to the Ixodidae. None of the Argasidae and Haemaphysalis sulcata species was infected with CCHFV. The phylogenetic analyses of the tick-derived CCHFV strains revealed that all 29 viral strains fell in clade IV (Asia 1). The most abundant species of tick collected in this study was R. sanguineus followed by different species of Hyalomma. Given the infection rate among collected ticks, H. marginatum was the most abundant infected tick species (16.7%) followed by H. anatolicum (13.2%), H. asiaticum (7.4%), and R. sanguineus (4.3%).

  20. Flying ticks: anciently evolved associations that constitute a risk of infectious disease spread.

    PubMed

    de la Fuente, José; Estrada-Peña, Agustín; Cabezas-Cruz, Alejandro; Brey, Ricardo

    2015-10-15

    Ticks are important vectors of emerging zoonotic diseases affecting human and animal health worldwide. Ticks are often found on wild birds, which have been long recognized as a potential risk factor for dissemination of ticks and tick-borne pathogens (TBP), thus raising societal concerns and prompting research into their biology and ecology. To fully understand the role of birds in disseminating some ticks species and TBP, it is important to consider the evolutionary relationships between birds, ticks and transmitted pathogens. In this paper we reviewed the possible role of birds in the dissemination of TBP as a result of the evolution of host-tick-pathogen associations. Birds are central elements in the ecological networks of ticks, hosts and TBP. The study of host-tick-pathogen associations reveals a prominent role for birds in the dissemination of Borrelia spp. and Anaplasma phagocytophilum, with little contribution to the possible dissemination of other TBP. Birds have played a major role during tick evolution, which explains why they are by far the most important hosts supporting the ecological networks of ticks and several TBP. The immune response of birds to ticks and TBP has been largely overlooked. To implement effective measures for the control of tick-borne diseases, it is necessary to study bird-tick and bird-pathogen molecular interactions including the immune response of birds to tick infestation and pathogen infection.

  1. Ticks on humans in the Pantanal wetlands, Brazil.

    PubMed

    Ramos, Vanessa N; Osava, Carolina F; Piovezan, Ubiratan; Szabó, Matias P J

    2014-09-01

    Information on ticks biting humans in Brazil is very restricted. In fact, many times when human tick-borne diseases are diagnosed, the involved vector tick is not identified, although this may be clinically helpful. Pantanal is one of the world's largest floodplains, has an exuberant wildlife, and is place of extensive cattle ranching, ecotourism, and fishing. We herein report tick species found on humans in a 13-month survey in a region with both cattle and wildlife handling in the Brazilian Pantanal. From February 2012 to February 2013, a total of 280 ticks was collected from humans (n=22), 121 of which were attached. Amblyomma cajennense sensu lato nymphs were the main tick species and stage found attached to humans (n=93) especially during the dry months (winter). In the wet season (summer), Amblyomma parvum adults were the main ticks found attached to humans (n=19) followed by A. cajennense s.l. adults (n=9). Only one unattached nymph of A. parvum was collected in this study. These results reinforce that A. cajennense s.l. nymphs are an important parasite of humans (and vectors) in Brazil and draw also attention to A. parvum adults as frequent human parasites as well.

  2. Tick-borne rickettsiae in Guinea and Liberia.

    PubMed

    Mediannikov, Oleg; Diatta, Georges; Zolia, Yah; Balde, Mamadou Cellou; Kohar, Henry; Trape, Jean-François; Raoult, Didier

    2012-02-01

    While the high seroprevalence for the rickettsiae that cause spotted fevers and the multiple pathogenic rickettsiae is known, the data on the distribution of rickettsial diseases in Africa are often incomplete. We collected ticks from domestic or wild animals (generally a source of bushmeat) that were in contact with humans in 2 neighboring countries of tropical West Africa, Guinea and Liberia. In total, 382 ticks representing 6 species were collected in Liberia and 655 ticks representing 7 species were collected in Guinea. We found rickettsiae in 9 different species of ticks from both countries. Rickettsia africae was found in 93-100% of Amblyomma variegatum, in 14-93% of Rhipicephalus (B.) geigyi, Rh. (B.) annulatus, and Rh. (B.) decoloratus, and in several Hyalomma marginatum rufipes and Haemaphysalis paraleachi. A genetic variant of R. africae was found in Amblyomma compressum. R. massiliae was found in 10/61 (16%) of Rh. senegalensis ticks and in 2% of Haemaphysalis paraleachi ticks collected from dogs. We identified a new rickettsia in one of 44 (2%) Ixodes muniensis collected from a dog in Liberia. As this rickettsia is not yet isolated, we propose the provisional name "Candidatus Rickettsia liberiensis" (for the West African country where the host tick was collected).

  3. Exploring the mialome of ticks: an annotated catalogue of midgut transcripts from the hard tick, Dermacentor variabilis (Acari: Ixodidae)

    PubMed Central

    Anderson, Jennifer M; Sonenshine, Daniel E; Valenzuela, Jesus G

    2008-01-01

    Background Ticks are obligate blood feeders. The midgut is the first major region of the body where blood and microbes ingested with the blood meal come in contact with the tick's internal tissues. Little is known about protein expression in the digestive tract of ticks. In this study, for analysis of global gene expression during tick attachment and feeding, we generated and sequenced 1,679 random transcripts (ESTs) from cDNA libraries from the midguts of female ticks at varying stages of feeding. Results Sequence analysis of the 1,679 ESTs resulted in the identification of 835 distinct transcripts, from these, a total of 82 transcripts were identified as proteins putatively directly involved in blood meal digestion, including enzymes involved in oxidative stress reduction/antimicrobial activity/detoxification, peptidase inhibitors, protein digestion (cysteine-, aspartic-, serine-, and metallo-peptidases), cell, protein and lipid binding including mucins and iron/heme metabolism and transport. A lectin-like protein with a high match to lectins in other tick species, allergen-like proteins and surface antigens important in pathogen recognition and/or antimicrobial activity were also found. Furthermore, midguts collected from the 6-day-fed ticks expressed twice as many transcripts involved in bloodmeal processing as midguts from unfed/2-day-fed ticks. Conclusion This tissue-specific transcriptome analysis provides an opportunity to examine the global expression of transcripts in the tick midgut and to compare the gut response to host attachment versus blood feeding and digestion. In contrast to those in salivary glands of other Ixodid ticks, most proteins in the D. variabilis midgut cDNA library were intracellular. Of the total ESTs associated with a function, an unusually large number of transcripts were associated with peptidases, cell, lipid and protein binding, and oxidative stress or detoxification. Presumably, this is consistent with their role in

  4. Enhancing Employee Skills.

    ERIC Educational Resources Information Center

    1999

    This document contains four symposium papers on enhancing employee skills. "The Effect of Study Skills Training Intervention on United States Air Force Aeromedical Apprentices" (John C. Griffith) demonstrates how study skills intervention resulted in a significant increase in the end-of-course scores of a sample of 90 randomly selected Air Force…

  5. Employees on the Move!

    ERIC Educational Resources Information Center

    Levin, Sarah

    This paper describes a method for designing, implementing, and evaluating a work-site physical activity campaign aimed at employees who are currently sedentary in their leisure time. Inactivity is a major but modifiable risk factor for coronary heart disease. Increasing the activity levels of underactive adults would have a positive impact on…

  6. Managing Employee Assistance Programmes.

    ERIC Educational Resources Information Center

    Schmidenberg, Olive C.; Cordery, John L.

    1990-01-01

    Interviews with 20 branch managers and 20 accountants in an Australian bank determined factors influencing the success of an employee assistance program (EAP). It was found that policies requiring supervisors to act against normal managerial practice doom EAPs to failure. Organizational analysis to integrate the EAP within existing organizational…

  7. 7 CFR 15b.6 - Designation of responsible employee and adoption of grievance procedures.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... 7 Agriculture 1 2014-01-01 2014-01-01 false Designation of responsible employee and adoption of... Provisions § 15b.6 Designation of responsible employee and adoption of grievance procedures. (a) Designation... one person to coordinate its efforts to comply with this part. (b) Adoption of grievance procedures....

  8. 7 CFR 15b.6 - Designation of responsible employee and adoption of grievance procedures.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... 7 Agriculture 1 2013-01-01 2013-01-01 false Designation of responsible employee and adoption of... Provisions § 15b.6 Designation of responsible employee and adoption of grievance procedures. (a) Designation... one person to coordinate its efforts to comply with this part. (b) Adoption of grievance procedures....

  9. 7 CFR 15b.6 - Designation of responsible employee and adoption of grievance procedures.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Designation of responsible employee and adoption of... Provisions § 15b.6 Designation of responsible employee and adoption of grievance procedures. (a) Designation... one person to coordinate its efforts to comply with this part. (b) Adoption of grievance procedures....

  10. Factors Associated with Tick Bite Preventive Practices among Farmworkers in Malaysia

    PubMed Central

    Wong, Li Ping; Tay, Sun Tee; Bulgiba, Awang; Zandi, Keivan; Kho, Kai Ling; Koh, Fui Xian; Ong, Bee Lee; Jaafar, Tariq; Hassan Nizam, Quaza Nizamuddin

    2016-01-01

    Background Farmworkers are at high-risk for tick bites, which potentially transmit various tick-borne diseases. Previous studies show that personal prevention against tick bites is key, and certain factors namely, knowledge, experience of tick bites, and health beliefs influence compliance with tick bites preventive behaviour. This study aimed to assess these factors and their associations with tick bite preventive practices among Malaysian farmworkers. Methods A total of eight cattle, goat and sheep farms in six states in Peninsular Malaysia participated in a cross-sectional survey between August and October 2013 Results A total of 151 (72.2%) out of 209 farmworkers answered the questionnaire. More than half of the farmworkers (n = 91) reported an experience of tick bites. Farms with monthly acaricide treatment had significantly (P<0.05) a low report of tick bites. Tick bite exposure rates did not differ significantly among field workers and administrative workers. The mean total knowledge score of ticks for the overall farmworkers was 13.6 (SD±3.2) from 20. The mean total tick bite preventive practices score for all farmworkers was 8.3 (SD±3.1) from 15. Fixed effect model showed the effects of four factors on tick bite prevention: (1) farms, (2) job categories (administrative workers vs. field workers), (3) perceived severity of tick bites, and (4) perceived barriers to tick bite prevention. Conclusions A high proportion of farmworkers, including administrative workers, reported an experience of tick bites. The effectiveness of monthly acaricide treatment was declared by low reports of tick bites on these farms. Tick bite preventive practices were insufficient, particularly in certain farms and for administrative workers. Our findings emphasise the need to have education programmes for all farmworkers and targeting farms with low prevention practices. Education and health programmes should increase the perception of the risk of tick bites and remove perceived

  11. Amblyomma americanum (L.) (Acari: Ixodidae) tick salivary gland serine protease inhibitor (serpin) 6 is secreted into tick saliva during tick feeding.

    PubMed

    Chalaire, Katelyn Cox; Kim, Tae Kwon; Garcia-Rodriguez, Heidy; Mulenga, Albert

    2011-02-15

    In order to successfully feed and transmit disease agents, ticks are thought to inject serine protease inhibitors (serpins) into the host to modulate host defense responses to tick feeding, such as inflammation, the complement activation pathway and blood coagulation. In this study, we show that Amblyomma americanum (Aam) serpin (S) 6 is putatively injected into the host during tick feeding, in that the antibody to recombinant (r) AamS6 specifically reacted with the expected ∼43/45 kDa AamS6 protein band on western blots of pilocarpine-induced tick saliva. Additionally, antibodies to tick saliva proteins that were generated by repeated 48 h infestations of rabbits with adult A. americanum specifically reacted with rAamS6. We speculate that AamS6 is associated with regulating events at the start of the tick feeding process, as temporal and spatial RT-PCR and western blot analyses revealed that both AamS6 mRNA and protein are strongly expressed during the first 24-72 h of feeding time before starting to fade from 96 h. The AamS6 protein has an apparently slow turnover rate in that, although the injection of AamS6 dsRNA into unfed ticks triggered complete disruption of the AamS6 mRNA by the 48 h feeding time point, western blot analysis of protein extracts of the same animals showed that the AamS6 protein that may have been expressed prior to disruption of the AamS6 mRNA was not depleted. We speculate that the presence of the AamS6 protein in ticks despite the complete disruption of the AamS6 mRNA explains the observation that RNAi-mediated silencing of the AamS6 mRNA did not affect the ability of A. americanum ticks to attach onto host skin, successfully feed and lay eggs. These findings are discussed in regards to advances in the molecular biology of ticks.

  12. Employee Perceptions of Quality Management: Effects of Employee Orientation Training

    ERIC Educational Resources Information Center

    Akdere, Mesut; Schmidt, Steven W.

    2008-01-01

    This empirical study examines employee perceptions of quality management at three different time periods. New employees at a large United States manufacturing organization were surveyed regarding their perceptions of their organization's quality management practices before they attended a new employee orientation training, immediately after the…

  13. Candidatus Neoehrlichia mikurensis in Ticks from Migrating Birds in Sweden.

    PubMed

    Labbé Sandelin, Lisa; Tolf, Conny; Larsson, Sara; Wilhelmsson, Peter; Salaneck, Erik; Jaenson, Thomas G T; Lindgren, Per-Eric; Olsen, Björn; Waldenström, Jonas

    2015-01-01

    Candidatus Neoehrlichia mikurensis (CNM; family Anaplasmataceae) was recently recognized as a potential tick-borne human pathogen. The presence of CNM in mammals, in host-seeking Ixodes ticks and in ticks attached to mammals and birds has been reported recently. We investigated the presence of CNM in ornithophagous ticks from migrating birds. A total of 1,150 ticks (582 nymphs, 548 larvae, 18 undetermined ticks and two adult females) collected from 5,365 birds captured in south-eastern Sweden was screened for CNM by molecular methods. The birds represented 65 different species, of which 35 species were infested with one or more ticks. Based on a combination of morphological and molecular species identification, the majority of the ticks were identified as Ixodes ricinus. Samples were initially screened by real-time PCR targeting the CNM 16S rRNA gene, and confirmed by a second real-time PCR targeting the groEL gene. For positive samples, a 1260 base pair fragment of the 16S rRNA gene was sequenced. Based upon bacterial gene sequence identification, 2.1% (24/1150) of the analysed samples were CNM-positive. Twenty-two out of 24 CNM-positive ticks were molecularly identified as I. ricinus nymphs, and the remaining two were identified as I. ricinus based on morphology. The overall CNM prevalence in I. ricinus nymphs was 4.2%. None of the 548 tested larvae was positive. CNM-positive ticks were collected from 10 different bird species. The highest CNM-prevalences were recorded in nymphs collected from common redpoll (Carduelis flammea, 3/7), thrush nightingale (Luscinia luscinia, 2/29) and dunnock (Prunella modularis, 1/17). The 16S rRNA sequences obtained in this study were all identical to each other and to three previously reported European strains, two of which were obtained from humans. It is concluded that ornithophagous ticks may be infected with CNM and that birds most likely can disperse CNM-infected ticks over large geographical areas.

  14. Ticks infesting amphibians and reptiles in Pernambuco, Northeastern Brazil.

    PubMed

    Dantas-Torres, Filipe; Oliveira-Filho, Edmilson F; Soares, Fábio Angelo M; Souza, Bruno O F; Valença, Raul Baltazar P; Sá, Fabrício B

    2008-01-01

    Ticks infesting amphibians and reptiles in the State of Pernambuco are reviewed, based on the current literature and new collections recently carried out by the authors. To date, three tick species have been found on amphibians and reptiles in Pernambuco. Amblyomma fuscum appears to be exclusively associated with Boa constrictor, its type host. Amblyomma rotundatum has a relatively low host-specificity, being found on toads, snakes, and iguana. Amblyomma dissimile has been found on a lizard and also small mammals (i.e., rodents and marsupials). New tick-host associations and locality records are given.

  15. New Borrelia species detected in ixodid ticks in Oromia, Ethiopia.

    PubMed

    Kumsa, Bersissa; Socolovschi, Cristina; Raoult, Didier; Parola, Philippe

    2015-04-01

    Little is known about Borrelia species transmitted by hard ticks in Ethiopia. The present study was conducted from November 2011 through March 2014 to address the occurrence and molecular identity of these bacteria in ixodid ticks infesting domestic animals in Oromia, Ethiopia. A total of 767 ixodid ticks collected from domestic animals were screened for Borrelia DNA by quantitative (q) real-time PCR followed by standard PCR and sequencing to identify the species. Overall, 3.8% (29/767) of the tested ticks were positive for Borrelia DNA, including 8/119 (6.7%) Amblyomma cohaerens, 1/42 (2.4%) Am. gemma, 3/53 (5.7%) Am. variegatum, 5/22 (22.7%) Amblyomma larvae, 3/60 (5%) Amblyomma nymphs, 2/139 (1.4%) Rhipicephalus (Boophilus) decoloratus, 2/31 (6.4%) Rh. decoloratus nymphs, and 5/118 (4.2%) Rh. pulchellus using 16S genus-specific qPCR. The prevalence of Borrelia DNA was significantly higher in genus Amblyomma (20/298, 6.7%) than in the genus Rhipicephalus (9/417, 2.1%) ticks (P=0.001). Sequencing of PCR products from the flaB and 16S rRNA genes of Borrelia spp. from Amblyomma ticks showed the presence of a new species between the relapsing fever and Lyme disease groups. However, Borrelia sp. detected in Rhipicephalus ticks clustered with B. theileri/B. lonestari. The human pathogenicity of the Borrelia sp. detected in Amblyomma ticks from Ethiopia has not yet been investigated, whereas the Borrelia sp. detected in Rhipicephalus ticks in our study is the causative agent of bovine borreliosis in cattle and may have veterinary importance in different parts of Ethiopia. Furthermore, the detection of previously unrecognized Borrelia species in Amblyomma and Rhipicephalus ticks in Ethiopia generates additional questions concerning the bacterial fauna in hard ticks and will prompt researchers to perform detailed studies for better understanding of ixodid ticks associated bacteria.

