Science.gov

Sample records for agriculture employees tick

  1. 28 CFR 0.64-3 - Delegation respecting designation of certain Department of Agriculture employees (Tick Inspectors...

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... certain Department of Agriculture employees (Tick Inspectors) to carry and use firearms. 0.64-3 Section 0... Division § 0.64-3 Delegation respecting designation of certain Department of Agriculture employees (Tick... 7, U.S. Code, concerning the designation of certain Department of Agriculture employees...

  2. 28 CFR 0.64-3 - Delegation respecting designation of certain Department of Agriculture employees (Tick Inspectors...

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... certain Department of Agriculture employees (Tick Inspectors) to carry and use firearms. 0.64-3 Section 0... Inspectors) to carry and use firearms. The Assistant Attorney General in charge of the Criminal Division is... Inspectors) to carry and use firearms. This delegation includes the power and authority to issue, with...

  3. 28 CFR 0.64-3 - Delegation respecting designation of certain Department of Agriculture employees (Tick Inspectors...

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... certain Department of Agriculture employees (Tick Inspectors) to carry and use firearms. 0.64-3 Section 0... Inspectors) to carry and use firearms. The Assistant Attorney General in charge of the Criminal Division is... Inspectors) to carry and use firearms. This delegation includes the power and authority to issue, with...

  4. 28 CFR 0.64-3 - Delegation respecting designation of certain Department of Agriculture employees (Tick Inspectors...

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... certain Department of Agriculture employees (Tick Inspectors) to carry and use firearms. 0.64-3 Section 0... Inspectors) to carry and use firearms. The Assistant Attorney General in charge of the Criminal Division is... Inspectors) to carry and use firearms. This delegation includes the power and authority to issue, with...

  5. 28 CFR 0.64-3 - Delegation respecting designation of certain Department of Agriculture employees (Tick Inspectors...

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Delegation respecting designation of certain Department of Agriculture employees (Tick Inspectors) to carry and use firearms. 0.64-3 Section 0.64-3 Judicial Administration DEPARTMENT OF JUSTICE ORGANIZATION OF THE DEPARTMENT OF JUSTICE Criminal Division § 0.64-3 Delegation...

  6. Milk Processing Plant Employee. Agricultural Cooperative Training. Vocational Agriculture.

    ERIC Educational Resources Information Center

    Blaschke, Nolan; Page, Foy

    This course of study is designed for the vocational agricultural student enrolled in an agricultural cooperative part-time training program in the area of milk processing occupations. The course consists of 11 units, each with 4 to 13 individual topics that milk processing plant employees should know. Subjects covered by the units are the…

  7. Crop Farm Employee. Agricultural Cooperative Training. Vocational Agriculture. Revised.

    ERIC Educational Resources Information Center

    Boyd, Chester; And Others

    Designed for students enrolled in the Vocational Agricultural Cooperative Part-Time Training Program, this course of study contains 13 units for crop farm employees. Units include (examples of unit topics in parentheses): introduction (opportunities in farming, farming as a science, and farming in the United States), farm records (keeping farm…

  8. Ticks

    USGS Publications Warehouse

    Ginsberg, H.S.; Faulde, M.K.

    2008-01-01

    The most common vector-borne diseases in both Europe and North America are transmitted by ticks. Lyme borreliosis (LB), a tick-borne bacterial zoonosis, is the most highly prevalent. Other important tick-borne diseases include TBE (tick-borne encephalitis) and Crimean-Congo haemorrhagic fever in Europe, Rocky Mountain spotted fever (RMSF) in North America, and numerous less common tick-borne bacterial, viral, and protozoan diseases on both continents. The major etiological agent of LB is Borrelia burgdorferi in North America, while in Europe several related species of Borrelia can also cause human illness. These Borrelia genospecies differ in clinical manifestations, ecology (for example, some have primarily avian and others primarily mammalian reservoirs), and transmission cycles, so the epizootiology of LB is more complex in Europe than in North America. Ticks dwell predominantly in woodlands and meadows, and in association with animal hosts, with only limited colonization of human dwellings by a few species. Therefore, suburbanization has contributed substantially to the increase in tick-borne disease transmission in North America by fostering increased exposure of humans to tick habitat. The current trend toward suburbanization in Europe could potentially result in similar increases in transmission of tick-borne diseases. Incidence of tick-borne diseases can be lowered by active public education campaigns, targeted at the times and places of greatest potential for encounter between humans and infected ticks. Similarly, vaccines (e.g., against TBE) are most effective when made available to people at greatest risk, and for high-prevalence diseases such as LB. Consultation with vector-borne disease experts during the planning stages of new human developments can minimize the potential for residents to encounter infected ticks (e.g., by appropriate dwelling and landscape design). Furthermore, research on tick vectors, pathogens, transmission ecology, and on

  9. The effect of changes in agricultural practices on the density of Dermacentor reticulatus ticks.

    PubMed

    Mierzejewska, Ewa J; Alsarraf, Mohammed; Behnke, Jerzy M; Bajer, Anna

    2015-07-30

    The impact of agricultural practices/ activities on the environment has been falling in many areas of Europe due to the widespread exodus of inhabitants from rural areas. The associated abandonment of agricultural lands has enabled a wide range of wild animals to prosper in the countryside, including birds, ungulates and large carnivores. One consequence has been the increase in ticks and associated tick-borne diseases which now constitute a greater threat for public health than earlier. The aim of the present study was to compare tick densities in different habitats (pasture, meadow, fallow land, post-fire areas) to assess the impact of different agricultural practices on tick densities in vicinities close to human habitation. Between September 2011 and June 2014, 2985 Dermacentor reticulatus ticks were collected by conventional dragging, in the Mazowieckie (Mazovia) and Warmińsko-Mazurskie (Masuria) regions of Poland. In each region, 3 study sites were selected, each situated near surface water sources (i.e., ponds or canals). At each site, three neighboring habitats of surface area 150-600 m(2) were dragged: one on a cattle/horse pasture; the second on meadow; the third on fallow land (abandoned field or meadow), at least twice during each spring and autumn. Additionally, four post-fire areas (one in 2013 and three in 2014) were identified in the Mazowieckie region, and dragging was conducted there in spring and autumn, including in each case a 'control area' comprising intact unburned fallow land situated in close vicinity to the burned areas. Eight hundred D. reticulatus ticks were collected and the densities were compared by multifactorial ANOVA. The highest tick densities were recorded on the fallow lands, and the lowest - on the grazed pastures. Tick densities were up to 10 × times higher on the control sites compared to neighboring post-fire sites. PMID:26073110

  10. The United States Department Of Agriculture Northeast Area-wide Tick Control Project: history and protocol.

    PubMed

    Pound, Joe Mathews; Miller, John Allen; George, John E; Fish, Durland

    2009-08-01

    The Northeast Area-wide Tick Control Project (NEATCP) was funded by the United States Department of Agriculture (USDA) as a large-scale cooperative demonstration project of the USDA-Agricultural Research Service (ARS)-patented 4-Poster tick control technology (Pound et al. 1994) involving the USDA-ARS and a consortium of universities, state agencies, and a consulting firm at research locations in the five states of Connecticut (CT), Maryland (MD), New Jersey (NJ), New York (NY), and Rhode Island (RI). The stated objective of the project was "A community-based field trial of ARS-patented tick control technology designed to reduce the risk of Lyme disease in northeastern states." Here we relate the rationale and history of the technology, a chronological listing of events leading to implementation of the project, the original protocol for selecting treatment, and control sites, and protocols for deployment of treatments, sampling, assays, data analyses, and estimates of efficacy.

  11. Seasonal analysis of Rickettsia species in ticks in an agricultural site of Slovakia.

    PubMed

    Špitalská, Eva; Stanko, Michal; Mošanský, Ladislav; Kraljik, Jasna; Miklisová, Dana; Mahríková, Lenka; Bona, Martin; Kazimírová, Mária

    2016-03-01

    Many rickettsiae of the spotted fever group are emerging pathogens causing serious diseases associated with vertebrate hosts. Ixodidae ticks are known as their vectors. Investigation of the relative abundance of questing Ixodes ricinus and their infection with Rickettsia spp. in an agricultural site comprising a game reserve in Slovakia was the aim of this study. In total, 2198 I. ricinus (492 larvae, 1503 nymphs and 203 adults) were collected by flagging the vegetation along 100 m(2) transects in Rozhanovce (eastern Slovakia): 334, 595 and 1269 in 2011, 2012 and 2013, respectively. Considering questing nymphs and adults, the highest relative density of 81 individuals/100 m(2) was observed in May 2013, the lowest of 0.3 individuals/100 m(2) in March 2012. A total of 1056 ticks (853 nymphs, 100 females and 103 males; 2011: n = 329, 2012: n = 509 and 2013: n = 218) were individually screened by PCR-based methods for the presence of Rickettsia spp. The overall prevalences were 7.3% for nymphs, 15% for females, 7.8% for males; 7.0% in 2011, 8.4% in 2012, and 8.7% in 2013. The maximum prevalences were observed in July in nymphs and in May in adults. Sequencing showed infection with R. helvetica in 73 ticks (72.6% nymphs, 16.4% females, 11% males) and with R. monacensis in 11 ticks (8 nymphs, 3 females). The results showed the circulation of pathogenic Rickettsia species in the agricultural site and a potential risk for humans to encounter infected ticks.

  12. 29 CFR 780.511 - Meaning of “agricultural employee.”

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... characterize him as a person who engages in them as an occupation. Isolated or sporadic instances of engagement... “agricultural employee.” His engagement in agriculture should be sufficiently substantial to demonstrate...

  13. 29 CFR 780.510 - “Any agricultural employee.”

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... Agricultural Employees in Processing Shade-Grown Tobacco; Exemption From Minimum Wage and Overtime Pay... 29 Labor 3 2014-07-01 2014-07-01 false âAny agricultural employee.â 780.510 Section 780.510 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR STATEMENTS OF...

  14. 29 CFR 780.510 - “Any agricultural employee.”

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... Agricultural Employees in Processing Shade-Grown Tobacco; Exemption From Minimum Wage and Overtime Pay... 29 Labor 3 2012-07-01 2012-07-01 false âAny agricultural employee.â 780.510 Section 780.510 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR STATEMENTS OF...

  15. 29 CFR 780.510 - “Any agricultural employee.”

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... Agricultural Employees in Processing Shade-Grown Tobacco; Exemption From Minimum Wage and Overtime Pay... 29 Labor 3 2011-07-01 2011-07-01 false âAny agricultural employee.â 780.510 Section 780.510 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR STATEMENTS OF...

  16. 29 CFR 780.510 - “Any agricultural employee.”

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... Agricultural Employees in Processing Shade-Grown Tobacco; Exemption From Minimum Wage and Overtime Pay... 29 Labor 3 2010-07-01 2010-07-01 false âAny agricultural employee.â 780.510 Section 780.510 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR STATEMENTS OF...

  17. 29 CFR 780.510 - “Any agricultural employee.”

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... Agricultural Employees in Processing Shade-Grown Tobacco; Exemption From Minimum Wage and Overtime Pay... 29 Labor 3 2013-07-01 2013-07-01 false âAny agricultural employee.â 780.510 Section 780.510 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR STATEMENTS OF...

  18. 29 CFR 780.511 - Meaning of “agricultural employee.”

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... 29 Labor 3 2014-07-01 2014-07-01 false Meaning of âagricultural employee.â 780.511 Section 780.511... Overtime Pay Requirements Under Section 13(a)(14) Shade-Grown Tobacco § 780.511 Meaning of “agricultural... dedication to agricultural work as a means of livelihood....

  19. 29 CFR 780.511 - Meaning of “agricultural employee.”

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... 29 Labor 3 2013-07-01 2013-07-01 false Meaning of âagricultural employee.â 780.511 Section 780.511... Overtime Pay Requirements Under Section 13(a)(14) Shade-Grown Tobacco § 780.511 Meaning of “agricultural... dedication to agricultural work as a means of livelihood....

  20. 29 CFR 780.511 - Meaning of “agricultural employee.”

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... 29 Labor 3 2012-07-01 2012-07-01 false Meaning of âagricultural employee.â 780.511 Section 780.511... Overtime Pay Requirements Under Section 13(a)(14) Shade-Grown Tobacco § 780.511 Meaning of “agricultural... dedication to agricultural work as a means of livelihood....

  1. 29 CFR 780.511 - Meaning of “agricultural employee.”

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... 29 Labor 3 2011-07-01 2011-07-01 false Meaning of âagricultural employee.â 780.511 Section 780.511... Overtime Pay Requirements Under Section 13(a)(14) Shade-Grown Tobacco § 780.511 Meaning of “agricultural... dedication to agricultural work as a means of livelihood....

  2. Tick Paralysis

    MedlinePlus

    ... Borrelia myamotoi Infections Colorado Tick Fever Ehrlichiosis Rocky Mountain Spotted Fever Southern Tick Associated Rash Illness (STARI) ... Infections Colorado Tick Fever Ehrlichiosis Lyme Disease Rocky Mountain Spotted Fever Southern Tick Associated Rash Illness (STARI) ...

  3. Avoiding Ticks

    MedlinePlus

    ... Avoiding ticks On people On pets In the yard Removing a tick Symptoms of tickborne illness Geographic ... ticks on your pets Preventing ticks in the yard File Formats Help: How do I view different ...

  4. Tick removal.

    PubMed

    Roupakias, S; Mitsakou, P; Nimer, A Al

    2011-03-01

    Ticks are blood feeding external parasites which can cause local and systemic complications to human body. A lot of tick-borne human diseases include Lyme disease and virus encephalitis, can be transmitted by a tick bite. Also secondary bacterial skin infection, reactive manifestations against tick allergens, and granuloma's formation can be occurred. Tick paralysis is a relatively rare complication but it can be fatal. Except the general rules for tick bite prevention, any tick found should be immediately and completely removed alive. Furthermore, the tick removal technique should not allow or provoke the escape of infective body fluids through the tick into the wound site, and disclose any local complication. Many methods of tick removal (a lot of them are unsatisfactory and/or dangerous) have been reported in the literature, but there is very limited experimental evidence to support these methods. No technique will remove completely every tick. So, there is not an appropriate and absolutely effective and/or safe tick removal technique. Regardless of the used tick removal technique, clinicians should be aware of the clinical signs of tick-transmitted diseases, the public should be informed about the risks and the prevention of tick borne diseases, and persons who have undergone tick removal should be monitored up to 30 days for signs and symptoms. PMID:21710824

  5. Tick Bites

    MedlinePlus

    ... Ticks are small bloodsucking parasites. Many species transmit diseases to animals and people. Some of the diseases you can get from a tick bite are Lyme disease, ehrlichiosis, Rocky Mountain spotted fever and tularemia. Some ...

  6. 29 CFR 516.33 - Employees employed in agriculture pursuant to section 13(a)(6) or 13(b)(12) of the Act.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... 29 Labor 3 2011-07-01 2011-07-01 false Employees employed in agriculture pursuant to section 13(a....33 Employees employed in agriculture pursuant to section 13(a)(6) or 13(b)(12) of the Act. (a) No... the number of weeks employed in agriculture during the preceding calendar year. (e) With respect...

  7. 29 CFR 516.33 - Employees employed in agriculture pursuant to section 13(a)(6) or 13(b)(12) of the Act.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... 29 Labor 3 2013-07-01 2013-07-01 false Employees employed in agriculture pursuant to section 13(a....33 Employees employed in agriculture pursuant to section 13(a)(6) or 13(b)(12) of the Act. (a) No... the number of weeks employed in agriculture during the preceding calendar year. (e) With respect...

  8. 29 CFR 516.33 - Employees employed in agriculture pursuant to section 13(a)(6) or 13(b)(12) of the Act.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... 29 Labor 3 2012-07-01 2012-07-01 false Employees employed in agriculture pursuant to section 13(a....33 Employees employed in agriculture pursuant to section 13(a)(6) or 13(b)(12) of the Act. (a) No... the number of weeks employed in agriculture during the preceding calendar year. (e) With respect...

  9. Employees.

    ERIC Educational Resources Information Center

    Beckham, Joseph C.

    This chapter examines cases reported during 1981 concerning school employees. In the format used, federal questions are addressed first, then issues associated with state laws. The author deals with cases in the areas of discrimination in employment, substantive constitutional rights of speech and association and privacy, and procedural due…

  10. Employees.

    ERIC Educational Resources Information Center

    Beckham, Joseph C.

    Decisions made by federal and state courts during 1983 concerning the employment, dismissal, and tenuring of the employees of public agencies--in particular, public schools--are reported in this chapter. The chapter first addresses discrimination in employment based on race, sex, age, or physical limitations and notes that the shifting burden of…

  11. Employees.

    ERIC Educational Resources Information Center

    Nordin, Virginia Davis

    Cases involving employment interests of teachers, administrators, and other school employees generally continue trends set in earlier years. Discrimination considerations continue to play an important role. One area in which the courts might be said to intervene somewhat more than in others is the prevention and remediation of race discrimination.…

  12. Employees.

    ERIC Educational Resources Information Center

    Biggs, Thomas S., Jr.

    In 1979 judicial activity continued to add to the body of law available relative to relationships between universities and colleges and their employees. Cases touched on the nature of the contract when an offer of employment has been made and accepted, benefits and working conditions, and termination and the procedural safeguards involved.…

  13. Tick paralysis.

    PubMed

    Pecina, Cara Ann

    2012-11-01

    Tick paralysis is a rare, but readily treatable condition that if missed can lead to significant morbidity and death. The classic clinical presentation of tick paralysis is the development of an unsteady, ataxic type gait followed by an acute symmetric ascending flaccid paralysis. Symptoms generally begin within 2 to 6 days of tick attachment. If the tick continues to feed, the weakness ascends to the upper extremities over a matter of hours, followed by cranial nerve involvement. Due to the similarity in its presentation, tick paralysis is often misdiagnosed as Guillain-Barré's syndrome, particularly the Miller Fisher's subtype, given its cranial nerve involvement. However, the weakness seen in tick paralysis progresses more quickly than what is generally seen in Guillain-Barré's syndrome and the protein concentration is not elevated in the cerebrospinal fluid. The mainstay of treatment for tick paralysis is tick removal. The time to full neurologic recovery after tick removal is estimated to be around 1.5 days with initial improvement generally within hours. PMID:23677663

  14. Tick bite

    MedlinePlus

    ... carry bacteria that can cause: Colorado tick fever Lyme disease Rocky Mountain spotted fever Tularemia These and other ... given to people who live in areas where Lyme disease is common. The person may receive: Blood and ...

  15. Career Preparation Programs for Potential Agribusinessmen, Agricultural Agency Employees, and Agricultural Instructors. Final Report. July 1, 1976-June 30, 1977.

    ERIC Educational Resources Information Center

    Mississippi State Univ., State College. Dept. of Agricultural Education.

    The purpose of the project was to develop innovative agricultural education programs within the comprehensive high school setting in selected school districts in the state of Mississippi, with the project's second year (described here) focusing on continuing existing specialized career preparation program in agriculture and continuing to orient…

  16. 75 FR 51369 - Supplemental Standards of Ethical Conduct for Employees of the Department of Agriculture...

    Federal Register 2010, 2011, 2012, 2013, 2014

    2010-08-20

    ... flexibility and fairness while raising the level of decision-making visibility and accountability. Requiring... establishing supplemental standards of ethical conduct for employees of USDA (65 FR 58635-40, October 2, 2000... affiliate is affected by decisions of the particular RD office in which the RD employee serves....

  17. 29 CFR 516.33 - Employees employed in agriculture pursuant to section 13(a)(6) or 13(b)(12) of the Act.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... 29 Labor 3 2010-07-01 2010-07-01 false Employees employed in agriculture pursuant to section 13(a)(6) or 13(b)(12) of the Act. 516.33 Section 516.33 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR REGULATIONS RECORDS TO BE KEPT BY EMPLOYERS Records Pertaining to Employees Subject to...

  18. Tick paralysis

    MedlinePlus

    ... away. Breathing difficulties require emergency care. Prevention Use insect repellents and protective clothing when in tick-infested areas. ... chap 298. Read More Botulism Guillain-Barré syndrome Insect bites and stings Movement - uncoordinated Muscle function loss Poisoning - fish and ...

  19. Tick Bites, First Aid

    MedlinePlus

    ... rashes clinical tools newsletter | contact Share | Tick Bites, First Aid A A A It is important to inspect ... temporary paralysis in their host (called tick paralysis). First Aid Guide To remove an embedded tick: Wash your ...

  20. The ecology of ticks and epidemiology of tick-borne viral diseases.

    PubMed

    Estrada-Peña, Agustín; de la Fuente, José

    2014-08-01

    A number of tick-borne diseases of humans have increased in incidence and geographic range over the past few decades, and there is concern that they will pose an even greater threat to public health in future. Although global warming is often cited as the underlying mechanism favoring the spread of tick-borne diseases, climate is just one of many factors that determine which tick species are found in a given geographic region, their population density, the likelihood that they will be infected with microbes pathogenic for humans and the frequency of tick-human contact. This article provides basic information needed for microbiologists to understand the many factors that affect the geographic range and population density of ticks and the risk of human exposure to infected ticks. It first briefly summarizes the life cycle and basic ecology of ticks and how ticks and vertebrate hosts interact, then reviews current understanding of the role of climate, sociodemographic factors, agricultural development and changes in human behavior that affect the incidence of tick-borne diseases. These concepts are then illustrated in specific discussions of tick-borne encephalitis and Crimean-Congo hemorrhagic fever.

  1. Estimated risk of death among employees in agriculture and agriculture-related industries in Georgia, 1985-1994.

    PubMed

    Tedders, Stuart H; Jobin, Tracy L; Vogel, Robert L; Dever, G E A

    2003-01-01

    Farming has an enormous impact on the economy of Georgia, with as many as one in six Georgians working in agriculture. The purpose of this study was to compare the risk of death of white and black farmers to non-farmers in Georgia. Mortality data stratified by age and aggregated by race were retrieved from the Georgia Office of Vital Statistics for the years 1985-1994. The classification system used to code occupation on the death certificate was W473-489, which includes farmers and most all other agricultural occupations. For each cause of death, the Breslow-Day Test was used to determine homogeneity of risk across all age strata (alpha=0.05). A common odds ratio (OR) and 95% confidence intervals were calculated for all homogeneous causes of death using the Mantel-Haenzel procedure. Among white farmers, the risk of death was significantly high for tuberculosis [OR=1.64 (1.01, 2.65)], fires [OR=1.60 (1.15, 2.22)], and accidental drowning [OR=1.52 (1.01, 2.28)]. The leading causes of death among black farmers were accidental drowning [OR=1.53 (1.03, 2.26)], cerebrovascular disease [OR=1.27 (1.18, 1.38)], and ischemic heart disease [OR=1.21 (1.14, 1.29)]. Causes of death reported to be significantly low were also investigated. The findings of this study are varied, but trends related to risk of death appear to be similar to observed national trends.

  2. Tick (Amblyomma chabaudi) infestation of endemic tortoises in southwest Madagascar and investigation of tick-borne pathogens.

    PubMed

    Ehlers, Julian; Ganzhorn, Jörg U; Silaghi, Cornelia; Krüger, Andreas; Pothmann, Daniela; Ratovonamana, R Yedidya; Veit, Alexandra; Keller, Christian; Poppert, Sven

    2016-03-01

    Little is known about the role of endemic ticks as vectors for bacterial and protozoan pathogens for animals and humans in Madagascar and their interaction in anthropogenic habitats where humans, their livestock and native Malagasy species (vectors and hosts) come into more frequent contact than in natural forest ecosystems. The aims of the study were (1) to test whether habitat degradation is associated with increased infestation of tortoises by ticks and (2) to investigate whether ticks carried Babesia, Borrelia or Rickettsia species that might be pathogenic for humans and livestock. We studied hard ticks of two endemic Malagasy tortoises, Astrochelys radiata and Pyxis arachnoides in March and April 2013 in southwest Madagascar. Two tortoise habitats were compared, the National Park of Tsimanampetsotsa and the adjacent degraded pasture and agricultural land at the end of the wet season. Ticks were screened for protozoan and bacterial pathogens via PCR on DNA isolated from ticks using genus-specific primers. Only one out of 42 A. radiata collected from both habitats had ticks. The low prevalence did not allow further analyses of the effect of habitat degradation. Forty-two P. arachnoides were found in the anthropogenic habitat and 36 individuals in the national park. Tick infestation rates of P. arachnoides differed significantly between the two study sites. Tortoises inside the park had lower tick prevalence than outside (8 of 36 (22%) versus 32 of 42 individuals (76%)) and infected animals tended to have fewer ticks inside than outside the park. All ticks collected in both habitats were adults of the ixodid tick Amblyomma chabaudi, which is supposed to be a host-specific tick of P. arachnoides. Screening for Borrelia sp. and Babesia sp. was negative in all ticks. But all A. chabaudi ticks were infected with Rickettsia africae, known to cause spotted fever in humans. Thus, habitat degradation seems to be linked to higher infestation of tortoises with ticks with

  3. Risk of tick-borne diseases in various categories of employment among forestry workers in eastern Poland.

    PubMed

    Cisak, Ewa; Zając, Violetta; Wójcik-Fatla, Angelina; Dutkiewicz, Jacek

    2012-01-01

    Among the zoonotic agents causing occupational diseases, those transmitted by ticks are very important, in particular the spirochetes Borrelia burgdorferi which are the common cause of occupational Lyme borreliosis in forestry and agricultural workers. The objective of this study was an evaluation of the exposure of forestry workers employed at individual workplaces to infection with tick-borne pathogens (especially Borrelia burgdorferi spirochetes), based on epidemiological investigation and serologic tests. Epidemiological studies covered 111 forestry employees from eastern Poland employed in 4 randomly-selected forest inspectorates which replied to questions in the area of epidemiology and prophylaxis of diseases transmitted by ticks. Eighty-two forestry workers employed in one forest inspectorate were examined for the presence of specific anti-Borrelia burgdorferi antibodies. The correlation between individual items of the questionnaire was assessed by Spearman's test. Results of serological tests were assessed by Mann-Whitney test. Statistical analysis of the results indicated that the workers performing manual jobs in the forest are at the greatest risk of tick bite and contraction of tick-borne disease. They are aware of the risk, but use the improper method of removal of ticks with the fingers. Comparisons of the relationship between job category and the results of serologic study, expressed in BBU/ml, revealed that the serologic response was significantly greater in manual workers than in administrative workers (p=0.019). All other comparisons did not produce significant results. Therefore, providing a simple tweezer-like device to forest inspectorates seems to be an effective mean of protection against Lyme borreliosis and other tick-borne diseases. PMID:23020041

  4. Risk of tick-borne diseases in various categories of employment among forestry workers in eastern Poland.

    PubMed

    Cisak, Ewa; Zając, Violetta; Wójcik-Fatla, Angelina; Dutkiewicz, Jacek

    2012-01-01

    Among the zoonotic agents causing occupational diseases, those transmitted by ticks are very important, in particular the spirochetes Borrelia burgdorferi which are the common cause of occupational Lyme borreliosis in forestry and agricultural workers. The objective of this study was an evaluation of the exposure of forestry workers employed at individual workplaces to infection with tick-borne pathogens (especially Borrelia burgdorferi spirochetes), based on epidemiological investigation and serologic tests. Epidemiological studies covered 111 forestry employees from eastern Poland employed in 4 randomly-selected forest inspectorates which replied to questions in the area of epidemiology and prophylaxis of diseases transmitted by ticks. Eighty-two forestry workers employed in one forest inspectorate were examined for the presence of specific anti-Borrelia burgdorferi antibodies. The correlation between individual items of the questionnaire was assessed by Spearman's test. Results of serological tests were assessed by Mann-Whitney test. Statistical analysis of the results indicated that the workers performing manual jobs in the forest are at the greatest risk of tick bite and contraction of tick-borne disease. They are aware of the risk, but use the improper method of removal of ticks with the fingers. Comparisons of the relationship between job category and the results of serologic study, expressed in BBU/ml, revealed that the serologic response was significantly greater in manual workers than in administrative workers (p=0.019). All other comparisons did not produce significant results. Therefore, providing a simple tweezer-like device to forest inspectorates seems to be an effective mean of protection against Lyme borreliosis and other tick-borne diseases.

  5. DEET, Showers, and Tick Checks Can Stop Ticks

    MedlinePlus

    ... and bringing ticks with them. Prevent Ticks on Animals Use tick control products to prevent family pets ... medications should be used regularly to protect your animals and your family from ticks. Consult your veterinarian ...

  6. Are ticks venomous animals?

    PubMed Central

    2014-01-01

    Introduction As an ecological adaptation venoms have evolved independently in several species of Metazoa. As haematophagous arthropods ticks are mainly considered as ectoparasites due to directly feeding on the skin of animal hosts. Ticks are of major importance since they serve as vectors for several diseases affecting humans and livestock animals. Ticks are rarely considered as venomous animals despite that tick saliva contains several protein families present in venomous taxa and that many Ixodida genera can induce paralysis and other types of toxicoses. Tick saliva was previously proposed as a special kind of venom since tick venom is used for blood feeding that counteracts host defense mechanisms. As a result, the present study provides evidence to reconsider the venomous properties of tick saliva. Results Based on our extensive literature mining and in silico research, we demonstrate that ticks share several similarities with other venomous taxa. Many tick salivary protein families and their previously described functions are homologous to proteins found in scorpion, spider, snake, platypus and bee venoms. This infers that there is a structural and functional convergence between several molecular components in tick saliva and the venoms from other recognized venomous taxa. We also highlight the fact that the immune response against tick saliva and venoms (from recognized venomous taxa) are both dominated by an allergic immunity background. Furthermore, by comparing the major molecular components of human saliva, as an example of a non-venomous animal, with that of ticks we find evidence that ticks resemble more venomous than non-venomous animals. Finally, we introduce our considerations regarding the evolution of venoms in Arachnida. Conclusions Taking into account the composition of tick saliva, the venomous functions that ticks have while interacting with their hosts, and the distinguishable differences between human (non-venomous) and tick salivary

  7. Deer ticks (image)

    MedlinePlus

    Diseases are often carried by ticks, including Rocky Mountain Spotted Fever, Colorado Tick Fever, Lyme disease, and tularemia. Less common or less frequent diseases include typhus, Q-fever, relapsing fever, viral encephalitis, ...

  8. Ticks: Geographic Distribution

    MedlinePlus

    ... Atlas. Download this map [PDF - 1 page] Lone star tick ( Amblyomma americanum ) Where found: Widely distributed in ... is distinguished by a white dot or “lone star” on her back. Lone star tick saliva can ...

  9. Tick-borne protozoa

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Tick-borne protozoa impose a significant health burden on humans and animals throughout the world. The virulence of tick-borne protozoa, and the geographic distribution of their tick vectors and vertebrate hosts remain in flux as they adapt to changing environmental and climatic conditions. Babesios...

  10. Biological control of ticks

    USGS Publications Warehouse

    Samish, M.; Ginsberg, H.; Glazer, I.; Bowman, A.S.; Nuttall, P.

    2004-01-01

    Ticks have numerous natural enemies, but only a few species have been evaluated as tick biocontrol agents (BCAs). Some laboratory results suggest that several bacteria are pathogenic to ticks, but their mode of action and their potential value as biocontrol agents remain to be determined. The most promising entomopathogenic fungi appear to be Metarhizium anisopliae and Beauveria bassiana, strains of which are already commercially available for the control of some pests. Development of effective formulations is critical for tick management. Entomopathogenic nematodes that are pathogenic to ticks can potentially control ticks, but improved formulations and selection of novel nematode strains are needed. Parasitoid wasps of the genus Ixodiphagus do not typically control ticks under natural conditions, but inundative releases show potential value. Most predators of ticks are generalists, with a limited potential for tick management (one possible exception is oxpeckers in Africa). Biological control is likely to play a substantial role in future IPM programmes for ticks because of the diversity of taxa that show high potential as tick BCAs. Considerable research is required to select appropriate strains, develop them as BCAs, establish their effectiveness, and devise production strategies to bring them to practical use.

  11. Tick Talk: Block Tick Bites and Lyme Disease

    MedlinePlus

    ... disclaimer . Subscribe Tick Talk Block Tick Bites and Lyme Disease When warm weather arrives, you might get the ... mainly in the mid-Atlantic and southern states. Lyme disease is the most common tick-borne illness. It’s ...

  12. Tick infestation patterns in free ranging African buffalo (Syncercus caffer): Effects of host innate immunity and niche segregation among tick species☆

    PubMed Central

    Anderson, Kadie; Ezenwa, Vanessa O.; Jolles, Anna E.