  16. Candidatus Neoehrlichia mikurensis in Ticks from Migrating Birds in Sweden

    PubMed Central

    Labbé Sandelin, Lisa; Tolf, Conny; Larsson, Sara; Wilhelmsson, Peter; Salaneck, Erik; Jaenson, Thomas G. T.; Lindgren, Per-Eric; Olsen, Björn; Waldenström, Jonas

    2015-01-01

    Candidatus Neoehrlichia mikurensis (CNM; family Anaplasmataceae) was recently recognized as a potential tick-borne human pathogen. The presence of CNM in mammals, in host-seeking Ixodes ticks and in ticks attached to mammals and birds has been reported recently. We investigated the presence of CNM in ornithophagous ticks from migrating birds. A total of 1,150 ticks (582 nymphs, 548 larvae, 18 undetermined ticks and two adult females) collected from 5,365 birds captured in south-eastern Sweden was screened for CNM by molecular methods. The birds represented 65 different species, of which 35 species were infested with one or more ticks. Based on a combination of morphological and molecular species identification, the majority of the ticks were identified as Ixodes ricinus. Samples were initially screened by real-time PCR targeting the CNM 16S rRNA gene, and confirmed by a second real-time PCR targeting the groEL gene. For positive samples, a 1260 base pair fragment of the 16S rRNA gene was sequenced. Based upon bacterial gene sequence identification, 2.1% (24/1150) of the analysed samples were CNM-positive. Twenty-two out of 24 CNM-positive ticks were molecularly identified as I. ricinus nymphs, and the remaining two were identified as I. ricinus based on morphology. The overall CNM prevalence in I. ricinus nymphs was 4.2%. None of the 548 tested larvae was positive. CNM-positive ticks were collected from 10 different bird species. The highest CNM-prevalences were recorded in nymphs collected from common redpoll (Carduelis flammea, 3/7), thrush nightingale (Luscinia luscinia, 2/29) and dunnock (Prunella modularis, 1/17). The 16S rRNA sequences obtained in this study were all identical to each other and to three previously reported European strains, two of which were obtained from humans. It is concluded that ornithophagous ticks may be infected with CNM and that birds most likely can disperse CNM-infected ticks over large geographical areas. PMID:26207834

  17. Ticks and tick-borne novel bunyavirus collected from the natural environment and domestic animals in Jinan city, East China.

    PubMed

    Wang, Dong; Wang, Yongming; Yang, Guoliang; Liu, Huiyuan; Xin, Zheng

    2016-02-01

    Since 2011, 73 cases of the severe fever with thrombocytopenia syndrome, a novel tick-borne disease, have been reported in Jinan city through information system for disease control and prevention. Therefore, this study aimed to investigate the species, distribution, host animals of ticks and tick-borne pathogens. A total of 722 ticks were collected from two types of natural environment and six kinds of domestic animal in Jinan city. All the sampled ticks belonged to the same species, namely Haemaphysalis longicornis, and 94.7% of them were adult. The density of free-living ticks in grassland was nearly six times that in shrub. The prevalence of the goat (53.3%) was highest among the domestic animals. The host body region most frequently parasitized by H. longicornis was the head (77.8%), especially ears and periocular region. Novel bunyavirus was detected on the free-ranging goats in Jinan city. Acaricide treatment with a higher concentration on the ears, periocular region and the groin of domestic animals should be recommended to control the ticks effectively.

  18. Molecular screening for Midichloria in hard and soft ticks reveals variable prevalence levels and bacterial loads in different tick species.

    PubMed

    Cafiso, Alessandra; Bazzocchi, Chiara; De Marco, Leone; Opara, Maxwell N; Sassera, Davide; Plantard, Olivier

    2016-10-01

    Candidatus Midichloria mitochondrii, symbiont of the sheep tick Ixodes ricinus, was the first described member of the family Candidatus Midichloriaceae, order Rickettsiales. Recent reports are expanding our view of this family, now including numerous bacteria of great biological and medical interest, indicating a widespread distribution with an increasing range of hosts, with ticks being strongly represented. Here we present a molecular screening of 17 tick species, detecting and quantifying bacteria of the family Midichloriaceae in seven of them, including the first report of a representative of this family in a soft tick species (Argasidae), Ornithodoros maritimus. Based on sequence identity and phylogenetic analysis we propose that all these bacterial symbionts of ticks could be members of the genus Midichloria. The performed screening highlights different prevalence levels and variable bacterial loads in different tick species including one, Ixodes aulacodi, where the bacterium is present in all examined individuals, like in I. ricinus. This result prompts us to hypothesize different roles of Midichloria bacteria in different tick species.

  19. Identification of potential plant extracts for anti-tick activity against acaricide resistant cattle ticks, Rhipicephalus (Boophilus) microplus (Acari: Ixodidae).

    PubMed

    Ghosh, Srikanta; Tiwari, Shashi Shankar; Kumar, Bhanu; Srivastava, Sharad; Sharma, Anil Kumar; Kumar, Sachin; Bandyopadhyay, A; Julliet, Sanis; Kumar, Rajesh; Rawat, A K S

    2015-05-01

    To develop an eco-friendly tick control method, seven plant extracts were prepared using 50 and 95% ethanol and evaluated for acaricidal activity against cattle tick, Rhipicephalus (Boophilus) microplus. The adult immersion test was adopted for testing different extracts. Based on 72 h screening criterion, 95% ethanolic extracts of Datura metel fruits and Argemone mexicana whole plant were found effective showing more than 50% mortality of treated ticks. The 95% ethanolic extracts of D. metel fruits and A. mexicana whole plant exhibited acaricidal and reproductive inhibitory effects on treated ticks. The LC90 values of D. metel and A. mexicana extracts were determined as 7.13 and 11.3%, respectively. However, although both the extracts were found efficacious against deltamethrin-resistant IVRI-4 and multi-acaricide resistant IVRI-5 lines of R. (B.) microplus, they caused less mortality than treated ticks of the reference IVRI-I line. Phytochemical studies indicated the presence of alkaloids and glucosides in D. metel fruits and alkaloids, terpenoids, flavonoids and phenolics in A. mexicana whole plant extracts. The results indicated that these botanicals may play an important role in reducing the use of chemicals for tick control and possibly to manage resistant tick population in environment friendly manner.

  20. 9 CFR 307.1 - Facilities for Program employees.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Facilities for Program employees. 307.1 Section 307.1 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE AGENCY ORGANIZATION AND TERMINOLOGY; MANDATORY MEAT AND POULTRY PRODUCTS INSPECTION AND...

  1. 29 CFR 780.303 - Exemption applicable on employee basis.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... Employment in Agriculture That Is Exempted From the Minimum Wage and Overtime Pay Requirements Under Section... 29 Labor 3 2010-07-01 2010-07-01 false Exemption applicable on employee basis. 780.303 Section 780.303 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF...

  2. 29 CFR 780.303 - Exemption applicable on employee basis.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... Employment in Agriculture That Is Exempted From the Minimum Wage and Overtime Pay Requirements Under Section... 29 Labor 3 2014-07-01 2014-07-01 false Exemption applicable on employee basis. 780.303 Section 780.303 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF...

  3. 29 CFR 780.303 - Exemption applicable on employee basis.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... Employment in Agriculture That Is Exempted From the Minimum Wage and Overtime Pay Requirements Under Section... 29 Labor 3 2011-07-01 2011-07-01 false Exemption applicable on employee basis. 780.303 Section 780.303 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF...

  4. 29 CFR 780.303 - Exemption applicable on employee basis.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... Employment in Agriculture That Is Exempted From the Minimum Wage and Overtime Pay Requirements Under Section... 29 Labor 3 2012-07-01 2012-07-01 false Exemption applicable on employee basis. 780.303 Section 780.303 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF...

  5. 29 CFR 780.303 - Exemption applicable on employee basis.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... Employment in Agriculture That Is Exempted From the Minimum Wage and Overtime Pay Requirements Under Section... 29 Labor 3 2013-07-01 2013-07-01 false Exemption applicable on employee basis. 780.303 Section 780.303 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF...

  6. Employee involvement: motivation or manipulation?

    PubMed

    McConnell, C R

    1998-03-01

    Employee involvement is subject to a great deal of verbal tribute; there is hardly a manager at work today who will not praise the value of employee input. However, many employee involvement efforts leave employees feeling more manipulated than motivated. This occurs because supervisors and managers, while expecting employees to change the way they work, are themselves either unwilling to change or remain unconscious of the need to change. The result is that, although employee input is regularly solicited in a number of forms, it is often discounted, ignored, or altered to fit the manager's preconceptions. Often the employee is left feeling manipulated. Since the opportunity for involvement can be a strong motivator, it becomes the manager's task to learn how to provide involvement opportunity in manipulative fashion. This can be accomplished by providing involvement opportunity accompanied by clear outcome expectations and allowing employees the freedom to pursue those outcomes in their own way.

  7. Prevalence of tick-borne pathogens in Ixodes ricinus and Dermacentor reticulatus ticks from different geographical locations in Belarus.

    PubMed

    Reye, Anna L; Stegniy, Valentina; Mishaeva, Nina P; Velhin, Sviataslau; Hübschen, Judith M; Ignatyev, George; Muller, Claude P

    2013-01-01

    Worldwide, ticks are important vectors of human and animal pathogens. Besides Lyme Borreliosis, a variety of other bacterial and protozoal tick-borne infections are of medical interest in Europe. In this study, 553 questing and feeding Ixodes ricinus (n = 327) and Dermacentor reticulatus ticks (n = 226) were analysed by PCR for Borrelia, Rickettsia, Anaplasma, Coxiella, Francisella and Babesia species. Overall, the pathogen prevalence in ticks was 30.6% for I. ricinus and 45.6% for D. reticulatus. The majority of infections were caused by members of the spotted-fever group rickettsiae (24.4%), 9.4% of ticks were positive for Borrelia burgdorferi sensu lato, with Borrelia afzelii being the most frequently detected species (40.4%). Pathogens with low prevalence rates in ticks were Anaplasma phagocytophilum (2.2%), Coxiella burnetii (0.9%), Francisella tularensis subspecies (0.7%), Bartonella henselae (0.7%), Babesia microti (0.5%) and Babesia venatorum (0.4%). On a regional level, hotspots of pathogens were identified for A. phagocytophilum (12.5-17.2%), F. tularensis ssp. (5.5%) and C. burnetii (9.1%), suggesting established zoonotic cycles of these pathogens at least at these sites. Our survey revealed a high burden of tick-borne pathogens in questing and feeding I. ricinus and D. reticulatus ticks collected in different regions in Belarus, indicating a potential risk for humans and animals. Identified hotspots of infected ticks should be included in future surveillance studies, especially when F. tularensis ssp. and C. burnetii are involved.

  8. Genetic characterization of tick-borne flaviviruses: new insights into evolution, pathogenetic determinants and taxonomy.

    PubMed

    Grard, Gilda; Moureau, Grégory; Charrel, Rémi N; Lemasson, Jean-Jacques; Gonzalez, Jean-Paul; Gallian, Pierre; Gritsun, Tamara S; Holmes, Edward C; Gould, Ernest A; de Lamballerie, Xavier

    2007-04-25

    Here, we analyze the complete coding sequences of all recognized tick-borne flavivirus species, including Gadgets Gully, Royal Farm and Karshi virus, seabird-associated flaviviruses, Kadam virus and previously uncharacterized isolates of Kyasanur Forest disease virus and Omsk hemorrhagic fever virus. Significant taxonomic improvements are proposed, e.g. the identification of three major groups (mammalian, seabird and Kadam tick-borne flavivirus groups), the creation of a new species (Karshi virus) and the assignment of Tick-borne encephalitis and Louping ill viruses to a unique species (Tick-borne encephalitis virus) including four viral types (i.e. Western Tick-borne encephalitis virus, Eastern Tick-borne encephalitis virus, Turkish sheep Tick-borne encephalitis virus and Louping ill Tick-borne encephalitis virus). The analyses also suggest a complex relationship between viruses infecting birds and those infecting mammals. Ticks that feed on both categories of vertebrates may constitute the evolutionary bridge between the three distinct identified lineages.

  9. Host Immunization with Recombinant Proteins to Screen Antigens for Tick Control.

    PubMed

    Galay, Remil Linggatong; Miyata, Takeshi; Umemiya-Shirafuji, Rika; Mochizuki, Masami; Fujisaki, Kozo; Tanaka, Tetsuya

    2016-01-01

    Ticks (Parasitiformes: Ixodida) are known for their obligate blood feeding habit and their role in transmitting pathogens to various vertebrate hosts. Tick control using chemical acaricides is extensively used particularly in livestock management, but several disadvantages arise from resistance development of many tick species, and concerns on animal product and environmental contamination. Vaccination offers better protection and more cost-effective alternative to application of chemical acaricides, addressing their disadvantages. However, an ideal anti-tick vaccine targeting multiple tick species and all the tick stages is still wanting. Here, we describe the procedures involved in the evaluation of a vaccine candidate antigen against ticks at the laboratory level, from the preparation of recombinant proteins, administration to the rabbit host and monitoring of antibody titer, to tick infestation challenge and determination of the effects of immunization to ticks.

  10. Comparison of infectivities of six tick-derived isolates of Borrelia burgdorferi for rodents and ticks.

    PubMed Central

    Peavey, C A; Lane, R S

    1996-01-01

    The infectivity and dissemination to the skin of six isolates of Borrelia burgdorferi were evaluated by inoculating them into groups of deer mice (Peromyscus maniculatus), hamsters, and Swiss Webster mice. Rodent infection was assayed by culture of ear punch biopsy specimens taken at 4, 8, and 12 weeks postinoculation (p.i.). Spirochetes were detected in biopsy specimens from individuals of all three host species that had been inoculated with four isolates (CA3, CA4, CA7, and CA8). Ear punch biopsy specimens taken from Swiss Webster mice at 12 weeks p.i. yielded an additional reisolate (CA2), even though these animals did not seroconvert. The remaining isolate (CA9) was not recovered from any host. However, two deer mice and all hamsters and Swiss Webster mice inoculated with CA9 seroconverted. All six isolates were of low infectivity to ticks when inoculated intramuscularly into hosts. Only 4 (1.6%) of 250 Ixodes pacificus larvae acquired and transstadially maintained infection from hosts inoculated intramuscularly. Infectivity of three isolates for ticks also was tested in Swiss Webster mice injected intradermally. The mean prevalences of infection in xenodiagnostic ticks fed on these mice at 4 weeks p.i. were 47.9, 1.2, and 2.2% for isolates CA4, CA7, and CA8, respectively. The mean prevalences of infection for ticks fed on the same mice at 12 weeks p.i. were 36.4, 11.8, and 20.4%, respectively. Such differences in the infectivity and rate of dissemination of individual isolates of B. burgdorferi should be considered during studies of reservoir and vector competence. PMID:8748276

  11. Tick-Borne Zoonoses in the United States: Persistent and Emerging Threats to Human Health.

    PubMed

    Eisen, Rebecca J; Kugeler, Kiersten J; Eisen, Lars; Beard, Charles B; Paddock, Christopher D

    2017-03-23

    In the United States, ticks transmit the greatest diversity of arthropod-borne pathogens and are responsible for the most cases of all vector-borne diseases. In recent decades, the number of reported cases of notifiable tick-borne diseases has steadily increased, geographic distributions of many ticks and tick-borne diseases have expanded, and new tick-borne disease agents have been recognized. In this review, we (1) describe the known disease agents associated with the most commonly human-biting ixodid ticks, (2) review the natural histories of these ticks and their associated pathogens, (3) highlight spatial and temporal changes in vector tick distributions and tick-borne disease occurrence in recent decades, and (4) identify knowledge gaps and barriers to more effective prevention of tick-borne diseases. We describe 12 major tick-borne diseases caused by 15 distinct disease agents that are transmitted by the 8 most commonly human-biting ixodid ticks in the United States. Notably, 40% of these pathogens were described within the last two decades. Our assessment highlights the importance of animal studies to elucidate how tick-borne pathogens are maintained in nature, as well as advances in molecular detection of pathogens which has led to the discovery of several new tick-borne disease agents.

  12. Professional Employees Turn to Unions

    ERIC Educational Resources Information Center

    Chamot, Dennis

    1976-01-01

    White-collar and professional employees are increasingly turning to unions to combat their loss of independence as employees of large organizations. Managers should realize that they and professional employees have different viewpoints about job situations and that the current trend toward white-collar unionism is apt to continue. (JG)

  13. Apply Pesticides Correctly, A Guide for Commercial Applicators: Agricultural Pest Control -- Animal.

    ERIC Educational Resources Information Center

    Wamsley, Mary Ann, Ed.; Vermeire, Donna M., Ed.

    This guide contains basic information to meet specific standards for pesticide applicators. The text is concerned with the common pests of agricultural animals such as flies, ticks, bots, lice and mites. Methods for controlling these pests and appropriate pesticides are discussed. (CS)

  14. Preliminary observations on specific adaptations of exophilic ixodid ticks to forests or open country habitats.

    PubMed

    Uspensky, Igor

    2002-01-01

    Some features of three-host exophilic ticks important for their survival differ at the generic level in relation to the types of their habitat. Ixodes and Haemaphysalis are typical forest genera. Hyalomma is an open country genus, whereas Dermacentor and Rhipicephalus, having some features of forest ticks, are closer to the ticks of open country. Forest ticks encounter rather stable and favorable temperature, humidity and illumination conditions as compared with open country ticks. A few differences determining every-day survival, hostseeking. and reproduction of ticks are considered. (1) Tolerance to desiccation is very low in forest ticks and much greater in ticks of open country. (2) Lack of eyes in forest ticks (having, however, epithelial photoreceptor cells) and formation of eyes as special morphological structures in ticks of open country. (3) Capability of mating and insemination of unfed specimens both on and off hosts in forest ticks (Ixodes) and insemination of partially engorged females only on hosts by fed males in open country ticks. (4) Reciprocal sexual dimorphism where in forest ticks females have a larger body than males and in open country ticks this correlation is opposite. (5) Linear dependence between female weight and number of eggs laid is established in forest ticks after the female weight becomes higher than 50% of mean engorgement weight whereas in open country ticks linear dependence begins to reveal itself much earlier. (6) In forest ticks the compensatory growth occurs only during adult feeding whereas in open country ticks such a growth occurs both during nymphal and adult feeding. The adaptive nature of the above differences and their evolutionary trends have been hypothesized.

  15. Cattle tick vaccine researchers join forces in CATVAC

    Technology Transfer Automated Retrieval System (TEKTRAN)

    A meeting sponsored by the Bill & Melinda Gates Foundation was held at the Avanti Hotel, Mohammedia, Morocco, July 14–15, 2015. The meeting resulted in the formation of the Cattle Tick Vaccine Consortium (CATVAC)....

  16. Risk of Disease from Mosquito and Tick Bites

    EPA Pesticide Factsheets

    Insect repellents help reduce the risk of mosquito and tick bites, which can transmit diseases including West Nile Virus, malaria, encephalitis, yellow fever, dengue fever, chikungunya virus, Lyme disease, Rocky Mountain spotted fever, and ehrlichiosis.

  17. Travelers' Health: Protection against Mosquitoes, Ticks, and Other Arthropods

    MedlinePlus

    ... dawn and dusk) or in the evening after dark. Avoiding the outdoors or taking preventive actions (such as using repellent) during peak biting hours may reduce risk. Place also matters; ticks and chiggers are often found in grasses, ...

  18. Cattle tick vaccine researchers join forces in CATVAC.

    PubMed

    Schetters, Theo; Bishop, Richard; Crampton, Michael; Kopáček, Petr; Lew-Tabor, Alicja; Maritz-Olivier, Christine; Miller, Robert; Mosqueda, Juan; Patarroyo, Joaquín; Rodriguez-Valle, Manuel; Scoles, Glen A; de la Fuente, José

    2016-02-24

    A meeting sponsored by the Bill & Melinda Gates Foundation was held at the Avanti Hotel, Mohammedia, Morocco, July 14-15, 2015. The meeting resulted in the formation of the Cattle Tick Vaccine Consortium (CATVAC).

  19. Tick Removal: A Step-by-Step Guide (For Parents)

    MedlinePlus

    ... Evaluate Your Child's Lyme Disease Risk Lyme Disease Rocky Mountain Spotted Fever Lyme Disease Hey! A Tick Bit Me! Bug Bites and Stings What's My Lyme Disease Risk? Rocky Mountain Spotted Fever Lyme Disease Contact Us Print Resources Send to ...

  20. [The species composition of mosquitoes and ticks in Armenia].

    PubMed

    Manukian, D V; Oganesian, A S; Shakhnazarian, S A; Aleksanian, Iu T

    2006-01-01

    Comprehensive epidemiological, entomological, virological, and parasitological studies were conducted to examine the species composition and size of bloodsucking arthropoda (mosquitoes and ticks). A total of 64,567 mosquitoes and 45,180 Ixodes ticks were collected. Among the mosquitoes, Anopheles maculipennis was a prevalent species (81.6%). In all climatic zones, Dermacentor marginatus was the largest in number and most abundant during flag collections from cattle and plants (62.5% and 95.5%, respectively). Virological studies of the collected field material identified 125 strains of arboviruses belonging to 10 viruses: Tyaginya, Sindbis, Batai, Dkhori, tick-borne encephalitis, West Nile fever, Tamdy, KGL, Geta, and Bkhandzha. The identified arboviruses are environmentally associated with both mosquitoes and ticks. The larger number and diversity of bloodsucking artropoda present a potential risk of outbursts of arbovirus infections on the territory of the republic.

  1. Small mammals as hosts of immature ixodid ticks.

    PubMed

    Horak, I G; Fourie, L J; Braack, L E O

    2005-09-01

    Two hundred and twenty-five small mammals belonging to 16 species were examined for ticks in Free State, Mpumalanga and Limpopo Provinces, South Africa, and 18 ixodid tick species, of which two could only be identified to genus level, were recovered. Scrub hares, Lepus saxatilis, and Cape hares, Lepus capensis, harboured the largest number of tick species. In Free State Province Namaqua rock mice, Aethomys namaquensis, and four-striped grass mice, Rhabdomys pumilio, were good hosts of the immature stages of Haemaphysalis leachi and Rhipicephalus gertrudae, while in Mpumalanga and Limpopo Provinces red veld rats, Aethomys chrysophilus, Namaqua rock mice and Natal multimammate mice, Mastomys natalensis were good hosts of H. leachi and Rhipicephalus simus. Haemaphysalis leachi was the only tick recovered from animals in all three provinces.

  2. [EFFECT OF PYRETHROIDS ON TAIGA TICKS (IXODES PERSULCATUS IXODIDAE)].

    PubMed

    Germant, O M; Shashina, N I

    2016-01-01

    Nonspecific prevention of infections, the agents of which are transmitted by Ixodes ticks, is aimed at stopping the suction of the ticks to humans and is substantially based one the use of acaricides. The most interesting group of compounds to be used to individually protect humans is pyrethroids that cause different nerve conduction disturbances in the ticks, which result in their paralysis and death more significantly rapidly than the compounds from other chemical groups. The effect of 8 pyrethroids was investigated when the taiga ticks were in contact with the tissue treated with the compounds. The relationship of the chemical structure of pyrethroids with their acaricidal activity was analyzed from motor activity values and knockdown time. The test pyreithroids, in order of decreasing acaricidal activity, are imiprothrin cyphenothrin, cyfluthrin, alpha-cyperamethrin, zeta-cyperimethrin fenothrin, flumethrin.

  3. Ticks (Acari: Ixodida) on wild carnivores in Brazil.

    PubMed

    Labruna, Marcelo B; Jorge, Rodrigo S P; Sana, Dênis A; Jácomo, Anah Tereza A; Kashivakura, Cyntia K; Furtado, Mariana M; Ferro, Claudia; Perez, Samuel A; Silveira, Leandro; Santos, Tarcísio S; Marques, Samuel R; Morato, Ronaldo G; Nava, Alessandra; Adania, Cristina H; Teixeira, Rodrigo H F; Gomes, Albério A B; Conforti, Valéria A; Azevedo, Fernando C C; Prada, Cristiana S; Silva, Jean C R; Batista, Adriana F; Marvulo, Maria Fernanda V; Morato, Rose L G; Alho, Cleber J R; Pinter, Adriano; Ferreira, Patrícia M; Ferreira, Fernado; Barros-Battesti, Darci M

    2005-01-01

    The present study reports field data of ticks infesting wild carnivores captured from July 1998 to September 2004 in Brazil. Additional data were obtained from one tick collection and from previous published data of ticks on carnivores in Brazil. During field work, a total of 3437 ticks were collected from 89 Cerdocyon thous (crab-eating fox), 58 Chrysocyon brachyurus (maned wolf), 30 Puma concolor (puma), 26 Panthera onca (jaguar), 12 Procyon cancrivorus (crab-eating raccoon), 4 Speothos venaticus (bush dog), 6 Pseudalopex vetulus (hoary fox), 6 Nasua nasua (coati), 6 Leopardus pardalis (ocelot), 2 Leopardus tigrinus (oncilla), 1 Leopardus wiedii (margay), 1 Herpailurus yagouaroundi (jaguarundi), 1 Oncifelis colocolo (pampas cat), 1 Eira barbara (tayara), 1 Galictis vittata (grison), 1 Lontra longicaudis (neotropical otter), and 1 Potus flavus (kinkajou). Data obtained from the Acari Collection IBSP included a total of 381 tick specimens collected on 13 C. thous, 8 C. brachyurus, 3 P. concolor, 10 P. onca, 3 P. cancrivorus, 4 N. nasua, 1 L. pardalis, 1 L. wiedii, 4 H. yagouaroundi, 1 Galictis cuja (lesser grison), and 1 L. longicaudis. The only tick-infested carnivore species previously reported in Brazil, for which we do not present any field data are Pseudalopex gymnocercus (pampas fox), Conepatus chinga (Molina's hog-nosed skunk), and Conepatus semistriatus (striped hog-nosed skunk). We report the first tick records in Brazil on two Felidae species (O. colocolo, H. yagouaroundi), two Canidae species (P. vetulus, S. venaticus), one Procyonidae species (P. flavus) and one Mustelidae (E. barbara). Tick infestation remains unreported for 5 of the 26 Carnivora species native in Brazil: Oncifelis geoffroyi (Geoffroy's cat), Atelocynus microtis (short-eared dog), Pteronura brasiliensis (giant otter), Mustela africana (Amazon weasel), and Bassaricyon gabbii (olingo). Our field data comprise 16 tick species represented by the genera Amblyomma (12 species), Ixodes (1

  4. The Identification and Analysis of Agricultural Occupations in Seventeen Pennsylvania Counties.

    ERIC Educational Resources Information Center

    McGee, Ivan C.

    Interviews with a random sample of employers from 2,142 businesses and services having employees needing agricultural competencies, compiled for 17 Pennsylvania counties, provided data for estimating the present number of employees needing agricultural competencies by occupational family, level of employment, and job title. Job characteristics,…

  5. Agricultural Wastes.

    ERIC Educational Resources Information Center

    Jewell, W. J.; Switzenbaum, M. S.

    1978-01-01

    Presents a literature review of agricultural wastes, covering publications of 1976-77. Some of the areas covered are: (1) water characteristics and impacts; (2) waste treatment; (3) reuse of agricultural wastes; and (4) nonpoint pollution sources. A list of 150 references is also presented. (HM)

  6. VOCATIONAL AGRICULTURE.

    ERIC Educational Resources Information Center

    California State Dept. of Education, Sacramento. Research Coordinating Unit.

    TO ASSIST THOSE WHO MAKE DECISIONS RELATING TO EDUCATIONAL PROGRAMS IN AGRICULTURE, RECENT RESEARCH IN VOCATIONAL AGRICULTURE IS SUMMARIZED. A 1963 STUDY TREATS THE RELATIONSHIP BETWEEN WORK EXPERIENCE AND STUDENT CHARACTERISTICS, PLANS, AND ASPIRATIONS. STUDIES ON POST-SECONDARY EDUCATION CONCERN GUIDELINES FOR TECHNICIAN PROGRAMS, JUSTIFICATION…

  7. Climate change and Ixodes tick-borne diseases of humans.

    PubMed

    Ostfeld, Richard S; Brunner, Jesse L

    2015-04-05

    The evidence that climate warming is changing the distribution of Ixodes ticks and the pathogens they transmit is reviewed and evaluated. The primary approaches are either phenomenological, which typically assume that climate alone limits current and future distributions, or mechanistic, asking which tick-demographic parameters are affected by specific abiotic conditions. Both approaches have promise but are severely limited when applied separately. For instance, phenomenological approaches (e.g. climate envelope models) often select abiotic variables arbitrarily and produce results that can be hard to interpret biologically. On the other hand, although laboratory studies demonstrate strict temperature and humidity thresholds for tick survival, these limits rarely apply to field situations. Similarly, no studies address the influence of abiotic conditions on more than a few life stages, transitions or demographic processes, preventing comprehensive assessments. Nevertheless, despite their divergent approaches, both mechanistic and phenomenological models suggest dramatic range expansions of Ixodes ticks and tick-borne disease as the climate warms. The predicted distributions, however, vary strongly with the models' assumptions, which are rarely tested against reasonable alternatives. These inconsistencies, limited data about key tick-demographic and climatic processes and only limited incorporation of non-climatic processes have weakened the application of this rich area of research to public health policy or actions. We urge further investigation of the influence of climate on vertebrate hosts and tick-borne pathogen dynamics. In addition, testing model assumptions and mechanisms in a range of natural contexts and comparing their relative importance as competing models in a rigorous statistical framework will significantly advance our understanding of how climate change will alter the distribution, dynamics and risk of tick-borne disease.

  8. Climate change and Ixodes tick-borne diseases of humans

    PubMed Central

    Ostfeld, Richard S.; Brunner, Jesse L.

    2015-01-01

    The evidence that climate warming is changing the distribution of Ixodes ticks and the pathogens they transmit is reviewed and evaluated. The primary approaches are either phenomenological, which typically assume that climate alone limits current and future distributions, or mechanistic, asking which tick-demographic parameters are affected by specific abiotic conditions. Both approaches have promise but are severely limited when applied separately. For instance, phenomenological approaches (e.g. climate envelope models) often select abiotic variables arbitrarily and produce results that can be hard to interpret biologically. On the other hand, although laboratory studies demonstrate strict temperature and humidity thresholds for tick survival, these limits rarely apply to field situations. Similarly, no studies address the influence of abiotic conditions on more than a few life stages, transitions or demographic processes, preventing comprehensive assessments. Nevertheless, despite their divergent approaches, both mechanistic and phenomenological models suggest dramatic range expansions of Ixodes ticks and tick-borne disease as the climate warms. The predicted distributions, however, vary strongly with the models' assumptions, which are rarely tested against reasonable alternatives. These inconsistencies, limited data about key tick-demographic and climatic processes and only limited incorporation of non-climatic processes have weakened the application of this rich area of research to public health policy or actions. We urge further investigation of the influence of climate on vertebrate hosts and tick-borne pathogen dynamics. In addition, testing model assumptions and mechanisms in a range of natural contexts and comparing their relative importance as competing models in a rigorous statistical framework will significantly advance our understanding of how climate change will alter the distribution, dynamics and risk of tick-borne disease. PMID:25688022

  9. Prevalence of Borrelia burgdorferi Sensu Lato in Ticks Collected from Migratory Birds in Switzerland

    PubMed Central

    Poupon, Marie-Angèle; Lommano, Elena; Humair, Pierre-François; Douet, Véronique; Rais, Olivier; Schaad, Michael; Jenni, Lukas; Gern, Lise

    2006-01-01

    The prevalence of ticks infected by Borrelia burgdorferi sensu lato on birds during their migrations was studied in Switzerland. A total of 1,270 birds captured at two sites were examined for tick infestation. Ixodes ricinus was the dominant tick species. Prevalences of tick infestation were 6% and 18.2% for birds migrating northward and southward, respectively. Borrelia valaisiana was the species detected most frequently in ticks, followed by Borrelia garinii and Borrelia lusitaniae. Among birds infested by infected ticks, 23% (6/26) were infested by B. lusitaniae-infected larvae. Migratory birds appear to be reservoir hosts for B. lusitaniae. PMID:16391149

  10. Transstadial Transmission of Borrelia turcica in Hyalomma aegyptium Ticks

    PubMed Central

    Kalmár, Zsuzsa; Cozma, Vasile; Sprong, Hein; Jahfari, Setareh; D’Amico, Gianluca; Mărcuțan, Daniel I.; Ionică, Angela M.; Magdaş, Cristian; Modrý, David; Mihalca, Andrei D.

    2015-01-01

    Borrelia turcica comprises the third major group of arthropod-transmitted borreliae and is phylogenetically divergent from other Borrelia groups. The novel group of Borrelia was initially isolated from Hyalomma aegyptium ticks in Turkey and it was recently found in blood and multiple organs of tortoises exported from Jordan to Japan. However, the ecology of these spirochetes and their development in ticks or the vertebrate hosts were not investigated in detail; our aims were to isolate the pathogen and to evaluate the possibility of transstadial transmission of Borrelia turcica by H. aegyptium ticks. Ticks were collected from Testudo graeca tortoises during the summer of 2013 from southeastern Romania. Engorged nymphs were successfully molted to the adult stage. Alive B. turcica was isolated from molted ticks by using Barbour-Stoenner-Kelly (BSK) II medium. Four pure cultures of spirochetes were obtained and analyzed by PCR and sequencing. Sequence analysis of glpQ, gyrB and flaB revealed 98%–100% similarities with B. turcica. H. aegyptium ticks collected from T. graeca tortoises were able to pass the infection with B. turcica via transstadial route, suggesting its vectorial capacity. PMID:25695663

  11. An Immunosuppressant Peptide from the Hard Tick Amblyomma variegatum

    PubMed Central

    Tian, Yufeng; Chen, Wenlin; Mo, Guoxiang; Chen, Ran; Fang, Mingqian; Yedid, Gabriel; Yan, Xiuwen

    2016-01-01

    Ixodid ticks are well known for spreading transmitted tick-borne pathogens while being attached to their hosts for almost 1–2 weeks to obtain blood meals. Thus, they must secrete many immunosuppressant factors to combat the hosts’ immune system. In the present work, we investigated an immunosuppressant peptide of the hard tick Amblyomma variegatum. This peptide, named amregulin, is composed of 40 residues with an amino acid sequence of HLHMHGNGATQVFKPRLVLKCPNAAQLIQPGKLQRQLLLQ. A cDNA of the precursor peptide was obtained from the National Center for Biotechnology Information (NCBI, Bethesda, MD, USA). In rat splenocytes, amregulin exerts significant anti-inflammatory effects by inhibiting the secretion of inflammatory factors in vitro, such as tumor necrosis factor-alpha (TNF-α), interleukin-1 (IL-1), interleukin-8 (IL-8) and interferon-gamma (IFN-γ). In rat splenocytes, treated with amregulin, compared to lipopolysaccharide (LPS) alone, the inhibition of the above inflammatory factors was significant at all tested concentrations (2, 4 and 8 µg/mL). Amregulin shows strong free radical scavenging and antioxidant activities (5, 10 and 20 µg/mL) in vitro. Amregulin also significantly inhibits adjuvant-induced paw inflammation in mouse models in vivo. This peptide may facilitate the ticks’ successful blood feeding and may lead to host immunotolerance of the tick. These findings have important implications for the understanding of tick-host interactions and the co-evolution between ticks and the viruses that they bear. PMID:27153086

  12. Transstadial transmission of Borrelia turcica in Hyalomma aegyptium ticks.

    PubMed

    Kalmár, Zsuzsa; Cozma, Vasile; Sprong, Hein; Jahfari, Setareh; D'Amico, Gianluca; Mărcuțan, Daniel I; Ionică, Angela M; Magdaş, Cristian; Modrý, David; Mihalca, Andrei D

    2015-01-01

    Borrelia turcica comprises the third major group of arthropod-transmitted borreliae and is phylogenetically divergent from other Borrelia groups. The novel group of Borrelia was initially isolated from Hyalomma aegyptium ticks in Turkey and it was recently found in blood and multiple organs of tortoises exported from Jordan to Japan. However, the ecology of these spirochetes and their development in ticks or the vertebrate hosts were not investigated in detail; our aims were to isolate the pathogen and to evaluate the possibility of transstadial transmission of Borrelia turcica by H. aegyptium ticks. Ticks were collected from Testudo graeca tortoises during the summer of 2013 from southeastern Romania. Engorged nymphs were successfully molted to the adult stage. Alive B. turcica was isolated from molted ticks by using Barbour-Stoenner-Kelly (BSK) II medium. Four pure cultures of spirochetes were obtained and analyzed by PCR and sequencing. Sequence analysis of glpQ, gyrB and flaB revealed 98%-100% similarities with B. turcica. H. aegyptium ticks collected from T. graeca tortoises were able to pass the infection with B. turcica via transstadial route, suggesting its vectorial capacity.

  13. Accelerated phenology of blacklegged ticks under climate warming

    PubMed Central

    Levi, Taal; Keesing, Felicia; Oggenfuss, Kelly; Ostfeld, Richard S.

    2015-01-01

    The phenology of tick emergence has important implications for the transmission of tick-borne pathogens. A long lag between the emergence of tick nymphs in spring and larvae in summer should increase transmission of persistent pathogens by allowing infected nymphs to inoculate the population of naive hosts that can subsequently transmit the pathogen to larvae to complete the transmission cycle. In contrast, greater synchrony between nymphs and larvae should facilitate transmission of pathogens that do not produce long-lasting infections in hosts. Here, we use 19 years of data on blacklegged ticks attached to small-mammal hosts to quantify the relationship between climate warming and tick phenology. Warmer years through May and August were associated with a nearly three-week advance in the phenology of nymphal and larval ticks relative to colder years, with little evidence of increased synchrony. Warmer Octobers were associated with fewer larvae feeding concurrently with nymphs during the following spring. Projected warming by the 2050s is expected to advance the timing of average nymph and larva activity by 8–11 and 10–14 days, respectively. If these trends continue, climate warming should maintain or increase transmission of persistent pathogens, while it might inhibit pathogens that do not produce long-lasting infections. PMID:25688016

  14. Accelerated phenology of blacklegged ticks under climate warming.

    PubMed

    Levi, Taal; Keesing, Felicia; Oggenfuss, Kelly; Ostfeld, Richard S

    2015-04-05

    The phenology of tick emergence has important implications for the transmission of tick-borne pathogens. A long lag between the emergence of tick nymphs in spring and larvae in summer should increase transmission of persistent pathogens by allowing infected nymphs to inoculate the population of naive hosts that can subsequently transmit the pathogen to larvae to complete the transmission cycle. In contrast, greater synchrony between nymphs and larvae should facilitate transmission of pathogens that do not produce long-lasting infections in hosts. Here, we use 19 years of data on blacklegged ticks attached to small-mammal hosts to quantify the relationship between climate warming and tick phenology. Warmer years through May and August were associated with a nearly three-week advance in the phenology of nymphal and larval ticks relative to colder years, with little evidence of increased synchrony. Warmer Octobers were associated with fewer larvae feeding concurrently with nymphs during the following spring. Projected warming by the 2050s is expected to advance the timing of average nymph and larva activity by 8-11 and 10-14 days, respectively. If these trends continue, climate warming should maintain or increase transmission of persistent pathogens, while it might inhibit pathogens that do not produce long-lasting infections.