    2012-01-01

    Ticks are of vast importance to livestock health, and contribute to conflicts between wildlife conservation and agricultural interests; but factors driving tick infestation patterns on wild hosts are not well understood. We studied tick infestation patterns on free-ranging African buffalo (Syncercus caffer), asking (i) is there evidence for niche segregation among tick species?; and (ii) how do host characteristics affect variation in tick abundance among hosts? We identified ticks and estimated tick burdens on 134 adult female buffalo from two herds at Kruger National Park, South Africa. To assess niche segregation, we evaluated attachment site preferences and tested for correlations between abundances of different tick species. To investigate which host factors may drive variability in tick abundance, we measured age, body condition, reproductive and immune status in all hosts, and examined their effects on tick burdens. Two tick species were abundant on buffalo, Amblyomma hebraeum and Rhipicephalus evertsi evertsi. A. hebraeum were found primarily in the inguinal and axillary regions; R. e. evertsi attached exclusively in the perianal area. Abundances of A. hebraeum and R. e. evertsi on the host were unrelated. These results suggest spatial niche segregation between A. hebraeum and R. e. evertsi on the buffalo. Buffalo with stronger innate immunity, and younger buffalo, had fewer ticks. Buffalo with low body condition scores, and pregnant buffalo, had higher tick burdens, but these effects varied between the two herds we sampled. This study is one of the first to link ectoparasite abundance patterns and immunity in a free-ranging mammalian host population. Based on independent abundances of A. hebraeum and R. e. evertsi on individual buffalo, we would expect no association between the diseases these ticks transmit. Longitudinal studies linking environmental variability with host immunity are needed to understand tick infestation patterns and the dynamics of tick

  13. Tick-Borne Relapsing Fever

    MedlinePlus

    ... their instructions to help prevent bites. Use an insect repellent containing 20% to 30% DEET. Tick repellents that ... I won’t get sick? What tick or insect repellent should I use for my child? Which tick ...

  14. Tick induced facial palsy.

    PubMed

    Patil, M M; Walikar, B N; Kalyanshettar, S S; Patil, S V

    2012-01-01

    We report a 3-year old boy with acute onset of left sided facial palsy secondary to tick infestation in the left ear. On 7th day of follow-up, following tick removal, the facial palsy had resolved. PMID:22318101

  15. Tick microbiome: the force within

    PubMed Central

    Narasimhan, Sukanya; Fikrig, Erol

    2015-01-01

    Ticks are obligate blood-feeders and serve as vectors of human and livestock pathogens worldwide. Defining the tick microbiome and deciphering the interactions between the tick and its symbiotic bacteria in the context of tick development and pathogen transmission, will likely reveal new insights and spawn new paradigms to control tick-borne diseases. Descriptive observations on the tick microbiome that began almost a century ago serve as forerunners to the gathering momentum to define the tick microbiome in greater detail. This review will focus on the current efforts to address the microbiomes of diverse ticks, and the evolving understanding of tick microbiomes. There is hope that these efforts will bring a holistic understanding of pathogen transmission by ticks. PMID:25936226

  16. Management of ticks and tick-borne diseases

    USGS Publications Warehouse

    Ginsberg, H.S.; Stafford, K.C.; Goodman, J.L.; Dennis, D.T.; Sonenshine, D .E.

    2005-01-01

    The mainstays of tick management and protection from tick-borne diseases have traditionally been personal precautions and the application of acaricides. These techniques maintain their value, and current innovations hold considerable promise for future improvement in effective targeting of materials for tick control. Furthermore, an explosion of research in the past few decades has resulted in the development and expansion of several novel and potentially valuable approaches to tick control, including vaccination against tick-borne pathogen transmission and against tick attachment, host management, use of natural enemies (especially entomopathogenic fungi), and pheromone-based techniques. The situations that require tick management are diverse, and occur under varied ecological conditions. Therefore, the likelihood of finding a single ?magic bullet? for tick management is low. In practical terms, the approach to tick management or to management of tick-borne disease must be tailored to the specific conditions at hand. One area that needs increased attention is the decision-making process in applying IPM to tick control. Further development of novel tick control measures, and increased efficiency in their integration and application to achieve desired goals, holds great promise for effective future management of ticks and tick-borne diseases.

  17. Tick-borne diseases.

    PubMed

    Doan-Wiggins, L

    1991-05-01

    Ticks may transmit a variety of human pathogens and are second in importance only to the mosquito as a vector of human disease. The majority of tick-borne diseases are nonspecific in their initial clinical and laboratory presentation and may be confused with a variety of more common illnesses. A history of tick exposure is frequently not available. Although specific serologic tests exist for confirming the diagnosis of many of these diseases, the time required for confirmation of results makes them of little use in the acute situation. Recognition of the epidemiology of tick-borne pathogens and clinical suspicion are of key importance in making the appropriate diagnosis. Early and specific therapy is a principal factor in reducing the morbidity and mortality associated with these diseases. PMID:1893895

  18. Colorado tick fever

    MedlinePlus

    ... immediately by using tweezers, pulling carefully and steadily. Insect repellent may be helpful. Alternative Names Mountain tick fever; ... chap 51. Read More Acute Encephalitis Fever Incidence Insect bites and stings Update Date 12/7/2014 Updated by: Jatin ...

  19. [Protection against tick bites].

    PubMed

    Boulanger, N; Lipsker, Dan

    2015-04-01

    There are numerous tick-borne infections, which include viral (TBE), parasitic (babesiosis) and bacterial diseases. Lyme disease (Lyme borreliosis) is the most common tick-borne disease in France. In temperate climates such as in France, ticks bite humans between March and October. Prevention relies on adequate clothing and on repellents. The latter are reviewed in this work. Repellents may be natural, made from eucalyptus, tomato and coconut, or synthetic, among which the most widely used is DEET (N,N,-Diethyl-m-toluamide). Newer, synthetic repellents exist such as IR3535 which, as well as being less toxic, also exhibits greater efficacy against ticks. Some repellents are used on the skin, while others, like permethrin, which is actually an insecticide, may be applied to clothing. PMID:25624140

  20. Tick Bites (For Parents)

    MedlinePlus

    ... carry harmful germs and cause diseases like Rocky Mountain spotted fever and Lyme disease . The deer tick ... red dots on the ankles and wrists (Rocky Mountain spotted fever) flu -like symptoms such as fever , ...

  1. Developing Anti-tick Vaccines.

    PubMed

    Rodríguez-Mallon, Alina

    2016-01-01

    Ticks are responsible for the transmission of viral, bacterial, and protozoal diseases of man and animals and also produce significant economic losses to cattle industry. The use of acaricides constitutes a major component of integrated tick control strategies. However, this is accompanied by the selection of acaricide-resistant ticks and contamination of environment and milk and meat products with drug residues. These issues highlight the need for alternative approaches to control tick infestations and have triggered the search for tick protective antigens for vaccine development. Vaccination as a tick control method has been practiced since the introduction of TickGARD and Gavac that were developed using the midgut glycoprotein Bm86 as antigen. Gavac within integrated tick management systems has proven to reduce the number of acaricidal applications per year that are required to control some strains of R. microplus ticks in different geographical regions. Nevertheless, it has limited or no efficacy against other tick species. These issues have stimulated research for additional tick protective antigens with critical functions in the tick. This chapter presents methodologies for the design and test of molecules as antigens against ticks. Considerations about different methods for the tick control compared to the immunological methods, the desirable characteristics for an anti-tick vaccine and the obstacles encountered for developing this kind of vaccines are discussed. Detailed methodologies for the establishment of a biological model to test new molecules as immunogens against ticks and to perform challenge trials with this model are presented. General considerations in the efficacy calculation for any anti-tick vaccine are also discussed. PMID:27076303

  2. Preventing Ticks on Your Pets

    MedlinePlus

    ... chemicals. Do not apply any insect acaricides or repellents to your cats without first consulting your veterinarian! ... permethrin, etc.) Amitraz Repel Ticks on Dogs A repellent product may prevent the tick from coming into ...

  3. Exposure to Borrelia burgdorferi and other tick-borne pathogens in Gettysburg National Military Park, South-Central Pennsylvania, 2009.

    PubMed

    Han, George S; Stromdahl, Ellen Y; Wong, David; Weltman, Andre C

    2014-04-01

    Since 1998, Lyme disease cases have increased in south-central Pennsylvania, which includes Gettysburg National Military Park (NMP). Limited information is available about tick populations or pathogens in this area, and no data regarding frequency of tick bites or prevention measures among Gettysburg NMP employees are available. To address these gaps, ticks were collected, classified, and replaced (to minimize disruptions to tick populations) at two sites within Gettysburg NMP during April-September, 2009, among eight nonremoval samplings. On two additional occasions during May and June, 2009, ticks were collected and removed from the two original sites plus 10 additional sites and tested for tick-borne pathogens by using PCR. A self-administered anonymous survey of Gettysburg NMP employees was conducted to determine knowledge, attitudes, and practices regarding tick-borne diseases. Peak Ixodes scapularis nymph populations were observed during May-July. Of 115 I. scapularis ticks tested, 21% were infected with Borrelia burgdorferi, including 18% of 74 nymphs and 27% of 41 adults; no other pathogen was identified. The entomologic risk index was calculated at 1.3 infected nymphs/hour. An adult and nymph Amblyomma americanum were also found, representing the first confirmed field collection of this tick in Pennsylvania, but no pathogens were detected. The survey revealed that most park employees believed Lyme disease was a problem at Gettysburg NMP and that they frequently found ticks on their skin and clothing. However, use of personal preventive measures was inconsistent, and 6% of respondents reported contracting Lyme disease while employed at Gettysburg NMP. These findings indicate a need to improve surveillance for tick bites among employees and enhance prevention programs for park staff and visitors. PMID:24689815

  4. Migratory birds, ticks, and Bartonella

    PubMed Central

    Molin, Ylva; Lindeborg, Mats; Nyström, Fredrik; Madder, Maxime; Hjelm, Eva; Olsen, Björn; Jaenson, Thomas G.T.; Ehrenborg, Christian

    2011-01-01

    Bartonella spp. infections are considered to be vector-borne zoonoses; ticks are suspected vectors of bartonellae. Migratory birds can disperse ticks infected with zoonotic pathogens such as Rickettsia and tick-borne encephalitis virus and possibly also Bartonella. Thus, in the present study 386 tick specimens collected in spring 2009 from migratory birds on the Mediterranean islands Capri and Antikythera were screened for Bartonella spp. RNA. One or more ticks were found on 2.7% of the birds. Most ticks were Hyalomma rufipes nymphs and larvae with mean infestation rates of 1.7 nymphs and 0.6 larvae per infested bird. Bartonella spp. RNA was not detected in any of the tick specimens. PMID:22957116

  5. Tick vaccines and the control of tick-borne pathogens.

    PubMed

    Merino, Octavio; Alberdi, Pilar; Pérez de la Lastra, José M; de la Fuente, José

    2013-01-01

    Ticks are obligate hematophagous ectoparasites that transmit a wide variety of pathogens to humans and animals. The incidence of tick-borne diseases has increased worldwide in both humans and domestic animals over the past years resulting in greater interest in the study of tick-host-pathogen interactions. Advances in vector and pathogen genomics and proteomics have moved forward our knowledge of the vector-pathogen interactions that take place during the colonization and transmission of arthropod-borne microbes. Tick-borne pathogens adapt from the vector to the mammalian host by differential gene expression thus modulating host processes. In recent years, studies have shown that targeting tick proteins by vaccination can not only reduce tick feeding and reproduction, but also the infection and transmission of pathogens from the tick to the vertebrate host. In this article, we review the tick-protective antigens that have been identified for the formulation of tick vaccines and the effect of these vaccines on the control of tick-borne pathogens.

  6. Tick vaccines and the control of tick-borne pathogens

    PubMed Central

    Merino, Octavio; Alberdi, Pilar; Pérez de la Lastra, José M.; de la Fuente, José

    2013-01-01

    Ticks are obligate hematophagous ectoparasites that transmit a wide variety of pathogens to humans and animals. The incidence of tick-borne diseases has increased worldwide in both humans and domestic animals over the past years resulting in greater interest in the study of tick-host-pathogen interactions. Advances in vector and pathogen genomics and proteomics have moved forward our knowledge of the vector-pathogen interactions that take place during the colonization and transmission of arthropod-borne microbes. Tick-borne pathogens adapt from the vector to the mammalian host by differential gene expression thus modulating host processes. In recent years, studies have shown that targeting tick proteins by vaccination can not only reduce tick feeding and reproduction, but also the infection and transmission of pathogens from the tick to the vertebrate host. In this article, we review the tick-protective antigens that have been identified for the formulation of tick vaccines and the effect of these vaccines on the control of tick-borne pathogens. PMID:23847771

  7. Tick imbedded in the skin (image)

    MedlinePlus

    This is a close-up photograph of a tick embedded in the skin. Ticks are important because they can carry diseases such as Rocky Mountain spotted fever, tularemia, Colorado tick fever, Lyme disease, and others.

  8. 7 CFR 1.501 - Policy on employee indemnification.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Policy on employee indemnification. 1.501 Section 1.501 Agriculture Office of the Secretary of Agriculture ADMINISTRATIVE REGULATIONS Policy With Regard to Indemnification of Department of Agriculture Employees § 1.501 Policy on employee...

  9. 7 CFR 1.501 - Policy on employee indemnification.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... 7 Agriculture 1 2013-01-01 2013-01-01 false Policy on employee indemnification. 1.501 Section 1.501 Agriculture Office of the Secretary of Agriculture ADMINISTRATIVE REGULATIONS Policy With Regard to Indemnification of Department of Agriculture Employees § 1.501 Policy on employee...

  10. Tick-borne encephalitis.

    PubMed

    Gritsun, T S; Lashkevich, V A; Gould, E A

    2003-01-01

    Tick-borne encephalitis (TBE) is one of the most dangerous human infections occurring in Europe and many parts of Asia. The etiological agent Tick-borne encephalitis virus (TBEV), is a member of the virus genus Flavivirus, of the family Flaviviridae. TBEV is believed to cause at least 11,000 human cases of encephalitis in Russia and about 3000 cases in the rest of Europe annually. Related viruses within the same group, Louping ill virus (LIV), Langat virus (LGTV) and Powassan virus (POWV), also cause human encephalitis but rarely on an epidemic scale. Three other viruses within the same group, Omsk hemorrhagic fever virus (OHFV), Kyasanur Forest disease virus (KFDV) and Alkhurma virus (ALKV), are closely related to the TBEV complex viruses and tend to cause fatal hemorrhagic fevers rather than encephalitis. This review describes the clinical manifestations associated with TBEV infections, the main molecular-biological properties of these viruses, and the different factors that define the incidence and severity of disease. The role of ticks and their local hosts in the emergence of new virus variants with different pathogenic characteristics is also discussed. This review also contains a brief history of vaccination against TBE including trials with live attenuated vaccine and modern tendencies in developing of vaccine virus strains. PMID:12615309

  11. Tick-borne encephalitis.

    PubMed

    Gritsun, T S; Lashkevich, V A; Gould, E A

    2003-01-01

    Tick-borne encephalitis (TBE) is one of the most dangerous human infections occurring in Europe and many parts of Asia. The etiological agent Tick-borne encephalitis virus (TBEV), is a member of the virus genus Flavivirus, of the family Flaviviridae. TBEV is believed to cause at least 11,000 human cases of encephalitis in Russia and about 3000 cases in the rest of Europe annually. Related viruses within the same group, Louping ill virus (LIV), Langat virus (LGTV) and Powassan virus (POWV), also cause human encephalitis but rarely on an epidemic scale. Three other viruses within the same group, Omsk hemorrhagic fever virus (OHFV), Kyasanur Forest disease virus (KFDV) and Alkhurma virus (ALKV), are closely related to the TBEV complex viruses and tend to cause fatal hemorrhagic fevers rather than encephalitis. This review describes the clinical manifestations associated with TBEV infections, the main molecular-biological properties of these viruses, and the different factors that define the incidence and severity of disease. The role of ticks and their local hosts in the emergence of new virus variants with different pathogenic characteristics is also discussed. This review also contains a brief history of vaccination against TBE including trials with live attenuated vaccine and modern tendencies in developing of vaccine virus strains.

  12. Tick vaccines: current status and future directions.

    PubMed

    de la Fuente, José; Contreras, Marinela

    2015-01-01

    Ticks and tick-borne diseases are a growing problem affecting human and animal health worldwide. Traditional control methods, based primarily on chemical acaricides, have proven not to be sustainable because of the selection of acaricide-resistant ticks. Tick vaccines appear to be a promising and effective alternative for control of tick infestations and pathogen transmission. The purpose of this review is to summarize previous tick vaccine development and performance and formulate critical issues and recommendations for future directions for the development of improved and effective tick vaccines. The development of effective screening platforms and algorithms using omics approaches focused on relevant biological processes will allow the discovery of new tick-protective antigens. Future vaccines will likely combine tick antigens with different protective mechanisms alone or pathogen-derived antigens. The application of tick vaccines as a part of integrated control strategies will ultimately result in the control of tick-borne diseases. PMID:26289976

  13. Transport of ixodid ticks and tick-borne pathogens by migratory birds.

    PubMed

    Hasle, Gunnar

    2013-01-01

    Birds, particularly passerines, can be parasitized by Ixodid ticks, which may be infected with tick-borne pathogens, like Borrelia spp., Babesia spp., Anaplasma, Rickettsia/Coxiella, and tick-borne encephalitis virus. The prevalence of ticks on birds varies over years, season, locality and different bird species. The prevalence of ticks on different species depends mainly on the degree of feeding on the ground. In Europe, the Turdus spp., especially the blackbird, Turdus merula, appears to be most important for harboring ticks. Birds can easily cross barriers, like fences, mountains, glaciers, desserts and oceans, which would stop mammals, and they can move much faster than the wingless hosts. Birds can potentially transport tick-borne pathogens by transporting infected ticks, by being infected with tick-borne pathogens and transmit the pathogens to the ticks, and possibly act as hosts for transfer of pathogens between ticks through co-feeding. Knowledge of the bird migration routes and of the spatial distribution of tick species and tick-borne pathogens is crucial for understanding the possible impact of birds as spreaders of ticks and tick-borne pathogens. Successful colonization of new tick species or introduction of new tick-borne pathogens will depend on suitable climate, vegetation and hosts. Although it has never been demonstrated that a new tick species, or a new tick pathogen, actually has been established in a new locality after being seeded there by birds, evidence strongly suggests that this could occur.

  14. Sialomes and Mialomes: A Systems-Biology View of Tick Tissues and Tick-Host Interactions.

    PubMed

    Chmelař, Jindřich; Kotál, Jan; Karim, Shahid; Kopacek, Petr; Francischetti, Ivo M B; Pedra, Joao H F; Kotsyfakis, Michail

    2016-03-01

    Tick saliva facilitates tick feeding and infection of the host. Gene expression analysis of tick salivary glands and other tissues involved in host-pathogen interactions has revealed a wide range of bioactive tick proteins. Transcriptomic analysis has been a milestone in the field and has recently been enhanced by next-generation sequencing (NGS). Furthermore, the application of quantitative proteomics to ticks with unknown genomes has provided deeper insights into the molecular mechanisms underlying tick hematophagy, pathogen transmission, and tick-host-pathogen interactions. We review current knowledge on the transcriptomics and proteomics of tick tissues from a systems-biology perspective and discuss future challenges in the field.

  15. Tick-borne relapsing fever.

    PubMed

    Dworkin, Mark S; Schwan, Tom G; Anderson, Donald E; Borchardt, Stephanie M

    2008-09-01

    Each year, many residents of and visitors to endemic regions of the western United States are exposed to the tick vectors of tick-borne relapsing fever (TBRF), Ornithodoros hermsi, Ornithodoros turicata, or Ornithodoros parkeri. This disease is remarkable because the human host is unaware of the tick bite, usually becomes very ill, may experience an exacerbation of symptoms rather than improvement shortly after beginning appropriate treatment, and, despite often high numbers of the etiologic organism in the blood, rarely dies as a result of the illness. Although relapsing fever is acquired in many parts of the world, this article focuses primarily on knowledge about TBRF in North America. PMID:18755384

  16. Habitat and Vegetation Variables Are Not Enough When Predicting Tick Populations in the Southeastern United States

    PubMed Central

    Trout Fryxell, R. T.; Moore, J. E.; Collins, M. D.; Kwon, Y.; Jean-Philippe, S. R.; Schaeffer, S. M.; Odoi, A.; Kennedy, M.; Houston, A. E.

    2015-01-01

    Two tick-borne diseases with expanding case and vector distributions are ehrlichiosis (transmitted by Amblyomma americanum) and rickettiosis (transmitted by A. maculatum and Dermacentor variabilis). There is a critical need to identify the specific habitats where each of these species is likely to be encountered to classify and pinpoint risk areas. Consequently, an in-depth tick prevalence study was conducted on the dominant ticks in the southeast. Vegetation, soil, and remote sensing data were used to test the hypothesis that habitat and vegetation variables can predict tick abundances. No variables were significant predictors of A. americanum adult and nymph tick abundance, and no clustering was evident because this species was found throughout the study area. For A. maculatum adult tick abundance was predicted by NDVI and by the interaction between habitat type and plant diversity; two significant population clusters were identified in a heterogeneous area suitable for quail habitat. For D. variabilis no environmental variables were significant predictors of adult abundance; however, D. variabilis collections clustered in three significant areas best described as agriculture areas with defined edges. This study identified few landscape and vegetation variables associated with tick presence. While some variables were significantly associated with tick populations, the amount of explained variation was not useful for predicting reliably where ticks occur; consequently, additional research that includes multiple sampling seasons and locations throughout the southeast are warranted. This low amount of explained variation may also be due to the use of hosts for dispersal, and potentially to other abiotic and biotic variables. Host species play a large role in the establishment, maintenance, and dispersal of a tick species, as well as the maintenance of disease cycles, dispersal to new areas, and identification of risk areas. PMID:26656122

  17. Habitat and Vegetation Variables Are Not Enough When Predicting Tick Populations in the Southeastern United States.

    PubMed

    Trout Fryxell, R T; Moore, J E; Collins, M D; Kwon, Y; Jean-Philippe, S R; Schaeffer, S M; Odoi, A; Kennedy, M; Houston, A E

    2015-01-01

    Two tick-borne diseases with expanding case and vector distributions are ehrlichiosis (transmitted by Amblyomma americanum) and rickettiosis (transmitted by A. maculatum and Dermacentor variabilis). There is a critical need to identify the specific habitats where each of these species is likely to be encountered to classify and pinpoint risk areas. Consequently, an in-depth tick prevalence study was conducted on the dominant ticks in the southeast. Vegetation, soil, and remote sensing data were used to test the hypothesis that habitat and vegetation variables can predict tick abundances. No variables were significant predictors of A. americanum adult and nymph tick abundance, and no clustering was evident because this species was found throughout the study area. For A. maculatum adult tick abundance was predicted by NDVI and by the interaction between habitat type and plant diversity; two significant population clusters were identified in a heterogeneous area suitable for quail habitat. For D. variabilis no environmental variables were significant predictors of adult abundance; however, D. variabilis collections clustered in three significant areas best described as agriculture areas with defined edges. This study identified few landscape and vegetation variables associated with tick presence. While some variables were significantly associated with tick populations, the amount of explained variation was not useful for predicting reliably where ticks occur; consequently, additional research that includes multiple sampling seasons and locations throughout the southeast are warranted. This low amount of explained variation may also be due to the use of hosts for dispersal, and potentially to other abiotic and biotic variables. Host species play a large role in the establishment, maintenance, and dispersal of a tick species, as well as the maintenance of disease cycles, dispersal to new areas, and identification of risk areas.

  18. Comparative Metagenomic Profiling of Symbiotic Bacterial Communities Associated with Ixodes persulcatus, Ixodes pavlovskyi and Dermacentor reticulatus Ticks

    PubMed Central

    Kurilshikov, Alexander; Livanova, Natalya N.; Fomenko, Nataliya V.; Tupikin, Alexey E.; Rar, Vera A.; Kabilov, Marsel R.; Livanov, Stanislav G.; Tikunova, Nina V.

    2015-01-01

    Ixodes persulcatus, Ixodes pavlovskyi, and Dermacentor reticulatus ticks inhabiting Western Siberia are responsible for the transmission of a number of etiological agents that cause human and animal tick-borne diseases. Because these ticks are abundant in the suburbs of large cities, agricultural areas, and popular tourist sites and frequently attack people and livestock, data regarding the microbiomes of these organisms are required. Using metagenomic 16S profiling, we evaluate bacterial communities associated with I. persulcatus, I. pavlovskyi, and D. reticulatus ticks collected from the Novosibirsk region of Russia. A total of 1214 ticks were used for this study. DNA extracted from the ticks was pooled according to tick species and sex. Sequencing of the V3-V5 domains of 16S rRNA genes was performed using the Illumina Miseq platform. The following bacterial genera were prevalent in the examined communities: Acinetobacter (all three tick species), Rickettsia (I. persulcatus and D. reticulatus) and Francisella (D. reticulatus). B. burgdorferi sensu lato and B. miyamotoi sequences were detected in I. persulcatus and I. pavlovskyi but not in D. reticulatus ticks. The pooled samples of all tick species studied contained bacteria from the Anaplasmataceae family, although their occurrence was low. DNA from A. phagocytophilum and Candidatus Neoehrlichia mikurensis was first observed in I. pavlovskyi ticks. Significant inter-species differences in the number of bacterial taxa as well as intra-species diversity related to tick sex were observed. The bacterial communities associated with the I. pavlovskyi ticks displayed a higher biodiversity compared with those of the I. persulcatus and D. reticulatus ticks. Bacterial community structure was also diverse across the studied tick species, as shown by permutational analysis of variance using the Bray-Curtis dissimilarity metric (p = 0.002). Between-sex variation was confirmed by PERMANOVA testing in I. persulcatus (p = 0

  19. Hey! A Tick Bit Me!

    MedlinePlus

    ... type of tick can carry is called Rocky Mountain spotted fever. What a Bite Looks and Feels ... carry diseases (such as Lyme disease or Rocky Mountain spotted fever) and can pass them to people. ...

  20. Coinfections Acquired from Ixodes Ticks

    PubMed Central

    Swanson, Stephen J.; Neitzel, David; Reed, Kurt D.; Belongia, Edward A.

    2006-01-01

    The pathogens that cause Lyme disease (LD), human anaplasmosis, and babesiosis can coexist in Ixodes ticks and cause human coinfections. Although the risk of human coinfection differs by geographic location, the true prevalence of coinfecting pathogens among Ixodes ticks remains largely unknown for the majority of geographic locations. The prevalence of dually infected Ixodes ticks appears highest among ticks from regions of North America and Europe where LD is endemic, with reported prevalences of ≤28%. In North America and Europe, the majority of tick-borne coinfections occur among humans with diagnosed LD. Humans coinfected with LD and babesiosis appear to have more intense, prolonged symptoms than those with LD alone. Coinfected persons can also manifest diverse, influenza-like symptoms, and abnormal laboratory test results are frequently observed. Coinfecting pathogens might alter the efficiency of transmission, cause cooperative or competitive pathogen interactions, and alter disease severity among hosts. No prospective studies to assess the immunologic effects of coinfection among humans have been conducted, but animal models demonstrate that certain coinfections can modulate the immune response. Clinicians should consider the likelihood of coinfection when pursuing laboratory testing or selecting therapy for patients with tick-borne illness. PMID:17041141

  1. Factors affecting the ecology of tick-borne encephalitis in Slovenia.

    PubMed

    Knap, N; Avšič-Županc, T

    2015-07-01

    Recognition of factors that influence the formation of tick-borne encephalitis (TBE) foci is important for assessing the risk of humans acquiring the viral infection and for establishing what can be done (within reasonable boundaries) to minimize that risk. In Slovenia, the dynamics of the TBE vector, i.e. Ixodes ricinus, was studied over a 4-year period and the prevalence of infection in ticks was established. Two groups of tick hosts were investigated: deer and small mammals. Red deer have been confirmed as having a direct influence on the incidence of TBE and rodents have been recognized as important sentinels for TBE infections, although their role in the enzootic cycle of the virus still remains to be elucidated. Last, forest and agricultural areas, which are influenced by human activity, are suitable habitats for ticks, and important for TBEV transmission and establishment. Human behaviour is also therefore an important factor and should always be considered in studies of TBE ecology.

  2. 29 CFR 516.33 - Employees employed in agriculture pursuant to section 13(a)(6) or 13(b)(12) of the Act.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... Standards Act (29 U.S.C. 201 et seq.) set forth and define the term “man-day.” (b) If it can reasonably be... of the employer's immediate family as defined in section 13(a)(6)(B) of the Act, (ii) Hand harvest laborers as defined in section 13(a)(6) (C) or (D), and (iii) Employees principally engaged in the...

  3. Looking in ticks for human bacterial pathogens.

    PubMed

    Mediannikov, O; Fenollar, F

    2014-12-01

    Ticks are considered to be second worldwide to mosquitoes as vectors of human diseases and the most important vectors of disease-causing pathogens in domestic and wild animals. A number of emerging tick-borne pathogens are already discovered; however, the proportion of undiagnosed infectious diseases, especially in tropical regions, may suggest that there are still more pathogens associated with ticks. Moreover, the identification of bacteria associated with ticks may provide new tool for the control of ticks and tick-borne diseases. Described here molecular methods of screening of ticks, extensive use of modern culturomics approach, newly developed artificial media and different cell line cultures may significantly improve our knowledge about the ticks as the agents of human and animal pathology. PMID:25229617

  4. Ancestral reconstruction of tick lineages.

    PubMed

    Mans, Ben J; de Castro, Minique H; Pienaar, Ronel; de Klerk, Daniel; Gaven, Philasande; Genu, Siyamcela; Latif, Abdalla A

    2016-06-01

    Ancestral reconstruction in its fullest sense aims to describe the complete evolutionary history of a lineage. This depends on accurate phylogenies and an understanding of the key characters of each parental lineage. An attempt is made to delineate our current knowledge with regard to the ancestral reconstruction of the tick (Ixodida) lineage. Tick characters may be assigned to Core of Life, Lineages of Life or Edges of Life phenomena depending on how far back these characters may be assigned in the evolutionary Tree of Life. These include housekeeping genes, sub-cellular systems, heme processing (Core of Life), development, moulting, appendages, nervous and organ systems, homeostasis, respiration (Lineages of Life), specific adaptations to a blood-feeding lifestyle, including the complexities of salivary gland secretions and tick-host interactions (Edges of Life). The phylogenetic relationships of lineages, their origins and importance in ancestral reconstruction are discussed. Uncertainties with respect to systematic relationships, ancestral reconstruction and the challenges faced in comparative transcriptomics (next-generation sequencing approaches) are highlighted. While almost 150 years of information regarding tick biology have been assembled, progress in recent years indicates that we are in the infancy of understanding tick evolution. Even so, broad reconstructions can be made with relation to biological features associated with various lineages. Conservation of characters shared with sister and parent lineages are evident, but appreciable differences are present in the tick lineage indicating modification with descent, as expected for Darwinian evolutionary theory. Many of these differences can be related to the hematophagous lifestyle of ticks. PMID:26868413

  5. 7 CFR 97.154 - Government employees.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... 7 Agriculture 3 2010-01-01 2010-01-01 false Government employees. 97.154 Section 97.154... PLANT VARIETY AND PROTECTION Attorneys and Agents § 97.154 Government employees. Officers and employees... attorneys or agents in proceedings or other matters before government departments or agencies, shall not...

  6. 7 CFR 97.154 - Government employees.

    Code of Federal Regulations, 2012 CFR

    2012-01-01

    ... 7 Agriculture 3 2012-01-01 2012-01-01 false Government employees. 97.154 Section 97.154... PLANT VARIETY AND PROTECTION Attorneys and Agents § 97.154 Government employees. Officers and employees... attorneys or agents in proceedings or other matters before government departments or agencies, shall not...

  7. 7 CFR 97.154 - Government employees.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... 7 Agriculture 3 2013-01-01 2013-01-01 false Government employees. 97.154 Section 97.154... PLANT VARIETY AND PROTECTION Attorneys and Agents § 97.154 Government employees. Officers and employees... attorneys or agents in proceedings or other matters before government departments or agencies, shall not...

  8. 7 CFR 97.154 - Government employees.

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... 7 Agriculture 3 2011-01-01 2011-01-01 false Government employees. 97.154 Section 97.154... PLANT VARIETY AND PROTECTION Attorneys and Agents § 97.154 Government employees. Officers and employees... attorneys or agents in proceedings or other matters before government departments or agencies, shall not...

  9. 7 CFR 97.154 - Government employees.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... 7 Agriculture 3 2014-01-01 2014-01-01 false Government employees. 97.154 Section 97.154... PLANT VARIETY AND PROTECTION Attorneys and Agents § 97.154 Government employees. Officers and employees... attorneys or agents in proceedings or other matters before government departments or agencies, shall not...

  10. Vaccinomics, the new road to tick vaccines.

    PubMed

    de la Fuente, José; Merino, Octavio

    2013-12-01

    Ticks are a threat to human and animal health worldwide. Ticks are considered to be second worldwide to mosquitoes as vectors of human diseases, the most important vectors of diseases that affect cattle industry worldwide and important vectors of diseases affecting pets. Tick vaccines are a cost-effective and environmentally friendly alternative to protect against tick-borne diseases through the control of vector infestations and reducing pathogen infection and transmission. These premises stress the need for developing improved tick vaccines in a more efficient way. In this context, development of improved vaccines for tick-borne diseases will be greatly enhanced by vaccinomics approaches starting from the study of tick–host–pathogen molecular interactions and ending in the characterization and validation of vaccine formulations. The discovery of new candidate vaccine antigens for the control of tick infestations and pathogen infection and transmission requires the development of effective screening platforms and algorithms that allow the analysis and validation of data produced by systems biology approaches to tick research. Tick vaccines that affect both tick infestations and pathogen transmission could be used to vaccinate human and animal populations at risk and reservoir species to reduce host exposure to ticks while reducing the number of infected ticks and their vectorial capacity for pathogens that affect human and animal health worldwide. PMID:24396872

  11. Ticks infesting humans in Northern Misiones, Argentina.

    PubMed

    Lamattina, Daniela; Nava, Santiago

    2016-01-01

    This work presents records of ticks infesting humans in northern Misiones Province, Argentina. Also, notes on potential transmission of tick-borne pathogens are included. A total of 282 ticks attached to researchers were collected and identified by their morphological characters. Eight tick species were found: Amblyomma brasiliense, Amblyomma coelebs, Amblyomma dubitatum, Amblyomma incisum, Amblyomma ovale, Haemaphysalis juxtakochi, Rhipicephalus sanguineus and Rhipicephalus microplus. Some of these species as A. dubitatum, A. ovale and R. sanguineus have been found infected with spotted fever group rickettsiae pathogenic to humans in Brazil and Argentina. The potential role as vectors of humans pathogens of the ticks found attached to humans in this study is discussed. PMID:27135846

  12. Ticks infesting humans in Northern Misiones, Argentina.

    PubMed

    Lamattina, Daniela; Nava, Santiago

    2016-01-01

    This work presents records of ticks infesting humans in northern Misiones Province, Argentina. Also, notes on potential transmission of tick-borne pathogens are included. A total of 282 ticks attached to researchers were collected and identified by their morphological characters. Eight tick species were found: Amblyomma brasiliense, Amblyomma coelebs, Amblyomma dubitatum, Amblyomma incisum, Amblyomma ovale, Haemaphysalis juxtakochi, Rhipicephalus sanguineus and Rhipicephalus microplus. Some of these species as A. dubitatum, A. ovale and R. sanguineus have been found infected with spotted fever group rickettsiae pathogenic to humans in Brazil and Argentina. The potential role as vectors of humans pathogens of the ticks found attached to humans in this study is discussed.

  13. Tick paralysis cases in Argentina.

    PubMed

    Remondegui, Carlos

    2012-01-01

    Tick paralysis (TP) occurs worldwide and is caused by a neurotoxin secreted by engorged female ticks that affects the peripheral and central nervous system. The clinical manifestations range from mild or nonspecific symptoms to manifestations similar to Guillain-Barré syndrome, bulbar involvement, and death in 10% of the patients. The diagnosis of TP is clinical. To our knowledge, there are no formal reports of TP in humans in South America, although clusters of TP among hunting dogs in Argentina have been identified recently. In this paper, clinical features of two cases of TP occurring during 1994 in Jujuy Province, Argentina, are described. PMID:22930054

  14. The mitochondrial genome of a Texas outbreak strain of the cattle tick, Rhipicephalus (Boophilus) microplus, derived from whole genome sequencing Pacific Biosciences and Illumina reads

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The cattle fever tick, Rhipicephalus (Boophilus) microplus is one of the most significant medical veterinary pests in the world, vectoring several serious livestock diseases negatively impacting agricultural economies of tropical and subtropical countries around the world. We assembled the complete ...

  15. Virus Discovery Using Tick Cell Lines.

    PubMed

    Bell-Sakyi, Lesley; Attoui, Houssam

    2016-01-01

    While ticks have been known to harbor and transmit pathogenic arboviruses for over 80 years, the application of high-throughput sequencing technologies has revealed that ticks also appear to harbor a diverse range of endogenous tick-only viruses belonging to many different families. Almost nothing is known about these viruses; indeed, it is unclear in most cases whether the identified viral sequences are derived from actual replication-competent viruses or from endogenous virus elements incorporated into the ticks' genomes. Tick cell lines play an important role in virus discovery and isolation through the identification of novel viruses chronically infecting such cell lines and by acting as host cells to aid in determining whether or not an entire replication-competent, infective virus is present in a sample. Here, we review recent progress in tick-borne virus discovery and comment on the actual and potential applications for tick cell lines in this emerging research area. PMID:27679414

  16. Amitraz: a tick and flea repellent and tick detachment drug.

    PubMed

    Folz, S D; Ash, K A; Conder, G A; Rector, D L

    1986-06-01

    A topical formulation of amitraz (Mitaban Liquid Concentrate, The Upjohn Company, Kalamazoo, Michigan, U.S.A.) was evaluated as a tick repellent and detachment agent, and flea repellent. The diluted liquid concentrate (250 p.p.m. active drug) was topically applied as a single treatment to dogs; the concentration was identical to the rate recommended for treatment of demodicosis and scabies. Brown dog tick (Rhipicephalus sanguineus) and American dog tick (Dermacentor variabilis) populations were eliminated and repelled. Repellent activity (92-95%) was observed against R. sanguineus for 2 weeks post-treatment; the treatment was moderately active (63%) during the third week, and at 4 weeks post-treatment the drug was inactive. Established R. sanguineus populations were also treated, and the diluted liquid concentrate had 100% tick-detachment efficacy. Repellent activity (99%) was also detected against D. variabilis; the activity was monitored for only 7 days. The ectoparasiticide had low to moderate flea (Ctenocephalides felis) repellent activity (42%) for 4 days post-treatment; thereafter the treatment was ineffective. Side-effects were not observed in any of the dogs treated with amitraz, or the placebo.

  17. [Tick-borne encephalitis viral titers of engorged adult Ixodes persulcatus ticks].

    PubMed

    Korenberg, E I; Pchelkina, A A

    1984-01-01

    The results of titration of adult virus infected ticks of Ixodes persulcatus are given. The ticks were collected in various natural nidi of tick-borne encephalitis and individually fed on laboratory animals. The results of titration of ticks of the same species primarily infected on laboratory animals during virusemia are given as well. Changes of the virus titer in engorged ticks were observed till the egg production. A role of the presence of virus in engorged ticks for the process of the agent circulation in natural nidi is discussed.

  18. The transstadial persistence of tick-borne encephalitis virus in Dermacentor reticulatus ticks in natural conditions.

    PubMed

    Karbowiak, Grzegorz; Biernat, Beata; Werszko, Joanna; Rychlik, Leszek

    2016-01-01

    There are a number of reports regarding natural infection of Dermacentor reticulatus ticks with TBE virus; however, the transmission mode of TBE virus in this tick population has not been investigated. This study was conducted in Białowieża Primeval Forest, east Poland. Forty fully engorged nymphs of D. reticulatus were sampled from root voles (Microtus oeconomus). Ticks were kept until molting. All ticks were screened for the presence of TBE virus by nested RT-PCR. Three adult ticks were positive for infection with TBE virus. The present study for the first time demonstrates the possibility of transstadial mode of TBEV transmission in D. reticulatus ticks. PMID:26751892

  19. Tick size and stock returns

    NASA Astrophysics Data System (ADS)

    Onnela, Jukka-Pekka; Töyli, Juuso; Kaski, Kimmo

    2009-02-01

    Tick size is an important aspect of the micro-structural level organization of financial markets. It is the smallest institutionally allowed price increment, has a direct bearing on the bid-ask spread, influences the strategy of trading order placement in electronic markets, affects the price formation mechanism, and appears to be related to the long-term memory of volatility clustering. In this paper we investigate the impact of tick size on stock returns. We start with a simple simulation to demonstrate how continuous returns become distorted after confining the price to a discrete grid governed by the tick size. We then move on to a novel experimental set-up that combines decimalization pilot programs and cross-listed stocks in New York and Toronto. This allows us to observe a set of stocks traded simultaneously under two different ticks while holding all security-specific characteristics fixed. We then study the normality of the return distributions and carry out fits to the chosen distribution models. Our empirical findings are somewhat mixed and in some cases appear to challenge the simulation results.

  20. Predicting Tick Presence by Environmental Risk Mapping

    PubMed Central

    Swart, Arno; Ibañez-Justicia, Adolfo; Buijs, Jan; van Wieren, Sip E.; Hofmeester, Tim R.; Sprong, Hein; Takumi, Katsuhisa

    2014-01-01

    Public health statistics recorded an increasing trend in the incidence of tick bites and erythema migrans (EM) in the Netherlands. We investigated whether the disease incidence could be predicted by a spatially explicit categorization model, based on environmental factors and a training set of tick absence–presence data. Presence and absence of Ixodes ricinus were determined by the blanket-dragging method at numerous sites spread over the Netherlands. The probability of tick presence on a 1 km by 1 km square grid was estimated from the field data using a satellite-based methodology. Expert elicitation was conducted to provide a Bayesian prior per landscape type. We applied a linear model to test for a linear relationship between incidence of EM consultations by general practitioners in the Netherlands and the estimated probability of tick presence. Ticks were present at 252 distinct sampling coordinates and absent at 425. Tick presence was estimated for 54% of the total land cover. Our model has predictive power for tick presence in the Netherlands, tick-bite incidence per municipality correlated significantly with the average probability of tick presence per grid. The estimated intercept of the linear model was positive and significant. This indicates that a significant fraction of the tick-bite consultations could be attributed to the I. ricinus population outside the resident municipality. PMID:25505781

  1. Research project for integrated control of the southern cattle fever tick in Puerto Rico

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Puerto Rico (PR) is infested with the southern cattle fever tick (SCFT), Rhipicephalus (Boophilus) microplus, which is considered the most economically important external parasite of livestock worldwide. A research coalition involving the livestock industry in PR, the PR Department of Agriculture (...

  2. Tick-borne relapsing fever: an interstate outbreak originating at Grand Canyon National Park.

    PubMed

    Boyer, K M; Munford, R S; Maupin, G O; Pattison, C P; Fox, M D; Barnes, A M; Jones, W L; Maynard, J E

    1977-05-01

    During the 1973 summer season, 27 employees and 35 overnight guests at the North Rim, Grand Canyon National Park, Arizona, acquired febrile illnesses compatibel with relapsing fever. Sixteen cases were confirmed by finding Borrelia spirochetes in peripheral blood smears or inoculated Swiss mice. Retrospective surveys of 278 employees and 7247 guests at the park revealed that acquisition of illness was significantly associated with the persons sleeping in rustic log cabins and acquiring bites of "unknown" insects. From rodent nesting materials found in the walls and attics of cabins where cases had occurred, infective Ornithodoros hermsi ticks were recovered. Exceptional activity of ticks in human populations appeared to have resulted from a decreased population of the ticks' usual rodent hosts. Vector control activities consisted of spraying the cabins with residual insecticide, removing nesting materials, and "rodent proofing." This outbreak, the largest yet identified in North America, extends the known range of a principal vector and establishes the North Rim as an endemic source of tick-borne relapsing fever.

  3. Employee relations.

    PubMed

    Demann, Eric T K; Stein, Pamela S; Levitt, Christine; Shelton, Keith E

    2008-07-01

    This review highlights some of the more important employee relation aspects involved in starting, establishing, or expanding an existing dental practice. Despite a competitive compensation package, staff-related conflicts can sometimes hamper the progress of a dental practice. Such conflicts can be reduced by having policies and procedures in place for each employee that set expectations concerning the hours of operation, professional manner, dress code, job tasks, performance evaluations, disciplinary actions, and termination if violations occur. Understanding the legal requirements set by various governmental agencies such as OSHA can help ensure that the rights and well-being of every employee are protected.

  4. TickBot: a novel robotic device for controlling tick populations in the natural environment.

    PubMed

    Gaff, Holly D; White, Alexis; Leas, Kyle; Kelman, Pamela; Squire, James C; Livingston, David L; Sullivan, Gerald A; Baker, Elizabeth W; Sonenshine, Daniel E

    2015-03-01

    A semi-autonomous 4-wheeled robot (TickBot) was fitted with a denim cloth treated with an acaricide (permethrin™) and tested for its ability to control ticks in a tick-infested natural environment in Portsmouth, Virginia. The robot's sensors detect a magnetic field signal from a guide wire encased in 80m polyethylene tubing, enabling the robot to follow the trails, open areas and other terrain where the tubing was located. To attract ticks to the treated area, CO2 was distributed through the same tubing, fitted with evenly spaced pores and flow control valves, which permitted uniform CO2 distribution. Tests were done to determine the optimum frequency for TickBot to traverse the wire-guided treatment site as well as the duration of operation that could be accomplished on a single battery charge. Prior to treatment, dragging was done to determine the natural abundance of ticks in the test site. Controls were done without CO2 and without permethrin. TickBot proved highly effective in reducing the overall tick densities to nearly zero with the treatment that included both carbon dioxide pretreatment and the permethrin treated cloth. Following a 60min traverse of the treatment areas, adult tick numbers, almost entirely Amblyomma americanum, was reduced to zero within 1h and remained at or near zero for 24h. Treatments without CO2 also showed reduction of ticks to near zero within 1h, but the populations were no different than the control sections at 4h. This study demonstrates the efficacy of TickBot as a tick control device to significantly reduce the risk of tick bites and disease transmission to humans and companion animals visiting a previously tick-infested natural environment. Continued deployment of TickBot for additional days or weeks can assure a relatively tick-safe environment for enjoyment by the public. PMID:25499615

  5. Employee health.

    PubMed

    2015-09-01

    The National Institute for Health and Care Excellence has produced a new guideline looking at improving the health and wellbeing of employees, with a particular focus on organisational culture and context, and the role of line managers. PMID:26309009

  6. Virus Discovery Using Tick Cell Lines

    PubMed Central

    Bell-Sakyi, Lesley; Attoui, Houssam

    2016-01-01

    While ticks have been known to harbor and transmit pathogenic arboviruses for over 80 years, the application of high-throughput sequencing technologies has revealed that ticks also appear to harbor a diverse range of endogenous tick-only viruses belonging to many different families. Almost nothing is known about these viruses; indeed, it is unclear in most cases whether the identified viral sequences are derived from actual replication-competent viruses or from endogenous virus elements incorporated into the ticks’ genomes. Tick cell lines play an important role in virus discovery and isolation through the identification of novel viruses chronically infecting such cell lines and by acting as host cells to aid in determining whether or not an entire replication-competent, infective virus is present in a sample. Here, we review recent progress in tick-borne virus discovery and comment on the actual and potential applications for tick cell lines in this emerging research area. PMID:27679414

  7. Virus Discovery Using Tick Cell Lines

    PubMed Central

    Bell-Sakyi, Lesley; Attoui, Houssam

    2016-01-01

    While ticks have been known to harbor and transmit pathogenic arboviruses for over 80 years, the application of high-throughput sequencing technologies has revealed that ticks also appear to harbor a diverse range of endogenous tick-only viruses belonging to many different families. Almost nothing is known about these viruses; indeed, it is unclear in most cases whether the identified viral sequences are derived from actual replication-competent viruses or from endogenous virus elements incorporated into the ticks’ genomes. Tick cell lines play an important role in virus discovery and isolation through the identification of novel viruses chronically infecting such cell lines and by acting as host cells to aid in determining whether or not an entire replication-competent, infective virus is present in a sample. Here, we review recent progress in tick-borne virus discovery and comment on the actual and potential applications for tick cell lines in this emerging research area.

  8. Ticks on Deer and Cattle in the Cattle Fever Tick Permanent Quarantine Zone, 2012

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Ticks were sampled from hosts in the cattle fever tick permanent quarantine zone along the Texas-Mexico border on five occasions in 2012. Three sample events involved white-tailed deer populations in Zapata and Starr Counties and two were from a cattle herd in Kinney County. Six species of ticks (n ...

  9. Tick Genome Assembled: New Opportunities for Research on Tick-Host-Pathogen Interactions

    PubMed Central

    de la Fuente, José; Waterhouse, Robert M.; Sonenshine, Daniel E.; Roe, R. Michael; Ribeiro, Jose M.; Sattelle, David B.; Hill, Catherine A.

    2016-01-01

    As tick-borne diseases are on the rise, an international effort resulted in the sequence and assembly of the first genome of a tick vector. This result promotes research on comparative, functional and evolutionary genomics and the study of tick-host-pathogen interactions to improve human, animal and ecosystem health on a global scale. PMID:27695689

  10. Tick Genome Assembled: New Opportunities for Research on Tick-Host-Pathogen Interactions

    PubMed Central

    de la Fuente, José; Waterhouse, Robert M.; Sonenshine, Daniel E.; Roe, R. Michael; Ribeiro, Jose M.; Sattelle, David B.; Hill, Catherine A.

    2016-01-01

    As tick-borne diseases are on the rise, an international effort resulted in the sequence and assembly of the first genome of a tick vector. This result promotes research on comparative, functional and evolutionary genomics and the study of tick-host-pathogen interactions to improve human, animal and ecosystem health on a global scale.

  11. Human Tick-Borne Encephalitis and Characterization of Virus from Biting Tick

    PubMed Central

    Lindqvist, Richard; Norberg, Peter; Lindblom, Pontus; Roth, Anette; Forsberg, Pia; Bergström, Tomas; Överby, Anna K.; Lindgren, Per-Eric

    2016-01-01

    We report a case of human tick-borne encephalitis (TBE) in which the TBE virus was isolated from the biting tick. Viral growth and sequence were characterized and compared with those of a reference strain. Virus isolation from ticks from patients with TBE may offer a new approach for studies of epidemiology and pathogenicity. PMID:27434395

  12. Tick-borne Diseases in Animals and USDA Research on Tick Control

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Tick-borne diseases represent a major threat to animal health in the United States. The cattle industry in the United States has benefited greatly from the continued USDA efforts through the Cattle Fever Tick Eradication Program in preventing the re-introduction of cattle ticks and associated pathog...

  13. TICK: Transparent Incremental Checkpointing at Kernel Level

    SciTech Connect

    Petrini, Fabrizio; Gioiosa, Roberto

    2004-10-25

    TICK is a software package implemented in Linux 2.6 that allows the save and restore of user processes, without any change to the user code or binary. With TICK a process can be suspended by the Linux kernel upon receiving an interrupt and saved in a file. This file can be later thawed in another computer running Linux (potentially the same computer). TICK is implemented as a Linux kernel module, in the Linux version 2.6.5

  14. [Fungal bio-control agents against ixodid tick--a review].

    PubMed

    Sun, Ming; Wang, Xiaoyan; Luo, Jianxun

    2012-08-01

    Entomopathogenic fungi as potential agents for bio-control have been widely applied in the control of insect pests in agriculture. However, the application remains in laboratory scale for the control of ectoparasites. Owing to the need to combat the short lasting period of chemical acaricides and reduction of pollution, it is urgent to develop sufficient, stable and safe measures for tick control. We reviewed the primary scientific achievements in utilization of environmental microbes for controlling of ticks. Studies conducted in this field may benefit to sustainable development, environmental protection, maintaining ecological balance and production of green products.

  15. [Diseases transmitted by ticks locally and abroad].

    PubMed

    Gétaz, L; Loutan, L; Mezger, N

    2012-05-01

    This article provides a brief overview of some diseases transmitted by ticks. These vectors do not transmit only Lyme disease and tickborne-encephalitis, even in Switzerland. Several tick-borne diseases cause nonspecific flu-like symptoms. Nevertheless sometimes severe, some of these diseases can be treated with specific treatments. Repellents, appropriate clothes impregnated with permethrine and prompt removal of the tick are effective preventive measures to limit the risk of infection. There is an effective vaccine which protects against tick-borne encephalitis. PMID:22662624

  16. Vaccinomics Approach to Tick Vaccine Development.

    PubMed

    Contreras, Marinela; Villar, Margarita; Alberdi, Pilar; de la Fuente, José

    2016-01-01

    Ticks are blood-feeding arthropod ectoparasites that transmit disease-causing pathogens to humans and animals worldwide. Vaccines using tick antigens have proven to be cost-effective and environmental friendly for the control of vector infestations and pathogen infection and transmission. However, new strategies are needed to identify tick protective antigens for development of improved vaccines. These strategies will be greatly enhanced by vaccinomics approaches starting from the study of tick-host-pathogen molecular interactions and ending in the characterization and validation of vaccine formulations. The discovery of tick antigens that affect both tick infestations and pathogen infection/transmission could be used for vaccines targeting human and animal populations at risk and reservoir species to reduce host exposure to ticks while reducing the number of infected ticks and their vector capacity for pathogens that affect human and animal health. In this chapter, we describe methods of the vaccinomics platform using transcriptomics and proteomics for the identification of candidate protective antigens in Ixodes scapularis, the vector for human and animal granulocytic anaplasmosis, tick-borne encephalitis, and Lyme disease.

  17. Vaccinomics Approach to Tick Vaccine Development.

    PubMed

    Contreras, Marinela; Villar, Margarita; Alberdi, Pilar; de la Fuente, José

    2016-01-01

    Ticks are blood-feeding arthropod ectoparasites that transmit disease-causing pathogens to humans and animals worldwide. Vaccines using tick antigens have proven to be cost-effective and environmental friendly for the control of vector infestations and pathogen infection and transmission. However, new strategies are needed to identify tick protective antigens for development of improved vaccines. These strategies will be greatly enhanced by vaccinomics approaches starting from the study of tick-host-pathogen molecular interactions and ending in the characterization and validation of vaccine formulations. The discovery of tick antigens that affect both tick infestations and pathogen infection/transmission could be used for vaccines targeting human and animal populations at risk and reservoir species to reduce host exposure to ticks while reducing the number of infected ticks and their vector capacity for pathogens that affect human and animal health. In this chapter, we describe methods of the vaccinomics platform using transcriptomics and proteomics for the identification of candidate protective antigens in Ixodes scapularis, the vector for human and animal granulocytic anaplasmosis, tick-borne encephalitis, and Lyme disease. PMID:27076305

  18. Tick-induced allergies: mammalian meat allergy, tick anaphylaxis and their significance

    PubMed Central

    2015-01-01

    Serious tick-induced allergies comprise mammalian meat allergy following tick bites and tick anaphylaxis. Mammalian meat allergy is an emergent allergy, increasingly prevalent in tick-endemic areas of Australia and the United States, occurring worldwide where ticks are endemic. Sensitisation to galactose-α-1,3-galactose (α-Gal) has been shown to be the mechanism of allergic reaction in mammalian meat allergy following tick bite. Whilst other carbohydrate allergens have been identified, this allergen is unique amongst carbohydrate food allergens in provoking anaphylaxis. Treatment of mammalian meat anaphylaxis involves avoidance of mammalian meat and mammalian derived products in those who also react to gelatine and mammalian milks. Before initiating treatment with certain therapeutic agents (e.g., cetuximab, gelatine-containing substances), a careful assessment of the risk of anaphylaxis, including serological analysis for α-Gal specific-IgE, should be undertaken in any individual who works, lives, volunteers or recreates in a tick endemic area. Prevention of tick bites may ameliorate mammalian meat allergy. Tick anaphylaxis is rare in countries other than Australia. Tick anaphylaxis is secondarily preventable by prevention and appropriate management of tick bites. Analysis of tick removal techniques in tick anaphylaxis sufferers offers insights into primary prevention of both tick and mammalian meat anaphylaxis. Recognition of the association between mammalian meat allergy and tick bites has established a novel cause and effect relationship between an environmental exposure and subsequent development of a food allergy, directing us towards examining environmental exposures as provoking factors pivotal to the development of other food allergies and refocusing our attention upon causation of allergy in general. PMID:25653915

  19. Tick-induced allergies: mammalian meat allergy, tick anaphylaxis and their significance.

    PubMed

    van Nunen, Sheryl

    2015-01-01

    Serious tick-induced allergies comprise mammalian meat allergy following tick bites and tick anaphylaxis. Mammalian meat allergy is an emergent allergy, increasingly prevalent in tick-endemic areas of Australia and the United States, occurring worldwide where ticks are endemic. Sensitisation to galactose-α-1,3-galactose (α-Gal) has been shown to be the mechanism of allergic reaction in mammalian meat allergy following tick bite. Whilst other carbohydrate allergens have been identified, this allergen is unique amongst carbohydrate food allergens in provoking anaphylaxis. Treatment of mammalian meat anaphylaxis involves avoidance of mammalian meat and mammalian derived products in those who also react to gelatine and mammalian milks. Before initiating treatment with certain therapeutic agents (e.g., cetuximab, gelatine-containing substances), a careful assessment of the risk of anaphylaxis, including serological analysis for α-Gal specific-IgE, should be undertaken in any individual who works, lives, volunteers or recreates in a tick endemic area. Prevention of tick bites may ameliorate mammalian meat allergy. Tick anaphylaxis is rare in countries other than Australia. Tick anaphylaxis is secondarily preventable by prevention and appropriate management of tick bites. Analysis of tick removal techniques in tick anaphylaxis sufferers offers insights into primary prevention of both tick and mammalian meat anaphylaxis. Recognition of the association between mammalian meat allergy and tick bites has established a novel cause and effect relationship between an environmental exposure and subsequent development of a food allergy, directing us towards examining environmental exposures as provoking factors pivotal to the development of other food allergies and refocusing our attention upon causation of allergy in general. PMID:25653915

  20. Research on the ecology of ticks and tick-borne pathogens—methodological principles and caveats

    PubMed Central

    Estrada-Peña, Agustín; Gray, Jeremy S.; Kahl, Olaf; Lane, Robert S.; Nijhof, Ard M.

    2013-01-01

    Interest in tick-transmitted pathogens has experienced an upsurge in the past few decades. Routine application of tools for the detection of fragments of foreign DNA in ticks, together with a high degree of interest in the quantification of disease risk for humans, has led to a marked increase in the number of reports on the eco-epidemiology of tick-borne diseases. However, procedural errors continue to accumulate in the scientific literature, resulting in misleading information. For example, unreliable identification of ticks and pathogens, erroneous interpretations of short-term field studies, and the hasty acceptance of some tick species as vectors have led to ambiguities regarding the vector role of these arthropods. In this review, we focus on the ecological features driving the life cycle of ticks and the resulting effects on the eco-epidemiology of tick-transmitted pathogens. We review the factors affecting field collections of ticks, and we describe the biologically and ecologically appropriate procedures for describing tick host-seeking activity and its correlation with environmental traits. We detail the climatic variables that have biological importance on ticks and explain how they should be properly measured and analyzed. We also provide evidence to critically reject the use of some environmental traits that are being increasingly reported as the drivers of the behavior of ticks. With the aim of standardization, we propose unambiguous definitions of the status of hosts and ticks regarding their ability to maintain and spread a given pathogen. We also describe laboratory procedures and standards for evaluating the vectorial capacity of a tick or the reservoir role of a host. This approach should provide a coherent framework for the reporting of research findings concerning ticks and tick-borne diseases. PMID:23964348

  1. Tick bite - a case study.

    PubMed

    McGrath, Mark; Buchan-Hepburn, Garry

    2012-03-01

    A woman, 84 years of age, presented to our southeastern Queensland general practice for removal of an engorged tick from her right external auditory meatus, thought to have been present for several days. She re-presented 3 days later with a right facial nerve palsy that affected her frontalis muscle only (Figure 1). The facial nerve palsy resolved spontaneously over the next 7 days (Figure 2). PMID:22396925

  2. The mitochondrial genome of a Texas outbreak strain of the cattle tick, Rhipicephalus (Boophilus) microplus, derived from whole genome sequencing Pacific Biosciences and Illumina reads.

    PubMed

    McCooke, John K; Guerrero, Felix D; Barrero, Roberto A; Black, Michael; Hunter, Adam; Bell, Callum; Schilkey, Faye; Miller, Robert J; Bellgard, Matthew I

    2015-10-15

    The cattle fever tick, Rhipicephalus (Boophilus) microplus is one of the most significant medical veterinary pests in the world, vectoring several serious livestock diseases negatively impacting agricultural economies of tropical and subtropical countries around the world. In our study, we assembled the complete R. microplus mitochondrial genome from Illumina and Pac Bio sequencing reads obtained from the ongoing R. microplus (Deutsch strain from Texas, USA) genome sequencing project. We compared the Deutsch strain mitogenome to the mitogenome from a Brazilian R. microplus and from an Australian cattle tick that has recently been taxonomically designated as Rhipicephalus australis after previously being considered R. microplus. The sequence divergence of the Texas and Australia ticks is much higher than the divergence between the Texas and Brazil ticks. This is consistent with the idea that the Australian ticks are distinct from the R. microplus of the Americas.

  3. The mitochondrial genome of a Texas outbreak strain of the cattle tick, Rhipicephalus (Boophilus) microplus, derived from whole genome sequencing Pacific Biosciences and Illumina reads.

    PubMed

    McCooke, John K; Guerrero, Felix D; Barrero, Roberto A; Black, Michael; Hunter, Adam; Bell, Callum; Schilkey, Faye; Miller, Robert J; Bellgard, Matthew I

    2015-10-15

    The cattle fever tick, Rhipicephalus (Boophilus) microplus is one of the most significant medical veterinary pests in the world, vectoring several serious livestock diseases negatively impacting agricultural economies of tropical and subtropical countries around the world. In our study, we assembled the complete R. microplus mitochondrial genome from Illumina and Pac Bio sequencing reads obtained from the ongoing R. microplus (Deutsch strain from Texas, USA) genome sequencing project. We compared the Deutsch strain mitogenome to the mitogenome from a Brazilian R. microplus and from an Australian cattle tick that has recently been taxonomically designated as Rhipicephalus australis after previously being considered R. microplus. The sequence divergence of the Texas and Australia ticks is much higher than the divergence between the Texas and Brazil ticks. This is consistent with the idea that the Australian ticks are distinct from the R. microplus of the Americas. PMID:26117172

  4. Tick-borne rickettsial pathogens in questing ticks, removed from humans and animals in Mexico

    PubMed Central

    Vargas-Sandoval, Margarita; Torres, Javier

    2016-01-01

    Tick-borne rickettsial diseases (TBRD) are commonly encountered in medical and veterinary clinical settings. The control of these diseases is difficult, requiring disruption of a complex transmission chain involving a vertebrate host and ticks. The geographical distribution of the diseases is related to distribution of the vector, which is an indicator of risk for the population. A total of 1,107 ticks were collected by tick dragging from forests, ecotourism parks and hosts at 101 sites in 22 of the 32 states of Mexico. Collected ticks were placed in 1.5 mL cryovials containing 70% ethanol and were identified to species. Ticks were pooled according to location/host of collection, date of collection, sex, and stage of development. A total of 51 ticks were assayed by polymerase chain reaction (PCR) to confirm species identification using morphological methods. A total of 477 pools of ticks were assayed using PCR techniques for selected tick-borne pathogens. Anaplasma phagocytophilum was the most commonly detected pathogen (45 pools), followed by, Ehrlichia (E.) canis (42), Rickettsia (R.) rickettsii (11), E. chaffeensis (8), and R. amblyommii (1). Rhipicephalus sanguineus was the tick most frequently positive for selected pathogens. Overall, our results indicate that potential tick vectors positive for rickettsial pathogens are distributed throughout the area surveyed in Mexico. PMID:26726019

  5. Accelerated infectivity of tick-transmitted Lyme disease spirochetes to vector ticks.

    PubMed

    Shih, C M; Liu, L P

    1996-09-01

    We determined whether the span of infectivity of Lyme disease spirochetes (Borrelia burgdorferi) to vector ticks varies with the mode of infection in laboratory mice. Noninfected larval deer ticks were permitted to feed on two strains of spirochete-infected mice that had been naturally (via tick bite) and parenterally (via needle injection) infected with B. burgdorferi 2, 4, or 8 weeks earlier, and engorged ticks were dissected and examined for spirochetes by direct immunofluorescence microscopy. After initial infection, spirochetal infectivity to ticks was less efficient in needle-infected mice than in mice infected via tick bites. Tick-transmitted spirochetes develop more rapidly from the skin of infected mice and do not induce a strong antispirochete antibody response during the early stage of infection.