  15. A tick B-cell inhibitory protein from salivary glands of the hard tick, Hyalomma asiaticum asiaticum

    SciTech Connect

    Yu Da; Liang Jiangguo; Yu Haining; Wu Haifeng; Xu Chunhua; Liu Jingze . E-mail: jzliu21@heinfo.net; Lai Ren . E-mail: rlai72@njau.edu.cn

    2006-05-05

    Some studies done to date suggest that B-cell inhibitory factor occurred in tick saliva. In this study, a novel protein having B-cell inhibitory activity was purified and characterized from the salivary glands of the hard tick, Hyalomma asiaticum asiaticum. This protein was named B-cell inhibitory factor (BIF). The cDNA encoding BIF was cloned by cDNA library screening. The predicted protein from the cDNA sequence is composed of 138 amino acids including the mature BIF. No similarity was found by Blast search. The lipopolysaccharide-induced B-cell proliferation was inhibited by BIF. This is First report of the identification and characterization of B-cell inhibitory protein from tick. The current study facilitates the study of identifying the interaction among tick, Borrelia burgdorferi, the causative agent of Lyme disease, and host.

  16. Prevalence of tick-borne encephalitis virus in Ixodes ricinus ticks in northern Europe with particular reference to Southern Sweden

    PubMed Central

    2014-01-01

    Background In northern Europe, the tick-borne encephalitis virus (TBEV) of the European subtype is usually transmitted to humans by the common tick Ixodes ricinus. The aims of the present study are (i) to obtain up-to-date information on the TBEV prevalence in host-seeking I. ricinus in southern and central Sweden; (ii) to compile and review all relevant published records on the prevalence of TBEV in ticks in northern Europe; and (iii) to analyse and try to explain how the TBE virus can be maintained in natural foci despite an apparently low TBEV infection prevalence in the vector population. Methods To estimate the mean minimum infection rate (MIR) of TBEV in I. ricinus in northern Europe (i.e. Denmark, Norway, Sweden and Finland) we reviewed all published TBEV prevalence data for host-seeking I. ricinus collected during 1958–2011. Moreover, we collected 2,074 nymphs and 906 adults of I. ricinus from 29 localities in Sweden during 2008. These ticks were screened for TBEV by RT-PCR. Results The MIR for TBEV in nymphal and adult I. ricinus was 0.28% for northern Europe and 0.23% for southern Sweden. The infection prevalence of TBEV was significantly lower in nymphs (0.10%) than in adult ticks (0.55%). At a well-known TBEV-endemic locality, Torö island south-east of Stockholm, the TBEV prevalence (MIR) was 0.51% in nymphs and 4.48% in adults of I. ricinus. Conclusions If the ratio of nymphs to adult ticks in the TBEV-analysed sample differs from that in the I. ricinus population in the field, the MIR obtained will not necessarily reflect the TBEV prevalence in the field. The relatively low TBEV prevalence in the potential vector population recorded in most studies may partly be due to: (i) inclusion of uninfected ticks from the ‘uninfected areas’ surrounding the TBEV endemic foci; (ii) inclusion of an unrepresentative, too large proportion of immature ticks, compared to adult ticks, in the analysed tick pools; and (iii) shortcomings in the laboratory

  17. Identification of a follistatin-related protein from the tick Haemaphysalis longicornis and its effect on tick oviposition.

    PubMed

    Zhou, Jinlin; Liao, Min; Hatta, Takeshi; Tanaka, Miho; Xuan, Xuenan; Fujisaki, Kozo

    2006-05-10

    The identification of ovary-associated molecules will lead to a better understanding of the physiology of tick reproduction and vector-pathogen interactions. A gene encoding a follistatin-related protein (FRP) was obtained by random sequencing from the ovary cDNA library of the tick Haemaphysalis longicornis. The full-length cDNA is 1157 bp, including an intact ORF encoding an expected protein with 289 amino acids. Three distinct domains were present in the deduced amino acids, namely, the follistatin-like domain, KAZAL, and two calcium-binding motifs, EFh. The sequence shows homology with the follistatin-related protein (FRP), which was thought to play some roles in the negative regulation of cellular growth. RT-PCR showed that the gene was expressed throughout the developing stages and mainly in the ovary as well as in fat body, hemocytes, salivary glands, and midgut. This gene was expressed in GST-fused recombinant protein with an expected size. The mouse antiserum against the recombinant protein recognized a 56-kDa native protein in both tick ovary and hemolymph. The recombinant proteins were found to have binding activity for both activin A and bone morphogenetic protein-2 (BMP-2). Silencing of FRP by RNAi showed a decrease in tick oviposition, which is consistent with the effect of a recombinant protein vaccine on the adult tick. These results showed that the tick FRP might be involved in tick oviposition. This is the first report of a member of follistatin family proteins in Chelicerata, which include ticks, spiders, and scorpions.

  18. Tick species, tick-borne pathogens and symbionts in an insular environment off the coast of Western France.

    PubMed

    Michelet, Lorraine; Joncour, Guy; Devillers, Elodie; Torina, Alessandra; Vayssier-Taussat, Muriel; Bonnet, Sarah I; Moutailler, Sara

    2016-10-01

    Insular environments provide ideal natural conditions to study disease ecology, especially emerging diseases, due to clear differentiation between local and long-distance transmission. Such environments are of particular interest regarding tick-borne pathogens (TBP), since animal exchange with the mainland (along with any ticks they carry) is limited, and because such locations could lie on migratory routes for birds carrying ticks. Therefore both tick species and TBP may display different prevalence than those observed on the continent. As such, an epidemiological survey was performed on Belle-Ile-en-Mer, an island off the coast of Western France, in order to estimate the prevalence of tick species and the microorganisms they carried. Three tick species, Dermacentor marginatus, D. reticulatus, and Haemaphysalis punctata were collected at five different sites in 2010 and 2011. All ticks were tested for pathogen's and symbiont's DNA by (i) PCR for Anaplasma spp., Borrelia spp., Rickettsia spp.; (ii) real-time PCR for Francisella tularensis, Francisella-like endosymbionts (FLE) and Coxiella spp. and (iii) PCR-RLB for Babesia-Theileria spp. Pathogen DNA detected in D. marginatus including Borrelia spp. (18%), Rickettsia spp. (13%) which was identified as R. slovaca, Babesia spp. (8%), and Theileria spp. (1%). Pathogens detected in D. reticulatus including Rickettsia spp. (31%) identified as R. raoulti, Francisella-like endosymbiont (86%), and Babesia spp (21%). Pathogens detected in H. punctata including Rickettsia spp. (1%) identified as R. aeschlimannii, FLE (0.4%), Babesia spp. (18%), and Theileria spp. (7%). Anaplasma spp., F. tularensis, or Coxiella spp. were not detected in any of the collected ticks. This study represents the first epidemiological survey of the insular Belle-Ile-en-Mer environment. It demonstrated the presence of expected pathogens, consistent with reports from island veterinarians or physicians, as well as unexpected pathogens, raising

  19. Agricultural Energy Practices. Agriculture Energy.

    ERIC Educational Resources Information Center

    Crank, Ron

    This instructional unit is one of 10 developed by students on various energy-related areas that deals specifically with agricultural energy practices. Its objective is for the student to be able to discuss energy use and conservation of resources in the production of agricultural products. Some topics covered are basic uses of direct energy in…

  20. Agriculture Education. Agricultural Metal Working.

    ERIC Educational Resources Information Center

    Stuttgart Public Schools, AR.

    This curriculum guide is designed for group instruction of secondary agricultural education students enrolled in one or two semester-long courses in agricultural metal working. The guide presents units of study in the following areas: (1) oxyacetylene welding, (2) arc welding, (3) sheet metal, (4) blueprint reading for welders and (5) job…

  1. Ecological preferences of exophilic and endophilic ticks (Acari: Ixodidae) parasitizing wild carnivores in the Iberian Peninsula.

    PubMed

    Sobrino, Raquel; Millán, Javier; Oleaga, Alvaro; Gortázar, Christian; de la Fuente, José; Ruiz-Fons, Francisco

    2012-03-23

    Ticks parasitizing wild carnivores and the tick-borne pathogens (TBPs) that they transmit may affect domestic carnivores and humans. Thus, investigating the role of wild carnivores as tick hosts is of relevance for understanding the life cycle of ticks in natural foci and the epidemiology of TBPs shared with domestic animals and humans. Therefore, the main objective of this study was to determine the ixodid tick fauna of wild carnivores in Peninsular Spain and the environmental factors driving the risk of wild carnivores to be parasitized by ixodid ticks. We hypothesized that the adaptation of tick species to differing climatic conditions may be reflected in a similar parasitization risk of wild carnivores by ticks between bioclimatic regions in our study area. To test this, we surveyed ixodid ticks in wild carnivores in oceanic, continental-Mediterranean, and thermo-Mediterranean bioclimatic regions of Peninsular Spain. We analyzed the influence of environmental factors on the risk of wild carnivores to be parasitized by ticks by performing logistic regression models. Models were separately performed for exophilic and endophilic ticks under the expected differing influence of environmental conditions on their life cycle. We found differences in the composition of the tick community parasitizing wild carnivores from different bioclimatic regions. Modelling results partially confirmed our null hypothesis because bioclimatic region was not a relevant factor influencing the risk of wild carnivores to be parasitized by exophilic ticks. Bioclimatic region was however a factor driving the risk of wild carnivores to be parasitized by endophilic ticks. Spanish wild carnivores are hosts to a relevant number of tick species, some of them being potential vectors of pathogens causing serious animal and human diseases. Information provided herein can be of help to understand tick ecology in Spanish wildlife, the epidemiology of tick-borne diseases, and to prevent the risks of

  2. Haemaphysalis longicornis Ticks as Reservoir and Vector of Severe Fever with Thrombocytopenia Syndrome Virus in China.

    PubMed

    Luo, Li-Mei; Zhao, Li; Wen, Hong-Ling; Zhang, Zhen-Tang; Liu, Jian-Wei; Fang, Li-Zhu; Xue, Zai-Feng; Ma, Dong-Qiang; Zhang, Xiao-Shuang; Ding, Shu-Jun; Lei, Xiao-Ying; Yu, Xue-jie

    2015-10-01

    Severe fever with thrombocytopenia syndrome (SFTS) is an emerging hemorrhagic fever in East Asia caused by SFTS virus (SFTSV), a newly discovered phlebovirus. The Haemaphysalis longicornis tick has been suspected to be the vector of SFTSV. To determine whether SFTSV can be transmitted among ticks, from ticks to animals, and from animals to ticks, we conducted transmission studies between developmental stages of H. longicornis ticks and between ticks and mice. Using reverse transcription PCR, we also analyzed the prevalence of SFTSV infection among H. longicornis ticks collected from vegetation in Shandong Province, China. Our results showed a low prevalence of SFTSV among collected ticks (0.2%, 8/3,300 ticks), and we showed that ticks fed on SFTSV-infected mice could acquire the virus and transstadially and transovarially transmit it to other developmental stages of ticks. Furthermore, SFTSV-infected ticks could transmit the virus to mice during feeding. Our findings indicate ticks could serve as a vector and reservoir of SFTSV.

  3. Knockdown of proteins involved in iron metabolism limits tick reproduction and development

    PubMed Central

    Hajdusek, Ondrej; Sojka, Daniel; Kopacek, Petr; Buresova, Veronika; Franta, Zdenek; Sauman, Ivo; Winzerling, Joy; Grubhoffer, Libor

    2009-01-01

    Ticks are among the most important vectors of a wide range of human and animal diseases. During blood feeding, ticks are exposed to an enormous amount of free iron that must be appropriately used and detoxified. However, the mechanism of iron metabolism in ticks is poorly understood. Here, we show that ticks possess a complex system that efficiently utilizes, stores and transports non-heme iron within the tick body. We have characterized a new secreted ferritin (FER2) and an iron regulatory protein (IRP1) from the sheep tick, Ixodes ricinus, and have demonstrated their relationship to a previously described tick intracellular ferritin (FER1). By using RNA interference-mediated gene silencing in the tick, we show that synthesis of FER1, but not of FER2, is subject to IRP1-mediated translational control. Further, we find that depletion of FER2 from the tick plasma leads to a loss of FER1 expression in the salivary glands and ovaries that normally follows blood ingestion. We therefore suggest that secreted FER2 functions as the primary transporter of non-heme iron between the tick gut and the peripheral tissues. Silencing of the fer1, fer2, and irp1 genes by RNAi has an adverse impact on hatching rate and decreases postbloodmeal weight in tick females. Importantly, knockdown of fer2 dramatically impairs the ability of ticks to feed, thus making FER2 a promising candidate for development of an efficient anti-tick vaccine. PMID:19171899

  4. Ticks infesting wild and domestic animals and humans of Sri Lanka with new host records.

    PubMed

    Liyanaarachchi, D R; Rajakaruna, R S; Dikkumbura, A W; Rajapakse, R P V J

    2015-02-01

    An island-wide collection of tick species infesting humans, domesticated and wild animals and questing ticks in domestic and peridomestic environments was carried out during 2009-2011. A total of 30,461 ticks were collected from 30 different hosts and free living stages from the ground. The collection consisted of 22 tick species from 30 different hosts recording 12 tick species from humans, 19 from domesticated animals and 21 from wild animals, with a total of 97 new host records. The most common tick species on humans were Dermacentor auratus and Amblyomma testudinairum, while Haemaphysalis intermedia, Rhipicephalus microplus and Rhipicephalus sanguineus were common in domesticated and wild animals sharing 20 host species. Among the questing ticks, immature D. auratus was the most abundant. Humans and domesticated animals were mostly infested by the nymphal stages while adult ticks were found on wild animals. High number of new host records could be due to domestic animals picking tick species from wildlife and vise versa at the human/animal interface. Habitat destruction due to forest fragmentation has lead to wild animals roaming in urban and semi-urban neighbourhoods increasing the interactions of wild animals with domesticated animals. Wild animals play a significant role as a reservoir of many tick borne infections which can easily be spread to domesticated animals and then to humans via tick infestations. Data in this paper are useful for those interested in tick infesting wild and domestic animals and humans in describing the zoonotic potential of tick borne infections.

  5. Broad-Range Survey of Tick-Borne Pathogens in Southern Germany Reveals a High Prevalence of Babesia microti and a Diversity of Other Tick-Borne Pathogens

    PubMed Central

    Crowder, Chris D.; Carolan, Heather E.; Rounds, Megan A.; Ecker, David J.; Haag, Heike; Mothes, Benedikt; Nolte, Oliver

    2014-01-01

    Abstract Ticks harbor numerous pathogens of significance to human and animal health. A better understanding of the pathogens carried by ticks in a given geographic area can alert health care providers of specific health risks leading to better diagnosis and treatments. In this study, we tested 226 Ixodes ricinis ticks from Southern Germany using a broad-range PCR and electrospray ionization mass spectrometry assay (PCR/ESI-MS) designed to identify tick-borne bacterial and protozoan pathogens in a single test. We found 21.2% of the ticks tested carried Borrelia burgdorferi sensu lato consisting of diverse genospecies; a surprisingly high percentage of ticks were infected with Babesia microti (3.5%). Other organisms found included Borrelia miyamotoi, Rickettsia helvetica, Rickettsia monacensis, and Anaplasma phagocytophilum. Of further significance was our finding that more than 7% of ticks were infected with more than one pathogen or putative pathogen. PMID:25072989

  6. [Occupational dermatitis in the agriculture-food industry environment].

    PubMed

    Tripodi, Dominique; Géraut, Christian

    2002-09-01

    The agricultural and food professions are those that touch agriculture, but also the restoration, the kitchens, and the employees of slaughterhouses. Various occupational skin diseases touch these salaried employees or craftsmen: eczemas or contact hives with plants or meats and fleshes of animals and all chemical substances that are added: pesticides, food additives and various preservatives. Irritation contact dermatitis or real skin burns are observed with housekeeping products imposed by the sanitary norms, increasingly powerful, but as increasingly caustic. Infectious illnesses transmitted from the animal to the man are sometimes observed especially among the breeders and employees of slaughterhouses.

  7. Population-based passive tick surveillance and detection of expanding foci of blacklegged ticks Ixodes scapularis and the Lyme disease agent Borrelia burgdorferi in Ontario, Canada.

    PubMed

    Nelder, Mark P; Russell, Curtis; Lindsay, L Robbin; Dhar, Badal; Patel, Samir N; Johnson, Steven; Moore, Stephen; Kristjanson, Erik; Li, Ye; Ralevski, Filip

    2014-01-01

    We identified ticks submitted by the public from 2008 through 2012 in Ontario, Canada, and tested blacklegged ticks Ixodes scapularis for Borrelia burgdorferi and Anaplasma phagocytophilum. Among the 18 species of ticks identified, I. scapularis, Dermacentor variabilis, Ixodes cookei and Amblyomma americanum represented 98.1% of the 14,369 ticks submitted. Rates of blacklegged tick submission per 100,000 population were highest in Ontario's Eastern region; D. variabilis in Central West and Eastern regions; I. cookei in Eastern and South West regions; and A. americanum had a scattered distribution. Rates of blacklegged tick submission per 100,000 population were highest from children (0-9 years old) and older adults (55-74 years old). In two health units in the Eastern region (i.e., Leeds, Grenville & Lanark District and Kingston-Frontenac and Lennox & Addington), the rate of submission for engorged and B. burgdorferi-positive blacklegged ticks was 47× higher than the rest of Ontario. Rate of spread for blacklegged ticks was relatively faster and across a larger geographic area along the northern shore of Lake Ontario/St. Lawrence River, compared with slower spread from isolated populations along the northern shore of Lake Erie. The infection prevalence of B. burgdorferi in blacklegged ticks increased in Ontario over the study period from 8.4% in 2008 to 19.1% in 2012. The prevalence of B. burgdorferi-positive blacklegged ticks increased yearly during the surveillance period and, while increases were not uniform across all regions, increases were greatest in the Central West region, followed by Eastern and South West regions. The overall infection prevalence of A. phagocytophilum in blacklegged ticks was 0.3%. This study provides essential information on ticks of medical importance in Ontario, and identifies demographic and geographic areas for focused public education on the prevention of tick bites and tick-borne diseases.

  8. The Phenology of Ticks and the Effects of Long-Term Prescribed Burning on Tick Population Dynamics in Southwestern Georgia and Northwestern Florida

    PubMed Central

    Gleim, Elizabeth R.; Conner, L. Mike; Berghaus, Roy D.; Levin, Michael L.; Zemtsova, Galina E.; Yabsley, Michael J.