  6. Rickettsial and other tick-borne infections.

    PubMed

    Flicek, Barbara Fouts

    2007-03-01

    Tick bites are best prevented by people avoiding tick-infested areas. When this is not possible, tick bites may be prevented by the wearing of long trousers that are tucked into boots. The best method to avoid tick bites is twofold: application of a topical deet (N,N-diethyl-m-toluamide) repellent to exposed skin, and treatment of clothing with permethrin. This system is currently used by the US Army to protect soldiers. Ticks can crawl underneath clothing and bite untreated portions of the body; therefore, treating clothing is imperative. Permethrin is nontoxic to humans, and can be used in any age group. Permethrin is commercially available. Checking clothing regularly while in tick-infested areas is highly recommended to back up the few hours of protection provided by the insect repellents. It is also recommended that the entire body be carefully screened for ticks and other parasites by campers and hunters while they are staying in and after leaving infested areas. Any tick found should be removed immediately. Removing ticks may not be easy. It is best to use blunt, rounded forceps, and a magnifying glass to remove ticks, especially when immature ticks are found. The forceps are used to grasp the mouthparts of the tick as close as possible to the skin, and then the tick is pulled upward, perpendicular to the skin, with a continuous and steady action. Usually any mouth parts of the tick retained in the skin are eliminated uneventfully by the body. Other methods of removing ticks, such as using fingers, lighted cigarettes, petroleum jelly, or suntan oil, should be avoided. Killing the tick in situ may increase the risk of regurgitation by the tick and the transmission of infectious agents. Most stick bites are uncomplicated, and result only in benign cutaneous inflammatory reactions that may be pruritic for a few days. As a result of mouthparts being retained at the feeding site, a granuloma may rarely develop. There are no data to indicate that antimicrobial

  7. Employee Handbook

    SciTech Connect

    Bello, Madelyn

    2008-09-05

    Welcome to Berkeley Lab. You are joining or are already a part of a laboratory with a sterling tradition of scientific achievement, including eleven Nobel Laureates and thirteen National Medal of Science winners. No matter what job you do, you make Berkeley Lab the outstanding organization that it is. Without your hard work and dedication, we could not achieve all that we have. We value you and thank you for choosing to be part of our community. This Employee Handbook is designed to help you navigate the Lab. With over 3,000 employees, an additional 3,000 guests visiting from countries around the world, a 200-acre campus and many policies and procedures, learning all the ins and outs may seem overwhelming, especially if you're a new employee. However, even if you have been here for a while, this Handbook should be a useful reference tool. It is meant to serve as a guide, highlighting and summarizing what you need to know and informing you where you can go for more detailed information. The general information provided in this Handbook serves only as a brief description of many of the Lab's policies. Policies, procedures and information are found in the Lab's Regulations and Procedures Manual (RPM), Summary Plan Descriptions, University of California policies, and provisions of Contract 31 between the Regents of the University and the U.S. Department of Energy. In addition, specific terms and conditions for represented employees are found in applicable collective bargaining agreements. Nothing in this Handbook is intended to supplant, change or conflict with the previously mentioned documents. In addition, the information in this Handbook does not constitute a contract or a promise of continued employment and may be changed at any time by the Lab. We believe employees are happier and more productive if they know what they can expect from their organization and what their organization expects from them. The Handbook will familiarize you with the privileges, benefits

  8. 7 CFR 3.76 - Result if employee fails to meet deadlines.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Result if employee fails to meet deadlines. 3.76 Section 3.76 Agriculture Office of the Secretary of Agriculture DEBT MANAGEMENT Federal Salary Offset § 3.76 Result if employee fails to meet deadlines. An employee will not be granted a hearing and...

  9. 7 CFR 3.76 - Result if employee fails to meet deadlines.

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... 7 Agriculture 1 2011-01-01 2011-01-01 false Result if employee fails to meet deadlines. 3.76 Section 3.76 Agriculture Office of the Secretary of Agriculture DEBT MANAGEMENT Federal Salary Offset § 3.76 Result if employee fails to meet deadlines. An employee will not be granted a hearing and...

  10. 7 CFR 3.76 - Result if employee fails to meet deadlines.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... 7 Agriculture 1 2014-01-01 2014-01-01 false Result if employee fails to meet deadlines. 3.76 Section 3.76 Agriculture Office of the Secretary of Agriculture DEBT MANAGEMENT Federal Salary Offset § 3.76 Result if employee fails to meet deadlines. An employee will not be granted a hearing and...

  11. Modern advances in sustainable tick control

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Ticks are the vector of the many different organisms responsible for both animal and human diseases. Understanding the progress we have made and new directions in tick control is critical to the sustainability of human and animal health. The integration of vaccines, acaricides, and new acaricide ap...

  12. Chemical ecology of tick-host interactions

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Ticks impact the health of livestock and humans world-wide through their roles as pests and vectors of diseases such as heartwater, theileriosis, anaplasmosis, babesiosis, Lyme disease, erhlichiosis, tick-borne encephalitis and Crimean Congo Haemorrhagic fever. Intrinsic to their capacity to serve ...

  13. 9 CFR 3.85 - Employees.

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... Welfare regulations (9 CFR parts 1, 2, and 3) maintaining nonhuman primates must have enough employees to... 9 Animals and Animal Products 1 2011-01-01 2011-01-01 false Employees. 3.85 Section 3.85 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE...

  14. 9 CFR 3.85 - Employees.

    Code of Federal Regulations, 2012 CFR

    2012-01-01

    ... Welfare regulations (9 CFR parts 1, 2, and 3) maintaining nonhuman primates must have enough employees to... 9 Animals and Animal Products 1 2012-01-01 2012-01-01 false Employees. 3.85 Section 3.85 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE...

  15. 9 CFR 3.85 - Employees.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... Welfare regulations (9 CFR parts 1, 2, and 3) maintaining nonhuman primates must have enough employees to... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Employees. 3.85 Section 3.85 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE...

  16. 9 CFR 3.85 - Employees.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... Welfare regulations (9 CFR parts 1, 2, and 3) maintaining nonhuman primates must have enough employees to... 9 Animals and Animal Products 1 2014-01-01 2014-01-01 false Employees. 3.85 Section 3.85 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE...

  17. 9 CFR 3.85 - Employees.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... Welfare regulations (9 CFR parts 1, 2, and 3) maintaining nonhuman primates must have enough employees to... 9 Animals and Animal Products 1 2013-01-01 2013-01-01 false Employees. 3.85 Section 3.85 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE...

  18. Tick capillary feeding for the study of proteins involved in tick-pathogen interactions as potential antigens for the control of tick infestation and pathogen infection

    PubMed Central

    2014-01-01

    Background Ticks represent a significant health risk to animals and humans due to the variety of pathogens they can transmit during feeding. The traditional use of chemicals to control ticks has serious drawbacks, including the selection of acaricide-resistant ticks and environmental contamination with chemical residues. Vaccination with the tick midgut antigen BM86 was shown to be a good alternative for cattle tick control. However, results vary considerably between tick species and geographic location. Therefore, new antigens are required for the development of vaccines controlling both tick infestations and pathogen infection/transmission. Tick proteins involved in tick-pathogen interactions may provide good candidate protective antigens for these vaccines, but appropriate screening procedures are needed to select the best candidates. Methods In this study, we selected proteins involved in tick-Anaplasma (Subolesin and SILK) and tick-Babesia (TROSPA) interactions and used in vitro capillary feeding to characterize their potential as antigens for the control of cattle tick infestations and infection with Anaplasma marginale and Babesia bigemina. Purified rabbit polyclonal antibodies were generated against recombinant SUB, SILK and TROSPA and added to uninfected or infected bovine blood to capillary-feed female Rhipicephalus (Boophilus) microplus ticks. Tick weight, oviposition and pathogen DNA levels were determined in treated and control ticks. Results The specificity of purified rabbit polyclonal antibodies against tick recombinant proteins was confirmed by Western blot and against native proteins in tick cell lines and tick tissues using immunofluorescence. Capillary-fed ticks ingested antibodies added to the blood meal and the effect of these antibodies on tick weight and oviposition was shown. However, no effect was observed on pathogen DNA levels. Conclusions These results highlighted the advantages and some of the disadvantages of in vitro tick capillary

  19. Tick-borne rickettsial pathogens in questing ticks, removed from humans and animals in Mexico.

    PubMed

    Sosa-Gutierrez, Carolina G; Vargas-Sandoval, Margarita; Torres, Javier; Gordillo-Pérez, Guadalupe

    2016-09-30

    Tick-borne rickettsial diseases (TBRD) are commonly encountered in medical and veterinary clinical settings. The control of these diseases is difficult, requiring disruption of a complex transmission chain involving a vertebrate host and ticks. The geographical distribution of the diseases is related to distribution of the vector, which is an indicator of risk for the population. A total of 1107 were collected by tick drag from forests, ecotourism parks and hosts at 101 sites in 22 of the 32 states of Mexico. Collected ticks were placed in 1.5 mL cryovials containing 70% ethanol and were identified to species. Ticks were pooled according to location/host of collection, date of collection, sex, and stage of development. A total of 51 ticks were assayed by polymerase chain reaction (PCR) to confirm species identification using morphological methods. A total of 477 pools of ticks were assayed using PCR techniques for selected tick-borne pathogens. Anaplasma phagocytophilum was the most commonly detected pathogen (45 pools), followed by, Ehrlichia (E.) canis (42), Rickettsia (R.) rickettsii (11), E. chaffeensis (8), and R. amblyommii (1). Rhipicephalus sanguineus was the tick most frequently positive for selected pathogens. Overall, our results indicate that potential tick vectors positive for rickettsial pathogens are distributed throughout the area surveyed in Mexico.

  20. Tick-borne rickettsial pathogens in questing ticks, removed from humans and animals in Mexico.

    PubMed

    Sosa-Gutierrez, Carolina G; Vargas-Sandoval, Margarita; Torres, Javier; Gordillo-Pérez, Guadalupe

    2016-09-30

    Tick-borne rickettsial diseases (TBRD) are commonly encountered in medical and veterinary clinical settings. The control of these diseases is difficult, requiring disruption of a complex transmission chain involving a vertebrate host and ticks. The geographical distribution of the diseases is related to distribution of the vector, which is an indicator of risk for the population. A total of 1107 were collected by tick drag from forests, ecotourism parks and hosts at 101 sites in 22 of the 32 states of Mexico. Collected ticks were placed in 1.5 mL cryovials containing 70% ethanol and were identified to species. Ticks were pooled according to location/host of collection, date of collection, sex, and stage of development. A total of 51 ticks were assayed by polymerase chain reaction (PCR) to confirm species identification using morphological methods. A total of 477 pools of ticks were assayed using PCR techniques for selected tick-borne pathogens. Anaplasma phagocytophilum was the most commonly detected pathogen (45 pools), followed by, Ehrlichia (E.) canis (42), Rickettsia (R.) rickettsii (11), E. chaffeensis (8), and R. amblyommii (1). Rhipicephalus sanguineus was the tick most frequently positive for selected pathogens. Overall, our results indicate that potential tick vectors positive for rickettsial pathogens are distributed throughout the area surveyed in Mexico. PMID:26726019

  1. A brown dog tick (Rhipicephalus sanguineus) bite at sea.

    PubMed

    Stachow, E

    2015-01-01

    Medical Officers (MOs) and Medical Branch Ratings (MBRs) must maintain an awareness of the risk of vector-borne diseases among deployed personnel. Personnel working in the maritime environment may not expect to be at risk of tick bites, as ticks typically occupy habitats with dense vegetation such as forests or scrub land. However, tick-borne pathogens can cause serious and sometimes fatal disease, and therefore the risk of tick bites and associated diseases should be recognised. We present a case of a tick bite in a member of a ship's company eight days after leaving port. The tick was identified as a brown dog tick (Rhipicephalus sanguineus), a species known to thrive indoors. We describe several important tick-borne diseases which can be transmitted by R. sanguineus and explore best practice for tick removal and aftercare. Finally, we outline the appropriate management of suspected tick-borne disease in deployed personnel in the maritime environment. PMID:26867423

  2. A brown dog tick (Rhipicephalus sanguineus) bite at sea.

    PubMed

    Stachow, E

    2015-01-01

    Medical Officers (MOs) and Medical Branch Ratings (MBRs) must maintain an awareness of the risk of vector-borne diseases among deployed personnel. Personnel working in the maritime environment may not expect to be at risk of tick bites, as ticks typically occupy habitats with dense vegetation such as forests or scrub land. However, tick-borne pathogens can cause serious and sometimes fatal disease, and therefore the risk of tick bites and associated diseases should be recognised. We present a case of a tick bite in a member of a ship's company eight days after leaving port. The tick was identified as a brown dog tick (Rhipicephalus sanguineus), a species known to thrive indoors. We describe several important tick-borne diseases which can be transmitted by R. sanguineus and explore best practice for tick removal and aftercare. Finally, we outline the appropriate management of suspected tick-borne disease in deployed personnel in the maritime environment.

  3. County Scale Distribution of Amblyomma americanum (Ixodida: Ixodidae) in Oklahoma: Addressing Local Deficits in Tick Maps Based on Passive Reporting.

    PubMed

    Barrett, Anne W; Noden, Bruce H; Gruntmeir, Jeff M; Holland, Taylor; Mitcham, Jessica R; Martin, Jaclyn E; Johnson, Eileen M; Little, Susan E

    2015-03-01

    Geographic distribution records for the lone star tick [Amblyomma americanum (L.)] in the peer-reviewed literature are incomplete for Oklahoma, preventing accurate disease risk assessments. To address this issue and document the presence of A. americanum in available habitats throughout the state, county-scale tick records published in U.S. Department of Agriculture-Cooperative Economic Insect Reports and specimens maintained at the K.C. Emerson Entomology Museum, Oklahoma State University, were reviewed. In addition, dry ice traps and tick drags were used to collect adult and nymphal A. americanum from throughout the state. Review of published USDA reports and the local museum collection documented A. americanum in 49 total counties (35 and 35, respectively). Active surveillance efforts confirmed the presence of this tick in 50 counties from which this species had not been previously reported to be established, documenting A. americanum is established in 68 of the 77 (88.3%) counties in Oklahoma. Taken together, these data verify that A. americanum ticks are much more widespread in Oklahoma than reflected in the literature, a phenomenon likely repeated throughout the geographic range of this tick in the eastern half of North America. PMID:26336311

  4. Detection of tick-borne encephalitis virus in I. ricinus ticks collected from autumn migratory birds in Latvia.

    PubMed

    Kazarina, Alisa; Japiņa, Kristīne; Keišs, Oskars; Salmane, Ineta; Bandere, Dace; Capligina, Valentina; Ranka, Renāte

    2015-03-01

    Birds have a potential of spreading ticks via bird migration routes. In this study, we screened 170 ticks removed during autumn 2010 from 55 birds belonging to 10 species for the presence of tick-borne encephalitis virus (TBEV). In total, TBEV RNA was detected in 14% of I. ricinus tick samples obtained from different birds species. The results of this study indicate the possible role of migrating birds in the dispersal of TBEV-infected ticks along the southward migration route.

  5. Agricultural Animal Pest Control. Bulletin 767.

    ERIC Educational Resources Information Center

    Nolan, Maxcy P., Jr.

    Included in this training manual are descriptions and pictures of the following agricultural animal pests: mosquitoes, stable flies, horse flies and deer or yellow flies, house flies, horn flies, wound-infesting larvae, lice, mites, ticks, and bots and grubs. Information is given on the life-cycle and breeding habits of the pests. Methods of…

  6. Influence of the Biotope on the Tick Infestation of Cattle and on the Tick-Borne Pathogen Repertoire of Cattle Ticks in Ethiopia

    PubMed Central

    Hornok, Sándor; Abichu, Getachew; Meli, Marina L.; Tánczos, Balázs; Sulyok, Kinga M.; Gyuranecz, Miklós; Gönczi, Enikő; Farkas, Róbert; Hofmann-Lehmann, Regina

    2014-01-01

    Background The majority of vector-borne infections occur in the tropics, including Africa, but molecular eco-epidemiological studies are seldom reported from these regions. In particular, most previously published data on ticks in Ethiopia focus on species distribution, and only a few molecular studies on the occurrence of tick-borne pathogens or on ecological factors influencing these. The present study was undertaken to evaluate, if ticks collected from cattle in different Ethiopian biotopes harbour (had access to) different pathogens. Methods In South-Western Ethiopia 1032 hard ticks were removed from cattle grazing in three kinds of tick biotopes. DNA was individually extracted from one specimen of both sexes of each tick species per cattle. These samples were molecularly analysed for the presence of tick-borne pathogens. Results Amblyomma variegatum was significantly more abundant on mid highland, than on moist highland. Rhipicephalus decoloratus was absent from savannah lowland, where virtually only A. cohaerens was found. In the ticks Coxiella burnetii had the highest prevalence on savannah lowland. PCR positivity to Theileria spp. did not appear to depend on the biotope, but some genotypes were unique to certain tick species. Significantly more A. variegatum specimens were rickettsia-positive, than those of other tick species. The presence of rickettsiae (R. africae) appeared to be associated with mid highland in case of A. variegatum and A. cohaerens. The low level of haemoplasma positivity seemed to be equally distributed among the tick species, but was restricted to one biotope type. Conclusions The tick biotope, in which cattle are grazed, will influence not only the tick burden of these hosts, but also the spectrum of pathogens in their ticks. Thus, the presence of pathogens with alternative (non-tick-borne) transmission routes, with transstadial or with transovarial transmission by ticks appeared to be associated with the biotope type, with the tick

  7. Coendangered hard-ticks: threatened or threatening?

    PubMed

    Mihalca, Andrei Daniel; Gherman, Călin Mircea; Cozma, Vasile

    2011-01-01

    The overwhelming majority of animal conservation projects are focused on vertebrates, despite most of the species on Earth being invertebrates. Estimates state that about half of all named species of invertebrates are parasitic in at least one stage of their development. The dilemma of viewing parasites as biodiversity or pest has been discussed by several authors. However, ticks were omitted. The latest taxonomic synopses of non-fossil Ixodidae consider valid 700 species. Though, how many of them are still extant is almost impossible to tell, as many of them are known only from type specimens in museums and were never collected since their original description. Moreover, many hosts are endangered and as part of conservation efforts of threatened vertebrates, a common practice is the removal of, and treatment for external parasites, with devastating impact on tick populations. There are several known cases when the host became extinct with subsequent coextinction of their ectoparasites. For our synoptic approach we have used the IUCN status of the host in order to evaluate the status of specifically associated hard-ticks. As a result, we propose a number of 63 coendangered and one extinct hard-tick species. On the other side of the coin, the most important issue regarding tick-host associations is vectorial transmission of microbial pathogens (i.e. viruses, bacteria, protozoans). Tick-borne diseases of threatened vertebrates are sometimes fatal to their hosts. Mortality associated with pathogens acquired from ticks has been documented in several cases, mostly after translocations. Are ticks a real threat to their coendangered host and should they be eliminated? Up to date, there are no reliable proofs that ticks listed by us as coendangered are competent vectors for pathogens of endangered animals. PMID:21554736

  8. A list of the 70 species of Australian ticks; diagnostic guides to and species accounts of Ixodes holocyclus (paralysis tick), Ixodes cornuatus (southern paralysis tick) and Rhipicephalus australis (Australian cattle tick); and consideration of the place of Australia in the evolution of ticks with comments on four controversial ideas.

    PubMed

    Barker, Stephen C; Walker, Alan R; Campelo, Dayana

    2014-10-15

    Seventy species of ticks are known from Australia: 14 soft ticks (family Argasidae) and 56 hard ticks (family Ixodidae). Sixteen of the 70 ticks in Australia may feed on humans and domestic animals (Barker and Walker 2014). The other 54 species of ticks in Australia feed only on wild mammals, reptiles and birds. At least 12 of the species of ticks in Australian also occur in Papua New Guinea. We use an image-matching system much like the image-matching systems of field guides to birds and flowers to identify Ixodes holocyclus (paralysis tick), Ixodes cornuatus (southern paralysis tick) and Rhipicephalus (Boophilus) australis (Australian cattle tick). Our species accounts have reviews of the literature on I. holocyclus (paralysis tick) from the first paper on the biology of an Australian tick by Bancroft (1884), on paralysis of dogs by I. holocyclus, to papers published recently, and of I. cornuatus (southern paralysis tick) and Rhipicephalus (Boophilus) australis (Australian cattle tick). We comment on four controversial questions in the evolutionary biology of ticks: (i) were labyrinthodont amphibians in Australia in the Devonian the first hosts of soft, hard and nuttalliellid ticks?; (ii) are the nuttalliellid ticks the sister-group to the hard ticks or the soft ticks?; (iii) is Nuttalliella namaqua the missing link between the soft and hard ticks?; and (iv) the evidence for a lineage of large bodied parasitiform mites (ticks plus the holothyrid mites plus the opiliocarid mites).

  9. Host specialization in ticks and transmission of tick-borne diseases: a review

    PubMed Central

    McCoy, Karen D.; Léger, Elsa; Dietrich, Muriel

    2013-01-01

    Determining patterns of host use, and the frequency at which these patterns change, are of key importance if we are to understand tick population dynamics, the evolution of tick biodiversity, and the circulation and evolution of associated pathogens. The question of whether ticks are typically host specialists or host generalists has been subject to much debate over the last half-century. Indeed, early research proposed that morphological diversity in ticks was linked to host specific adaptations and that most ticks were specialists. Later work disputed this idea and suggested that ticks are largely limited by biogeographic conditions and tend to use all locally available host species. The work presented in this review suggests that the actual answer likely lies somewhere between these two extremes. Although recent observational studies support the view that phylogenetically diverse host species share ticks when found on similar ecological ranges, theory on host range evolution predicts that host specialization should evolve in ticks given their life history characteristics. Contemporary work employing population genetic tools to examine host-associated population structure in several tick systems support this prediction and show that simple species records are not enough to determine whether a parasite is a true host generalist; host specialization does evolve in ticks at local scales, but may not always lead to speciation. Ticks therefore seem to follow a pattern of being global generalists, local specialists. Given this, the notion of host range needs to be modified from an evolutionary perspective, where one simply counts the number of hosts used across the geographic distribution, to a more ecological view, where one considers host use at a local scale, if we are to better understand the circulation of tick-borne pathogens and exposure risks for humans and livestock. PMID:24109592

  10. Tick infestation in birds and prevalence of pathogens in ticks collected from different places in Germany.

    PubMed

    Klaus, Christine; Gethmann, Jörn; Hoffmann, Bernd; Ziegler, Ute; Heller, Martin; Beer, Martin

    2016-07-01

    The importance of ticks and tick-borne pathogens for human and animal health has been increasing over the past decades. For their transportation and dissemination, birds may play a more important role than wingless hosts. In this study, tick infestation of birds in Germany was examined. Eight hundred ninety-two captured birds were infested with ticks and belonged to 48 different species, of which blackbirds (Turdus merula) and song thrushes (Turdus philomelos) were most strongly infested. Ground feeders were more strongly infested than non-ground feeders, sedentary birds more strongly than migratory birds, and short-distance migratory birds more strongly than long-distance migratory birds. Mean tick infestation per bird ranged between 2 (long-distance migratory bird) and 4.7 (sedentary bird), in some single cases up to 55 ticks per bird were found. With the exception of three nymphs of Haemaphysalis spp., all ticks belonged to Ixodes spp., the most frequently detected tick species was Ixodes ricinus. Birds were mostly infested by nymphs (65.1 %), followed by larvae (32.96 %). Additionally, ticks collected from birds were examined for several pathogens: Tick-borne encephalitis virus (TBEV) and Sindbisvirus with real-time RT-PCR, Flaviviruses, Simbuviruses and Lyssaviruses with broad-range standard RT-PCR-assays, and Borrelia spp. with a Pan-Borrelia real-time PCR. Interestingly, no viral pathogens could be detected, but Borrelia spp. positive ticks were collected from 76 birds. Borrelia (B.) garinii, B. valaisiaina, B. burgdorferi s.s. and B. afzelii were determined. The screening of ticks and birds for viral pathogens with broad range PCR-assays was tested and the use as an "early warning system" is discussed. PMID:27048511

  11. Tick infestation in birds and prevalence of pathogens in ticks collected from different places in Germany.

    PubMed

    Klaus, Christine; Gethmann, Jörn; Hoffmann, Bernd; Ziegler, Ute; Heller, Martin; Beer, Martin

    2016-07-01

    The importance of ticks and tick-borne pathogens for human and animal health has been increasing over the past decades. For their transportation and dissemination, birds may play a more important role than wingless hosts. In this study, tick infestation of birds in Germany was examined. Eight hundred ninety-two captured birds were infested with ticks and belonged to 48 different species, of which blackbirds (Turdus merula) and song thrushes (Turdus philomelos) were most strongly infested. Ground feeders were more strongly infested than non-ground feeders, sedentary birds more strongly than migratory birds, and short-distance migratory birds more strongly than long-distance migratory birds. Mean tick infestation per bird ranged between 2 (long-distance migratory bird) and 4.7 (sedentary bird), in some single cases up to 55 ticks per bird were found. With the exception of three nymphs of Haemaphysalis spp., all ticks belonged to Ixodes spp., the most frequently detected tick species was Ixodes ricinus. Birds were mostly infested by nymphs (65.1 %), followed by larvae (32.96 %). Additionally, ticks collected from birds were examined for several pathogens: Tick-borne encephalitis virus (TBEV) and Sindbisvirus with real-time RT-PCR, Flaviviruses, Simbuviruses and Lyssaviruses with broad-range standard RT-PCR-assays, and Borrelia spp. with a Pan-Borrelia real-time PCR. Interestingly, no viral pathogens could be detected, but Borrelia spp. positive ticks were collected from 76 birds. Borrelia (B.) garinii, B. valaisiaina, B. burgdorferi s.s. and B. afzelii were determined. The screening of ticks and birds for viral pathogens with broad range PCR-assays was tested and the use as an "early warning system" is discussed.

  12. Saliva, salivary gland, and hemolymph collection from Ixodes scapularis ticks.

    PubMed

    Patton, Toni G; Dietrich, Gabrielle; Brandt, Kevin; Dolan, Marc C; Piesman, Joseph; Gilmore, Robert D

    2012-01-01

    Ticks are found worldwide and afflict humans with many tick-borne illnesses. Ticks are vectors for pathogens that cause Lyme disease and tick-borne relapsing fever (Borrelia spp.), Rocky Mountain Spotted fever (Rickettsia rickettsii), ehrlichiosis (Ehrlichia chaffeensis and E. equi), anaplasmosis (Anaplasma phagocytophilum), encephalitis (tick-borne encephalitis virus), babesiosis (Babesia spp.), Colorado tick fever (Coltivirus), and tularemia (Francisella tularensis) (1-8). To be properly transmitted into the host these infectious agents differentially regulate gene expression, interact with tick proteins, and migrate through the tick (3,9-13). For example, the Lyme disease agent, Borrelia burgdorferi, adapts through differential gene expression to the feast and famine stages of the tick's enzootic cycle (14,15). Furthermore, as an Ixodes tick consumes a bloodmeal Borrelia replicate and migrate from the midgut into the hemocoel, where they travel to the salivary glands and are transmitted into the host with the expelled saliva (9,16-19). As a tick feeds the host typically responds with a strong hemostatic and innate immune response (11,13,20-22). Despite these host responses, I. scapularis can feed for several days because tick saliva contains proteins that are immunomodulatory, lytic agents, anticoagulants, and fibrinolysins to aid the tick feeding (3,11,20,21,23). The immunomodulatory activities possessed by tick saliva or salivary gland extract (SGE) facilitate transmission, proliferation, and dissemination of numerous tick-borne pathogens (3,20,24-27). To further understand how tick-borne infectious agents cause disease it is essential to dissect actively feeding ticks and collect tick saliva. This video protocol demonstrates dissection techniques for the collection of hemolymph and the removal of salivary glands from actively feeding I. scapularis nymphs after 48 and 72 hours post mouse placement. We also demonstrate saliva collection from an adult female I

  13. Integrated control of the southern cattle fever tick, Rhipicephalus (Boophilus) microplus, in Puerto Rico using new and alternative products

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Puerto Rico (PR) is plagued by the southern cattle fever tick (SCFT), Rhipicephalus microplus, which is considered the most economically important external parasite of livestock worldwide. A research coalition involving the livestock industry in PR, the PR Department of Agriculture (PR-DA), and the...

  14. 9 CFR 72.24 - Litter and manure from carriers and premises of tick-infested animals; destruction or treating...

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Litter and manure from carriers and premises of tick-infested animals; destruction or treating required. 72.24 Section 72.24 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE INTERSTATE TRANSPORTATION...

  15. Anti-tick biological control agents: assessment and future perspectives

    USGS Publications Warehouse

    Samish, M.; Ginsberg, H.S.; Glazer, I.; Bowman, Alan. S.; Nuttall, Patricia A.

    2008-01-01

    Widespread and increasing resistance to most available acaracides threatens both global livestock industries and public health. This necessitates better understanding of ticks and the diseases they transmit in the development of new control strategies. Ticks: Biology, Disease and Control is written by an international collection of experts and covers in-depth information on aspects of the biology of the ticks themselves, various veterinary and medical tick-borne pathogens, and aspects of traditional and potential new control methods. A valuable resource for graduate students, academic researchers and professionals, the book covers the whole gamut of ticks and tick-borne diseases from microsatellites to satellite imagery and from exploiting tick saliva for therapeutic drugs to developing drugs to control tick populations. It encompasses the variety of interconnected fields impinging on the economically important and biologically fascinating phenomenon of ticks, the diseases they transmit and methods of their control.

  16. [Behavioral therapy of ticks with negative reinforcement in children].

    PubMed

    Nabieva, T N; Mukhin, E I

    2003-01-01

    Thirty-two children suffering from motor and vocal ticks exhibited weakness and distonia of ticks-prone muscles were examined. Based on the results obtained earlier, a complex of physical exercises has been worked out and conducted for 20 days. The patients were divided into 3 groups: 1st (n = 10) group did the exercises daily for training the ticks-prone muscles; the 2nd one (n = 10) exercised only after tick's appearance--negative reinforcement; 3rd group (n = 12) did exercises after tick's appearance as well but on irregular basis--probable negative reinforcement. In the 1st group, the exercising resulted in muscle strengthening and decrease of tick's number. The patients of the 2nd group got rid of ticks for 20 days. The probable tick's reinforcement in children of the 3rd group did not change pathological muscle activity. The central mechanisms of cortical plasticity in behavioral therapy of ticks are discussed.

  17. Molecular Ecological Insights into Neotropical Bird-Tick Interactions.

    PubMed

    Miller, Matthew J; Esser, Helen J; Loaiza, Jose R; Herre, Edward Allen; Aguilar, Celestino; Quintero, Diomedes; Alvarez, Eric; Bermingham, Eldredge

    2016-01-01

    In the tropics, ticks parasitize many classes of vertebrate hosts. However, because many tropical tick species are only identifiable in the adult stage, and these adults usually parasitize mammals, most attention on the ecology of tick-host interactions has focused on mammalian hosts. In contrast, immature Neotropical ticks are often found on wild birds, yet difficulties in identifying immatures hinder studies of birds' role in tropical tick ecology and tick-borne disease transmission. In Panama, we found immature ticks on 227 out of 3,498 individually-sampled birds representing 93 host species (24% of the bird species sampled, and 13% of the Panamanian land bird fauna). Tick parasitism rates did not vary with rainfall or temperature, but did vary significantly with several host ecological traits. Likewise, Neotropical-Nearctic migratory birds were significantly less likely to be infested than resident species. Using a molecular library developed from morphologically-identified adult ticks specifically for this study, we identified eleven tick species parasitizing birds, indicating that a substantial portion of the Panamanian avian species pool is parasitized by a diversity of tick species. Tick species that most commonly parasitized birds had the widest diversity of avian hosts, suggesting that immature tick species are opportunistic bird parasites. Although certain avian ecological traits are positively associated with parasitism, we found no evidence that individual tick species show specificity to particular avian host ecological traits. Finally, our data suggest that the four principal vectors of Rocky Mountain Spotted Fever in the Neotropics rarely, if ever, parasitize Panamanian birds. However, other tick species that harbor newly-discovered rickettsial parasites of unknown pathogenicity are frequently found on these birds. Given our discovery of broad interaction between Panamanian tick and avian biodiversity, future work on tick ecology and the dynamics of

  18. Molecular Ecological Insights into Neotropical Bird–Tick Interactions

    PubMed Central

    Esser, Helen J.; Loaiza, Jose R.; Herre, Edward Allen; Aguilar, Celestino; Quintero, Diomedes; Alvarez, Eric; Bermingham, Eldredge

    2016-01-01

    In the tropics, ticks parasitize many classes of vertebrate hosts. However, because many tropical tick species are only identifiable in the adult stage, and these adults usually parasitize mammals, most attention on the ecology of tick-host interactions has focused on mammalian hosts. In contrast, immature Neotropical ticks are often found on wild birds, yet difficulties in identifying immatures hinder studies of birds’ role in tropical tick ecology and tick-borne disease transmission. In Panama, we found immature ticks on 227 out of 3,498 individually–sampled birds representing 93 host species (24% of the bird species sampled, and 13% of the Panamanian land bird fauna). Tick parasitism rates did not vary with rainfall or temperature, but did vary significantly with several host ecological traits. Likewise, Neotropical–Nearctic migratory birds were significantly less likely to be infested than resident species. Using a molecular library developed from morphologically–identified adult ticks specifically for this study, we identified eleven tick species parasitizing birds, indicating that a substantial portion of the Panamanian avian species pool is parasitized by a diversity of tick species. Tick species that most commonly parasitized birds had the widest diversity of avian hosts, suggesting that immature tick species are opportunistic bird parasites. Although certain avian ecological traits are positively associated with parasitism, we found no evidence that individual tick species show specificity to particular avian host ecological traits. Finally, our data suggest that the four principal vectors of Rocky Mountain Spotted Fever in the Neotropics rarely, if ever, parasitize Panamanian birds. However, other tick species that harbor newly–discovered rickettsial parasites of unknown pathogenicity are frequently found on these birds. Given our discovery of broad interaction between Panamanian tick and avian biodiversity, future work on tick ecology and the

  19. Tick control: trapping, biocontrol, host management and other alternative strategies

    USGS Publications Warehouse

    Ginsberg, Howard S.; Edited by Sonenshine, Daniel E.; Roe, R. Michael

    2014-01-01

    Biology of Ticks is the most comprehensive work on tick biology and tick-borne diseases. This second edition is a multi-authored work, featuring the research and analyses of renowned experts across the globe. Spanning two volumes, the book examines the systematics, biology, structure, ecological adaptations, evolution, genomics and the molecular processes that underpin the growth, development and survival of these important disease-transmitting parasites. Also discussed is the remarkable array of diseases transmitted (or caused) by ticks, as well as modern methods for their control. This book should serve as a modern reference for students, scientists, physicians, veterinarians and other specialists. Volume I covers the biology of the tick and features chapters on tick systematics, tick life cycles, external and internal anatomy, and others dedicated to specific organ systems, specifically, the tick integument, mouthparts and digestive system, salivary glands, waste removal, salivary glands, respiratory system, circulatory system and hemolymph, fat body, the nervous and sensory systems and reproductive systems. Volume II includes chapters on the ecology of non-nidicolous and nidicolous ticks, genetics and genomics (including the genome of the Lyme disease vector Ixodes scapularis) and immunity, including host immune responses to tick feeding and tick-host interactions, as well as the tick's innate immune system that prevents and/or controls microbial infections. Six chapters cover in depth the many diseases caused by the major tick-borne pathogens, including tick-borne protozoa, viruses, rickettsiae of all types, other types of bacteria (e.g., the Lyme disease agent) and diseases related to tick paralytic agents and toxins. The remaining chapters are devoted to tick control using vaccines, acaricides, repellents, biocontrol, and, finally, techniques for breeding ticks in order to develop tick colonies for scientific study.