    2014-01-01

    Some tick populations have increased dramatically in the past several decades leading to an increase in the incidence and emergence of tick-borne diseases. Management strategies that can effectively reduce tick populations while better understanding regional tick phenology is needed. One promising management strategy is prescribed burning. However, the efficacy of prescribed burning as a mechanism for tick control is unclear because past studies have provided conflicting data, likely due to a failure of some studies to simulate operational management scenarios and/or account for other predictors of tick abundance. Therefore, our study was conducted to increase knowledge of tick population dynamics relative to long-term prescribed fire management. Furthermore, we targeted a region, southwestern Georgia and northwestern Florida (USA), in which little is known regarding tick dynamics so that basic phenology could be determined. Twenty-one plots with varying burn regimes (burned surrounded by burned [BB], burned surrounded by unburned [BUB], unburned surrounded by burned [UBB], and unburned surrounded by unburned [UBUB]) were sampled monthly for two years while simultaneously collecting data on variables that can affect tick abundance (e.g., host abundance, vegetation structure, and micro- and macro-climatic conditions). In total, 47,185 ticks were collected, of which, 99% were Amblyomma americanum, 0.7% were Ixodes scapularis, and fewer numbers of Amblyomma maculatum, Ixodes brunneus, and Dermacentor variabilis. Monthly seasonality trends were similar between 2010 and 2011. Long-term prescribed burning consistently and significantly reduced tick counts (overall and specifically for A. americanum and I. scapularis) regardless of the burn regimes and variables evaluated. Tick species composition varied according to burn regime with A. americanum dominating at UBUB, A. maculatum at BB, I. scapularis at UBB, and a more even composition at BUB. These data indicate that

  9. The diversity and prevalence of hard ticks attacking human hosts in Eastern Siberia (Russian Federation) with first description of invasion of non-endemic tick species.

    PubMed

    Khasnatinov, Maxim Anatolyevich; Liapunov, Alexander Valeryevich; Manzarova, Ellina Lopsonovna; Kulakova, Nina Viktorovna; Petrova, Irina Viktorovna; Danchinova, Galina Anatolyevna

    2016-02-01

    Hard ticks are the vectors of many pathogens including tick-borne encephalitis virus and the Lyme disease agent Borrelia burgdorferi sensu lato. In Eastern Siberia, Ixodes persulcatus, Dermacentor nuttalli, Dermacentor silvarum and Haemaphysalis concinna are regarded as aggressive to humans. Recently, significant changes in world tick fauna have been reported and this affects the spread of tick-borne pathogens. We studied the current species diversity, population structure and prevalence of tick-borne pathogens of hard ticks (Acari: Ixodidae) that attacked humans in Eastern Siberia (Irkutsk region, Russia). In total, 31,892 individual ticks were identified and analysed during the years 2007-2014. The majority (85.4%) of victims was bitten by I. persulcatus, 14.55% of attacks on humans were caused by D. nuttalli and D. silvarum, whereas H. concinna was documented only in 15 cases (0.05%). The seasonal activity and the age/gender structure of the tick population were studied as well. Among all the studied ticks, three unconventional species, i.e. Rhipicephalus sanguineus, Dermacentor reticulatus and Amblyomma americanum, were identified. Analysis of tick bite histories indicates at least three events of invasion of non-endemic ticks into the ecosystems of northern Eurasia with harsh continental climates. Invading ticks are able to reach the adult life stage and are aggressive to the local human population. Phylogenetic analysis of mt 16S rRNA gene fragments suggests multiple independent routes of tick migration to Eastern Siberia. Possible implications to human health and epidemiology of tick-borne infections are discussed.

  10. Nuttalliella namaqua: a living fossil and closest relative to the ancestral tick lineage: implications for the evolution of blood-feeding in ticks.

    PubMed

    Mans, Ben J; de Klerk, Daniel; Pienaar, Ronel; Latif, Abdalla A

    2011-01-01

    Ticks are monophyletic and composed of the hard (Ixodidae) and soft (Argasidae) tick families, as well as the Nuttalliellidae, a family with a single species, Nuttalliella namaqua. Significant biological differences in lifestyle strategies for hard and soft ticks suggest that various blood-feeding adaptations occurred after their divergence. The phylogenetic relationships between the tick families have not yet been resolved due to the lack of molecular data for N. namaqua. This tick possesses a pseudo-scutum and apical gnathostoma as observed for ixodids, has a leathery cuticle similar to argasids and has been considered the evolutionary missing link between the two families. Little knowledge exists with regard to its feeding biology or host preferences. Data on its biology and systematic relationship to the other tick families could therefore be crucial in understanding the evolution of blood-feeding behaviour in ticks. Live specimens were collected and blood meal analysis showed the presence of DNA for girdled lizards from the Cordylid family. Feeding of ticks on lizards showed that engorgement occurred rapidly, similar to argasids, but that blood meal concentration occurs via malpighian excretion of water. Phylogenetic analysis of the 18S nuclear and 16S mitochondrial genes indicate that N. namaqua grouped basal to the main tick families. The data supports the monophyly of all tick families and suggests the evolution of argasid-like blood-feeding behaviour in the ancestral tick lineage. Based on the data and considerations from literature we propose an origin for ticks in the Karoo basin of Gondwanaland during the late Permian. The nuttalliellid family almost became extinct during the End Permian event, leaving N. namaqua as the closest living relative to the ancestral tick lineage and the evolutionary missing link between the tick families.

  11. Agricultural Geophysics

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The four geophysical methods predominantly used for agricultural purposes are resistivity, electromagnetic induction, ground penetrating radar (GPR), and time domain reflectometry (TDR). Resistivity and electromagnetic induction methods are typically employed to map lateral variations of apparent so...

  12. Agriculture Sectors

    EPA Pesticide Factsheets

    The Agriculture sectors comprise establishments primarily engaged in growing crops, raising animals, and harvesting fish and other animals. Find information on compliance, enforcement and guidance on EPA laws and regulations on the NAICS 111 & 112 sectors.

  13. Agricultural Microbiology.

    ERIC Educational Resources Information Center

    Brill, Winston J.

    1981-01-01

    Elucidates strategies for applying microbiological techniques to traditional agricultural practices. Discusses the manipulation of microorganisms that live with plants and also the problems involved in the introduction of new genes into crop plants by recombinant DNA methods. (CS)

  14. Agricultural Waste.

    PubMed

    Shu, Huajie; Zhang, Panpan; Chang, Chein-Chi; Wang, Renqing; Zhang, Shuping

    2015-10-01

    The management and disposal of agricultural waste are drawn more and more attention because of the increasing yields and negative effects on the environment. However, proper treatments such as converting abundant biomass wastes into biogas through anaerobic digestion technology, can not only avoid the negative impacts, but also convert waste into available resources. This review summarizes the studies of nearly two hundred scholars from the following four aspects: the characterization, reuse, treatment, and management of agricultural waste.

  15. Reducing the Risk of Tick-Borne Diseases through Smart, Safe and Sustainable Pest Control

    EPA Pesticide Factsheets

    Each year PestWise programs form new partnerships to address ongoing and emerging issues. Reducing the risk from ticks and tick-borne disease is an issue of importance and EPA is contributing to a larger federal effort.

  16. Natural occurrence of lethal aspergillosis in the cattle tick Rhipicephalus (Boophilus) microplus (Acari:Ixodidae).

    PubMed

    Miranda-Miranda, E; Cossio-Bayugar, R; Martínez-Ibañez, F; Casasanero-Orduña, R; Folch-Mallol, J

    2012-02-01

    The purpose of this study was to describe an unreported entomopathogenic fungus that naturally infects the cattle tick Rhipicephalus (Boophilus) microplus (Acari: Ixodidae). Engorged female ticks, showed symptoms of fungal infection after controlled tick infestation of cattle. Infected ticks developed a distinctive dark colour, a pale mould grew over the cuticle and the ticks eventually died covered with fungal conidiophores. The responsible fungus was isolated and cultured on mycological medium and submitted to microscopic morphology, biochemical phenotyping and 18S rRNA ribotyping analyses, which identified it as aflatoxin-producing Aspergillus flavus. Spores from the cultured fungus were experimentally sprayed over healthy engorged female ticks, obtaining an 80% prevalence of experimental infection of healthy ticks and their egg masses, the larval progeny after incubation under laboratory conditions was also infected. These results demonstrate that A. flavus is the causative agent of the natural fungal disease of the cattle tick R. microplus described here.

  17. Tick-borne Diseases: The Big Two | NIH MedlinePlus the Magazine

    MedlinePlus

    ... Ticks and Diseases Tick-borne Diseases: The Big Two Past Issues / Spring - Summer 2010 Table of Contents ... muscle pain. The red-spotted rash usually happens 2 to 5 days after the fever begins. Antibiotics ...

  18. Agriculture: About EPA's National Agriculture Center

    EPA Pesticide Factsheets

    EPA's National Agriculture Center (Ag Center), with the support of the United States Department of Agriculture, serves growers, livestock producers, other agribusinesses, and agricultural information/education providers.

  19. Surveillance of ticks and associated pathogens in free-ranging Formosan pangolins (Manis pentadactyla pentadactyla).

    PubMed

    Khatri-Chhetri, Rupak; Wang, Hsi-Chieh; Chen, Chen-Chih; Shih, Han-Chun; Liao, Hsien-Chun; Sun, Ching-Min; Khatri-Chhetri, Nabin; Wu, Hung-Yi; Pei, Kurtis Jai-Chyi

    2016-10-01

    Chinese pangolins are critically endangered insectivorous mammals distributed in several South and Southeast Asian countries. In recent years, there has been an increase in spread of tick-borne diseases in both humans and animals worldwide. Currently, limited information is available on ticks and associated pathogens infesting pangolins. The objective of the present study was to survey ticks and associated pathogens in the Formosan pangolin population in Southeastern Taiwan. Free-ranging Formosan pangolins captured during ecological survey were examined for the presence of ticks. DNA extracted from these ticks was used to identify the tick species and also to detect the tick-borne pathogens, by molecular methods. In the present study, we found 25% (13/52) of pangolins captured during 2012-2014 infested with ixodid ticks. A total of 21 ticks were collected and 3 species were identified: Haemaphysalis hystricis (14/21), Haemaphysalis formosensis (2/21) and Amblyomma testudinarium (5/21). We detected four different tick-borne pathogens, where one was identical to Anaplasma sp. strain An.H1446 while others showed close resemblance to Rickettsia conorii subsp. caspia A-167, Ehrlichia sp. TC251-2 and Cytauxzoon spp., respectively. The present study is the first survey of ticks infesting the free-ranging Chinese pangolins and pathogens harboured by these ticks. This information is important to know the diversity of ticks and tick-borne pathogens, and its conservation significance to pangolins and other sympatric wildlife. Important future step should be regular surveillance of ticks and tick-borne diseases at human-domestic animals-wildlife interface, which can provide a useful insight into the dynamics of these pathogens and can help control and prevent outbreak of zoonoses.

  20. Molecular epidemiological survey of bacterial and parasitic pathogens in hard ticks from eastern China.

    PubMed

    Liu, Xiang-Ye; Gong, Xiang-Yao; Zheng, Chen; Song, Qi-Yuan; Chen, Ting; Wang, Jing; Zheng, Jie; Deng, Hong-Kuan; Zheng, Kui-Yang

    2017-03-01

    Ticks are able to transmit various pathogens-viruses, bacteria, and parasites-to their host during feeding. Several molecular epidemiological surveys have been performed to evaluate the risk of tick-borne pathogens in China, but little is known about pathogens circulating in ticks from eastern China. Therefore, this study aimed to investigate the presence of bacteria and parasites in ticks collected from Xuzhou, a 11258km(2) region in eastern China. In the present study, ticks were collected from domestic goats and grasses in urban districts of Xuzhou region from June 2015 to July 2016. After tick species identification, the presence of tick-borne bacterial and parasitic pathogens, including Anaplasma phagocytophilum, Borrelia burgdorferi, Rickettsia sp., Bartonella sp., Babesia sp., and Theileria sp., was established via conventional or nested polymerase chain reaction assays (PCR) and sequence analysis. Finally, a total of 500 questing adult ticks, identified as Haemaphysalis longicornis, were investigated. Among them, 28/500 tick samples (5.6%) were infected with A. phagocytophilum, and 23/500 (4.6%) with Theileria luwenshuni, whereas co-infection with these pathogens was detected in only 1/51 (2%) of all infected ticks. In conclusion, H. longicornis is the dominant tick species in the Xuzhou region and plays an important role in zoonotic pathogen transmission. Both local residents and animals are at a significant risk of exposure to anaplasmosis and theileriosis, due to the high rates of A. phagocytophilum and T. luwenshuni tick infection.

  1. Evaluation of four bed bug traps for surveillances of brown dog ticks (Acari: Ixodidae)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The brown dog tick can be a serious residential pest due to its unique ability, among ticks, to complete its lifecycle indoors. A single engorged and fertilized female tick can oviposit around 4,000 eggs, allowing indoor establishment to be rapid and easy to miss in early-stage infestations. Acari...

  2. 9 CFR 72.12 - Cattle; exposure to tick infestation after treatment or inspection prohibited.

    Code of Federal Regulations, 2012 CFR

    2012-01-01

    ... 9 Animals and Animal Products 1 2012-01-01 2012-01-01 false Cattle; exposure to tick infestation... (INCLUDING POULTRY) AND ANIMAL PRODUCTS TEXAS (SPLENETIC) FEVER IN CATTLE § 72.12 Cattle; exposure to tick infestation after treatment or inspection prohibited. The cattle shall not be exposed to tick...

  3. 9 CFR 72.12 - Cattle; exposure to tick infestation after treatment or inspection prohibited.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... 9 Animals and Animal Products 1 2013-01-01 2013-01-01 false Cattle; exposure to tick infestation... (INCLUDING POULTRY) AND ANIMAL PRODUCTS TEXAS (SPLENETIC) FEVER IN CATTLE § 72.12 Cattle; exposure to tick infestation after treatment or inspection prohibited. The cattle shall not be exposed to tick...

  4. 9 CFR 72.12 - Cattle; exposure to tick infestation after treatment or inspection prohibited.

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... 9 Animals and Animal Products 1 2011-01-01 2011-01-01 false Cattle; exposure to tick infestation... (INCLUDING POULTRY) AND ANIMAL PRODUCTS TEXAS (SPLENETIC) FEVER IN CATTLE § 72.12 Cattle; exposure to tick infestation after treatment or inspection prohibited. The cattle shall not be exposed to tick...

  5. 9 CFR 72.12 - Cattle; exposure to tick infestation after treatment or inspection prohibited.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... 9 Animals and Animal Products 1 2014-01-01 2014-01-01 false Cattle; exposure to tick infestation... (INCLUDING POULTRY) AND ANIMAL PRODUCTS BOVINE BABESIOSIS § 72.12 Cattle; exposure to tick infestation after treatment or inspection prohibited. The cattle shall not be exposed to tick infestation after treatment...

  6. 9 CFR 72.12 - Cattle; exposure to tick infestation after treatment or inspection prohibited.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Cattle; exposure to tick infestation... (INCLUDING POULTRY) AND ANIMAL PRODUCTS TEXAS (SPLENETIC) FEVER IN CATTLE § 72.12 Cattle; exposure to tick infestation after treatment or inspection prohibited. The cattle shall not be exposed to tick...

  7. Severe fever with thrombocytopenia syndrome virus in ticks collected from humans, South Korea, 2013.

    PubMed

    Yun, Seok-Min; Lee, Wook-Gyo; Ryou, Jungsang; Yang, Sung-Chan; Park, Sun-Whan; Roh, Jong Yeol; Lee, Ye-Ji; Park, Chan; Han, Myung Guk

    2014-08-01

    We investigated the infection rate for severe fever with thrombocytopenia syndrome virus (SFTSV) among ticks collected from humans during May-October 2013 in South Korea. Haemaphysalis longicornis ticks have been considered the SFTSV vector. However, we detected the virus in H. longicornis, Amblyomma testudinarium, and Ixodes nipponensis ticks, indicating additional potential SFTSV vectors.

  8. How to Remove a Tick | NIH MedlinePlus the Magazine

    MedlinePlus

    ... of this page please turn Javascript on. Feature: Ticks and Diseases How to Remove a Tick Past Issues / Spring - Summer 2010 Table of Contents ... with a good grasping end to remove the tick as close to the skin as possible. Do ...

  9. Detection of rickettsial DNA in ticks and wild boars in Kyoto City, Japan.

    PubMed

    Someya, Azusa; Ito, Ryuki; Maeda, Akihiko; Ikenaga, Mitsuhiro

    2015-01-01

    The tick is a well-known vector for arthropod-borne pathogens, such as tick-borne encephalitis, Lyme disease, Japanese spotted fever and severe fever with thrombocytopenia syndrome. It is therefore important to know the tick population and distribution in our environment and wild animals in order to prevent tick-borne diseases. Here, we report the results of tick surveillance from May to September 2011 at 14 geographical points and in 5 wild boars in Kyoto City, Kyoto prefecture, Japan. We collected 3,198 ticks comprising 5 tick species, Haemaphysalis (H.) longicornis, H. flava, H. kitaokai, Amblyomma testudinarium and Dermacentor taiwanensis. Interestingly, the proportion of tick species varied according to geographical region within the city. The ticks collected in the city were reported as potential vectors of pathogens, such as rickettsiosis. We detected rickettsial DNA by PCR in 71.1% of 201 ticks investigated. The ticks that carried rickettsiae were distributed across the whole the city. The sequences of PCR-amplified DNA fragments were determined and showed similarities to spotted fever group rickettsiae. Although their pathogenicity for animals including humans is still unclear, it is important to stay alert and pay attention to tick-borne diseases in order to ensure the safety of the citizens of the city as well as that of visitors.

  10. Serotonin-like immunoreactivity in the central nervous system of two Ixodid tick species

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Immunocytochemistry was used to detect the presence of serotonin-like immunoreactive (5HT-IR) neurons and neuronal processes in the central nervous system (CNS), the synganglion, of two Ixodid tick species; the winter tick, Dermacentor albipictus and the lone star tick, Amblyomma americanum. Seroto...

  11. The US experience of eradicating and preventing re-infestation with cattle fever ticks

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The southern cattle tick, Rhipicephalus microplus, and the cattle tick, R. annulatus, are obligate ectoparasites and the vectors of pathogens causing bovine babesiosis, or “Cattle Fever”, and anaplasmosis in cattle. These cattle fever tick (CFT) species were declared eradicated from the U.S. in 1943...