  20. Molecular Ecological Insights into Neotropical Bird-Tick Interactions.

    PubMed

    Miller, Matthew J; Esser, Helen J; Loaiza, Jose R; Herre, Edward Allen; Aguilar, Celestino; Quintero, Diomedes; Alvarez, Eric; Bermingham, Eldredge

    2016-01-01

    In the tropics, ticks parasitize many classes of vertebrate hosts. However, because many tropical tick species are only identifiable in the adult stage, and these adults usually parasitize mammals, most attention on the ecology of tick-host interactions has focused on mammalian hosts. In contrast, immature Neotropical ticks are often found on wild birds, yet difficulties in identifying immatures hinder studies of birds' role in tropical tick ecology and tick-borne disease transmission. In Panama, we found immature ticks on 227 out of 3,498 individually-sampled birds representing 93 host species (24% of the bird species sampled, and 13% of the Panamanian land bird fauna). Tick parasitism rates did not vary with rainfall or temperature, but did vary significantly with several host ecological traits. Likewise, Neotropical-Nearctic migratory birds were significantly less likely to be infested than resident species. Using a molecular library developed from morphologically-identified adult ticks specifically for this study, we identified eleven tick species parasitizing birds, indicating that a substantial portion of the Panamanian avian species pool is parasitized by a diversity of tick species. Tick species that most commonly parasitized birds had the widest diversity of avian hosts, suggesting that immature tick species are opportunistic bird parasites. Although certain avian ecological traits are positively associated with parasitism, we found no evidence that individual tick species show specificity to particular avian host ecological traits. Finally, our data suggest that the four principal vectors of Rocky Mountain Spotted Fever in the Neotropics rarely, if ever, parasitize Panamanian birds. However, other tick species that harbor newly-discovered rickettsial parasites of unknown pathogenicity are frequently found on these birds. Given our discovery of broad interaction between Panamanian tick and avian biodiversity, future work on tick ecology and the dynamics of

  1. Protect Yourself against Tick-Borne Disease

    MedlinePlus

    ... this tick can transmit Lyme disease and a malaria-like disease called babesiosis. When in the larvae ... have no symptoms, mild symptoms or flu or malaria-like symptoms. However, Babesiosis can be severe or ...

  2. Scouts, forests, and ticks: Impact of landscapes on human-tick contacts.

    PubMed

    De Keukeleire, Mathilde; Vanwambeke, Sophie O; Somassè, Elysée; Kabamba, Benoît; Luyasu, Victor; Robert, Annie

    2015-07-01

    Just as with forest workers or people practicing outdoor recreational activities, scouts are at high risk for tick bites and tick-borne infections. The risk of a tick bite is shaped not only by environmental and climatic factors but also by land management. The aim of this study was to assess which environmental conditions favour scout-tick contacts, and thus to better understand how these factors and their interactions influence the two components of risk: hazard (related to vector and host ecology) and exposure of humans to disease vectors. A survey was conducted in the summer of 2009 on the incidence of tick bites in scout camps taking place in southern Belgium. Joint effects of landscape composition and configuration, weather, climate, forest and wildlife management were examined using a multiple gamma regression with a log link. The landscape was characterized by buffers of varying sizes around the camps using a detailed land use map, and accounting for climate and weather variables. Landscape composition and configuration had a significant influence on scout-tick contacts: the risk was high when the camp was surrounded by a low proportion of arable land and situated in a complex and fragmented landscape. The distance to the nearest forest patch, the composition of the forest ecotone as well as weather and climatic factors were all significantly associated with scout-tick contacts. Both hazard- and exposure-related variables significantly contributed to the frequency of scout-tick contact. Our results show that environmental conditions favour scout-tick contacts. For example, we emphasize the impact of accessibility of environments suitable for ticks on the risk of contact. We also highlight the significant effect of both hazard and exposure. Our results are consistent with current knowledge, but further investigations on the effect of forest management, e.g. through its impact on forest structure, on the tick-host-pathogen system, and on humans exposure, is

  3. Wild Birds and Urban Ecology of Ticks and Tick-borne Pathogens, Chicago, Illinois, USA, 2005–2010

    PubMed Central

    Goldberg, Tony L.; Kitron, Uriel D.; Brawn, Jeffrey D.; Anderson, Tavis K.; Loss, Scott R.; Walker, Edward D.; Hamer, Gabriel L.

    2012-01-01

    Bird-facilitated introduction of ticks and associated pathogens is postulated to promote invasion of tick-borne zoonotic diseases into urban areas. Results of a longitudinal study conducted in suburban Chicago, Illinois, USA, during 2005–2010 show that 1.6% of 6,180 wild birds captured in mist nets harbored ticks. Tick species in order of abundance were Haemaphysalis leporispalustris, Ixodes dentatus, and I. scapularis, but 2 neotropical tick species of the genus Amblyomma were sampled during the spring migration. I. scapularis ticks were absent at the beginning of the study but constituted the majority of ticks by study end and were found predominantly on birds captured in areas designated as urban green spaces. Of 120 ticks, 5 were infected with Borrelia burgdorferi, spanning 3 ribotypes, but none were infected with Anaplasma phagocytophilum. Results allow inferences about propagule pressure for introduction of tick-borne diseases and emphasize the large sample sizes required to estimate this pressure. PMID:23017244

  4. Wild birds and urban ecology of ticks and tick-borne pathogens, Chicago, Illinois, USA, 2005-2010.

    PubMed

    Hamer, Sarah A; Goldberg, Tony L; Kitron, Uriel D; Brawn, Jeffrey D; Anderson, Tavis K; Loss, Scott R; Walker, Edward D; Hamer, Gabriel L

    2012-10-01

    Bird-facilitated introduction of ticks and associated pathogens is postulated to promote invasion of tick-borne zoonotic diseases into urban areas. Results of a longitudinal study conducted in suburban Chicago, Illinois, USA, during 2005-2010 show that 1.6% of 6,180 wild birds captured in mist nets harbored ticks. Tick species in order of abundance were Haemaphysalis leporispalustris, Ixodes dentatus, and I. scapularis, but 2 neotropical tick species of the genus Amblyomma were sampled during the spring migration. I. scapularis ticks were absent at the beginning of the study but constituted the majority of ticks by study end and were found predominantly on birds captured in areas designated as urban green spaces. Of 120 ticks, 5 were infected with Borrelia burgdorferi, spanning 3 ribotypes, but none were infected with Anaplasma phagocytophilum. Results allow inferences about propagule pressure for introduction of tick-borne diseases and emphasize the large sample sizes required to estimate this pressure. PMID:23017244

  5. Ticks imported to Europe with exotic reptiles.

    PubMed

    Mihalca, Andrei Daniel

    2015-09-30

    It is known that traded exotic animals carry with them an immense number of associated symbionts, including parasites. Reptiles are no exception. Most of the imported reptiles originate from tropical countries and their possibility to carry potentially dangerous pathogens is high. According to CITES, Europe is currently the main reptile importer in the world. Despite this, there is no review or analysis available for the risk related to the importation of tick-borne diseases with traded reptile to the EU. The main aim of the manuscript is to provide a review on the available literature on ticks introduced to and exchanged between European countries via the live reptile trade. So far, the published reports of ticks imported on reptiles are limited to few European countries: Italy, Poland, Spain, Netherlands, Belgium, Slovenia and UK. The following species have been reported: Hyalomma aegyptium, Amblyomma dissimile, Amblyomma exornatum, Amblyomma flavomaculatum, Amblyomma fuscolineatum, Amblyomma latum, Amblyomma quadricavum, Amblyomma marmoreum, Amblyomma nuttalli, Amblyomma sparsum, Amblyomma sphenodonti, Amblyomma transversale and Amblyomma varanense. The majority of species are of African origin, followed by American and Asian species. All groups of reptiles (chelonians, snakes, lizards, crocodiles, tuataras) were involved. However, it seems that certain groups (i.e. tortoises of genus Testudo, monitor lizards of genus Varanus, snakes of genus Python) are more important as host for imported ticks, but this may be related to higher levels of international trade. Even fewer are the reports of tick-borne pathogens associated with imported reptile ticks. Despite the diversity of tick species reported on imported reptiles, the situations of truly invasive species are atypical and are limited in natural environments to maximum two cases where H. aegyptium was involved. Otherwise, the risk associated with reptile trade for introduction of invasive tick to Europe is low

  6. Ticks imported to Europe with exotic reptiles.

    PubMed

    Mihalca, Andrei Daniel

    2015-09-30

    It is known that traded exotic animals carry with them an immense number of associated symbionts, including parasites. Reptiles are no exception. Most of the imported reptiles originate from tropical countries and their possibility to carry potentially dangerous pathogens is high. According to CITES, Europe is currently the main reptile importer in the world. Despite this, there is no review or analysis available for the risk related to the importation of tick-borne diseases with traded reptile to the EU. The main aim of the manuscript is to provide a review on the available literature on ticks introduced to and exchanged between European countries via the live reptile trade. So far, the published reports of ticks imported on reptiles are limited to few European countries: Italy, Poland, Spain, Netherlands, Belgium, Slovenia and UK. The following species have been reported: Hyalomma aegyptium, Amblyomma dissimile, Amblyomma exornatum, Amblyomma flavomaculatum, Amblyomma fuscolineatum, Amblyomma latum, Amblyomma quadricavum, Amblyomma marmoreum, Amblyomma nuttalli, Amblyomma sparsum, Amblyomma sphenodonti, Amblyomma transversale and Amblyomma varanense. The majority of species are of African origin, followed by American and Asian species. All groups of reptiles (chelonians, snakes, lizards, crocodiles, tuataras) were involved. However, it seems that certain groups (i.e. tortoises of genus Testudo, monitor lizards of genus Varanus, snakes of genus Python) are more important as host for imported ticks, but this may be related to higher levels of international trade. Even fewer are the reports of tick-borne pathogens associated with imported reptile ticks. Despite the diversity of tick species reported on imported reptiles, the situations of truly invasive species are atypical and are limited in natural environments to maximum two cases where H. aegyptium was involved. Otherwise, the risk associated with reptile trade for introduction of invasive tick to Europe is low

  7. Ecology of tick vectors of American spotted fever

    PubMed Central

    Burgdorfer, W.

    1969-01-01

    The author reviews the natural history of the tick vectors of American spotted fever. The discussion concerns the ecology of the Rocky Mountain wood tick, Dermacentor andersoni, the American dog tick, Dermacentor variabilis, and the lone-star tick, Amblyomma americanum, all of which are proven vectors of Rocky Mountain spotted fever to man. Also included are the rabbit tick, Haemaphysalis leporispalustris and Dermacentor parumapertus, which very rarely bite man but which are considered of importance in maintaining and distributing Rickettsia rickettsi, the etiological agent of Rocky Mountain spotted fever, in nature. Brief reference is also made to recently developed techniques for studying the ecology of tick vectors. PMID:5306621

  8. THE ROLE OF SALIVA IN TICK FEEDING

    PubMed Central

    Francischetti, Ivo M.B; Sá-Nunes, Anderson; Mans, Ben J.; Santos, Isabel M.; Ribeiro, José M.C.

    2009-01-01

    When attempting to feed on their hosts, ticks face the problem of host hemostasis (the vertebrate mechanisms that prevent blood loss), inflammation (that can produce itching or pain and thus initiate defensive behavior on their hosts) and immunity (by way of both cellular and humoral responses). Against these barriers, ticks evolved a complex and sophisticated pharmacological armamentarium, consisting of bioactive lipids and proteins, to assist blood feeding. Recent progress in transcriptome research has uncovered that hard ticks have hundreds of different proteins expressed in their salivary glands, the majority of which have no known function, and include many novel protein families (e.g., their primary structure is unique to ticks). This review will address the vertebrate mechanisms of these barriers as a guide to identify the possible targets of these large numbers of known salivary proteins with unknown function. We additionally provide a supplemental table that catalogues over 3,500 putative salivary proteins from various tick species, which might assist the scientific community in the process of functional identification of these unique proteins. This supplemental file is accessble from http://exon.niaid.nih.gov/transcriptome/tick_review/Sup-Table-1.xls.gz. PMID:19273185

  9. Ticks

    MedlinePlus

    ... Links 2016 HHS joint webinar - Trends in Tickborne Diseases New publication – Eisen RJ, Eisen L, Beard CB ... Tickborne Diseases – Agents, Clinical Features, and Surveillance New Handbook – Tickborne Diseases of the United States: A Reference Manual for ...

  10. Mixtures of compound Poisson processes as models of tick-by-tick financial data

    NASA Astrophysics Data System (ADS)

    Scalas, Enrico

    2007-10-01

    A model for the phenomenological description of tick-by-tick share prices in a stock exchange is introduced. It is based on mixtures of compound Poisson processes. Preliminary results based on Monte Carlo simulation show that this model can reproduce various stylized facts.

  11. Breeding strategies for tick resistance in tropical cattle: a sustainable approach for tick control.

    PubMed

    Shyma, K P; Gupta, Jay Prakash; Singh, Veer

    2015-03-01

    About 80 % of world cattle population is under the risk of ticks and tick borne diseases (TTBDs). Losses caused by bovine tick burdens in tropical countries have a tremendous economic impact on production systems. Chemical control of disease has been found to be ineffective and also involving large cost. To reduce our reliance on these chemical products, it is necessary to embark on programs that include habitat management, genetic selection of hosts, and development of a strain capable of inducing host resistance to ticks. Selection for disease resistance provide alternate method for sustainable control of TTBDs. Domestic livestock manifests tick-resistance by skin thickness, coat type, coat color, hair density and skin secretions etc. Zebu cattle have, on average, greater tick resistance than either European cattle or African cattle. Heritability for tick burden in cattle has been shown to range about 0.30, which is sufficient to result in the success of some programs of selection for tick resistance in cattle. To select animals at younger age, to reduce generation interval and to increase genetic gain, marker assisted selection is an important tool. There are also various MHC molecules which are associated with resistance to TTBDs. PMID:25698850

  12. Endogenous tick viruses and modulation of tick-borne pathogen growth

    PubMed Central

    Bell-Sakyi, Lesley; Attoui, Houssam

    2013-01-01

    Ticks transmit a wide range of viral, bacterial and protozoan pathogens, many of which can establish persistent infections of lifelong duration in the vector tick and in some cases are transmitted transovarially to the next generation. In addition many ixodid and argasid tick cell lines and, by inference the parent ticks from which they were derived, harbor endogenous viruses (ETV) of which almost nothing is known. In general, low level persistent infections with viral pathogens (arboviruses) are not known to have a deleterious effect on tick survival and fitness, suggesting that they can strike a balance with the tick innate immune response. This tolerance of arbovirus infection may be modulated by the permanent presence of ETV in the host cell. In mosquito cells, temporary or permanent silencing of the genes of an endogenous virus by RNA interference can result in changes in replication rate of a co-infecting arbovirus. We propose that tick cell lines offer a useful model system for in vitro investigation of the modulatory effect of ETV on superinfecting pathogen survival and replication in ticks, using the molecular manipulation techniques applied to insect cells. PMID:23875176

  13. Nomuraea rileyi as biological control agents of Rhipicephalus microplus tick.

    PubMed

    Perinotto, W M S; Terra, A L M; Angelo, I C; Fernandes, É K K; Golo, P S; Camargo, M G; Bittencourt, V R E P

    2012-10-01

    Nomuraea rileyi, a fungus pathogenic to insects, has been widely used for biological control of agricultural pests in Brazil. This study investigates the effects of N. rileyi, isolates Nr 138, Nr 151, and Nr 177, to eggs, larvae, and engorged females of Rhipicephalus microplus tick. Specimens were immersed in 1 ml of conidial suspension for 3 min, whereas the control group was immersed in 0.01% Tween 80 water solution. The isolate Nr 138 controlled 67.37% of ticks when the highest conidial concentration was used, 10(8) conidia ml(-1). The isolate Nr 177 significantly reduced the percentage of hatch of larvae from eggs treated with 10(8) conidia ml(-1). Conversely, the isolate Nr 151 was not virulent to eggs, larvae, or adults. Variability in virulence was observed among the N. rileyi isolates investigated in the current study-Nr 138 was more virulent to engorged females, while Nr 177 was more virulent to unfed larvae. Although N. rileyi proved to be virulent to several stages of R. microplus, the results obtained in this study indicate that N. rileyi does not appear to be a remarkable biological control agent for R. microplus.

  14. Prevention and control strategies for ticks and pathogen transmission.

    PubMed

    de La Fuente, J; Kocan, K M; Contreras, M

    2015-04-01

    Ticks and tick-borne pathogens have evolved together, resulting in a complex relationship in which the pathogen's life cycle is perfectly coordinated with the tick's feeding cycle, and the tick can harbour high pathogen levels without affecting its biology. Tick-borne diseases (TBDs) continue to emerge and/or spread, and pose an increasing threatto human and animal health. The disruptive impacts of global change have resulted in ecosystem instability and the future outcomes of management and control programmes for ticks and TBDs are difficult to predict. In particular, the selection of acaricide-resistant ticks has reduced the value of acaricides as a sole means of tick control. Vaccines provide an alternative control method, but the use of tick vaccines has not advanced since the first vaccines were registered in the early 1990s. An understanding of the complex molecular relationship between hosts, ticks and pathogens and the use of systems biology and vaccinomics approaches are needed to discover proteins with the relevant biological function in tick feeding, reproduction, development, immune response, the subversion of host immunity and pathogen transmission, all of which mediate tick and pathogen success. The same approaches will also be required to characterise candidate protective antigens and to validate vaccine formulations. Tick vaccines with a dual effect on tick infestations and pathogen transmission could reduce both tick infestations and their vector capacity for humans, animals and reservoir hosts. The development of integrated tick control strategies, including vaccines and synthetic and botanical acaricides, in combination with managing drug resistance and educating producers, should lead to the sustainable control of ticks and TBDs.

  15. Distribution pattern and number of ticks on lizards.

    PubMed

    Dudek, Krzysztof; Skórka, Piotr; Sajkowska, Zofia Anna; Ekner-Grzyb, Anna; Dudek, Monika; Tryjanowski, Piotr

    2016-02-01

    The success of ectoparasites depends primarily on the site of attachment and body condition of their hosts. Ticks usually tend to aggregate on vertebrate hosts in specific areas, but the distribution pattern may depend on host body size and condition, sex, life stage or skin morphology. Here, we studied the distribution of ticks on lizards and tested the following hypothesis: occurrence or high abundance of ticks is confined with body parts with smaller scales and larger interscalar length because such sites should provide ticks with superior attachment conditions. This study was performed in field conditions in central Poland in 2008-2011. In total, 500 lizards (Lacerta agilis) were caught and 839 ticks (Ixodes ricinus, larvae and nymphs) were collected from them. Using generalised linear mixed models, we found that the ticks were most abundant on forelimbs and their axillae, with 90% of ticks attached there. This part of the lizard body and the region behind the hindlimb were covered by the smallest scales with relatively wide gaps between them. This does not fully support our hypothesis that ticks prefer locations with easy access to skin between scales, because it does not explain why so few ticks were in the hindlimb area. We found that the abundance of ticks was positively correlated with lizard body size index (snout-vent length). Tick abundance was also higher in male and mature lizards than in female and young individuals. Autotomy had no effect on tick abundance. We found no correlation between tick size and lizard morphology, sex, autotomy and body size index. The probability of occurrence of dead ticks was positively linked with the total number of ticks on the lizard but there was no relationship between dead tick presence and lizard size, sex or age. Thus lizard body size and sex are the major factors affecting the abundance of ticks, and these parasites are distributed nearly exclusively on the host's forelimbs and their axillae.

  16. Distribution pattern and number of ticks on lizards.

    PubMed

    Dudek, Krzysztof; Skórka, Piotr; Sajkowska, Zofia Anna; Ekner-Grzyb, Anna; Dudek, Monika; Tryjanowski, Piotr

    2016-02-01

    The success of ectoparasites depends primarily on the site of attachment and body condition of their hosts. Ticks usually tend to aggregate on vertebrate hosts in specific areas, but the distribution pattern may depend on host body size and condition, sex, life stage or skin morphology. Here, we studied the distribution of ticks on lizards and tested the following hypothesis: occurrence or high abundance of ticks is confined with body parts with smaller scales and larger interscalar length because such sites should provide ticks with superior attachment conditions. This study was performed in field conditions in central Poland in 2008-2011. In total, 500 lizards (Lacerta agilis) were caught and 839 ticks (Ixodes ricinus, larvae and nymphs) were collected from them. Using generalised linear mixed models, we found that the ticks were most abundant on forelimbs and their axillae, with 90% of ticks attached there. This part of the lizard body and the region behind the hindlimb were covered by the smallest scales with relatively wide gaps between them. This does not fully support our hypothesis that ticks prefer locations with easy access to skin between scales, because it does not explain why so few ticks were in the hindlimb area. We found that the abundance of ticks was positively correlated with lizard body size index (snout-vent length). Tick abundance was also higher in male and mature lizards than in female and young individuals. Autotomy had no effect on tick abundance. We found no correlation between tick size and lizard morphology, sex, autotomy and body size index. The probability of occurrence of dead ticks was positively linked with the total number of ticks on the lizard but there was no relationship between dead tick presence and lizard size, sex or age. Thus lizard body size and sex are the major factors affecting the abundance of ticks, and these parasites are distributed nearly exclusively on the host's forelimbs and their axillae. PMID:26520053

  17. Widespread Rickettsia spp. Infections in Ticks (Acari: Ixodoidea) in Taiwan.

    PubMed

    Kuo, Chi-Chien; Shu, Pei-Yun; Mu, Jung-Jung; Lee, Pei-Lung; Wu, Yin-Wen; Chung, Chien-Kung; Wang, Hsi-Chieh

    2015-09-01

    Ticks are second to mosquitoes as the most important disease vectors, and recent decades have witnessed the emergence of many novel tick-borne rickettsial diseases, but systematic surveys of ticks and tick-borne rickettsioses are generally lacking in Asia. We collected and identified ticks from small mammal hosts between 2006 and 2010 in different parts of Taiwan. Rickettsia spp. infections in ticks were identified by targeting ompB and gltA genes with nested polymerase chain reaction. In total, 2,732 ticks were collected from 1,356 small mammals. Rhipicephalus haemaphysaloides Supino (51.8% of total ticks), Haemaphysalis bandicota Hoogstraal & Kohls (28.0%), and Ixodes granulatus Supino (20.0%) were the most common tick species, and Rattus losea Swinhoe (44.7% of total ticks) and Bandicota indica Bechstein (39.9%) were the primary hosts. The average Rickettsia infective rate in 329 assayed ticks was 31.9% and eight Rickettsia spp. or closely related species were identified. This study shows that rickettsiae-infected ticks are widespread in Taiwan, with a high diversity of Rickettsia spp. circulating in the ticks. Because notifiable rickettsial diseases in Taiwan only include mite-borne scrub typhus and flea-borne murine typhus, more studies are warranted for a better understanding of the real extent of human risks to rickettsioses in Taiwan.

  18. 5 CFR 8301.104 - Additional rules for employees of the Food Safety and Inspection Service.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Additional rules for employees of the Food Safety and Inspection Service. 8301.104 Section 8301.104 Administrative Personnel DEPARTMENT OF AGRICULTURE SUPPLEMENTAL STANDARDS OF ETHICAL CONDUCT FOR EMPLOYEES OF THE DEPARTMENT OF AGRICULTURE § 8301.104 Additional rules for employees of...

  19. Factors affecting the ecology of tick-borne encephalitis in Slovenia.

    PubMed

    Knap, N; Avšič-Županc, T

    2015-07-01

    Recognition of factors that influence the formation of tick-borne encephalitis (TBE) foci is important for assessing the risk of humans acquiring the viral infection and for establishing what can be done (within reasonable boundaries) to minimize that risk. In Slovenia, the dynamics of the TBE vector, i.e. Ixodes ricinus, was studied over a 4-year period and the prevalence of infection in ticks was established. Two groups of tick hosts were investigated: deer and small mammals. Red deer have been confirmed as having a direct influence on the incidence of TBE and rodents have been recognized as important sentinels for TBE infections, although their role in the enzootic cycle of the virus still remains to be elucidated. Last, forest and agricultural areas, which are influenced by human activity, are suitable habitats for ticks, and important for TBEV transmission and establishment. Human behaviour is also therefore an important factor and should always be considered in studies of TBE ecology. PMID:25918865

  20. Identification of tick-borne encephalitis virus in ticks collected in southeastern Hungary.

    PubMed

    Pintér, Réka; Madai, Mónika; Vadkerti, Edit; Németh, Viktória; Oldal, Miklós; Kemenesi, Gábor; Dallos, Bianka; Gyuranecz, Miklós; Kiss, Gábor; Bányai, Krisztián; Jakab, Ferenc

    2013-09-01

    Tick-borne encephalitis virus (TBEV) is an arthropod-borne viral pathogen causing infections in Europe and is responsible for most arbovirus central nervous system infections in Hungary. Assessing the TBEV prevalence in ticks through detection of genomic RNA is a broadly accepted approach to estimate the transmission risk from a tick bite. For this purpose, 2731 ticks were collected from the neighboring area of the town of Dévaványa, located in southeastern Hungary, which is considered a low-risk-transmission area for TBEV. Altogether, 2300 ticks were collected from the vegetation, while 431 were collected from rodents. Samples were pooled and then screened for TBEV with a newly designed semi-nested RT-PCR (RT-snPCR) targeting the NS1 genomic region. PCR results were confirmed by direct sequencing of the second round amplicons. Among the 3 different collected tick species (Ixodes ricinus, Haemaphysalis concinna, Dermacentor marginatus), I. ricinus was the only species that tested positive for TBEV. TBEV-positive ticks were collected from small mammals or from the vegetation. One nymphal pool and 4 larval pools tested positive for TBEV. The only positive nymphal pool was unfed and came from vegetation, while ticks of the 4 positive larval pools were collected from rodents. Minimal TBEV prevalence in ticks was 0.08% for unfed nymphs and 0.78% for feeding larvae. Our results indicate that further long-term investigations on the occurrence of TBEV are needed to better describe the geographic distribution and the prevalence of infected ticks in Hungary.

  1. Avian migrants facilitate invasions of neotropical ticks and tick-borne pathogens into the United States.

    PubMed

    Cohen, Emily B; Auckland, Lisa D; Marra, Peter P; Hamer, Sarah A

    2015-12-01

    Migratory birds have the potential to transport exotic vectors and pathogens of human and animal health importance across vast distances. We systematically examined birds that recently migrated to the United States from the Neotropics for ticks. We screened both ticks and birds for tick-borne pathogens, including Rickettsia species and Borrelia burgdorferi. Over two spring seasons (2013 and 2014), 3.56% of birds (n = 3,844) representing 42.35% of the species examined (n = 85) were infested by ticks. Ground-foraging birds with reduced fuel stores were most commonly infested. Eight tick species were identified, including seven in the genus Amblyomma, of which only Amblyomma maculatum/Amblyomma triste is known to be established in the United States. Most ticks on birds (67%) were neotropical species with ranges in Central and South America. Additionally, a single Ixodes genus tick was detected. A total of 29% of the ticks (n = 137) and no avian blood samples (n = 100) were positive for infection with Rickettsia species, including Rickettsia parkeri, an emerging cause of spotted fever in humans in the southern United States, a species in the group of Rickettsia monacensis, and uncharacterized species and endosymbionts of unknown pathogenicity. No avian tick or blood samples tested positive for B. burgdorferi, the etiologic agent of Lyme disease. An extrapolation of our findings suggests that anywhere from 4 to 39 million exotic neotropical ticks are transported to the United States annually on migratory songbirds, with uncertain consequences for human and animal health if the current barriers to their establishment and spread are overcome.

  2. Avian Migrants Facilitate Invasions of Neotropical Ticks and Tick-Borne Pathogens into the United States

    PubMed Central

    Auckland, Lisa D.; Marra, Peter P.