  12. Ticks (Acari: Ixodidae) associated with wildlife and vegetation of Haller park along the Kenyan coastline.

    PubMed

    Wanzala, W; Okanga, S

    2006-09-01

    This artcile describes the results obtained from a tick survey conducted in Haller park along the Kenyan coastline. The survey aimed at evaluating tick-host associations, assessing tick population density, and providing baseline information for planning future tick control and management in the park. Ticks (2,968) were collected by handpicking from eight species of wildlife and by dragging in 14 selected sites within the park. A considerable proportion of ticks were also collected from leaves, stems, and bark of most dominant trees, namely, Casuarina equisetifolia L. (Forst. and Forst.), Cocos nucifera L., Adansonia digitata L., Musa paradisiaca L., and Azadiracta indica Adr. Juss. Dragging was conducted in sites predominantly occupied by Cynodon dactylon L. (Pers.), Cenchrus ciliaris L., Stenotaphrum dimidiatum L. (Kuntze.) Brongn., and Brachiaria xantholeuca Hack. Ex Schinz Stapf. and Loudetia kagerensis K. Schum. Hutch. Eight tick species were identified, and the collection included Rhipicephalus pravus Dönitz 1910, Rhipicephalus pulchellus Gerstäcker 1873, Hyalomma marginatum rufipes Koch 1844, Amblyomma gemma Dönitz 1910, Amblyomma hebraeum Koch 1844, Amblyomma sparsum Neumann 1899, Amblyomma nuttalli Dönitz 1909, and Boophilus decoloratus Koch 1844. Given that the identified tick species are known to parasitize humans as well as livestock, there exist risks of emergence of zoonotic infections mediated by tick vectors. In the recreational environment of Haller park, where tick vectors share habitats with hosts, there is a need to develop sustainable and effective tick control and management strategies to minimize economic losses that tick infestation may cause.

  13. Passive tick surveillance, dog seropositivity, and incidence of human Lyme disease

    USGS Publications Warehouse

    Johnson, Jaree L.; Ginsberg, Howard S.; Zhioua, Elyes; Whitworth, Ulysses G.; Markowski, Daniel; Hyland, Kerwin E.; Hu, Renjie

    2004-01-01

    Data on nymphal Ixodes scapularis ticks submitted by the public to the University of Rhode Island Tick Research Laboratory for testing from 1991 to 2000 were compared with human case data from the Rhode Island Department of Health to determine the efficacy of passive tick surveillance at assessing human risk of Lyme disease. Numbers of ticks submitted were highly correlated with human cases by county (r = 0.998, n = 5 counties) and by town (r = 0.916, n = 37 towns), as were the numbers of positive ticks submitted (r = 0.989 by county, r = 0.787 by town). Human cases were correlated with ticks submitted by town each year, and with positive ticks in all but 2 years. Thus, passive tick surveillance effectively assessed geographical risk of human Lyme disease. In contrast, tick submissions through time were not correlated with human cases from year to year. Dog seropositivity was significantly correlated with human cases by county in both years tested, but by town in only one of two years. Numbers of ticks submitted were correlated with dog seropositivity by county but not by town, apparently because of high variability among towns with small sample sizes. Our results suggest that passive tick surveillance, using ticks submitted by the public for Lyme spirochete testing, can be used to assess the geographical distribution of Lyme disease risk, but cannot reliably predict Lyme incidence from year to year.

  14. Variation in the Microbiota of Ixodes Ticks with Regard to Geography, Species, and Sex

    PubMed Central

    Van Treuren, Will; Ponnusamy, Loganathan; Brinkerhoff, R. Jory; Gonzalez, Antonio; Parobek, Christian M.; Juliano, Jonathan J.; Andreadis, Theodore G.; Falco, Richard C.; Ziegler, Lorenza Beati; Hathaway, Nicholas; Keeler, Corinna; Emch, Michael; Bailey, Jeffrey A.; Roe, R. Michael; Apperson, Charles S.; Knight, Rob

    2015-01-01

    Ixodes scapularis is the principal vector of Lyme disease on the East Coast and in the upper Midwest regions of the United States, yet the tick is also present in the Southeast, where Lyme disease is absent or rare. A closely related species, I. affinis, also carries the pathogen in the South but does not seem to transmit it to humans. In order to better understand the geographic diversity of the tick, we analyzed the microbiota of 104 adult I. scapularis and 13 adult I. affinis ticks captured in 19 locations in South Carolina, North Carolina, Virginia, Connecticut, and New York. Initially, ticks from 4 sites were analyzed by 454 pyrosequencing. Subsequently, ticks from these sites plus 15 others were analyzed by sequencing with an Illumina MiSeq machine. By both analyses, the microbiomes of female ticks were significantly less diverse than those of male ticks. The dissimilarity between tick microbiomes increased with distance between sites, and the state in which a tick was collected could be inferred from its microbiota. The genus Rickettsia was prominent in all locations. Borrelia was also present in most locations and was present at especially high levels in one site in western Virginia. In contrast, members of the family Enterobacteriaceae were very common in North Carolina I. scapularis ticks but uncommon in I. scapularis ticks from other sites and in North Carolina I. affinis ticks. These data suggest substantial variations in the Ixodes microbiota in association with geography, species, and sex. PMID:26150449

  15. High Prevalence of Borrelia miyamotoi among Adult Blacklegged Ticks from White-Tailed Deer.

    PubMed

    Han, Seungeun; Hickling, Graham J; Tsao, Jean I

    2016-02-01

    We compared the prevalence of Borrelia miyamotoi infection in questing and deer-associated adult Ixodes scapularis ticks in Wisconsin, USA. Prevalence among deer-associated ticks (4.5% overall, 7.1% in females) was significantly higher than among questing ticks (1.0% overall, 0.6% in females). Deer may be a sylvatic reservoir for this newly recognized zoonotic pathogen.

  16. First report of Rickettsia raoultii in field collected Dermacentor reticulatus ticks from Austria.

    PubMed

    Duscher, Georg G; Hodžić, Adnan; Weiler, Martin; Vaux, Alexander G C; Rudolf, Ivo; Sixl, Wolfdieter; Medlock, Jolyon M; Versteirt, Veerle; Hubálek, Zdenek

    2016-07-01

    In a set of pooled field collected Dermacentor reticulatus ticks, Rickettsia raoultii, the causative agent of Tick-borne lymphadenopathy/Dermacentor-borne necrosis erythema and lymphadenopathy, was found for the first time in Austria. The coordinates of the positive locations for tick and pathogen abundance are given and shown in a map.

  17. A focus of deer tick virus transmission in the northcentral United States.

    PubMed Central

    Ebel, G. D.; Foppa, I.; Spielman, A.; Telford, S. R.

    1999-01-01

    We screened salivary glands from adult deer ticks collected near Spooner and Hayward, Wisconsin, to determine whether deer tick virus, a recently described flavivirus, occurs with other tickborne agents in the upper Midwest. Intraacinar inclusions suggestive of replicating virus were detected in 4 (4.6%) of 87 ticks. The virus was isolated by suckling-mouse inoculation. PMID:10460180

  18. Confirmation of tick bite by detection of antibody to Ixodes calreticulin salivary protein.

    PubMed

    Alarcon-Chaidez, Francisco; Ryan, Raymond; Wikel, Stephen; Dardick, Kenneth; Lawler, Caroline; Foppa, Ivo M; Tomas, Patricio; Cushman, Alexis; Hsieh, Ann; Spielman, Andrew; Bouchard, Keith R; Dias, Filiciano; Aslanzadeh, Jaber; Krause, Peter J

    2006-11-01

    Ticks introduce a variety of pharmacologically active molecules into their host during attachment and feeding in order to obtain a blood meal. People who are repeatedly exposed to ticks may develop an immune response to tick salivary proteins. Despite this response, people usually are unaware of having been bitten, especially if they are not repeatedly exposed to ticks. In order to develop a laboratory marker of tick exposure that would be useful in understanding the epidemiology of tick-borne infection and the immune response to tick bite, we developed an enzyme-linked immunosorbent assay (ELISA) to detect antibody to a recombinant form of calreticulin protein found in the salivary glands of Ixodes scapularis, a member of a complex of Ixodes ticks that serve as the vectors for Lyme disease, human babesiosis, and human granulocytic anaplasmosis. Using this assay, we tested sera obtained from C3H/HeN and BALB/c mice before and after experimental deer tick infestation. These mice developed antibody to Ixodes calreticulin antigen after infestation. We then used the same assay to test sera obtained from people before and after they experienced deer tick bite(s). People experiencing deer tick bite(s) developed Ixodes calreticulin-specific antibody responses that persisted for up to 17 months. This Ixodes recombinant calreticulin ELISA provides objective evidence of deer tick exposure in people.

  19. Confirmation of Tick Bite by Detection of Antibody to Ixodes Calreticulin Salivary Protein▿

    PubMed Central

    Alarcon-Chaidez, Francisco; Ryan, Raymond; Wikel, Stephen; Dardick, Kenneth; Lawler, Caroline; Foppa, Ivo M.; Tomas, Patricio; Cushman, Alexis; Hsieh, Ann; Spielman, Andrew; Bouchard, Keith R.; Dias, Filiciano; Aslanzadeh, Jaber; Krause, Peter J.

    2006-01-01

    Ticks introduce a variety of pharmacologically active molecules into their host during attachment and feeding in order to obtain a blood meal. People who are repeatedly exposed to ticks may develop an immune response to tick salivary proteins. Despite this response, people usually are unaware of having been bitten, especially if they are not repeatedly exposed to ticks. In order to develop a laboratory marker of tick exposure that would be useful in understanding the epidemiology of tick-borne infection and the immune response to tick bite, we developed an enzyme-linked immunosorbent assay (ELISA) to detect antibody to a recombinant form of calreticulin protein found in the salivary glands of Ixodes scapularis, a member of a complex of Ixodes ticks that serve as the vectors for Lyme disease, human babesiosis, and human granulocytic anaplasmosis. Using this assay, we tested sera obtained from C3H/HeN and BALB/c mice before and after experimental deer tick infestation. These mice developed antibody to Ixodes calreticulin antigen after infestation. We then used the same assay to test sera obtained from people before and after they experienced deer tick bite(s). People experiencing deer tick bite(s) developed Ixodes calreticulin-specific antibody responses that persisted for up to 17 months. This Ixodes recombinant calreticulin ELISA provides objective evidence of deer tick exposure in people. PMID:16928887

  20. Variation in the Microbiota of Ixodes Ticks with Regard to Geography, Species, and Sex.

    PubMed

    Van Treuren, Will; Ponnusamy, Loganathan; Brinkerhoff, R Jory; Gonzalez, Antonio; Parobek, Christian M; Juliano, Jonathan J; Andreadis, Theodore G; Falco, Richard C; Ziegler, Lorenza Beati; Hathaway, Nicholas; Keeler, Corinna; Emch, Michael; Bailey, Jeffrey A; Roe, R Michael; Apperson, Charles S; Knight, Rob; Meshnick, Steven R

    2015-09-01

    Ixodes scapularis is the principal vector of Lyme disease on the East Coast and in the upper Midwest regions of the United States, yet the tick is also present in the Southeast, where Lyme disease is absent or rare. A closely related species, I. affinis, also carries the pathogen in the South but does not seem to transmit it to humans. In order to better understand the geographic diversity of the tick, we analyzed the microbiota of 104 adult I. scapularis and 13 adult I. affinis ticks captured in 19 locations in South Carolina, North Carolina, Virginia, Connecticut, and New York. Initially, ticks from 4 sites were analyzed by 454 pyrosequencing. Subsequently, ticks from these sites plus 15 others were analyzed by sequencing with an Illumina MiSeq machine. By both analyses, the microbiomes of female ticks were significantly less diverse than those of male ticks. The dissimilarity between tick microbiomes increased with distance between sites, and the state in which a tick was collected could be inferred from its microbiota. The genus Rickettsia was prominent in all locations. Borrelia was also present in most locations and was present at especially high levels in one site in western Virginia. In contrast, members of the family Enterobacteriaceae were very common in North Carolina I. scapularis ticks but uncommon in I. scapularis ticks from other sites and in North Carolina I. affinis ticks. These data suggest substantial variations in the Ixodes microbiota in association with geography, species, and sex.

  1. Research careers for microbiologists in the USDA Agricultural Research Service

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The United States Department of Agriculture (USDA) and the Agricultural Research Service (ARS) employees microbiologists in a wide variety of diverse positions. This includes work involving animal health, infectious diseases and food safety. Various agencies within the USDA are responsible for monit...

  2. 20 CFR 404.1056 - Explanation of agricultural labor.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... agricultural labor. An example of this is the extraction of juices from fruits or vegetables. However, work in the cutting and drying of fruits or vegetables does not change the commodity from its raw or natural... 20 Employees' Benefits 2 2011-04-01 2011-04-01 false Explanation of agricultural labor....

  3. 20 CFR 404.1056 - Explanation of agricultural labor.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... agricultural labor. An example of this is the extraction of juices from fruits or vegetables. However, work in the cutting and drying of fruits or vegetables does not change the commodity from its raw or natural... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Explanation of agricultural labor....

  4. Selected Job Title Description for Nonfarm Agricultural Jobs in Louisiana.

    ERIC Educational Resources Information Center

    Mondart, C. L., Jr.; And Others

    Job information, presented for use by high school counselors, was derived from a statewide study of nonfarm agricultural occupations which revealed that 20,025 Louisiana workers in 1,699 job titles were doing work demanding some specialized training in agriculture. Information includes a description, employee qualifications, employment…

  5. Establishment of a laboratory colony of taiga tick Ixodes persulcatus for tick-borne pathogen transmission studies.

    PubMed

    Konnai, Satoru; Saito, Yoichi; Nishikado, Hideto; Yamada, Shinji; Imamura, Saiki; Mori, Akina; Ito, Takuya; Onuma, Misao; Ohashi, Kazuhiko

    2008-01-01

    Ixodes persulcatus Schulze (I. persulcatus) is distributed in Russia and Far East Asia including Japan, and has been implicated as the vector of several human pathogens. In particular, I. persulcatus acts as the only tick vector for human lyme borreliosis in Japan. In order to elucidate the mechanism of transmission of I. persulcatus-borne pathogens, we developed a laboratory colony of I. persulcatus. Ticks were fed on Syrian hamster and engorged ticks that had dropped off the animals were collected and maintained to allow them to molt. Tick rearing was performed in incubator at 20 degrees C with 95% relative humidity and 12-hour light/dark photo-period regimen. We found out that adult females fed for 8 +/- 2 days and had a pre-oviposition period lasting for 7 +/- 2 days. The minimum egg incubation period was 1 month with the hatched larvae feeding for 3 +/- 1 days and molting to nymphs 3-4 months thereafter. Meanwhile, the nymphs fed for 4 +/- 1 days and molted to adult 2-3 months thereafter. For future analysis of gene expression profiles in I. persulcatus, we cloned and sequenced the actin gene (a housekeeping gene), and found that it is 92.7% to 98.6% homologous to the published sequences of related ixodid ticks. This laboratory colony of I. persulcatus will facilitate investigations on the role of tick-derived molecules on the transmission of I. persulcatus-borne pathogens and will be important for identification of potential anti-tick vaccine and acaricide target molecules.

  6. Theileria sp. OT3 and other tick-borne pathogens in sheep and ticks in Italy: molecular characterization and phylogeny.

    PubMed

    Giangaspero, A; Marangi, M; Papini, R; Paoletti, B; Wijnveld, M; Jongejan, F

    2015-02-01

    PCR Reverse Line Blot (RLB) hybridization and sequencing were used to determine the dynamics of infection with tick-borne pathogens in one hundred apparently healthy sheep in Italy. Blood samples were tested once prior to the onset of the grazing season (June 2010) and once after the end of the grazing season (August 2010). Ticks collected from sheep and from the vegetation were also tested by PCR/RLB. Before grazing, 56% of the sheep harbored several tick-borne pathogens: Anaplasma ovis was the most prevalent (41%), followed by A. ovis co-infected with Theileria sp. OT3 (14%). After grazing, 87% of sheep were positive for A. ovis alone (41%), co-infected with Theileria sp. OT3 (8%) or co-infected with Babesia motasi (5%). Other sheep were infected with Anaplasma phagocytophilum alone (20%), co-infected with B. motasi (7%) or with Theileria sp. OT3 (5%) (p<0.001). After grazing, sheep were significantly more infected with tick-borne pathogens than before grazing. Ticks collected were all Haemaphysalis punctata (n-89) and 36% were positive for A. ovis, Ehrlichia ovina and A. ovis combined with A. phagocytophilum. Phylogenetic analysis including isolates from countries in the Mediterranean Basin show circulation of the same variants of Theileria sp. OT3, whereas two different geographical origins for the isolates of A. ovis and A. phagocytophilum were identified. This is the first report from Italy of Theileria sp. OT3 in sheep, whereas the detection of Ehrlichia ovina in ticks is worth noting, and the presence of A. phagocytophilum in sheep and in ticks poses a potential public health risk.

  7. Concurrent micro-RNA mediated silencing of tick-borne flavivirus replication in tick vector and in the brain of vertebrate host

    PubMed Central

    Tsetsarkin, Konstantin A.; Liu, Guangping; Kenney, Heather; Hermance, Meghan; Thangamani, Saravanan; Pletnev, Alexander G.

    2016-01-01

    Tick-borne viruses include medically important zoonotic pathogens that can cause life-threatening diseases. Unlike mosquito-borne viruses, whose impact can be restrained via mosquito population control programs, for tick-borne viruses only vaccination remains the reliable means of disease prevention. For live vaccine viruses a concern exists, that spillovers from viremic vaccinees could result in introduction of genetically modified viruses into sustainable tick-vertebrate host transmission cycle in nature. To restrict tick-borne flavivirus (Langat virus, LGTV) vector tropism, we inserted target sequences for tick-specific microRNAs (mir-1, mir-275 and mir-279) individually or in combination into several distant regions of LGTV genome. This caused selective attenuation of viral replication in tick-derived cells. LGTV expressing combinations of target sequences for tick- and vertebrate CNS-specific miRNAs were developed. The resulting viruses replicated efficiently and remained stable in simian Vero cells, which do not express these miRNAs, however were severely restricted to replicate in tick-derived cells. In addition, simultaneous dual miRNA targeting led to silencing of virus replication in live Ixodes ricinus ticks and abolished virus neurotropism in highly permissive newborn mice. The concurrent restriction of adverse replication events in vertebrate and invertebrate hosts will, therefore, ensure the environmental safety of live tick-borne virus vaccine candidates. PMID:27620807

  8. The first detection of the tick-borne encephalitis virus (TBEV) RNA in Dermacentor reticulatus ticks collected from the lowland European bison (Bison bonasus bonasus L.).

    PubMed

    Biernat, Beata; Karbowiak, Grzegorz; Stańczak, Joanna; Masny, Aleksander; Werszko, Joanna

    2016-01-01

    Tick borne encephalitis virus (TBEV) (Flaviviridae, Flavivirus) is the causative agent of tick-borne encephalitis (TBE), a potentially fatal neurological infection. The disease is endemic in a large region in Eurasia, where is transmitted mainly by hard ticks: Ixodes ricinus and I. persulcatus. It is known that also Dermacentor reticulatus is involved in a circulation of TBEV, but the knowledge of its importance in the TBE epidemiology is still insufficient. The Białowieża Primeval Forest is located in eastern Poland and it is a well-known endemic focus of tick-borne encephalitis. The aim of this study was to identify the prevalence of tick-borne encephalitis virus (TBEV) in Dermacentor reticulatus ticks collected from European bison (Bison bonasus bonasus), an important host of hard ticks in the Białowieża Primeval Forest. In the years 2008-2009, a total of 114 adult D. reticulatus ticks were collected from 7 European bison and examined individually for the presence of TBEV RNA using nested RT-PCR assay. Positive results were noted in 18.42% of ticks. This is the first record of TBEV infection in ticks collected from European bison.

  9. Scavenger receptor mediates systemic RNA interference in ticks.

    PubMed

    Aung, Kyaw Min; Boldbaatar, Damdinsuren; Umemiya-Shirafuji, Rika; Liao, Min; Xuenan, Xuan; Suzuki, Hiroshi; Galay, Remil Linggatong; Tanaka, Tetsuya; Fujisaki, Kozo

    2011-01-01

    RNA interference is an efficient method to silence gene and protein expressions. Here, the class B scavenger receptor CD36 (SRB) mediated the uptake of exogenous dsRNAs in the induction of the RNAi responses in ticks. Unfed female Haemaphysalis longicornis ticks were injected with a single or a combination of H. longicornis SRB (HlSRB) dsRNA, vitellogenin-1 (HlVg-1) dsRNA, and vitellogenin receptor (HlVgR) dsRNA. We found that specific and systemic silencing of the HlSRB, HlVg-1, and HlVgR genes was achieved in ticks injected with a single dsRNA of HlSRB, HlVg-1, and HlVgR. In ticks injected first with HlVg-1 or HlVgR dsRNA followed 96 hours later with HlSRB dsRNA (HlVg-1/HlSRB or HlVgR/HlSRB), gene silencing of HlSRB was achieved in addition to first knockdown in HlVg-1 or HlVgR, and prominent phenotypic changes were observed in engorgement, mortality, and hatchability, indicating that a systemic and specific double knockdown of target genes had been simultaneously attained in these ticks. However, in ticks injected with HlSRB dsRNA followed 96 hours later with HlVg-1 or HlVgR dsRNAs, silencing of HlSRB was achieved, but no subsequent knockdown in HlVgR or HlVg-1 was observed. The Westernblot and immunohistochemical examinations revealed that the endogenous HlSRB protein was fully abolished in midguts of ticks injected with HlSRB/HlVg-1 dsRNAs but HlVg-1 was normally expressed in midguts, suggesting that HlVg-1 dsRNA-mediated RNAi was fully inhibited by the first knockdown of HlSRB. Similarly, the abolished localization of HlSRB protein was recognized in ovaries of ticks injected with HlSRB/HlVgR, while normal localization of HlVgR was observed in ovaries, suggesting that the failure to knock-down HlVgR could be attributed to the first knockdown of HlSRB. In summary, we demonstrated for the first time that SRB may not only mediate the effective knock-down of gene expression by RNAi but also play essential roles for systemic RNAi of ticks.

  10. Scavenger Receptor Mediates Systemic RNA Interference in Ticks

    PubMed Central

    Aung, Kyaw Min; Boldbaatar, Damdinsuren; Umemiya-Shirafuji, Rika; Liao, Min; Xuenan, Xuan; Suzuki, Hiroshi; Linggatong Galay, Remil; Tanaka, Tetsuya; Fujisaki, Kozo

    2011-01-01

    RNA interference is an efficient method to silence gene and protein expressions. Here, the class B scavenger receptor CD36 (SRB) mediated the uptake of exogenous dsRNAs in the induction of the RNAi responses in ticks. Unfed female Haemaphysalis longicornis ticks were injected with a single or a combination of H. longicornis SRB (HlSRB) dsRNA, vitellogenin-1 (HlVg-1) dsRNA, and vitellogenin receptor (HlVgR) dsRNA. We found that specific and systemic silencing of the HlSRB, HlVg-1, and HlVgR genes was achieved in ticks injected with a single dsRNA of HlSRB, HlVg-1, and HlVgR. In ticks injected first with HlVg-1 or HlVgR dsRNA followed 96 hours later with HlSRB dsRNA (HlVg-1/HlSRB or HlVgR/HlSRB), gene silencing of HlSRB was achieved in addition to first knockdown in HlVg-1 or HlVgR, and prominent phenotypic changes were observed in engorgement, mortality, and hatchability, indicating that a systemic and specific double knockdown of target genes had been simultaneously attained in these ticks. However, in ticks injected with HlSRB dsRNA followed 96 hours later with HlVg-1 or HlVgR dsRNAs, silencing of HlSRB was achieved, but no subsequent knockdown in HlVgR or HlVg-1 was observed. The Westernblot and immunohistochemical examinations revealed that the endogenous HlSRB protein was fully abolished in midguts of ticks injected with HlSRB/HlVg-1 dsRNAs but HlVg-1 was normally expressed in midguts, suggesting that HlVg-1 dsRNA-mediated RNAi was fully inhibited by the first knockdown of HlSRB. Similarly, the abolished localization of HlSRB protein was recognized in ovaries of ticks injected with HlSRB/HlVgR, while normal localization of HlVgR was observed in ovaries, suggesting that the failure to knock-down HlVgR could be attributed to the first knockdown of HlSRB. In summary, we demonstrated for the first time that SRB may not only mediate the effective knock-down of gene expression by RNAi but also play essential roles for systemic RNAi of ticks. PMID:22145043

  11. Comparison of flagging, walking, trapping, and collecting from hosts as sampling methods for northern deer ticks, Ixodes dammini, and lone-star ticks, Amblyomma americanum (Acari:Ixodidae).

    PubMed

    Ginsberg, H S; Ewing, C P

    1989-09-01

    Ticks were sampled by flagging, collecting from the investigator's clothing (walking samples), trapping with dry-ice bait, and collecting from mammal hosts on Fire Island, NY, U.S.A. The habitat distribution of adult deer ticks, Ixodes dammini, was the same in simultaneous collections from the investigator's clothing and from muslin flags. Walking and flagging samples can both be biased by differences between investigators, so the same person should do comparative samples whenever possible. Walking samples probably give a more accurate estimate than flagging samples of the human risk of encountering ticks. However, ticks (such as immature I. dammini) that seek hosts in leaf litter and ground-level vegetation are poorly sampled by walking collections. These ticks can be sampled by flagging at ground level. Dry-ice-baited tick-traps caught far more lone-star ticks, Amblyomma americanum, than deer ticks, even in areas where deer ticks predominated in flagging samples. In comparisons of tick mobility in the lab, nymphal A. americanum were more mobile than nymphal I. dammini in 84% of the trials. Therefore, the trapping bias may result from increased trap encounter due to more rapid movement by A. americanum, although greater attraction to carbon dioxide may also play a role. Tick traps are useful for intraspecific between-habitat comparisons. Early in their seasonal activity period, larval I. dammini were better represented in collections from mouse hosts than in flagging samples. Apparently, sampling from favored hosts can detect ticks at low population levels, but often cannot be used to get accurate estimates of pathogen prevalence in questing ticks.

  12. Anaplasma phagocytophilum in questing Ixodes ricinus ticks in southwestern Finland.

    PubMed

    Sormunen, Jani J; Penttinen, Ritva; Klemola, Tero; Vesterinen, Eero J; Hänninen, Jari

    2016-12-01

    Anaplasma phagocytophilum is the causative agent of an emerging tick-borne disease, human granulocytic anaplasmosis. While the bacterium has been reported from questing ticks in neighboring Sweden, Norway and Russia, the few surveys regarding questing ticks in Finland have thus far been negative. In the current study, the prevalence of A. phagocytophilum in Ixodes ricinus populations was evaluated in several study localities around southwestern Finland during 2013-2014. Some of these populations were previously screened and found negative for A. phagocytophilum in 2000. A total of 3158 I. ricinus collected by blanket dragging were screened for Anaplasma spp. using qPCR. Anaplasma were detected in 9.2% of adult ticks (n = 87) and 3.1% of nymphs (n = 979). All larval samples were negative for infection. All Anaplasma-positive samples were identified as A. phagocytophilum by sequencing. This is, to the best of our knowledge, the first report of the pathogen from questing ticks in Finland. Furthermore, the pathogen was detected from several localities found negative during the previous screening 13 years earlier.

  13. Autophagy-related genes from a tick, Haemaphysalis longicornis.

    PubMed

    Umemiya, Rika; Matsuo, Tomohide; Hatta, Takeshi; Sakakibara, Shin-Ichi; Boldbaatar, Damdinsuren; Fujisaki, Kozo

    2008-01-01

    Ticks are gorging-fasting organisms;(1) their life cycle is characterized by alternate off-host (starvation) and on-host (meal) conditions. Their generation time is estimated in several years and many ticks spend more than 95% of their life off the host. They seem to have a unique strategy to endure the off-host state for a long period. Thus, we focused on autophagy, which is induced by starvation and is essential for extension of the lifespan,(2-4) and hypothesized that ticks also have a system of autophagy to overcome the starved condition. Recently, we showed the existence of a homologue of an ATG gene, ATG12, and its expression pattern from nymphal to adult stages in a three-host tick, Haemaphysalis longicornis. The expression level of HlATG12 was downregulated at the beginning of feeding and was highest at 3 months after engorgement. In addition, the HlAtg12 protein was localized to the region around granule-like structures within midgut cells of unfed adults. These results indicate that HlATG12 functions during unfed stages. Here, a potential role of autophagy in unfed ticks is discussed with regard to reports in other animals, such as yeast, mammal, and fruit fly.

  14. On the search for markers of tick resistance in bovines.

    PubMed

    Regitano, L C A; Ibelli, A M G; Gasparin, G; Miyata, M; Azevedo, A L S; Coutinho, L L; Teodoro, R L; Machado, M A; Silva, M V G B; Nakata, L C; Zaros, L G; Sonstegard, T S; Silva, A M; Alencar, M M; Oliveira, M C S

    2008-01-01

    Genetic differences in susceptibility to ticks (Rhipicephalus (Boophilus) microplus) are considerable in bovines. Here, mapping, association and gene expression approaches were employed to further advance our understanding of the molecular basis of tick resistance. A B. taurus x B. indicus F2 population was developed by Embrapa and 382 individuals were measured for parasitic load. Scanning of all chromosomes is in progress. Quantitative trait loci (QTL) for tick load were mapped to chromosomes 4, 5, 7, 10, 14, 18 and 23 out of the 20 chromosomes scanned and were dependent on the season in which the phenotype was scored. In the candidate gene approach, females from the genetic groups Nelore (NE--184), Canchim x Nelore (CN--153), Aberdeen Angus x Nelore (AN--123) and Simmental x Nelore (SN--120) were evaluated under natural infestation. Microsatellite markers close to the genes for interleukin 2 (IL2), interleukin 4 (IL4) and interferon gamma (IFNG) were analysed. Tick counts were associated with the marker for interleukin 4 (P < 0.05) in three genetic groups. Differences in cytokine mRNA levels of naive versus infested Nelore calves as well as between resistant versus susceptible cows from NE, CN and AN genetic groups were also investigated. Comparison of cytokines from infested and naïve animals showed downregulation of IL2. When resistant cows were compared to susceptible animals, IL8 was downregulated. These results reinforce the multiloci nature of tick resistance and the need to consider QTL and environment interactions.

  15. Ticks parasitizing bats (Mammalia: Chiroptera) in the Caatinga Biome, Brazil.

    PubMed

    Luz, Hermes Ribeiro; Muñoz-Leal, Sebastián; Almeida, Juliana Cardoso de; Faccini, João Luiz Horacio; Labruna, Marcelo Bahia

    2016-01-01

    In this paper, the authors report ticks parasitizing bats from the Serra das Almas Natural Reserve (RPPN) located in the municipality of Crateús, state of Ceará, in the semiarid Caatinga biome of northeastern Brazil. The study was carried out during nine nights in the dry season (July 2012) and 10 nights in the rainy season (February 2013). Only bats of the Phyllostomidae and Mormoopidae families were parasitized by ticks. The species Artibeus planirostris and Carolia perspicillata were the most parasitized. A total of 409 larvae were collected and classified into three genera: Antricola (n = 1), Nothoaspis (n = 1) and Ornithodoros (n = 407). Four species were morphologically identified as Nothoaspis amazoniensis, Ornithodoros cavernicolous, Ornithodoros fonsecai, Ornithodoros hasei, and Ornithodoros marinkellei. Ornithodoros hasei was the most common tick associated with bats in the current study. The present study expand the distributional ranges of at least three soft ticks into the Caatinga biome, and highlight an unexpected richness of argasid ticks inhabiting this arid ecosystem.

  16. Francisella species in ticks and animals, Iberian Peninsula.

    PubMed

    Lopes de Carvalho, I; Toledo, A; Carvalho, C L; Barandika, J F; Respicio-Kingry, L B; Garcia-Amil, C; García-Pérez, A L; Olmeda, A S; Zé-Zé, L; Petersen, J M; Anda, P; Núncio, M S; Escudero, R

    2016-02-01

    The presence of Francisella species in 2134 ticks, 93 lagomorphs and 280 small mammals from the Iberian Peninsula was studied. Overall, 19 ticks and 6 lagomorphs were positive for Francisella tularensis subsp. holarctica, suggesting, as described for other regions, that lagomorphs may have an important role in the maintenance of F. tularensis in nature. Of the 6 positive lagomorphs, 4 were identified as the European rabbit, Oryctogalus cuniculus. Additionally, 353 ticks and 3 small mammals were PCR positive for Francisella-like endosymbionts (FLEs) and one small mammal was also positive for Francisella hispaniensis-like DNA sequences. Among FLE positive specimens, a variety of sequence types were detected: ticks were associated with 5 lpnA sequence types, with only one type identified per tick, in contrast to 2 lpnA sequence types detected in a single wood mouse (Apodemus sylvaticus). To our knowledge, this is the first report of FLEs in free-living small mammals as well as the first detection of F. hispaniensis-like sequences in a natural setting.

  17. Tick-borne infections in human and animal population worldwide.

    PubMed

    Brites-Neto, José; Duarte, Keila Maria Roncato; Martins, Thiago Fernandes

    2015-03-01

    The abundance and activity of ectoparasites and its hosts are affected by various abiotic factors, such as climate and other organisms (predators, pathogens and competitors) presenting thus multiples forms of association (obligate to facultative, permanent to intermittent and superficial to subcutaneous) developed during long co-evolving processes. Ticks are ectoparasites widespread globally and its eco epidemiology are closely related to the environmental conditions. They are obligatory hematophagous ectoparasites and responsible as vectors or reservoirs at the transmission of pathogenic fungi, protozoa, viruses, rickettsia and others bacteria during their feeding process on the hosts. Ticks constitute the second vector group that transmit the major number of pathogens to humans and play a role primary for animals in the process of diseases transmission. Many studies on bioecology of ticks, considering the information related to their population dynamics, to the host and the environment, comes possible the application and efficiency of tick control measures in the prevention programs of vector-borne diseases. In this review were considered some taxonomic, morphological, epidemiological and clinical fundamental aspects related to the tick-borne infections that affect human and animal populations.

  18. Tick-borne infections in human and animal population worldwide

    PubMed Central

    Brites-Neto, José; Duarte, Keila Maria Roncato; Martins, Thiago Fernandes

    2015-01-01

    The abundance and activity of ectoparasites and its hosts are affected by various abiotic factors, such as climate and other organisms (predators, pathogens and competitors) presenting thus multiples forms of association (obligate to facultative, permanent to intermittent and superficial to subcutaneous) developed during long co-evolving processes. Ticks are ectoparasites widespread globally and its eco epidemiology are closely related to the environmental conditions. They are obligatory hematophagous ectoparasites and responsible as vectors or reservoirs at the transmission of pathogenic fungi, protozoa, viruses, rickettsia and others bacteria during their feeding process on the hosts. Ticks constitute the second vector group that transmit the major number of pathogens to humans and play a role primary for animals in the process of diseases transmission. Many studies on bioecology of ticks, considering the information related to their population dynamics, to the host and the environment, comes possible the application and efficiency of tick control measures in the prevention programs of vector-borne diseases. In this review were considered some taxonomic, morphological, epidemiological and clinical fundamental aspects related to the tick-borne infections that affect human and animal populations. PMID:27047089

  19. Acquisition of exogenous haem is essential for tick reproduction

    PubMed Central

    Perner, Jan; Sobotka, Roman; Sima, Radek; Konvickova, Jitka; Sojka, Daniel; de Oliveira, Pedro Lagerblad; Hajdusek, Ondrej; Kopacek, Petr

    2016-01-01

    Haem and iron homeostasis in most eukaryotic cells is based on a balanced flux between haem biosynthesis and haem oxygenase-mediated degradation. Unlike most eukaryotes, ticks possess an incomplete haem biosynthetic pathway and, together with other (non-haematophagous) mites, lack a gene encoding haem oxygenase. We demonstrated, by membrane feeding, that ticks do not acquire bioavailable iron from haemoglobin-derived haem. However, ticks require dietary haemoglobin as an exogenous source of haem since, feeding with haemoglobin-depleted serum led to aborted embryogenesis. Supplementation of serum with haemoglobin fully restored egg fertility. Surprisingly, haemoglobin could be completely substituted by serum proteins for the provision of amino-acids in vitellogenesis. Acquired haem is distributed by haemolymph carrier protein(s) and sequestered by vitellins in the developing oocytes. This work extends, substantially, current knowledge of haem auxotrophy in ticks and underscores the importance of haem and iron metabolism as rational targets for anti-tick interventions. DOI: http://dx.doi.org/10.7554/eLife.12318.001 PMID:26949258

  20. Ticks infesting humans in Italy and associated pathogens

    PubMed Central

    2014-01-01

    Background Ticks may transmit a large variety of pathogens, which cause illnesses in animals and humans, commonly referred to as to tick-borne diseases (TBDs). The incidence of human TBDs in Italy is underestimated because of poor surveillance and the scant amount of studies available. Methods Samples (n = 561) were collected from humans in four main geographical areas of Italy (i.e., northwestern, northeastern, southern Italy, and Sicily), which represent a variety of environments. After being morphologically identified, ticks were molecularly tested with selected protocols for the presence of pathogens of the genera Rickettsia, Babesia, Theileria, Candidatus Neoehrlichia mikurensis, Borrelia and Anaplasma. Results Ticks belonged to 16 species of the genera Argas, Dermacentor, Haemaphysalis, Hyalomma, Ixodes and Rhipicephalus, with Ixodes ricinus (59.5%) being the species most frequently retrieved, followed by Rhipicephalus sanguineus sensu lato (21.4%). Nymphs were the life stage most frequently retrieved (41%), followed by adult females (34.6%). The overall positivity to any pathogen detected was 18%. Detected microorganisms were Rickettsia spp. (17.0%), Anaplasma phagocytophilum (0.8%), Borrelia afzelii (0.5%), Borrelia valaisiana (0.3%), C. N. mikurensis (0.5%) and Babesia venatorum (0.6%). Conclusions Results indicate that people living in the Italian peninsula are at risk of being bitten by different tick species, which may transmit a plethora of TBD causing pathogens and that co-infections may also occur. PMID:25023709

  1. Apparent tick paralysis by Rhipicephalus sanguineus (Acari: Ixodidae) in dogs.

    PubMed

    Otranto, Domenico; Dantas-Torres, Filipe; Tarallo, Viviana Domenica; Ramos, Rafael Antonio do Nascimento; Stanneck, Dorothee; Baneth, Gad; de Caprariis, Donato

    2012-09-10

    Certain tick species including Ixodes holocyclus can inoculate neurotoxins that induce a rapid, ascending flaccid paralysis in animals. Rhipicephalus sanguineus, the most widespread tick of dogs, is recognized as a vector of several pathogens causing diseases in dogs and humans. A single report suggests its role as cause of paralysis in dogs. This study presents the clinical history of 14 young dogs heavily infested by R. sanguineus (intensity of infestation, 63-328) in an endemic area of southern Italy. During May to June of 2011, dogs were presented at the clinical examination with neurological signs of different degrees (e.g., hind limb ataxia, generalized lethargy, and difficulty in movements). All animals were treated with acaricides and by manual tick removal but ten of them died within a day, displaying neurological signs. The other 4 dogs recovered within 3 days with acaricidal and supportive treatment. Twelve dogs were positive by blood smear examination for Hepatozoon canis with a high parasitemia, two also for Babesia vogeli and two were negative for hemoparasites. Low-grade thrombocytopenia, hypoalbuminemia, and pancytopenia were the haematological alterations most frequently recorded. Other causes of neurological disease in dogs were excluded and the diagnosis of tick paralysis by R. sanguineus was confirmed (ex juvantibus) by early and complete recovery of 4 dogs following acaricidal treatment and tick removal.