    2015-01-01

    Migratory birds have the potential to transport exotic vectors and pathogens of human and animal health importance across vast distances. We systematically examined birds that recently migrated to the United States from the Neotropics for ticks. We screened both ticks and birds for tick-borne pathogens, including Rickettsia species and Borrelia burgdorferi. Over two spring seasons (2013 and 2014), 3.56% of birds (n = 3,844) representing 42.35% of the species examined (n = 85) were infested by ticks. Ground-foraging birds with reduced fuel stores were most commonly infested. Eight tick species were identified, including seven in the genus Amblyomma, of which only Amblyomma maculatum/Amblyomma triste is known to be established in the United States. Most ticks on birds (67%) were neotropical species with ranges in Central and South America. Additionally, a single Ixodes genus tick was detected. A total of 29% of the ticks (n = 137) and no avian blood samples (n = 100) were positive for infection with Rickettsia species, including Rickettsia parkeri, an emerging cause of spotted fever in humans in the southern United States, a species in the group of Rickettsia monacensis, and uncharacterized species and endosymbionts of unknown pathogenicity. No avian tick or blood samples tested positive for B. burgdorferi, the etiologic agent of Lyme disease. An extrapolation of our findings suggests that anywhere from 4 to 39 million exotic neotropical ticks are transported to the United States annually on migratory songbirds, with uncertain consequences for human and animal health if the current barriers to their establishment and spread are overcome. PMID:26431964

  3. Isolate of Anaplasma marginale not transmitted by ticks.

    PubMed

    Smith, R D; Levy, M G; Kuhlenschmidt, M S; Adams, J H; Rzechula, D L; Hardt, T A; Kocan, K M

    1986-01-01

    The tick-borne transmissibility of 2 isolates of Anaplasma marginale was compared. Dermacentor variabilis were exposed to A marginale as nymphs by feeding on 1 of 4 splenectomized calves during periods of ascending parasitemia (maximum 49% to 81% parasitized erythrocytes) induced by injection of a stabilate. Tick-borne transmission was attempted, using 26 to 224 adult ticks within 30 to 220 days after molting. Adult D variabilis did not transmit an Illinois isolate of A marginale in 7 tick-borne transmission experiments (P = 0.0047), including 2 experiments in which calves were inoculated IV with homogenates of adult ticks. In contrast, a Virginia isolate of A marginale was readily transmitted by the same tick colony. Thus, previously reported morphologic and immunologic differences among A marginale isolates may extend to tick-borne transmissibility. The Virginia and Illinois A marginale isolates had an inclusion appendage that was not a marker for tick transmissibility. PMID:3946891

  4. Experimental Infection of Amblyomma aureolatum Ticks with Rickettsia rickettsii

    PubMed Central

    Ogrzewalska, Maria; Soares, João F.; Martins, Thiago F.; Soares, Herbert S.; Moraes-Filho, Jonas; Nieri-Bastos, Fernanda A.; Almeida, Aliny P.; Pinter, Adriano

    2011-01-01

    We experimentally infected Amblyomma aureolatum ticks with the bacterium Rickettsia rickettsii, the etiologic agent of Rocky Mountain spotted fever (RMSF). These ticks are a vector for RMSF in Brazil. R. rickettsii was efficiently conserved by both transstadial maintenance and vertical (transovarial) transmission to 100% of the ticks through 4 laboratory generations. However, lower reproductive performance and survival of infected females was attributed to R. rickettsii infection. Therefore, because of the high susceptibility of A. aureolatum ticks to R. rickettsii infection, the deleterious effect that the bacterium causes in these ticks may contribute to the low infection rates (<1%) usually reported among field populations of A. aureolatum ticks in RMSF-endemic areas of Brazil. Because the number of infected ticks would gradually decrease after each generation, it seems unlikely that A. aureolatum ticks could sustain R. rickettsii infection over multiple successive generations solely by vertical transmission. PMID:21529391

  5. Ixodid and Argasid Tick Species and West Nile Virus

    PubMed Central

    Uzcátegui, Nathalie Yumari; Gould, Ernest Andrew; Nuttall, Patricia Anne

    2004-01-01

    Control of West Nile virus (WNV) can only be effective if the vectors and reservoirs of the virus are identified and controlled. Although mosquitoes are the primary vectors, WNV has repeatedly been isolated from ticks. Therefore tick-borne transmission studies were performed with an ixodid (Ixodes ricinus) and an argasid tick species (Ornithodoros moubata). Both species became infected after feeding upon viremic hosts, but I. ricinus ticks were unable to maintain the virus. In contrast, O. moubata ticks were infected for at least 132 days, and the infection was maintained through molting and a second bloodmeal. Infected O. moubata ticks transmitted the virus to rodent hosts, albeit at a low level. Moreover, the virus was nonsystemically transmitted between infected and uninfected O. moubata ticks co-fed upon uninfected hosts. Although ticks are unlikely to play a major role in WNV transmission, our findings suggest that some species have the potential to act as reservoirs for the virus. PMID:15200855

  6. Deorphanization and target validation of cross-tick species conserved novel Amblyomma americanum tick saliva protein

    PubMed Central

    Mulenga, Albert; Kim, Tae Kwon; Ibelli, Adriana Mércia Guaratini

    2013-01-01

    We previously identified a cross-tick species conserved tick feeding stimuli responsive Amblyomma americanum (Aam) AV422 gene. This study demonstrates that AamAV422 belongs to a novel group of arthropod proteins that is characterized by 14 cysteine amino acid residues: C23-X7/9-C33-X23/24-C58-C8-C67X7-X75-X23-C99-X15-C115-X10-C126X24/25/33-C150C151-X7-C159-X8-X168-X23/24-C192-X9/10-C202 predicted to form seven disulfide bonds. We show that AamAV422 protein is a ubiquitously expressed protein that is injected into the host within the first 24 h of the tick attaching onto the host as revealed by western blotting analyses of recombinant (r)AamAV422, tick saliva and dissected tick organ protein extracts using antibodies to 24 h and 48 h tick saliva proteins (TSPs). Native AamAV422 is apparently involved with mediating tick anti-hemostasis and anti-complement functions in that rAamAV422 delayed plasma clotting time in a dose responsive manner by up to ~160 s, prevented platelet aggregation by up to ~16% and caused ~24% reduction in production of terminal complement complexes. Target validation analysis revealed that rAamAV422 is a potential candidate for a cocktail or multivalent tick vaccine preparation in that RNA interference (RNAi)-mediated silencing of AamAV422 mRNA caused a statistically significant (~44%) reduction in tick engorgement weights, which is proxy for amounts of ingested blood. We speculate that AamAV422 is a potential target antigen for development of the highly desired universal tick vaccine in that consistent with high conservation among ticks, antibodies to 24 h Ixodes scapularis TSPs specifically bound rAamAV422. We discuss data in this study in the context of advancing the biology of tick feeding physiology and discovery of potential target antigens for tick vaccine development. PMID:23428900

  7. Tick repellents and acaricides of botanical origin: a green roadmap to control tick-borne diseases?

    PubMed

    Benelli, Giovanni; Pavela, Roman; Canale, Angelo; Mehlhorn, Heinz

    2016-07-01

    Arthropods are dangerous vectors of agents of deadly diseases, which may hit as epidemics or pandemics in the increasing world population of humans and animals. Among them, ticks transmit more pathogen species than any other group of blood-feeding arthropods worldwide. Thus, the effective and eco-friendly control of tick vectors in a constantly changing environment is a crucial challenge. A number of novel routes have been attempted to prevent and control tick-borne diseases, including the development of (i) vaccines against viruses vectored by ticks; (ii) pheromone-based control tools, with special reference to the "lure and kill" techniques; (iii) biological control programmes relying on ticks' natural enemies and pathogens; and (iv) the integrated pest management practices aimed at reducing tick interactions with livestock. However, the extensive employment of acaricides and tick repellents still remains the two most effective and ready-to-use strategies. Unfortunately, the first one is limited by the rapid development of resistance in ticks, as well as by serious environmental concerns. On the other hand, the exploitation of plants as sources of effective tick repellents is often promising. Here, we reviewed current knowledge concerning the effectiveness of plant extracts as acaricides or repellents against tick vectors of public health importance, with special reference to Ixodes ricinus, Ixodes persulcatus, Amblyomma cajennense, Haemaphysalis bispinosa, Haemaphysalis longicornis, Hyalomma anatolicum, Hyalomma marginatum rufipes, Rhipicephalus appendiculatus, Rhipicephalus (Boophilus) microplus, Rhipicephalus pulchellus, Rhipicephalus sanguineus and Rhipicephalus turanicus. Eighty-three plant species from 35 botanical families were selected. The most frequent botanical families exploited as sources of acaricides and repellents against ticks were Asteraceae (15 % of the selected studies), Fabaceae (9 %), Lamiaceae (10 %), Meliaceae (5 %), Solanaceae (6

  8. Methods to Prevent Tick Bites and Lyme Disease.

    PubMed

    Ogden, Nick H; Lindsay, L Robbin; Schofield, Steven W

    2015-12-01

    Current approaches for prevention of tick bites, Lyme disease, and other tick-borne diseases are described. Particular attention is paid to 4 risk-reduction strategies: (i) avoiding risk areas; (ii) personal protective measures that reduce the risk of tick bites or transmission of the agent of Lyme disease, Borrelia burgdorferi; (iii) reducing the number of infected ticks in the environment; and (iv) use of prophylactic antibiotic treatments following a bite to prevent clinical Lyme disease.

  9. The bacterial microbiome of dermacentor andersoni ticks influences pathogen susceptibility

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Ticks are of medical and veterinary importance due to their ability to transmit pathogens to humans and animals. The Rocky Mountain wood tick, Dermacentor andersoni, is a vector of a number of pathogens, including Anaplasma marginale, which is the most widespread tick-borne pathogen of livestock. Al...

  10. 16 CFR 1632.6 - Ticking substitution procedure.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... application, fiber content, and weight per unit area. With respect to film-coated ticking, a mattress ticking... backing fabric construction, weave, finish, fiber content, and weight. (2) Mattress pad ticking prototype..., weave pattern design, finish application, fiber content, and weight per unit area. With respect to...

  11. Ticks associated with domestic dogs and cats in Florida, USA

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Voluntary collections of ticks from domestic dogs and cats by veterinary practitioners across Florida were conducted over a 10 month period. Of the 1,337 ticks submitted, five species of ixodid ticks were identified and included Rhipicephalus sanguineus, Amblyomma americanum, A. maculatum, Dermacen...

  12. 16 CFR 1632.6 - Ticking substitution procedure.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... provides an independent evaluation of the cigarette ignition characteristics of ticking and for the... as barriers against cigarette ignition; Class B represents tickings evaluated as having no effect on cigarette ignition; and Class C represents tickings evaluated as having the potential, in some manner,...

  13. The supercooling ability of ticks (Acari, Ixodoidea).

    PubMed

    Dautel, H; Knülle, W

    1996-01-01

    The supercooling capacity of nine laboratory-held species of ticks originating from different geographical areas, as well as five field-collected species from Germany, was investigated. All but one tick species showed mean supercooling points between about -17 and -23 degrees C, suggesting that the capacity to supercool to temperatures of < or = -17 degrees C might be an inherent property of many tick species unrelated to their geographic origin. Photoperiod did not influence the mean supercooling point in any of the species and there was also no distinct seasonal pattern of supercooling in seasonally acclimatized Dermacentor marginatus. Thus, the supercooling ability was independent of the presence/absence of diapause. The finding of thermal hysteresis in D. marginatus hemolymph raises the question of whether or not anti-freeze proteins are involved in the supercooling capacity of that species. An interspecies comparison revealed a weak negative correlation between relative water content and supercooling point of the ticks and an even weaker correlation between body mass or body water mass and the supercooling point. Since the ticks exhibited low supercooling points both before and shortly after feeding, the blood used as food should lack potent ice nucleators.

  14. [Tick-borne encephalitis--an update].

    PubMed

    Stock, Ingo

    2016-05-01

    Tick-borne encephalitis (TBE) is a systemic infectious disease with nonspecific symptoms and/or severe neurological disorders such as meningitis, encephalitis and myelitis. The disease is caused by TBE virus, an enveloped RNA virus belonging to the family of flaviviruses. Three subtypes are currently present in different parts of Europe and Asia. The TBE virus is transmitted to humans primarily by the tick bite of Ixodes species such as I. ricinus, but also by the ingestion of contaminated raw milk and raw milk products. In Germany, more than 75% of all TBE cases occur in Bavaria and Baden-Württemberg (southern Germany). Depending on the region, 1 to 4% of adult I. ricinus ticks in southern Germany are infected with the central European TBE virus variant. Treatment of TBE is symptomatic and supportive, a specific antiviral therapy does not exist. TBE cases acquired in central European countries have usually a good prognosis. Mortality rates above 2% have been documented in cases of tick-borne encephalitis in the elderly. In endemic areas, active immunization with inactivated TBE virus vaccines provides the most secure protection against TBE. In addition, exposure prophylaxis (protection against tick bites) plays a crucial role for TBE prevention.

  15. Bacteria associated with Amblyomma cajennense tick eggs

    PubMed Central

    Machado-Ferreira, Erik; Vizzoni, Vinicius Figueiredo; Piesman, Joseph; Gazeta, Gilberto Salles; Soares, Carlos Augusto Gomes

    2015-01-01

    Abstract Ticks represent a large group of pathogen vectors that blood feed on a diversity of hosts. In the Americas, the Ixodidae ticks Amblyomma cajennense are responsible for severe impact on livestock and public health. In the present work, we present the isolation and molecular identification of a group of culturable bacteria associated with A. cajennense eggs from females sampled in distinct geographical sites in southeastern Brazil. Additional comparative analysis of the culturable bacteria from Anocentor nitens, Rhipicephalus sanguineus and Ixodes scapularis tick eggs were also performed. 16S rRNA gene sequence analyses identified 17 different bacterial types identified as Serratia marcescens, Stenotrophomonas maltophilia, Pseudomonas fluorescens, Enterobacter spp., Micrococcus luteus, Ochrobactrum anthropi, Bacillus cereus and Staphylococcus spp., distributed in 12 phylogroups. Staphylococcus spp., especially S. sciuri, was the most prevalent bacteria associated with A. cajennense eggs, occurring in 65% of the samples and also frequently observed infecting A. nitens eggs. S. maltophilia, S. marcescens and B. cereus occurred infecting eggs derived from specific sampling sites, but in all cases rising almost as pure cultures from infected A. cajennense eggs. The potential role of these bacterial associations is discussed and they possibly represent new targets for biological control strategies of ticks and tick borne diseases. PMID:26537602

  16. Socio-economic factors in the differential upsurge of tick-borne encephalitis in Central and Eastern Europe.

    PubMed

    Sumilo, Dana; Bormane, Antra; Asokliene, Loreta; Vasilenko, Veera; Golovljova, Irina; Avsic-Zupanc, Tatjana; Hubalek, Zdenek; Randolph, Sarah E

    2008-01-01

    Tick-borne encephalitis (TBE), the most serious widespread vector-borne disease of humans in Europe, increased from 2- to 30-fold in many Central and Eastern European countries from 1992 to 1993, coinciding with independence from Soviet rule. Unemployment and low income have been shown in Latvia to be statistically associated with high-risk behaviour involving harvest of wild foods from tick-infested forests, and also with not being vaccinated against TBE. Archival data for 1970--2005 record major changes in the agricultural and industrial sectors, and consequent changes in the abiotic and biotic environment and socio-economic conditions, which could have increased the abundance of infected ticks and the contact of humans with those ticks. For example, abandoned agricultural fields became suitable for rodent transmission hosts; use of pesticides and emissions of atmospheric industrial pollutants plummeted; wildlife hosts for ticks increased; tick populations appear to have responded; unemployment and inequality increased in all countries. These factors, by acting synergistically but differentially between and within each country, can explain the marked spatio-temporal heterogeneities in TBE epidemiology better than can climate change alone, which is too uniform across wide areas. Different degrees of socio-economic upheaval caused by political transition in Estonia, Latvia, Lithuania, Slovenia and the Czech Republic can apparently explain the marked variation in TBE upsurge. Causal linkage between national socio-economic conditions and epidemiology is strongly indicated by striking correlations across eight countries between the degree of upsurge of TBE and both poverty and household expenditure on food (R2 = 0.533 and 0.716, respectively).

  17. Socio-economic factors in the differential upsurge of tick-borne encephalitis in Central and Eastern Europe.

    PubMed

    Sumilo, Dana; Bormane, Antra; Asokliene, Loreta; Vasilenko, Veera; Golovljova, Irina; Avsic-Zupanc, Tatjana; Hubalek, Zdenek; Randolph, Sarah E

    2008-01-01

    Tick-borne encephalitis (TBE), the most serious widespread vector-borne disease of humans in Europe, increased from 2- to 30-fold in many Central and Eastern European countries from 1992 to 1993, coinciding with independence from Soviet rule. Unemployment and low income have been shown in Latvia to be statistically associated with high-risk behaviour involving harvest of wild foods from tick-infested forests, and also with not being vaccinated against TBE. Archival data for 1970--2005 record major changes in the agricultural and industrial sectors, and consequent changes in the abiotic and biotic environment and socio-economic conditions, which could have increased the abundance of infected ticks and the contact of humans with those ticks. For example, abandoned agricultural fields became suitable for rodent transmission hosts; use of pesticides and emissions of atmospheric industrial pollutants plummeted; wildlife hosts for ticks increased; tick populations appear to have responded; unemployment and inequality increased in all countries. These factors, by acting synergistically but differentially between and within each country, can explain the marked spatio-temporal heterogeneities in TBE epidemiology better than can climate change alone, which is too uniform across wide areas. Different degrees of socio-economic upheaval caused by political transition in Estonia, Latvia, Lithuania, Slovenia and the Czech Republic can apparently explain the marked variation in TBE upsurge. Causal linkage between national socio-economic conditions and epidemiology is strongly indicated by striking correlations across eight countries between the degree of upsurge of TBE and both poverty and household expenditure on food (R2 = 0.533 and 0.716, respectively). PMID:18183571

  18. Upcoming of the integrated tick control program of ruminants with special emphasis on livestock farming system in India.

    PubMed

    Mondal, D B; Sarma, K; Saravanan, M

    2013-02-01

    Ticks and tick-borne diseases are a global problem and considered as a major obstacle in the health and product performance of animals which reflects impact on the livelihood of resource-poor farming communities. Tick control is practiced in a variety of methods including vaccination involving different livestock system. At present, periodic application of chemical acaricides is the most commonly used method of tick control especially among the small and marginal farmers of India. Resistance to existing chemical acaricides is widespread, and newer classes of acaricides have tended to be significantly more expensive. Presently, there is increasing concern about the use of chemicals in all forms of agriculture as well as livestock management by their potential environmental hazard and presence in food products. The use of herbal preparations among the rural folks is gaining importance because of their strong belief for folded benefits. Integrated control of ticks is the combination of a series of complementary control measures to make the best use of each without placing too much reliance on any single component. Alternative integrated approaches involve the use of eco-friendly cost effective sustainable methods in a strategic integrated manner.

  19. Tick cell culture isolation and growth of Rickettsia raoultii from Dutch Dermacentor reticulatus ticks.

    PubMed

    Alberdi, M Pilar; Nijhof, Ard M; Jongejan, Frans; Bell-Sakyi, Lesley

    2012-12-01

    Tick cell lines play an important role in research on ticks and tick-borne pathogenic and symbiotic microorganisms. In an attempt to derive continuous Dermacentor reticulatus cell lines, embryo-derived primary cell cultures were set up from eggs laid by field ticks originally collected as unfed adults in The Netherlands and maintained for up to 16 months. After several months, it became evident that cells in the primary cultures were infected with a Rickettsia-like intracellular organism. Supernatant medium containing some D. reticulatus cells was inoculated into cultures of 2 Rhipicephalus (Boophilus) microplus cell lines, BME/CTVM2 and BME/CTVM23, where abundant growth of the bacteria occurred intracellularly on transfer to both cell lines. Bacterial growth was monitored by light (live, inverted microscope, Giemsa-stained cytocentrifuge smears) and transmission electron microscopy revealing heavy infection with typical intracytoplasmic Rickettsia-like bacteria, not present in uninfected cultures. DNA was extracted from bacteria-infected and uninfected control cultures, and primers specific for Rickettsia 16S rRNA, ompB, and sca4 genes were used to generate PCR products that were subsequently sequenced. D. reticulatus primary cultures and both infected tick cell lines were positive for all 3 Rickettsia genes. Sequencing of PCR products revealed 99-100% identity with published Rickettsia raoultii sequences. The R. raoultii also grew abundantly in the D. nitens cell line ANE58, poorly in the D. albipictus cell line DALBE3, and not at all in the D. andersoni cell line DAE15. In conclusion, primary tick cell cultures and cell lines are useful systems for isolation and propagation of fastidious tick-borne microorganisms. In vitro isolation of R. raoultii from Dutch D. reticulatus confirms previous PCR-based detection in field ticks, and presence of the bacteria in the tick eggs used to initiate the primary cultures confirms that transovarial transmission of this

  20. Tick cell culture isolation and growth of Rickettsia raoultii from Dutch Dermacentor reticulatus ticks

    PubMed Central

    Alberdi, M. Pilar; Nijhof, Ard M.; Jongejan, Frans; Bell-Sakyi, Lesley

    2012-01-01

    Tick cell lines play an important role in research on ticks and tick-borne pathogenic and symbiotic microorganisms. In an attempt to derive continuous Dermacentor reticulatus cell lines, embryo-derived primary cell cultures were set up from eggs laid by field ticks originally collected as unfed adults in The Netherlands and maintained for up to 16 months. After several months, it became evident that cells in the primary cultures were infected with a Rickettsia-like intracellular organism. Supernatant medium containing some D. reticulatus cells was inoculated into cultures of 2 Rhipicephalus (Boophilus) microplus cell lines, BME/CTVM2 and BME/CTVM23, where abundant growth of the bacteria occurred intracellularly on transfer to both cell lines. Bacterial growth was monitored by light (live, inverted microscope, Giemsa-stained cytocentrifuge smears) and transmission electron microscopy revealing heavy infection with typical intracytoplasmic Rickettsia-like bacteria, not present in uninfected cultures. DNA was extracted from bacteria-infected and uninfected control cultures, and primers specific for Rickettsia 16S rRNA, ompB, and sca4 genes were used to generate PCR products that were subsequently sequenced. D. reticulatus primary cultures and both infected tick cell lines were positive for all 3 Rickettsia genes. Sequencing of PCR products revealed 99–100% identity with published Rickettsia raoultii sequences. The R. raoultii also grew abundantly in the D. nitens cell line ANE58, poorly in the D. albipictus cell line DALBE3, and not at all in the D. andersoni cell line DAE15. In conclusion, primary tick cell cultures and cell lines are useful systems for isolation and propagation of fastidious tick-borne microorganisms. In vitro isolation of R. raoultii from Dutch D. reticulatus confirms previous PCR-based detection in field ticks, and presence of the bacteria in the tick eggs used to initiate the primary cultures confirms that transovarial transmission of this

  1. 20 CFR 404.1095 - Agricultural trade or business.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Agricultural trade or business. 404.1095... Income § 404.1095 Agricultural trade or business. (a) An agricultural trade or business is one in which, if the trade or business were carried on entirely by employees, the major portion of the...

  2. 20 CFR 404.1095 - Agricultural trade or business.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ... 20 Employees' Benefits 2 2012-04-01 2012-04-01 false Agricultural trade or business. 404.1095... Income § 404.1095 Agricultural trade or business. (a) An agricultural trade or business is one in which, if the trade or business were carried on entirely by employees, the major portion of the...

  3. 20 CFR 404.1095 - Agricultural trade or business.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ... 20 Employees' Benefits 2 2013-04-01 2013-04-01 false Agricultural trade or business. 404.1095... Income § 404.1095 Agricultural trade or business. (a) An agricultural trade or business is one in which, if the trade or business were carried on entirely by employees, the major portion of the...

  4. Impact of Climate Trends on Tick-Borne Pathogen Transmission

    PubMed Central

    Estrada-Peña, Agustín; Ayllón, Nieves; de la Fuente, José

    2012-01-01

    Recent advances in climate research together with a better understanding of tick–pathogen interactions, the distribution of ticks and the diagnosis of tick-borne pathogens raise questions about the impact of environmental factors on tick abundance and spread and the prevalence and transmission of tick-borne pathogens. While undoubtedly climate plays a role in the changes in distribution and seasonal abundance of ticks, it is always difficult to disentangle factors impacting on the abundance of tick hosts from those exerted by human habits. All together, climate, host abundance, and social factors may explain the upsurge of epidemics transmitted by ticks to humans. Herein we focused on tick-borne pathogens that affect humans with epidemic potential. Borrelia burgdorferi s.l. (Lyme disease), Anaplasma phagocytophilum (human granulocytic anaplasmosis), and tick-borne encephalitis virus (tick-borne encephalitis) are transmitted by Ixodes spp. Crimean–Congo hemorrhagic fever virus (Crimean–Congo hemorrhagic fever) is transmitted by Hyalomma spp. In this review, we discussed how vector tick species occupy the habitat as a function of different climatic factors, and how these factors impact on tick survival and seasonality. How molecular events at the tick–pathogen interface impact on pathogen transmission is also discussed. Results from statistically and biologically derived models are compared to show that while statistical models are able to outline basic information about tick distributions, biologically derived models are necessary to evaluate pathogen transmission rates and understand the effect of climatic variables and host abundance patterns on pathogen transmission. The results of these studies could be used to build early alert systems able to identify the main factors driving the subtle changes in tick distribution and seasonality and the prevalence of tick-borne pathogens. PMID:22470348

  5. A Program in Agricultural Education in Nevada Based on Off-Farm Agricultural Occupations.

    ERIC Educational Resources Information Center

    Christensen, Howard Harward

    To investigate the further development of agricultural education in Nevada in light of current and future opportunities for employment in off-farm agricultural occupations, personal interviews were conducted with 363 agricultural firms and 30 agricultural agencies. Data were summarized for the 148 companies where some employees needed agricultural…

  6. Ticks parasitizing reptiles in the Bahamas.

    PubMed

    Durden, L A; Knapp, C R

    2005-09-01

    Two species of reptile ticks, Amblyomma dissimile Koch and Amblyomma torrei Pérez Vigueras (Acari: Ixodidae), are reported from the Bahama Islands for the first time. The widespread neotropical (including the Caribbean and southern Florida) A. dissimile was recovered on Andros Island from three species of reptiles all for the first time: the Andros iguana Cyclura cychlura cychlura Cuvier, the Andros curly tail lizard Leiocephalus carinatus coryi Schmidt, and the Andros boa Epicrates striatus fowleri Sheplan and Schwartz. The iguana tick A. torrei, previously known only from Cuba, Puerto Rico and the Cayman Islands, was recovered in the Exuma Islands from the Exuma iguana Cyclura cychlura figginsi Barbour. Mean numbers of ticks per host were as high as 36.6 on Mangrove Cay, Andros Island, and 25.8 on Pasture Cay in the Exuma Islands.

  7. 7 CFR 15a.7 - Designation of responsible employee and adoption of grievance procedures.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Designation of responsible employee and adoption of grievance procedures. 15a.7 Section 15a.7 Agriculture Office of the Secretary of Agriculture EDUCATION... Designation of responsible employee and adoption of grievance procedures. (a) Designation of...

  8. 7 CFR 15a.7 - Designation of responsible employee and adoption of grievance procedures.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... 7 Agriculture 1 2014-01-01 2014-01-01 false Designation of responsible employee and adoption of grievance procedures. 15a.7 Section 15a.7 Agriculture Office of the Secretary of Agriculture EDUCATION... Designation of responsible employee and adoption of grievance procedures. (a) Designation of...

  9. Recent cases of invasive alien mites and ticks in Japan: why is a regulatory framework needed?

    PubMed

    Goka, Koichi; Okabe, Kimiko; Takano, Ai

    2013-02-01

    Japan's economy depends on the importation of natural resources, and as a result, Japan is subjected to a high risk of biological invasion. Although Japan has quarantine systems to protect ecosystems, agriculture, forestry, fisheries, and human health against alien species, economic globalization has resulted in an ever-increasing risk of invasion. Mite invasion is no exception. Alien species that impact natural ecosystems are regulated in Japan by the Invasive Alien Species Act. However, the law focuses only on visibly recognizable species, so that species too small to see, such as viruses, bacteria, fungi, and mites, are beyond the scope of this law. The Plant Protection Law has limited the introduction of alien pests, including mites, that are harmful to agricultural crops. Recently, the liberalization of global trade policies have increased pressure to loosen regulations on various pests, including spider mites. Infectious diseases and their causative species are quarantined under the Rabies Prevention Law, the Domestic Animal Infectious Diseases Control Law, and the Human Infectious Diseases Control Law, but these laws do not cover wildlife diseases. The most serious problem is that wild reptiles, which can be carriers of ticks and tick-borne diseases, can be freely introduced to Japan. These loopholes in Japan's regulatory system have resulted in mite and tick invasions, which affect not only wildlife communities and human society but also endemism and biological diversity of natural mite populations.

  10. Tick-borne infections in the United States.

    PubMed

    Pujalte, George G A; Chua, Joel V

    2013-09-01

    Patients with illnesses caused by ticks may present with flulike symptoms. Physicians should learn how to recognize these illnesses by specific aspects in the patients' histories and physical examinations. Prevention of mortality and morbidity may depend on correct early diagnosis and treatment. Illness prevention may result with early removal of the tick, because infection usually requires 24 to 48 hours of attachment to the host. A bite from one tick may transmit several different pathogens leading to concurrent infections. The prevention of tick-borne illnesses can start with advice on how to prevent tick bites, especially during summer time. PMID:23958360

  11. [Prevention of tick-borne meningoencephalitis--summary report].

    PubMed

    Vlcková, J; Rupes, V; Kollárová, H; Horáková, D

    2011-09-01

    Tick-borne meningoencephalitis is a zoonosis that shows an upward trend. The causative agent is an RNA virus of the family Flaviviridae whose vector in Central Europe is the castor bean tick (Ixodes ricinus). The infection is most often transmitted via tick bite or, less commonly, by the alimentary route, through the consumption of unpasteurized milk of infected animals. Preventive measures consist in personal protection from ticks, exceptionally in blanket treatment with contact insecticides, in preventing consumption of unpasteurized milk and dairy products from areas with a high incidence of tick-borne encephalitis, and particularly in vaccination of the susceptible population.

  12. The relationship between spotted fever group Rickettsiae and Ixodid ticks

    PubMed Central

    Socolovschi, Cristina; Mediannikov, Oleg; Raoult, Didier; Parola, Philippe

    2009-01-01

    Spotted fever group Rickettsiae are predominantly transmitted by ticks. Rickettsiae have developed many strategies to adapt to different environmental conditions, including those within their arthropod vectors and vertebrate hosts. The tick-Rickettsiae relationship has been a point of interest for many researchers, with most studies concentrating on the role of ticks as vectors. Unfortunately, less attention has been directed towards the relationship of Rickettsiae with tick cells, tissues, and organs. This review summarizes our current understanding of the mechanisms involved in the relationship between ticks and Rickettsiae and provides an update on the recent methodological improvements that have allowed for comprehensive studies at the molecular level. PMID:19358804

  13. [Did you know this about the diseases spread by ticks?].

    PubMed

    Hytönen, Jukka

    2016-01-01

    The number of ticks, members of the acarids, is increasing in the Finnish nature, and the risk of tick-borne infections has therefore increased as well. The incidence of Lyme borreliosis and tick-borne encephalitis has also increased over the past few years. Possible recently discovered tick-borne infectious organisms include Borrelia miyamotoi and Anaplasma phagocytophilum bacteria and the babesia protozoon. Although infections caused by these microorganism are presumed to be rare in Finland, they should be considered in the differential, diagnosis of a febrile patient following a detected or suspected tick bite. PMID:27522835

  14. Conjunctival attachment of a tick: clinicopathologic report of a case.

    PubMed

    Willen, Christi; Mullen, Gary R; Yee, Jeff; Read, Russell W

    2011-03-01

    Attachment by ticks to ocular surfaces is uncommon, but has been reported. The objective of this article is to describe a case of conjunctival tick attachment and a method for removal by conjunctival excision. A 39-year-old man presented to the Emergency Department with a complaint of foreign-body sensation in his right eye. He was found to have a live tick embedded in his conjunctiva. The tick was removed en bloc with surrounding conjunctiva by an ophthalmologist. The arthropod was identified as the larval stage of the Lone Star tick (Amblyomma americanum). The patient did not experience any systemic illnesses or adverse sequelae. Attachment of ticks to the conjunctiva is unlikely to result in disease transmission when the larval stage is involved. However, removal by excision of a surrounding block of conjunctiva is recommended to ensure complete removal of all tick body parts. PMID:18514466

  15. Seasonal activity and tick-borne pathogen infection rates of Ixodes ricinus ticks in Hungary.

    PubMed

    Egyed, László; Elő, Péter; Sréter-Lancz, Zsuzsanna; Széll, Zoltán; Balogh, Zsuzsanna; Sréter, Tamás

    2012-04-01

    Ixodes ricinus is the most important tick species in Europe as it is most widely distributed and transmits the majority of tick-borne zoonotic pathogens. As limited data are available for Hungary, the aim of the present study was to investigate the seasonal timing of questing by I. ricinus and the infection rate of this tick species with all major tick-borne zoonotic pathogens. Monthly collections of I. ricinus were carried out over 3 consecutive years by dragging a blanket in 6 biotopes representing different areas of Hungary. Altogether, 1800 nymphs (300 per collection point) were screened as pooled samples (each of 5 specimens) by PCR-based methods for tick-borne pathogens. I. ricinus larvae, nymphs, and adults had bimodal activity patterns with a major peak in the spring. As newly moulted ticks of all stages are thought to emerge in the autumn of each year, it appears that most newly emerged ticks delayed their questing until the following spring. The minimum prevalence of Borrelia burgdorferi sensu lato was 2.5%. Borr. afzelii, Borr. burgdorferi sensu stricto, Borr. garinii, Borr. lusitaniae, and Borr. valaisiana were identified by hybridization. The minimum infection rate with spotted fever group rickettsiae was 1.9%. Rickettsia helvetica was identified in all biotopes. The minimum prevalence of Anaplasma phagocytophilum, Babesia divergens and Bab. microti was low (0.3-0.5%). Bartonella spp.-, Francisella tularensis-, and TBE virus-specific amplification products were not detected. Relative to the results of comparable studies carried out in the Carpathian Basin, the prevalence of tick-borne pathogens was low in Hungary. This might be attributed to the climatic difference between the lowland areas of Hungary and submountain areas of the surrounding countries involved in the studies.

  16. Tick bite victims and their environment: the risk of Lyme disease.

    PubMed

    Smith-Fiola, D C; Hallman, W K

    1995-09-01

    The authors surveyed 308 New Jersey tick bite victims. Education concerning landscape ecology, wildlife control, tick and wildlife habitat reduction, tick control using acaricides, and how to keep pets tick-free is especially needed to reduce human exposure to tick bites and Lyme disease.