  2. Rickettsial infections in ticks from wild birds in Paraguay.

    PubMed

    Ogrzewalska, Maria; Literak, Ivan; Martins, Thiago F; Labruna, Marcelo B

    2014-03-01

    Ticks were collected from wild birds at 3 locations in Paraguay during the South American winter in August and September 2012. In total, 480 birds belonging to 106 species were examined. Overall, 31 (6.5%) birds representing 21 species were found parasitized by ticks which were identified as Amblyomma calcaratum Neumann (2 larvae, 20 nymphs), Amblyomma longirostre (Koch) (17 larvae, 3 nymphs), Amblyomma parvum Aragão (7 nymphs), Amblyomma aureolatum (Pallas) (1 nymph), Amblyomma ovale Koch (1 nymph), Amblyomma tigrinum Koch (1 larva), and Amblyomma spp. (4 larvae). Ticks collected accidentally on humans at the study locations during field work included 1 nymph of Amblyomma coelebs Neumann and 54 nymphs of Amblyomma cajennense (Fabricius). Most ticks were individually tested for the presence of Rickettsia species by polymerase chain reaction targeting rickettsial genes gltA and ompA and by amplicon sequencing. Two (12%) out of 17 A. longirostre larvae were found infected with Candidatus 'Rickettsia amblyommii', and 2 (33%) out of 6 A. parvum nymphs were infected with Candidatus 'Rickettsia andeanae'. This study provides the first report of rickettsial infections in Paraguayan ticks.

  3. Employee Perceived Training Effectiveness Relationship to Employee Attitudes

    ERIC Educational Resources Information Center

    Sahinidis, Alexandros G.; Bouris, John

    2008-01-01

    Purpose: The purpose of this study is to investigate the relationship between perceived employee training effectiveness and job satisfaction, motivation and commitment. Design/methodology/approach: The study examined the responses of 134 employees and lower managers, of five large Greek organizations, after they had completed a training program.…

  4. VIEW OF SITE EMPLOYEES CHECKINGIN IN THE CLOCK ROOM. EMPLOYEES ...

    Library of Congress Historic Buildings Survey, Historic Engineering Record, Historic Landscapes Survey

    VIEW OF SITE EMPLOYEES CHECKING-IN IN THE CLOCK ROOM. EMPLOYEES WERE REQUIRED TO HAVE A SEPARATE BADGE FOR EACH AREA OF THE SITE THAT THEY ENTERED. (7/31/67) - Rocky Flats Plant, Offices, Print Shop & Photography Lab, Northwest quad of plant near terminus of Central Avenue, Golden, Jefferson County, CO

  5. Introduction to Agricultural Business Unit. Student Reference for Agricultural Science I Core Curriculum. [Volume 19, Number 20.

    ERIC Educational Resources Information Center

    Timko, Joseph J.; Birkenholz, Robert J.

    This student reference on agricultural business, designed to accompany the lessons outlined in the 1984 instructor's guide, "Introduction to Agricultural Business," has seven lessons: (1) introduction to agribusiness; (2) careers in agribusiness; (3) agribusiness in the community; (4) the role of the employee in an agribusiness; (5)…

  6. Comparative population genetics of two invading ticks: Evidence of the ecological mechanisms underlying tick range expansions.

    PubMed

    Nadolny, Robyn; Gaff, Holly; Carlsson, Jens; Gauthier, David

    2015-10-01

    Two species of ixodid tick, Ixodes affinis Neumann and Amblyomma maculatum Koch, are simultaneously expanding their ranges throughout the mid-Atlantic region of the US. Although we have some understanding of the ecology and life history of these species, the ecological mechanisms governing where and how new populations establish and persist are unclear. To assess population connectivity and ancestry, we sequenced a fragment of the 16S mitochondrial rRNA gene from a representative sample of individuals of both species from populations throughout the eastern US. We found that despite overlapping host preferences throughout ontogeny, each species exhibited very different genetic and geographic patterns of population establishment and connectivity. I. affinis was of two distinct mitochondrial clades, with a clear geographic break separating northern and southern populations. Both I. affinis populations showed evidence of recent expansion, although the southern population was more genetically diverse, indicating a longer history of establishment. A. maculatum exhibited diverse haplotypes that showed no significant relationship with geographic patterns and little apparent connectivity between sites. Heteroplasmy was also observed in the 16S mitochondrial rRNA gene in 3.5% of A. maculatum individuals. Genetic evidence suggests that these species rely on different key life stages to successfully disperse into novel environments, and that host vagility, habitat stability and habitat connectivity all play critical roles in the establishment of new tick populations.

  7. Molecular differentiation of metastriate tick immatures.

    PubMed

    Anderson, Jennifer M; Ammerman, Nicole C; Norris, Douglas E

    2004-01-01

    Hard ticks, family Ixodidae, are divided into two groups, the Metastriata and the Prostriata, based on morphological differences. In the United States, there are four medically important genera of the Ixodidae: Ixodes, Amblyomma, Dermacentor, and Rhipicephalus. Ixodes is the only genus in and representative of the Prostriata, whereas the latter three genera are members of the Metastriata. All developmental stages of the Prostriata can be easily differentiated from the Metastriata using morphology. Similarly, the three Metastriate genera are highly identifiable as adults, yet as immatures, the discriminating characteristics can be difficult to use for differentiation, especially if the specimens are damaged or engorged with blood. All three Metastriate genera represent medically important vectors, thus accurate differentiation is necessary. To this end, we have developed a multiplexed-PCR diagnostic assay that, when combined with RFLP analysis will differentiate between the Metastriate genera--Amblyomma, Dermacentor, Rhipicephalus, and Haemaphysalis based on the length of the PCR amplicon and subsequent restriction digestion profile. The intended use for this diagnostic is to verify morphological identifications, especially of immatures, as well as to identify samples destroyed for molecular analysis, which will lead to more accurate field data as well as implication of vectors in disease transmission.

  8. Tick-borne encephalitis in eastern France.

    PubMed

    Hansmann, Yves; Pierre Gut, Jean; Remy, Veronique; Martinot, Martin; Allard Witz, Marie; Christmann, Daniel

    2006-01-01

    Each y a few cases of TBE infection are described in Alsace, France which lies at the occidental limit of the endemic zone of tick-borne encephalitis (TBE). Hence we carried out a retrospective epidemiological and clinical study of TBE infection in Alsace. Data were collected from serological results sent to the Institut de Virologie (Université Louis Pasteur) in Strasbourg. All samples positive for specific IgM against TBE were retained. The physician in charge of each patient was asked to provide clinical, epidemiological and biological data and with his agreement the medical file was referred to us. Since 1968, 64 cases of TBE infection, occurring between April and November, had been described. In 56% of cases, flu-like symptoms preceded neurological symptoms. Most patients had meningitis (54%) or meningoencephalitis (34%). There was no death due to TBE. Two areas were more highly endemic for the disease: the Guebwiller valley in low mountain country and the Neuhof forest, near Strasbourg in the plain of Alsace. In the last 2 y of the study, a third zone seemed to emerge, in the Munster valley. This epidemiological survey revealed the existence in Alsace of 2 endemic zones of TBE with a third zone possibly emerging in the last few y. The survey must be continued to follow the evolution of the disease.

  9. Impact of white-tailed deer and exotic ungulate populations on cattle fever tick outbreaks in South Texas

    Technology Transfer Automated Retrieval System (TEKTRAN)

    From 1907 when the fever tick eradication campaign began until 1933, the two tick eradication methods of either dipping cattle in an acaricide or “pasture vacation” were enormously successful in eradicating cattle ticks [CT, Rhipicephalus (Boophilus) annulatus (Say)] and southern cattle ticks [SCT, ...

  10. Ticks collected from migratory birds, including a new record of Haemaphysalis formosensis, on Jeju Island, Korea.

    PubMed

    Choi, Chang-Yong; Kang, Chang-Wan; Kim, Eun-Mi; Lee, Sang; Moon, Kyoung-Ha; Oh, Mi-Rae; Yamauchi, Takeo; Yun, Young-Min

    2014-04-01

    Migratory birds may disperse parasites across ecological barriers, and recent climate change may alter the pattern of ectoparasite dispersal via changed patterns of bird migration. In order to document the parasitization of migratory birds by Ixodidae ticks on Jeju Island in Korea, we examined 934 migratory birds comprising 75 species for ticks from 2010 to 2012. In total, 313 ticks were collected from 74 migratory birds across 17 avian species and identified based on morphological keys. These ticks represented six species: Haemaphysalis flava, H. formosensis, H. longicornis, H. concinna, Ixodes turdus and I. nipponensis. Of particular note was the presence of H. formosensis, a species not previously reported to have been found in Korea, and H. concinna, which had not been previously reported on Jeju Island. The dominant tick species found were H. flava (226 ticks, 72.2 %) and I. turdus (54 ticks, 17.3 %), and ground-dwelling thrushes such as Pale thrushes (Turdus pallidus; 39 birds, 52.7 %) were the most important hosts. Although H. longicornis is the most abundant and prevalent terrestrial tick on Jeju Island, the species accounted for only 3.8 % of the total ticks collected in this study, suggesting that ticks on migratory birds may differ from the local tick fauna and that exotic ticks may be introduced via migratory birds. Therefore, long-term programs for tick and tick-borne disease surveillance are recommended to understand the role of migratory animals in the introduction of exotic species and associated pathogens and in life cycles of ticks at different stages in this region.

  11. Tick pests and vectors (Acari: Ixodoidea) in European towns: Introduction, persistence and management.

    PubMed

    Uspensky, Igor

    2014-02-01

    Ticks have always been a part of fauna in and around human settlements, and their significance changed concurrently with the enlargement of settlements and their transformation into towns. The increased rate of urbanization during the last decades has created a new reality for tick existence. Two groups of ticks are of major concern for modern towns: those living under natural conditions of urban surroundings and those well-adapted to urban conditions. During the process of urbanization, encroachment into forested and uncultivated areas as well as protection of existing green spaces create opportunities for ticks living in nature to also exist under urban and suburban conditions. Conditions of modern urban and especially suburban environment in developed European countries adequately meet tick requirements. Tick species having an advantage in urban areas are those that can use one and the same host at all parasitic stages, can starve for a prolonged time, can use either urban pests or domesticated animals as hosts, and can live in man-made buildings. The ticks of the Argas reflexus group (Argasidae) and the brown dog tick Rhipicephalus sanguineus (Ixodidae) comply with practically all conditions necessary for successful survival in urban areas. The ability of ticks to transmit numerous human and animal pathogens and the presence of many reservoir hosts in urban and suburban areas create persistent danger for human populations and domestic animals. Impact on urban ticks should be directed against the two major requirements of tick existence: reducing populations of potential tick hosts (feral pigeons, stray dogs and cats, and urban rodents), and changing other environmental conditions to make them less suitable for ticks. It is especially important that urban inhabitants be properly informed about the danger posed by ticks, the sites of possible tick attacks, and basic self-protection techniques.

  12. Target validation of highly conserved Amblyomma americanum tick saliva serine protease inhibitor 19.

    PubMed

    Kim, Tae K; Radulovic, Zeljko; Mulenga, Albert

    2016-04-01

    Amblyomma americanum tick serine protease inhibitor (serpin, AAS) 19, is a highly conserved protein that is characterized by its functional domain being 100% conserved across tick species. We also reported that AAS19 was an immunogenic tick saliva protein with anti-haemostatic functions and an inhibitor of trypsin-like proteases including five of the eight serine protease factors in the blood clotting cascade. In this study the goal was to validate the importance of AAS19 in A. americanum tick physiology, assess immunogenicity and investigate tick vaccine efficacy of yeast-expressed recombinant (r) AAS19. We confirm that AAS19 is important to A. americanum fitness and blood meal feeding. AAS19 mRNA disruption by RNAi silencing caused ticks to obtain blood meals that were 50% smaller than controls, and treated ticks being morphologically deformed with 100% of the deformed ticks dying in incubation. We show that rAAS19 is highly immunogenic in that two 500 μg inoculations mixed with TiterMax Gold adjuvant provoked antibody titers of more than 1:320,000 that specifically reacted with native AAS19 in unfed and partially fed tick tissue. Since AAS19 is injected into animals during tick feeding, we challenge infested immunized rabbits twice to test if tick infestations of immunized rabbits could act as booster. While in the first infestation significantly smaller tick blood meals were observed on one of the two immunized rabbits, smaller blood meals were observed on both rabbits, but 60% of ticks that engorged on immunized rabbits in the second infestation failed to lay eggs. It is notable that ticks fed faster on immunized animals despite obtaining smaller blood meals. We conclude that rAAS19 is a potential component of cocktail tick vaccine.

  13. 25 CFR 700.549 - Employee organizations.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 25 Indians 2 2012-04-01 2012-04-01 false Employee organizations. 700.549 Section 700.549 Indians... Employee Responsibility and Conduct § 700.549 Employee organizations. An employee may not knowingly be a member of an organization of Government employees that advocates the overthrow of the United...

  14. 25 CFR 700.549 - Employee organizations.

    Code of Federal Regulations, 2011 CFR

    2011-04-01

    ... 25 Indians 2 2011-04-01 2011-04-01 false Employee organizations. 700.549 Section 700.549 Indians... Employee Responsibility and Conduct § 700.549 Employee organizations. An employee may not knowingly be a member of an organization of Government employees that advocates the overthrow of the United...

  15. 25 CFR 700.549 - Employee organizations.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 25 Indians 2 2013-04-01 2013-04-01 false Employee organizations. 700.549 Section 700.549 Indians... Employee Responsibility and Conduct § 700.549 Employee organizations. An employee may not knowingly be a member of an organization of Government employees that advocates the overthrow of the United...

  16. 25 CFR 700.549 - Employee organizations.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 25 Indians 2 2010-04-01 2010-04-01 false Employee organizations. 700.549 Section 700.549 Indians... Employee Responsibility and Conduct § 700.549 Employee organizations. An employee may not knowingly be a member of an organization of Government employees that advocates the overthrow of the United...

  17. 25 CFR 700.549 - Employee organizations.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ... 25 Indians 2 2014-04-01 2014-04-01 false Employee organizations. 700.549 Section 700.549 Indians... Employee Responsibility and Conduct § 700.549 Employee organizations. An employee may not knowingly be a member of an organization of Government employees that advocates the overthrow of the United...

  18. Motivating pharmacy employees.

    PubMed

    White, S J; Generali, J A

    1984-07-01

    Concepts from theories of motivation are used to suggest methods for improving the motivational environment of hospital pharmacy departments. Motivation--the state of being stimulated to take action to achieve a goal or to satisfy a need--comes from within individuals, but hospital pharmacy managers can facilitate motivation by structuring the work environment so that it satisfies employees' needs. Concepts from several theories of motivation are discussed, including McGregor's theory X and theory Y assumptions, Maslow's hierarchy of needs theory, Herzberg's motivation hygiene theory, and Massey's value system theory. Concepts from the Japanese style of management that can be used to facilitate motivation, such as quality circles, also are described. The autocratic, participative, and laissez faire styles of leadership are discussed in the context of the motivation theories, and suggested applications of theoretical concepts to practice are presented.

  19. Ethnoecological knowledge of ticks and treatment of tick-borne diseases among Maasai people in Northern Tanzania

    PubMed Central

    Kioko, John; Baker, Julia; Shannon, Avery; Kiffner, Christian

    2015-01-01

    Aim: The aim of this study was to understand traditional knowledge of tick ecology and remedies for tick-borne diseases (TBDs) among the Maasai people in northern Tanzania. Materials and Methods: Semi-structured interviews were conducted among specific groups likely to be knowledgeable about tick ecology and TBDs in livestock among the Maasai people. Results: A total of 25 plant species belonging to 18 families were used to treat 8 different TBDs of livestock. Most of the plant species used were of Fabaceae and Burseraceae families. Aloe volkensii, Cissus grandifolia, and Terminalia brownii were the most commonly used plant species. The major plant growth form used was trees, while stems and bark were the main plant parts used. Most treatments were taken orally. Conclusion: Maasai people have substantial knowledge on tick ecology exemplified by their ability to differentiate between different tick species and the range of remedies for each of the TBDs. Because traditional ethnoveterinary remedies are frequently utilized, their effectiveness should be further investigated. PMID:27065643

  20. Ticking All the Boxes? A Systematic Review of Education and Communication Interventions to Prevent Tick-Borne Disease

    PubMed Central

    Amlôt, Richard; Rubin, G. James

    2012-01-01

    Abstract Tick-borne disease has become increasingly prevalent across Europe. Despite the effectiveness of protective behaviors, relatively few people adopt them when in areas where ticks are known to be present. In this systematic review we identified studies that assessed the impact of any educational or behavioral interventions intended to encourage the widespread use of protective behaviors against tick-borne disease. An extensive search of electronic databases returned a total of only nine such studies. Only two of these were fully randomized controlled trials, with the remaining studies using weaker designs and often relying solely on self-reports to assess behavior. The majority of research in this area has not explicitly noted the consideration of any formal psychological theory on how best to promote behaviors that protect health. Nonetheless, the results show that both knowledge of and attitudes towards tick-borne disease are amenable to change, although the stability of these changes over time has not yet been determined. Not all intervention strategies have proved effective, with some producing detrimental effects. More theory-based, methodologically-robust studies are urgently required if we are to gain a better understanding of the most effective strategies for encouraging members of the public to adopt behaviors known to protect against tick-borne disease. PMID:22607072