  17. Ticks of Australia. The species that infest domestic animals and humans.

    PubMed

    Barker, Stephen C; Walker, Alan R

    2014-01-01

    The book Australian Ticks by F.H.S. Roberts (1970) is a land-mark in Australian tick biology. But it is time for a new and improved book on the ticks of Australia. The present book has identification guides and accounts of the biology and diseases associated with the 16 species of ticks that may feed on domestic animals and humans in Australia. These comprise five argasid (soft) ticks: Argas persicus (poultry tick), Argas robertsi (Robert's bird tick), Ornithodoros capensis (seabird soft tick), O. gurneyi (kangaroo soft tick), Otobius megnini (spinose ear tick); and 11 ixodid (hard) ticks, Amblyomma triguttatum (ornate kangaroo tick), Bothriocroton auruginans (wombat tick), B. hydrosauri (southern reptile tick), Haemaphysalis bancrofti (wallaby tick), H. longicornis (bush tick), Ixodes cornuatus (southern paralysis tick), I. hirsti (Hirst's marsupial tick), I. holocyclus (paralysis tick), I. tasmani (common marsupial tick), Rhipicephalus (Boophilus) australis (Australian cattle tick) and R. sanguineus (brown dog tick).  We use an image-matching system to identify ticks, much like the image-matching systems used in field-guides for birds and flowers. Ticks may be identified by drawings that emphasise unique matrices of uniformly defined morphological characters that, together, allow these 16 ticks to be identified by morphology unequivocally. The species accounts have seven sections: (i) General; (ii)  Differential diagnosis; (iii) Hosts; (iv) Life-cycle and seasonality; (v) Disease; (vi) Habitat and geographic distribution; (vii) Genes and genomes; and (viii) Other information. There are 71 figures and tables, including a glossary character matrices, drawings of life-cycles, drawings of genera, species, and colour photographs of tick biology. PMID:24943801

  18. First survey on hard ticks (Ixodidae) collected from humans in Romania: possible risks for tick-borne diseases.

    PubMed

    Briciu, V T; Titilincu, A; Tăţulescu, D F; Cârstina, D; Lefkaditis, M; Mihalca, A D

    2011-06-01

    The importance of studies on the diversity of ticks attacking humans resides mostly in the relatively highly-specific tick-pathogen associations. Human tick bites are commonly reported worldwide but removal of ticks from patients is rarely followed by specific identification of the ticks, leaving to some degree of hazard the preventive treatment of possible associated diseases. A total number of 308 ticks were collected between April and June 2010 from 275 human patients who voluntarily presented to a hospital from Cluj-Napoca, Romania. The mean intensity of infection was 1.12 ± 0.46. Four species of ticks were identified Ixodes ricinus, Dermacentor marginatus, Haemaphysalis concinna and H. punctata. Ixodes ricinus was the most abundant species feeding on humans in the study area. A brief review of possible associated pathogen is provided. PMID:21161719

  19. Spread of ticks and tick-borne diseases in Germany due to global warming.

    PubMed

    Hartelt, Kathrin; Pluta, Silvia; Oehme, Rainer; Kimmig, Peter

    2008-12-01

    Tick-transmitted diseases like tick-borne encephalitis and Lyme Borreliosis have been well known in Germany for decades. Global climate changes may influence the emergence and reemergence of diseases. Ongoing research now gives an additional focus on other tick-borne pathogens such as Coxiella burnetii, Rickettsia conorii, Anaplasma phagocytophilum and Babesia spp., the causative agents of Q-fever, Mediterranean spotted fever, Anaplasmosis and Babesiosis, respectively. The epidemiology of these pathogens was investigated on ticks as well as on rodents, the main hosts. Therefore adults of Dermacentor spp. (n = 862) and rodents (n = 119) were collected and examined for the existence of C. burnetii and Rickettsia spp. by polymerase chain reaction (PCR). In none of the ticks and rodents C. burnetii could be detected, in contrast to Rickettsia spp. where the infection rate in ticks was about 20%. Over and above that, nymphs and adults of Ixodes ricinus were also collected and investigated by PCR for A. phagocytophilum (n = 5,424), Rickettsia helvetica (n = 1,187) and Babesia spp. (n = 3,113). Thereby infection rates of 1%, 8.9% and 1%, respectively, could be determined. The prevalence in rodents was 5.3% for A. phagocytophilum and 0.8% for Babesia microti. None of the rodents was R. helvetica positive.

  20. Questing ticks in suburban forest are infected by at least six tick-borne pathogens.

    PubMed

    Reis, Caroline; Cote, Martine; Paul, Richard E L; Bonnet, Sarah

    2011-07-01

    The role of Ixodes ricinus ticks in the transmission of pathogens of public health importance such as Borrelia burgdorferi s.l. is widely recognized and is suspected in several emerging vector-borne pathogens in Europe. Here, we assess prevalence rates of several endemic and emerging zoonotic pathogens in tick populations in an area of high human population density in France, to contribute to a risk assessment for potential transmission to humans. Pathogen prevalence rates were evaluated by polymerase chain reaction detection and sequencing in questing ticks, individually for adults and in pools of 10 for nymphs. In addition to finding micro-organisms corresponding to symbionts, we found high prevalence rates of B. burgdorferi s.l. (32% of adult females and 10% of nymphs) and low to moderate ones of Anaplasma phagocytophilum (~1%), spotted fever group Rickettsia spp. (~6%), Babesia sp. EU1 (~1%), Bartonella birtlesii (0.1%), and Francisella tularensis (!1%). Our findings extend the knowledge of the geographical distribution of these endemic and emergent pathogens and support the conclusion that ticks are important vectors of pathogenic micro-organisms in suburban forests. Moreover, tick coinfection with multiple pathogens was found to occur frequently, which poses a serious challenge for diagnosis and appropriate treatment. The incrimination of these pathogens in potentially severe pathologies requires widespread surveillance to assess the risk of infection, thereby facilitating diagnosis and treatment, as well as raising local awareness of tick-borne diseases.

  1. Induction and suppression of tick cell antiviral RNAi responses by tick-borne flaviviruses

    PubMed Central

    Schnettler, Esther; Tykalová, Hana; Watson, Mick; Sharma, Mayuri; Sterken, Mark G.; Obbard, Darren J.; Lewis, Samuel H.; McFarlane, Melanie; Bell-Sakyi, Lesley; Barry, Gerald; Weisheit, Sabine; Best, Sonja M.; Kuhn, Richard J.; Pijlman, Gorben P.; Chase-Topping, Margo E.; Gould, Ernest A.; Grubhoffer, Libor; Fazakerley, John K.; Kohl, Alain

    2014-01-01

    Arboviruses are transmitted by distantly related arthropod vectors such as mosquitoes (class Insecta) and ticks (class Arachnida). RNA interference (RNAi) is the major antiviral mechanism in arthropods against arboviruses. Unlike in mosquitoes, tick antiviral RNAi is not understood, although this information is important to compare arbovirus/host interactions in different classes of arbovirus vectos. Using an Ixodes scapularis-derived cell line, key Argonaute proteins involved in RNAi and the response against tick-borne Langat virus (Flaviviridae) replication were identified and phylogenetic relationships characterized. Analysis of small RNAs in infected cells showed the production of virus-derived small interfering RNAs (viRNAs), which are key molecules of the antiviral RNAi response. Importantly, viRNAs were longer (22 nucleotides) than those from other arbovirus vectors and mapped at highest frequency to the termini of the viral genome, as opposed to mosquito-borne flaviviruses. Moreover, tick-borne flaviviruses expressed subgenomic flavivirus RNAs that interfere with tick RNAi. Our results characterize the antiviral RNAi response in tick cells including phylogenetic analysis of genes encoding antiviral proteins, and viral interference with this pathway. This shows important differences in antiviral RNAi between the two major classes of arbovirus vectors, and our data broadens our understanding of arthropod antiviral RNAi. PMID:25053841

  2. Rickettsiae and Borrelia burgdorferi in ixodid ticks.

    PubMed Central

    Magnarelli, L A; Andreadis, T G; Stafford, K C; Holland, C J

    1991-01-01

    Nymphs and adults of hard-bodied ticks were collected in Connecticut and tested by direct and indirect immunofluorescence staining methods for rickettsiae and Borrelia burgdorferi. Of the 609 Ixodes dammini ticks examined, 59 (9.7%) harbored rickettsialike microorganisms in hemocytes (blood cells). These bacteria reacted with fluorescein-conjugated antiserum to Ehrlichia canis, the etiologic agent of with fluorescein-conjugated antiserum to Ehrlichia canis, the etiologic agent of canine ehrlichiosis. Prevalence of infection ranged from 6.8 to 12.7% for males and females, respectively. Although the specific identities of the hemocytic rickettsialike organisms are unknown, they share antigens with ehrlichiae. Electron microscopy revealed rickettsiae in ovarian tissues of I. dammini that also had infected hemocytes. Rickettsialike organisms were also observed in the hemocytes of 5 (6.9%) of 73 Dermacentor variabilis ticks. In analyses for B. burgdorferi, 146 (23.7%) of 617 I. dammini ticks harbored these spirochetes in midguts. Hemocytic rickettsialike microorganisms coexisted with B. burgdorferi in 36 (6.7%) of the 537 nymphs and adults of I. dammini examined. I. dammini, with its broad host range, has the potential to acquire multiple microorganisms. Images PMID:1757551

  3. What's eating you? tick bite alopecia.

    PubMed

    Sperling, Leonard C; Sutton, Elizabeth; Wilke, Marke S

    2016-08-01

    Tick bite alopecia is seldom reported in the literature. The condition usually presents as a solitary oval zone of alopecia with a central eschar. Histologic findings are not well described but generally indicate dense perifollicular lymphocytic inflammation. The mechanism for hair loss is poorly understood, but the prognosis for hair regrowth appears to be favorable. PMID:27622251

  4. Ticks Take Cues from Mammalian Interferon.

    PubMed

    de Silva, Aravinda M

    2016-07-13

    Interferons are considered a first line of immune defense restricted to vertebrates. In this issue of Cell Host & Microbe, Smith et al. (2016) demonstrate that mammalian interferon γ activates an antimicrobial response within ticks feeding on blood. The study suggests that arthropods have a parallel interferon-like defense system. PMID:27414493

  5. Ticks (Ixodidae) on humans in South America.

    PubMed

    Guglielmone, A A; Beati, L; Barros-Battesti, D M; Labruna, M B; Nava, S; Venzal, J M; Mangold, A J; Szabó, M P J; Martins, J R; González-Acuña, D; Estrada-Peña, A

    2006-01-01

    Twenty eight species of Ixodidae have been found on man in South America (21 Amblyomma, 1 Boophilus, 2 Dermacentor, 2 Haemaphysalis, 1 Ixodes and 1 Rhipicephalus species). Most of them are rarely found on man. However, three species frequently parasitize humans in restricted areas of Argentina (A. neumanni reported from 46 localities), Uruguay (A. triste from 21 sites) and Argentina-Brazil (A. parvum from 27 localities). The most widespread ticks are A. cajennense (134 localities in Argentina, Bolivia, Brazil, Colombia, Ecuador, French Guiana, Guyana, Paraguay, Suriname and Venezuela), A. ovale (37 localities in Argentina, Brazil, Ecuador, French Guiana, Guyana, Paraguay, Suriname and Venezuela) and A. oblongoguttatum (28 sites in Brazil, Colombia, French Guiana, Guyana, Suriname and Venezuela). Amblyomma aureolatum (18 localities in Argentina, Brazil, French Guiana and Paraguay), A. cajennense, and A. triste are vectors of rickettsioses to man in South America. A better understanding of the respective roles of these and other tick species in transmitting pathogens to humans will require further local investigations. Amblyomma ticks should be the main subjects of these studies followed by species of Boophilus, Dermacentor, Haemaphysalis and Rhipicephalus species. In contrast with North America, Europe and Asia, ticks of the genus Ixodes do not appear to be major players in transmitting diseases to human. Indeed, there is only one record of an Ixodes collected while feeding on man for all South America.

  6. Molecular Detection of Tick-Borne Pathogens in Humans with Tick Bites and Erythema Migrans, in the Netherlands

    PubMed Central

    Jahfari, Setareh; Hofhuis, Agnetha; Fonville, Manoj; van der Giessen, Joke; van Pelt, Wilfrid; Sprong, Hein

    2016-01-01

    Background Tick-borne diseases are the most prevalent vector-borne diseases in Europe. Knowledge on the incidence and clinical presentation of other tick-borne diseases than Lyme borreliosis and tick-borne encephalitis is minimal, despite the high human exposure to these pathogens through tick bites. Using molecular detection techniques, the frequency of tick-borne infections after exposure through tick bites was estimated. Methods Ticks, blood samples and questionnaires on health status were collected from patients that visited their general practitioner with a tick bite or erythema migrans in 2007 and 2008. The presence of several tick-borne pathogens in 314 ticks and 626 blood samples of this cohort were analyzed using PCR-based methods. Using multivariate logistic regression, associations were explored between pathogens detected in blood and self-reported symptoms at enrolment and during a three-month follow-up period. Results Half of the ticks removed from humans tested positive for Borrelia burgdorferi sensu lato, Anaplasma phagocytophilum, Candidatus Neoehrlichia mikurensis, Rickettsia helvetica, Rickettsia monacensis, Borrelia miyamotoi and several Babesia species. Among 92 Borrelia burgdorferi s. l. positive ticks, 33% carried another pathogen from a different genus. In blood of sixteen out of 626 persons with tick bites or erythema migrans, DNA was detected from Candidatus Neoehrlichia mikurensis (n = 7), Anaplasma phagocytophilum (n = 5), Babesia divergens (n = 3), Borrelia miyamotoi (n = 1) and Borrelia burgdorferi s. l. (n = 1). None of these sixteen individuals reported any overt symptoms that would indicate a corresponding illness during the three-month follow-up period. No associations were found between the presence of pathogen DNA in blood and; self-reported symptoms, with pathogen DNA in the corresponding ticks (n = 8), reported tick attachment duration, tick engorgement, or antibiotic treatment at enrolment. Conclusions Based on molecular

  7. Clinical and neurophysiological features of tick paralysis.

    PubMed

    Grattan-Smith, P J; Morris, J G; Johnston, H M; Yiannikas, C; Malik, R; Russell, R; Ouvrier, R A

    1997-11-01

    The clinical and neurophysiological findings in six Australian children with generalized tick paralysis are described. Paralysis is usually caused by the mature female of the species Ixodes holocyclus. It most frequently occurs in the spring and summer months but can be seen at any time of year. Children aged 1-5 years are most commonly affected. The tick is usually found in the scalp, often behind the ear. The typical presentation is a prodrome followed by the development of an unsteady gait, and then ascending, symmetrical, flaccid paralysis. Early cranial nerve involvement is a feature, particularly the presence of both internal and external ophthalmoplegia. In contrast to the experience with North American ticks, worsening of paralysis in the 24-48 h following tick removal is common and the child must be carefully observed over this period. Death from respiratory failure was relatively common in the first half of the century and tick paralysis remains a potentially fatal condition. Respiratory support may be required for > 1 week but full recovery occurs. This is slow with several weeks passing before the child can walk unaided. Anti-toxin has a role in the treatment of seriously ill children but there is a high incidence of acute allergy and serum sickness. Neurophysiological studies reveal low-amplitude compound muscle action potentials with normal motor conduction velocities, normal sensory studies and normal response to repetitive stimulation. The biochemical structure of the toxin of I. holocyclus has not been fully characterized but there are many clinical, neurophysiological and experimental similarities to botulinum toxin. PMID:9397015

  8. Tick-borne pathogens, transmission rates and climate change.

    PubMed

    Estrada-Pena, Agustin

    2009-01-01

    Ticks are parasites that expend most of their life cycles off the host. Most important parts of the tick life cycle are directly dependent upon climate. There exist some concerns about the effects of the forecasted climate change on the geographical distribution of ticks. As tick life cycle dynamics would also be affected, the transmission of tick-borne pathogens could also be transformed by climate trends. Tick cycles are the result of complex interactions between climate, hosts populations, landscape characteristics, and the fine modulation of the populations of every partner involved, and not a simple, straightforward correlation between abundance and climate. The understanding of the climate niche used by different tick species may help in the search of clues towards a clarification of the expected effects of climate changes on the reported tick range shift. Populations of ticks occupying different portions of a wide geographical range may use different "portions" of the climate envelope, therefore resulting in misinterpretations from modeling results. Some advances can be foreseen in the complex task of modeling tick-host-pathogen interactions.

  9. SFTS virus in ticks in an endemic area of China.

    PubMed

    Wang, Shiwen; Li, Jiandong; Niu, Guoyu; Wang, Xianjun; Ding, Shujun; Jiang, Xiaolin; Li, Chuan; Zhang, Quanfu; Liang, Mifang; Bi, Zhenqiang; Li, Dexin

    2015-04-01

    In total, 3,145 ticks of the species Haemaphysalis longicornis (3,048; 96.9%), R. microplus (82; 2.6%), H. campanulata (9; 0.3%), and Dermacentor sinicus (5; 0.2%) were collected from animals and vegetation at Yantai in Shandong Province. Both adult and immature ticks were obtained, and all ticks collected from vegetation were unfed. Eggs were obtained from 22 blood-fed female ticks through maintenance at room temperature after collection. Severe fever with thrombocytopenia syndrome virus (SFTSV) viral RNA was identified in H. longicornis and R. microplus, with a prevalence of 4.75 per 100 ticks (95% confidence interval [95% CI] = 3.87-5.63) for ticks collected from animals and 2.24 per 100 ticks (95% CI = 1.27-3.21) for ticks collected from vegetation. The possibility that SFTSV transmission may occur by both the transstadial and transovarial routes was suggested by the fact that viral RNA was detected in H. longicornis at all developmental stages. Tick-derived sequences shared over 95.6% identity with human- and animal-derived isolates. This study provides evidence that implicates ticks as not only vectors but also, reservoirs of SFTSV. PMID:25711611

  10. The role of cystatins in tick physiology and blood feeding

    PubMed Central

    Schwarz, Alexandra; Valdés, James J.; Kotsyfakis, Michalis

    2012-01-01

    Summary Ticks, as obligate hematophagous ectoparasites, impact greatly on animal and human health because they transmit various pathogens worldwide. Over the last decade, several cystatins from different hard and soft ticks were identified and biochemically analyzed for their role in the physiology and blood feeding lifestyle of ticks. All these cystatins are potent inhibitors of papain-like cysteine proteases, but not of legumain. Tick cystatins were either detected in the salivary glands and/or the midgut, key tick organs responsible for blood digestion and the expression of pharmacologically potent salivary proteins for blood feeding. For example, the transcription of two cystatins named HlSC-1 and Sialostatin L2 was highly upregulated in these tick tissues during feeding. Vaccinating hosts against Sialostatin L2 and Om-cystatin 2 as well as silencing of a cystatin gene from Amblyomma americanum significantly inhibited the feeding ability of ticks. Additionally, Om-cystatin 2 and Sialostatin L possessed strong host immunosuppressive properties by inhibiting dendritic cell maturation due to their interaction with cathepsin S. These two cystatins, together with Sialostatin L2 are the first tick cystatins with resolved three-dimensional structure. Sialostatin L, furthermore, showed preventive properties against autoimmune diseases. In the case of the cystatin Hlcyst-2, experimental evidence showed its role in tick innate immunity, since increased Hlcyst-2 transcript levels were detected in Babesia gibsoni-infected larval ticks and the protein inhibited Babesia growth. Other cystatins, such as Hlcyst-1 or Om-cystatin 2 are assumed to be involved in regulating blood digestion. Only for Bmcystatin was a role in tick embryogenesis suggested. Finally, all the biochemically analyzed tick cystatins are powerful protease inhibitors, and some may be novel antigens for developing anti-tick vaccines and drugs of medical importance due to their stringent target specificity

  11. The role of cystatins in tick physiology and blood feeding.

    PubMed

    Schwarz, Alexandra; Valdés, James J; Kotsyfakis, Michalis

    2012-06-01

    Ticks, as obligate hematophagous ectoparasites, impact greatly on animal and human health because they transmit various pathogens worldwide. Over the last decade, several cystatins from different hard and soft ticks were identified and biochemically analyzed for their role in the physiology and blood feeding lifestyle of ticks. All these cystatins are potent inhibitors of papain-like cysteine proteases, but not of legumain. Tick cystatins were either detected in the salivary glands and/or the midgut, key tick organs responsible for blood digestion and the expression of pharmacologically potent salivary proteins for blood feeding. For example, the transcription of two cystatins named HlSC-1 and Sialostatin L2 was highly upregulated in these tick tissues during feeding. Vaccinating hosts against Sialostatin L2 and Om-cystatin 2 as well as silencing of a cystatin gene from Amblyomma americanum significantly inhibited the feeding ability of ticks. Additionally, Om-cystatin 2 and Sialostatin L possessed strong host immunosuppressive properties by inhibiting dendritic cell maturation due to their interaction with cathepsin S. These two cystatins, together with Sialostatin L2 are the first tick cystatins with resolved three-dimensional structure. Sialostatin L, furthermore, showed preventive properties against autoimmune diseases. In the case of the cystatin Hlcyst-2, experimental evidence showed its role in tick innate immunity, since increased Hlcyst-2 transcript levels were detected in Babesia gibsoni-infected larval ticks and the protein inhibited Babesia growth. Other cystatins, such as Hlcyst-1 or Om-cystatin 2 are assumed to be involved in regulating blood digestion. Only for Bmcystatin was a role in tick embryogenesis suggested. Finally, all the biochemically analyzed tick cystatins are powerful protease inhibitors, and some may be novel antigens for developing anti-tick vaccines and drugs of medical importance due to their stringent target specificity.

  12. 9 CFR 72.2 - Splenetic or tick fever in cattle in Texas, the Virgin Islands of the United States and vectors...

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... AGRICULTURE INTERSTATE TRANSPORTATION OF ANIMALS (INCLUDING POULTRY) AND ANIMAL PRODUCTS TEXAS (SPLENETIC... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Splenetic or tick fever in cattle in Texas, the Virgin Islands of the United States and vectors of said disease in the Northern...

  13. The mitochondrial genome of a Texas outbreak strain of the cattle tick, Rhipicephalus (Boophilus) microplus, derived from whole genome sequencing Pacific Biosciences and Illumina reads

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The cattle fever tick, Rhipicephalus (Boophilus) microplus is one of the most significant medical veterinary pests in the world, vectoring several serious livestock diseases negatively impacting agricultural economies of tropical and subtropical countries around the world. In our study, we assembled...

  14. Climate change, biodiversity, ticks and tick-borne diseases: The butterfly effect.

    PubMed

    Dantas-Torres, Filipe

    2015-12-01

    We have killed wild animals for obtaining food and decimated forests for many reasons. Nowadays, we are burning fossil fuels as never before and even exploring petroleum in deep waters. The impact of these activities on our planet is now visible to the naked eye and the debate on climate change is warming up in scientific meetings and becoming a priority on the agenda of both scientists and policy decision makers. On the occasion of the Impact of Environmental Changes on Infectious Diseases (IECID) meeting, held in the 2015 in Sitges, Spain, I was invited to give a keynote talk on climate change, biodiversity, ticks and tick-borne diseases. The aim of the present article is to logically extend my rationale presented on the occasion of the IECID meeting. This article is not intended to be an exhaustive review, but an essay on climate change, biodiversity, ticks and tick-borne diseases. It may be anticipated that warmer winters and extended autumn and spring seasons will continue to drive the expansion of the distribution of some tick species (e.g., Ixodes ricinus) to northern latitudes and to higher altitudes. Nonetheless, further studies are advocated to improve our understanding of the complex interactions between landscape, climate, host communities (biodiversity), tick demography, pathogen diversity, human demography, human behaviour, economics, and politics, also considering all ecological processes (e.g., trophic cascades) and other possible interacting effects (e.g., mutual effects of increased greenhouse gas emissions and increased deforestation rates). The multitude of variables and interacting factors involved, and their complexity and dynamism, make tick-borne transmission systems beyond (current) human comprehension. That is, perhaps, the main reason for our inability to precisely predict new epidemics of vector-borne diseases in general.

  15. Climate change, biodiversity, ticks and tick-borne diseases: The butterfly effect.

    PubMed

    Dantas-Torres, Filipe

    2015-12-01

    We have killed wild animals for obtaining food and decimated forests for many reasons. Nowadays, we are burning fossil fuels as never before and even exploring petroleum in deep waters. The impact of these activities on our planet is now visible to the naked eye and the debate on climate change is warming up in scientific meetings and becoming a priority on the agenda of both scientists and policy decision makers. On the occasion of the Impact of Environmental Changes on Infectious Diseases (IECID) meeting, held in the 2015 in Sitges, Spain, I was invited to give a keynote talk on climate change, biodiversity, ticks and tick-borne diseases. The aim of the present article is to logically extend my rationale presented on the occasion of the IECID meeting. This article is not intended to be an exhaustive review, but an essay on climate change, biodiversity, ticks and tick-borne diseases. It may be anticipated that warmer winters and extended autumn and spring seasons will continue to drive the expansion of the distribution of some tick species (e.g., Ixodes ricinus) to northern latitudes and to higher altitudes. Nonetheless, further studies are advocated to improve our understanding of the complex interactions between landscape, climate, host communities (biodiversity), tick demography, pathogen diversity, human demography, human behaviour, economics, and politics, also considering all ecological processes (e.g., trophic cascades) and other possible interacting effects (e.g., mutual effects of increased greenhouse gas emissions and increased deforestation rates). The multitude of variables and interacting factors involved, and their complexity and dynamism, make tick-borne transmission systems beyond (current) human comprehension. That is, perhaps, the main reason for our inability to precisely predict new epidemics of vector-borne diseases in general. PMID:26835253

  16. Climate change, biodiversity, ticks and tick-borne diseases: The butterfly effect

    PubMed Central

    Dantas-Torres, Filipe

    2015-01-01

    We have killed wild animals for obtaining food and decimated forests for many reasons. Nowadays, we are burning fossil fuels as never before and even exploring petroleum in deep waters. The impact of these activities on our planet is now visible to the naked eye and the debate on climate change is warming up in scientific meetings and becoming a priority on the agenda of both scientists and policy decision makers. On the occasion of the Impact of Environmental Changes on Infectious Diseases (IECID) meeting, held in the 2015 in Sitges, Spain, I was invited to give a keynote talk on climate change, biodiversity, ticks and tick-borne diseases. The aim of the present article is to logically extend my rationale presented on the occasion of the IECID meeting. This article is not intended to be an exhaustive review, but an essay on climate change, biodiversity, ticks and tick-borne diseases. It may be anticipated that warmer winters and extended autumn and spring seasons will continue to drive the expansion of the distribution of some tick species (e.g., Ixodes ricinus) to northern latitudes and to higher altitudes. Nonetheless, further studies are advocated to improve our understanding of the complex interactions between landscape, climate, host communities (biodiversity), tick demography, pathogen diversity, human demography, human behaviour, economics, and politics, also considering all ecological processes (e.g., trophic cascades) and other possible interacting effects (e.g., mutual effects of increased greenhouse gas emissions and increased deforestation rates). The multitude of variables and interacting factors involved, and their complexity and dynamism, make tick-borne transmission systems beyond (current) human comprehension. That is, perhaps, the main reason for our inability to precisely predict new epidemics of vector-borne diseases in general. PMID:26835253

  17. Tick-Borne Rickettsial Pathogens in Ticks and Small Mammals in Korea

    PubMed Central

    Kim, Chul-Min; Yi, Ying-Hua; Yu, Do-Hyeon; Lee, Mi-Jin; Cho, Mae-Rim; Desai, Atul R.; Shringi, Smriti; Klein, Terry A.; Kim, Heung-Chul; Song, Jin-Won; Baek, Luck-Ju; Chong, Sung-Tae; O'Guinn, Monica L.; Lee, John S.; Lee, In-Yong; Park, Jin-Ho; Foley, Janet; Chae, Joon-Seok

    2006-01-01

    In order to investigate the prevalence of tick-borne infectious agents among ticks, ticks comprising five species from two genera (Hemaphysalis spp. and Ixodes spp.) were screened using molecular techniques. Ticks (3,135) were collected from small wild-caught mammals or by dragging/flagging in the Republic of Korea (ROK) and were pooled into a total of 1,638 samples (1 to 27 ticks per pool). From the 1,638 tick samples, species-specific fragments of Anaplasma phagocytophilum (1 sample), Anaplasma platys (52 samples), Ehrlichia chaffeensis (29 samples), Ehrlichia ewingii (2 samples), Ehrlichia canis (18 samples), and Rickettsia rickettsii (28 samples) were amplified by PCR assay. Twenty-one pooled and individual tick samples had mixed infections of two (15 samples) or three (6 samples) pathogens. In addition, 424 spleen samples from small captured mammals (389 rodents, 33 insectivores, and 2 weasels) were screened for selected zoonotic pathogens. Species-specific DNA fragments of A. phagocytophilum (110 samples), A. platys (68 samples), E. chaffeensis (8 samples), E. ewingii (26 samples), E. canis (51 samples), and Rickettsia sp. (22 samples) were amplified by PCR assay. One hundred thirty small mammals had single infections, while 4, 14, and 21 striped field mice (Apodemus agrarius) had mixed infections of four, three, and two pathogens, respectively. Phylogenetic analysis based on nucleotide sequence comparison also revealed that Korean strains of E. chaffeensis clustered closely with those from China and the United States, while the Rickettsia (rOmpA) sequences clustered within a clade together with a Chinese strain. These results suggest that these agents should be considered in differential diagnosis while examining cases of acute febrile illnesses in humans as well as animals in the ROK. PMID:16957192

  18. Tick-borne rickettsial pathogens in ticks and small mammals in Korea.

    PubMed

    Kim, Chul-Min; Yi, Ying-Hua; Yu, Do-Hyeon; Lee, Mi-Jin; Cho, Mae-Rim; Desai, Atul R; Shringi, Smriti; Klein, Terry A; Kim, Heung-Chul; Song, Jin-Won; Baek, Luck-Ju; Chong, Sung-Tae; O'guinn, Monica L; Lee, John S; Lee, In-Yong; Park, Jin-Ho; Foley, Janet; Chae, Joon-Seok

    2006-09-01

    In order to investigate the prevalence of tick-borne infectious agents among ticks, ticks comprising five species from two genera (Hemaphysalis spp. and Ixodes spp.) were screened using molecular techniques. Ticks (3,135) were collected from small wild-caught mammals or by dragging/flagging in the Republic of Korea (ROK) and were pooled into a total of 1,638 samples (1 to 27 ticks per pool). From the 1,638 tick samples, species-specific fragments of Anaplasma phagocytophilum (1 sample), Anaplasma platys (52 samples), Ehrlichia chaffeensis (29 samples), Ehrlichia ewingii (2 samples), Ehrlichia canis (18 samples), and Rickettsia rickettsii (28 samples) were amplified by PCR assay. Twenty-one pooled and individual tick samples had mixed infections of two (15 samples) or three (6 samples) pathogens. In addition, 424 spleen samples from small captured mammals (389 rodents, 33 insectivores, and 2 weasels) were screened for selected zoonotic pathogens. Species-specific DNA fragments of A. phagocytophilum (110 samples), A. platys (68 samples), E. chaffeensis (8 samples), E. ewingii (26 samples), E. canis (51 samples), and Rickettsia sp. (22 samples) were amplified by PCR assay. One hundred thirty small mammals had single infections, while 4, 14, and 21 striped field mice (Apodemus agrarius) had mixed infections of four, three, and two pathogens, respectively. Phylogenetic analysis based on nucleotide sequence comparison also revealed that Korean strains of E. chaffeensis clustered closely with those from China and the United States, while the Rickettsia (rOmpA) sequences clustered within a clade together with a Chinese strain. These results suggest that these agents should be considered in differential diagnosis while examining cases of acute febrile illnesses in humans as well as animals in the ROK.

  19. 9 CFR 3.132 - Employees.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... Warmblooded Animals Other Than Dogs, Cats, Rabbits, Hamsters, Guinea Pigs, Nonhuman Primates, and Marine... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Employees. 3.132 Section 3.132 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE...

  20. 9 CFR 3.132 - Employees.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... 9 Animals and Animal Products 1 2014-01-01 2014-01-01 false Employees. 3.132 Section 3.132 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL... Warmblooded Animals Other Than Dogs, Cats, Rabbits, Hamsters, Guinea Pigs, Nonhuman Primates, and...

  1. 9 CFR 3.132 - Employees.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... 9 Animals and Animal Products 1 2013-01-01 2013-01-01 false Employees. 3.132 Section 3.132 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL... Warmblooded Animals Other Than Dogs, Cats, Rabbits, Hamsters, Guinea Pigs, Nonhuman Primates, and...

  2. 9 CFR 3.132 - Employees.

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... 9 Animals and Animal Products 1 2011-01-01 2011-01-01 false Employees. 3.132 Section 3.132 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL... Warmblooded Animals Other Than Dogs, Cats, Rabbits, Hamsters, Guinea Pigs, Nonhuman Primates, and...

  3. 9 CFR 3.32 - Employees.

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... 9 Animals and Animal Products 1 2011-01-01 2011-01-01 false Employees. 3.32 Section 3.32 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE STANDARDS Specifications for the Humane Handling, Care, Treatment, and Transportation of...

  4. 9 CFR 3.32 - Employees.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Employees. 3.32 Section 3.32 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE STANDARDS Specifications for the Humane Handling, Care, Treatment, and Transportation of...

  5. 9 CFR 3.57 - Employees.

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... 9 Animals and Animal Products 1 2011-01-01 2011-01-01 false Employees. 3.57 Section 3.57 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE STANDARDS Specifications for the Humane Handling, Care, Treatment and Transportation of...

  6. 9 CFR 3.32 - Employees.

    Code of Federal Regulations, 2012 CFR

    2012-01-01

    ... 9 Animals and Animal Products 1 2012-01-01 2012-01-01 false Employees. 3.32 Section 3.32 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE STANDARDS Specifications for the Humane Handling, Care, Treatment, and Transportation of...

  7. 9 CFR 3.32 - Employees.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... 9 Animals and Animal Products 1 2014-01-01 2014-01-01 false Employees. 3.32 Section 3.32 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE STANDARDS Specifications for the Humane Handling, Care, Treatment, and Transportation of...

  8. 9 CFR 3.57 - Employees.

    Code of Federal Regulations, 2012 CFR

    2012-01-01

    ... 9 Animals and Animal Products 1 2012-01-01 2012-01-01 false Employees. 3.57 Section 3.57 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE STANDARDS Specifications for the Humane Handling, Care, Treatment and Transportation of...

  9. 9 CFR 3.57 - Employees.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Employees. 3.57 Section 3.57 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE STANDARDS Specifications for the Humane Handling, Care, Treatment and Transportation of...

  10. 9 CFR 3.57 - Employees.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... 9 Animals and Animal Products 1 2013-01-01 2013-01-01 false Employees. 3.57 Section 3.57 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE STANDARDS Specifications for the Humane Handling, Care, Treatment and Transportation of...

  11. 9 CFR 3.57 - Employees.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... 9 Animals and Animal Products 1 2014-01-01 2014-01-01 false Employees. 3.57 Section 3.57 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE STANDARDS Specifications for the Humane Handling, Care, Treatment and Transportation of...

  12. 9 CFR 3.32 - Employees.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... 9 Animals and Animal Products 1 2013-01-01 2013-01-01 false Employees. 3.32 Section 3.32 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE STANDARDS Specifications for the Humane Handling, Care, Treatment, and Transportation of...

  13. A survey of tick-borne pathogens in dogs and their ticks in the Pantanal biome, Brazil.

    PubMed

    Melo, A L T; Witter, R; Martins, T F; Pacheco, T A; Alves, A S; Chitarra, C S; Dutra, V; Nakazato, L; Pacheco, R C; Labruna, M B; Aguiar, D M

    2016-03-01

    Tick and blood samples collected from domestic dogs in the Brazilian Pantanal were tested by molecular methods for the presence of tick-borne protozoa and bacteria. Among 320 sampled dogs, 3.13% were infected by Babesia vogeli (Piroplasmida: Babesiidae), 8.75% by Hepatozoon canis (Eucoccidiorida: Hepatozoidae), 7.19% by Anaplasma platys (Rickettsiales: Anaplasmataceae), and 0.94% by an unclassified Anaplasma sp. In three tick species collected from dogs, the following tick-borne agents were detected: (a) B. vogeli, An. platys and Ehrlichia canis (Rickettsiales: Anaplasmataceae), infecting Rhipicephalus sanguineus sensu lato (Ixodida: Ixodidae) ticks; (b) H. canis, an unclassified Anaplasma sp. and Rickettsia amblyommii (Rickettsiales: Rickettsiaceae), infecting Amblyomma cajennense sensu lato (Ixodida: Ixodidae) ticks, and (c) Rickettsia sp. strain Atlantic rainforest, an emerging human pathogen, infecting Amblyomma ovale ticks. Molecular analysis, based on a mitochondrial gene, revealed that the Am. cajennense s.l. ticks of the present study corresponded to Amblyomma sculptum, a member of the Am. cajennense species complex, and that Rh. sanguineus s.l. belonged to the tropical lineage. Whereas dogs are exposed to a number of tick-borne bacterial and protozoan agents in the Pantanal biome, humans are potentially exposed to infection by spotted fever group rickettsiae (e.g. R. amblyommii and Rickettsia sp. strain Atlantic rainforest) because both Am. sculptum and Am. ovale are among the most important human-biting ticks in Brazil. PMID:26467462

  14. Efficacy of an imidacloprid/flumethrin collar against fleas, ticks and tick-borne pathogens in dogs

    PubMed Central

    2013-01-01

    Background Tick-borne diseases comprise a group of maladies that are of substantial medical and veterinary significance. A range of tick-borne pathogens, including diverse species of bacteria and protozoa, can infect both dogs and humans. Hence, the control of tick infestations is pivotal to decrease or prevent tick-borne pathogen transmission. Therefore, different commercial products with insecticidal, repellent or both properties have been developed for use on dogs. Recently, a collar containing a combination of imidacloprid 10% and flumethrin 4.5% has proven effective to prevent tick and flea infestations in dogs under field conditions and the infection by some vector-borne pathogens they transmit under laboratory-controlled conditions. Methods From March 2011 to April 2012, a field study was conducted in a private shelter in southern Italy to assess the efficacy of the imidacloprid/flumethrin collar against tick and flea infestations and to determine if this strategy would decrease tick-borne pathogen transmission in young dogs. A total of 122 animals were enrolled in the study and randomly assigned to group A (n = 64; collared) or group B (n = 58; untreated controls). Dogs were examined monthly for ticks and fleas and systematically tested for selected tick-borne pathogens. Results Compared to controls, the collar provided overall efficacies of 99.7% and 100% against tick and flea infestation, respectively. The overall efficacy for the prevention of tick-borne pathogens (i.e., Anaplasma platys and Babesia vogeli) was 91.6%. Conclusions This study demonstrates that the imidacloprid/flumethrin collar is efficacious against flea and tick infestation as well as tick-borne pathogen transmission to dogs under field conditions. PMID:23972013

  15. Infection Prevalences of Common Tick-borne Pathogens in Adult Lone Star Ticks (Amblyomma americanum) and American Dog Ticks (Dermacentor variabilis) in Kentucky

    PubMed Central

    Fritzen, Charissa M.; Huang, Junjun; Westby, Kathleen; Freye, James D.; Dunlap, Brett; Yabsley, Michael J.; Schardein, Mike; Dunn, John R.; Jones, Timothy F.; Moncayo, Abelardo C.

    2011-01-01

    Rocky Mountain spotted fever, Lyme disease, and ehrlichiosis are tick-borne diseases that are reported annually in Kentucky. We conducted a survey to describe infection prevalence of tick-borne pathogens in Amblyomma americanum and Dermacentor variabilis ticks collected in Kentucky. During 2007–2008, we collected 287 ticks (179 D. variabilis and 108 A. americanum) from canine, feral hog, horse, raccoon, white-tailed deer, and human hosts in six counties in Kentucky. Ticks were screened for Rickettsia spp., Borrelia spp., and Ehrlichia spp. by using polymerase chain reaction. Forty-one (14.3%) ticks (31 A. americanum and 10 D. variabilis) were polymerase chain reaction–positive for a Rickettsia spp. Fourteen (4.9%) ticks (6 A. americanum and 8 D. variabilis) were positive for E. chaffeensis, and 4 A. americanum (1.4%) were positive for E. ewingii. One (0.4%) A. americanum was positive for Borrelia lonestari. Although Rocky Mountain spotted fever is diagnosed in Kentucky, no R. rickettsii was found in ticks in this study. PMID:21976578

  16. Infection prevalences of common tick-borne pathogens in adult lone star ticks (Amblyomma americanum) and American dog ticks (Dermacentor variabilis) in Kentucky.

    PubMed

    Fritzen, Charissa M; Huang, Junjun; Westby, Kathleen; Freye, James D; Dunlap, Brett; Yabsley, Michael J; Schardein, Mike; Dunn, John R; Jones, Timothy F; Moncayo, Abelardo C

    2011-10-01

    Rocky Mountain spotted fever, Lyme disease, and ehrlichiosis are tick-borne diseases that are reported annually in Kentucky. We conducted a survey to describe infection prevalence of tick-borne pathogens in Amblyomma americanum and Dermacentor variabilis ticks collected in Kentucky. During 2007-2008, we collected 287 ticks (179 D. variabilis and 108 A. americanum) from canine, feral hog, horse, raccoon, white-tailed deer, and human hosts in six counties in Kentucky. Ticks were screened for Rickettsia spp., Borrelia spp., and Ehrlichia spp. by using polymerase chain reaction. Forty-one (14.3%) ticks (31 A. americanum and 10 D. variabilis) were polymerase chain reaction-positive for a Rickettsia spp. Fourteen (4.9%) ticks (6 A. americanum and 8 D. variabilis) were positive for E. chaffeensis, and 4 A. americanum (1.4%) were positive for E. ewingii. One (0.4%) A. americanum was positive for Borrelia lonestari. Although Rocky Mountain spotted fever is diagnosed in Kentucky, no R. rickettsii was found in ticks in this study.

  17. Ticks on white-tailed deer fawns from southern Illinois.

    PubMed

    Nelson, T A; Grubb, K Y; Woolf, A

    1984-10-01

    Seventy-six white-tailed deer (Odocoileus virginianus (Zimmermann] fawns captured on Crab Orchard National Wildlife Refuge in southern Illinois during June-July 1980-1983 were aged and examined for ticks. The prevalence of ticks (Amblyomma americanum (Linnaeus, 1758) and Dermacentor variabilis (Say, 1821] was 80%; intensity of infestation ranged from one to 123 ticks per fawn, averaging 21.6. Tick intensity correlated poorly with age suggesting that there were other, more important determinants of infestation rates. Packed cell volumes in blood of the fawns increased significantly with age, but were not significantly affected by existing tick intensities. Ticks were not directly or indirectly implicated in any of 16 mortalities that occurred among 61 radio-collared fawns monitored for approximately 6 mo post-partum, and were not considered a serious health problem for fawns on the study area. PMID:6530716

  18. [Case report: isolated facial paralysis with a tick.].

    PubMed

    Gürbüz, Melek Kezban; Erdoğan, Murat; Doğan, Nihal; Birdane, Leyla; Cingi, Cemal; Cingi, Emre

    2010-01-01

    Tick-borne diseases are seen all over the world and their importance rises increasingly. It is noticeably important that disease and death rates due to tick-bites in our country in different areas increased in 2008. In Turkey, the numbers of diseases which are transmitted by ticks are considerably large and all of them are not detected. Reports of isolated facial paralysis cases due to tick infestation in the ear are infrequent in literature. The development of isolated facial paralysis due to ticks can be explained by several theories. This article reports a case report of a 3 year- old girl who was bought to our clinic with severe left ear pain and paresthesia on the left half of her face. She couldn't close her left eye and she lisped. The tick was removed from her external auditory canal surgically.

  19. Methods for control of tick vectors of Lyme Borreliosis

    USGS Publications Warehouse

    Jaenson, T.G.T.; Fish, D.; Ginsberg, H.S.; Gray, J.S.; Mather, T.N.; Piesman, J.

    1991-01-01

    During the IVth International Conference on Lyme Borreliosis in Stockholm, 1990, a workshop on control of Lyme disease vectors briefly reviewed: basic ecological principles for tick control; biocontrol of ticks; chemical control, including the use of repellents and use of permethrin-treated rodent nest material; tick control by habitat modification; and reduction of tick host availability. It was concluded that, although much research work remains, Lyme borreliosis is to a large extent a preventable infection. Avoidance of heavily tick-infested areas, personal protection using proper clothing, and prompt removal of attached ticks remain the most effective protective measures. Many other prophylactic measures are available and could be efficiently integrated into schemes to reduce the abundance of vectors. However, since the ecology of the infection varies greatly between different localities it may be necessary to apply different combinations of control methods in different endemic regions.

  20. Rickettsia conorii israelensis in Rhipicephalus sanguineus ticks, Sardinia, Italy.

    PubMed

    Chisu, Valentina; Masala, Giovanna; Foxi, Cipriano; Socolovschi, Cristina; Raoult, Didier; Parola, Philippe

    2014-06-01

    The presence of tick-borne Rickettsia spp. was examined by PCR using DNA samples extracted from 254 ticks collected from mammals originating from northern and eastern Sardinia, Italy. The spotted fever group rickettsial agent Rickettsia conorii israelensis was detected in 3 Rhipicephalus sanguineus ticks from a dog for the first time in this geographical area. In addition, Ri. massiliae, Ri. slovaca, and Ri. aeschlimannii were detected in Rh. turanicus, Rh. sanguineus, Dermacentor marginatus, and Hyalomma marginatum marginatum ticks from dogs, goats, wild boar, and horse. Moreover, Candidatus Rickettsia barbariae was detected in 2 Rh. turanicus ticks from goats. The detection of Ri. conorii israelensis, an emergent agent which causes Israeli spotted fever, increases our knowledge on tick-borne rickettsioses in Sardinia.

  1. Rickettsia species in ticks removed from humans in Istanbul, Turkey.

    PubMed

    Gargili, Aysen; Palomar, Ana M; Midilli, Kenan; Portillo, Aránzazu; Kar, Sırrı; Oteo, José A

    2012-11-01

    A total of 167 ticks collected from humans in Istanbul (Turkey) in 2006 were screened for Rickettsia species, and nested PCRs targeting gltA and ompA rickettsial fragment genes were carried out. Rickettsia monacensis (51), R. aeschlimannii (8), R. conorii subsp. conorii (3), R. helvetica (2), R. raoultii (1), R. africae (1), R. felis (1), and other Rickettsia spp. (2), were detected. To our knowledge, these Rickettsia species (except R. conorii) had never been reported in ticks removed from humans in Turkey. The presence of R. africae also had not been previously described, either in Hyalomma ticks or in any European tick species. In addition, R. aeschlimannii and R. felis had not been found associated with Rhipicephalus bursa specimens. The presence of human pathogenic Rickettsia in ticks removed from humans provides information about the risk of tick-borne rickettsioses in Turkey.

  2. Detection of Rickettsia and Anaplasma from hard ticks in Thailand.

    PubMed

    Malaisri, Premnika; Hirunkanokpun, Supanee; Baimai, Visut; Trinachartvanit, Wachareeporn; Ahantarig, Arunee

    2015-12-01

    We collected a total of 169 adult hard ticks and 120 nymphs from under the leaves of plants located along tourist nature trails in ten localities. The results present data examining the vector competence of ticks of different genera and the presence of Rickettsia and Anaplasma species. The ticks belonged to three genera, Amblyomma, Dermacentor, and Haemaphysalis, comprising 11 species. Rickettsia bacteria were detected at three collection sites, while Anaplasma bacteria were detected at only one site. Phylogenetic analysis revealed new rickettsia genotypes from Thailand that were closely related to Rickettsia tamurae, Rickettsia monacensis, and Rickettsia montana. This study was also the first to show that Anaplasma bacteria are found in Haemaphysalis shimoga ticks and are closely related evolutionarily to Anaplasma bovis. These results provide additional information for the geographical distribution of tick species and tick-borne bacteria in Thailand and can therefore be applied for ecotourism management. PMID:26611960

  3. Detection of Rickettsia and Anaplasma from hard ticks in Thailand.

    PubMed

    Malaisri, Premnika; Hirunkanokpun, Supanee; Baimai, Visut; Trinachartvanit, Wachareeporn; Ahantarig, Arunee

    2015-12-01

    We collected a total of 169 adult hard ticks and 120 nymphs from under the leaves of plants located along tourist nature trails in ten localities. The results present data examining the vector competence of ticks of different genera and the presence of Rickettsia and Anaplasma species. The ticks belonged to three genera, Amblyomma, Dermacentor, and Haemaphysalis, comprising 11 species. Rickettsia bacteria were detected at three collection sites, while Anaplasma bacteria were detected at only one site. Phylogenetic analysis revealed new rickettsia genotypes from Thailand that were closely related to Rickettsia tamurae, Rickettsia monacensis, and Rickettsia montana. This study was also the first to show that Anaplasma bacteria are found in Haemaphysalis shimoga ticks and are closely related evolutionarily to Anaplasma bovis. These results provide additional information for the geographical distribution of tick species and tick-borne bacteria in Thailand and can therefore be applied for ecotourism management.

  4. Assessment of bacterial diversity in the cattle tick Rhipicephalus (Boophilus) microplus through tag-encoded pyrosequencing

    PubMed Central

    2011-01-01

    Background Ticks are regarded as the most relevant vectors of disease-causing pathogens in domestic and wild animals. The cattle tick, Rhipicephalus (Boophilus) microplus, hinders livestock production in tropical and subtropical parts of the world where it is endemic. Tick microbiomes remain largely unexplored. The objective of this study was to explore the R. microplus microbiome by applying the bacterial 16S tag-encoded FLX-titanium amplicon pyrosequencing (bTEFAP) technique to characterize its bacterial diversity. Pyrosequencing was performed on adult males and females, eggs, and gut and ovary tissues from adult females derived from samples of R. microplus collected during outbreaks in southern Texas. Results Raw data from bTEFAP were screened and trimmed based upon quality scores and binned into individual sample collections. Bacteria identified to the species level include Staphylococcus aureus, Staphylococcus chromogenes, Streptococcus dysgalactiae, Staphylococcus sciuri, Serratia marcescens, Corynebacterium glutamicum, and Finegoldia magna. One hundred twenty-one bacterial genera were detected in all the life stages and tissues sampled. The total number of genera identified by tick sample comprised: 53 in adult males, 61 in adult females, 11 in gut tissue, 7 in ovarian tissue, and 54 in the eggs. Notable genera detected in the cattle tick include Wolbachia, Coxiella, and Borrelia. The molecular approach applied in this study allowed us to assess the relative abundance of the microbiota associated with R. microplus. Conclusions This report represents the first survey of the bacteriome in the cattle tick using non-culture based molecular approaches. Comparisons of our results with previous bacterial surveys provide an indication of geographic variation in the assemblages of bacteria associated with R. microplus. Additional reports on the identification of new bacterial species maintained in nature by R. microplus that may be pathogenic to its vertebrate hosts

  5. Preventing mosquito and tick bites: A Canadian update

    PubMed Central

    Onyett, Heather

    2014-01-01

    The present practice point provides updated guidance on personal protective measures to safely and effectively prevent mosquito and tick bites in Canada. Means of avoidance as well as physical and chemical barriers are described. Current information regarding insect and tick repellents and recommendations for their use are provided, along with instructions for removing ticks. Guidance on using insecticide for additional chemical protection is offered. PMID:25332663

  6. Ticks and spotted fever group rickettsiae of southeastern Virginia

    PubMed Central

    Sonenshine, Daniel E.; Hynes, Wayne L.; Gaff, Holly D.

    2013-01-01

    The incidence of tick-borne rickettsial disease in the southeastern United States has been rising steadily through the past decade, and the range expansions of tick species and tick-borne infectious agents, new and old, has resulted in an unprecedented mix of vectors and pathogens. The results of an ongoing 4-year surveillance project describe the relative abundance of questing tick populations in southeastern Virginia. Since 2009, more than 66,000 questing ticks of 7 species have been collected from vegetation in a variety of habitats, with Amblyomma americanum constituting over 95% of ticks collected. Other species represented included Ixodes scapularis, Dermacentor variabilis, Amblyomma maculatum, Ixodes affinis, Haemaphysalis leporispalustris, and Ixodes brunneus. We found that 26.9–54.9% of A. americanum ticks tested were positive for Rickettsia amblyommii, a non-pathogenic symbiont of this tick species. We also found no evidence of R. rickettsii in D. variabilis ticks, although they did show low infection rates of R. montanensis (1.5–2.0%). Rickettsia parkeri and Candidatus R. andeanae were found in 41.8–55.7% and 0–1.5% A. maculatum ticks, respectively. The rate of R. parkeri in A. maculatum ticks is among the highest in the literature and has increased in the 2 years since R. parkeri and A. maculatum were first reported in southeastern Virginia. We conclude that tick populations in southeastern Virginia have recently undergone dramatic changes in species and abundance and that these populations support a variety of rickettsial agents with the potential for increased risk to human health. PMID:24201057

  7. Interaction between ticks (Acari: Ixodidae) and pathogenic nematodes (Nematoda): susceptibility of tick species at various developmental stages.

    PubMed

    Samish, M; Alekseev, E; Glazer, I

    1999-11-01

    The virulence of entomopathogenic nematodes (Steinernematidae and Heterorhabditidae) to tick species under laboratory conditions is reported. The susceptibility of larval, nymphal, and adult stages of the ticks Hyalomma excavatum (Koch), Rhipicephalus bursa (Canestrini & Fanz), and R. sanguineus (Latereille) to 2 strains of Steinernema carpocapsae and 3 strains of Heterorhabditis bacteriophora were compared in laboratory assays. Preimaginal stages of ticks were found to be more resistant to the nematodes than were adult ticks which exhibited 80-100% mortality in a dish containing 5,000 infective juveniles of H. bacteriophora IS-3 or IS-5 strains isolated in Israel. These 2 strains were found to be much more virulent to unfed adult ticks than were the other isolates. No marked difference was found between engorged ticks and unfed adults of R. sanguineus or H. excavatum in terms of mortality, whereas engorged males and unfed females of R. bursa were significantly more susceptible than unfed males or engorged females. PMID:10593074

  8. Diel rhythms of tick parasitism on incubating African penguins.

    PubMed

    Duffy, D C; Daturi, A

    1987-01-01

    1. Ticks (Ornithodoros capensis Neumann) were most abundant on incubating host African penguins (Spheniscus demersus Linnaeus) at 24.00 hours and least abundant during 09.00-12.00 hours during 4 day periods in May and October at 3 h intervals. 2. Ticks were three times as abundant in May, the start of the breeding season, as in October, at its end. 3. Air temperature and humidity appear less important than light levels in determining tick activity. 4. The degree of tick parasitism of breeding seabirds is best studied at night.

  9. African swine fever virus infection in Ornithodoros ticks.

    PubMed

    Burrage, Thomas G

    2013-04-01

    African swine fever virus (ASFV) is an arbovirus which is vectored by soft ticks of the Ornithodoros spp. and in the sylvatic cycle infects wart hogs and bush pigs. ASFV infection of domestic swine causes a high mortality disease. On the other hand, ASFV infection of the tick can result in a high-titered and persistent infection depending upon the ASFV isolate and the tick combination. Recently, morphological, classical virology (titration) and recombinant ASFV have been used to study the cellular, molecular and genetic interactions that occur between ASFV and its host tick.

  10. Tick paralysis in Australia caused by Ixodes holocyclus Neumann

    PubMed Central

    Hall-Mendelin, S; Craig, S B; Hall, R A; O’Donoghue, P; Atwell, R B; Tulsiani, S M; Graham, G C

    2011-01-01

    Ticks are obligate haematophagous ectoparasites of various animals, including humans, and are abundant in temperate and tropical zones around the world. They are the most important vectors for the pathogens causing disease in livestock and second only to mosquitoes as vectors of pathogens causing human disease. Ticks are formidable arachnids, capable of not only transmitting the pathogens involved in some infectious diseases but also of inducing allergies and causing toxicoses and paralysis, with possible fatal outcomes for the host. This review focuses on tick paralysis, the role of the Australian paralysis tick Ixodes holocyclus, and the role of toxin molecules from this species in causing paralysis in the host. PMID:21396246

  11. Transport of ticks by migratory passerine birds to Norway.

    PubMed

    Hasle, Gunnar; Bjune, Gunnar; Edvardsen, Erik; Jakobsen, Christer; Linnehol, Bjørn; Røer, Jan Erik; Mehl, Reidar; Røed, Knut H; Pedersen, Jon; Leinaas, Hans Petter

    2009-12-01

    Ticks can be transported over large distances and across geographical barriers by avian hosts. During the spring migrations of 2003 to 2005, 9,768 passerine birds from 4 bird observatories along the southern coastline of Norway were examined for ticks. Altogether, 713 birds carried a total of 517 larvae and 1,440 nymphs. The highest prevalence of tick infestation was observed in thrushes and dunnock (Prunella modularis). The degree of tick infestation varied during each season, between localities, and from year to year. Blackbirds (Turdus merula) caught in localities with many ticks had greater infestation than those from localities with few or no ticks, suggesting local tick recruitment. A similar study performed during 1965–1970 involving 2 of the bird observatories in the present study found ticks on 4.2% of birds, while we found infestation of 6.9% at the same localities (P < 0.001). With the exception of 10 nymphs and 1 larva, the predominant tick was Ixodes ricinus. Seven nymphs of Hyalomma rufipes and 1 larva of Dermacentor sp. were also found. No species of Dermacentor had previously been found in Norway. PMID:19658452

  12. Cascading effect of economic globalization on human risks of scrub typhus and tick-borne rickettsial diseases.

    PubMed

    Kuo, Chi-Chien; Huang, Jing-Lun; Shu, Pei-Yun; Lee, Pei-Lung; Kelt, Douglas A; Wang, Hsi-Chieh

    2012-09-01

    The increase in global travel and trade has facilitated the dissemination of disease vectors. Globalization can also indirectly affect vector-borne diseases through the liberalization of cross-border trade, which has far-reaching, worldwide effects on agricultural practices and may in turn influence vectors through the modification of the ecological landscape. While the cascading effect of economic globalization on vector-borne diseases, sometimes acting synergistically with regional agricultural policy, could be substantial and have significant economic, agricultural, and public health implications, research into this remains very limited. We evaluated how abandonment of rice paddies in Taiwan after joining the World Trade Organization, along with periodic plowing, an agricultural policy to reduce farm pests in abandoned fields can unexpectedly influence risks to diseases transmitted by ticks and chiggers (larval trombiculid mites), which we collected from their small-mammal hosts. Sampling was limited to abandoned (fallow) and plowed fields due to the challenge of trapping small mammals in flooded rice paddies. Striped field mice (Apodemus agrarius) are the main hosts for both vectors. They harbored six times more ticks and three times more chiggers in fallow than in plowed plots. The proportion of ticks infected with Rickettsia spp. (etiologic agent of spotted fever) was three times higher in fallow plots, while that of Orientia tsutsugamushi (scrub typhus) in chiggers was similar in both treatments. Fallow plots had more ground cover and higher vegetation than plowed ones. Moreover, ticks and chiggers in both field types were dominated by species known to infest humans. Because ticks and chiggers should exhibit very low survival in flooded rice paddies, we propose that farm abandonment in Taiwan, driven by globalization, may have inadvertently led to increased risks of spotted fever and scrub typhus. However, periodic plowing can unintentionally mitigate vector

  13. Tick-borne relapsing fever in children.

    PubMed

    Le, C T

    1980-12-01

    Three cases of tick-borne fever diagnosed during the summer of 1979 are reported and the ecoepidemiology, clinical manifestations, and treatment of this infection are reviewed. Although challenging, the diagnosis can be made easily if specific historical clues are sought and the patient's blood smear is carefully examined. The diagnosis of this condition early in its course can save clinicians and patients the anxiety and cost of the work-up of a "fever of unknown origin." Since vacationing in the national parks and forests has become increasingly popular among many American families, tick-borne relapsing fever should be considered in any patient with an acute or recurrent fever of unknown origin who exhibits nonspecific symptoms of an undifferentiated "viral illness," and who gives a history of sleeping overnight in log cabins in the coniferous forests of the Western mountains of the United States.

  14. Resistance status of ticks (Acari; Ixodidae) to amitraz and cypermethrin acaricides in Isoka District, Zambia.

    PubMed

    Muyobela, Jackson; Nkunika, Philip Obed Yobe; Mwase, Enala Tembo

    2015-12-01

    This study was designed to obtain data on the farmer's approach to tick control and to determine whether Rhipicephalus appendiculatus Neuman, Amblyomma variegatum (Fabricius), and Rhipicephalus (Boophilus) microplus (Canestrini) were resistant to amitraz and cypermethrin acaricides, in Isoka District, Zambia. Prevailing tick control practices were documented by administering a semi-structured questionnaire to 80 randomly selected smallholder livestock farmers from four agricultural camps (Longwe, Kantenshya, Kapililonga, and Ndeke) in Isoka District. Modified larval packet test (LPT) bioassay experiments were used to determine the resistance status of the common tick species against amitraz and cypermethrin acaricides. Fifty percent of respondents practiced chemical tick control with amitraz (27 %) and cypermethrin (23 %) being the acaricides in use, and were applied with knapsack sprayers. Less than 3 l of spray wash per animal was used which was considerably lower than the recommended delivery rate of 10 l of spray wash per animal. No significant susceptibility change to amitraz at 95 % confidence level was observed in R. appendiculatus and A. variegatum against amitraz. However, a significant change in the susceptibility of R. (Bo.) microplus tested with amitraz was detected at 95 % confidence. The test population had a lower susceptibility (LD50 0.014 %; LD90 0.023 %) than the reference population (LD50 0.013 %; LD90 0.020 %). The results indicated that resistance to amitraz was developing in R. (Bo.) microplus. For cypermethrin, no significant susceptibility change at 95 % confidence was observed in any of the three species and thus resistance to this chemical was not observed.

  15. Resistance status of ticks (Acari; Ixodidae) to amitraz and cypermethrin acaricides in Isoka District, Zambia.

    PubMed

    Muyobela, Jackson; Nkunika, Philip Obed Yobe; Mwase, Enala Tembo

    2015-12-01

    This study was designed to obtain data on the farmer's approach to tick control and to determine whether Rhipicephalus appendiculatus Neuman, Amblyomma variegatum (Fabricius), and Rhipicephalus (Boophilus) microplus (Canestrini) were resistant to amitraz and cypermethrin acaricides, in Isoka District, Zambia. Prevailing tick control practices were documented by administering a semi-structured questionnaire to 80 randomly selected smallholder livestock farmers from four agricultural camps (Longwe, Kantenshya, Kapililonga, and Ndeke) in Isoka District. Modified larval packet test (LPT) bioassay experiments were used to determine the resistance status of the common tick species against amitraz and cypermethrin acaricides. Fifty percent of respondents practiced chemical tick control with amitraz (27 %) and cypermethrin (23 %) being the acaricides in use, and were applied with knapsack sprayers. Less than 3 l of spray wash per animal was used which was considerably lower than the recommended delivery rate of 10 l of spray wash per animal. No significant susceptibility change to amitraz at 95 % confidence level was observed in R. appendiculatus and A. variegatum against amitraz. However, a significant change in the susceptibility of R. (Bo.) microplus tested with amitraz was detected at 95 % confidence. The test population had a lower susceptibility (LD50 0.014 %; LD90 0.023 %) than the reference population (LD50 0.013 %; LD90 0.020 %). The results indicated that resistance to amitraz was developing in R. (Bo.) microplus. For cypermethrin, no significant susceptibility change at 95 % confidence was observed in any of the three species and thus resistance to this chemical was not observed. PMID:26310511

  16. The climate system as a ticking clock

    SciTech Connect

    Kerr, R.A.

    1990-09-14

    Climate researchers are picking up a more or less regular 2-year beat to the global climate system - one that seems to be heard from every quarter. The most recently discovered example of this climatic ticking - and perhaps the most intriguing - comes from the very core of El Nino. Researchers have found that some aspects of this cycle of alternating warm and relatively cold waters along the equatorial Pacific have a tendency to repeat every 2 years. The overlying winds pulsate at the same pace, as do the globe-girdling effects of the El Nino cycle, from winter warmth in Alaska to heavy rains in Peru and drought in Australia. The climatic ticking in the tropical Pacific is hardly as reliable as the changing of the seasons. Sometimes it is muted, and occasionally it skips a beat. But some researchers nevertheless see hope of using it in the prediction of El Nino and its global effects. In any case, climate researchers are eager to determine what makes El Nino tick. The answer could be an underlying pacemaker of this crucial atmospheric cycle.

  17. Changing distributions of ticks: causes and consequences.

    PubMed

    Léger, Elsa; Vourc'h, Gwenaël; Vial, Laurence; Chevillon, Christine; McCoy, Karen D

    2013-02-01

    Today, we are witnessing changes in the spatial distribution and abundance of many species, including ticks and their associated pathogens. Evidence that these changes are primarily due to climate change, habitat modifications, and the globalisation of human activities are accumulating. Changes in the distribution of ticks and their invasion into new regions can have numerous consequences including modifications in their ecological characteristics and those of endemic species, impacts on the dynamics of local host populations and the emergence of human and livestock disease. Here, we review the principal causes for distributional shifts in tick populations and their consequences in terms of the ecological attributes of the species in question (i.e. phenotypic and genetic responses), pathogen transmission and disease epidemiology. We also describe different methodological approaches currently used to assess and predict such changes and their consequences. We finish with a discussion of new research avenues to develop in order to improve our understanding of these host-vector-pathogen interactions in the context of a changing world. PMID:23015121

  18. Changing distributions of ticks: causes and consequences.

    PubMed

    Léger, Elsa; Vourc'h, Gwenaël; Vial, Laurence; Chevillon, Christine; McCoy, Karen D

    2013-02-01

    Today, we are witnessing changes in the spatial distribution and abundance of many species, including ticks and their associated pathogens. Evidence that these changes are primarily due to climate change, habitat modifications, and the globalisation of human activities are accumulating. Changes in the distribution of ticks and their invasion into new regions can have numerous consequences including modifications in their ecological characteristics and those of endemic species, impacts on the dynamics of local host populations and the emergence of human and livestock disease. Here, we review the principal causes for distributional shifts in tick populations and their consequences in terms of the ecological attributes of the species in question (i.e. phenotypic and genetic responses), pathogen transmission and disease epidemiology. We also describe different methodological approaches currently used to assess and predict such changes and their consequences. We finish with a discussion of new research avenues to develop in order to improve our understanding of these host-vector-pathogen interactions in the context of a changing world.

  19. Uukuniemi Virus as a Tick-Borne Virus Model

    PubMed Central

    Mazelier, Magalie; Rouxel, Ronan Nicolas; Zumstein, Michael; Mancini, Roberta; Bell-Sakyi, Lesley

    2016-01-01

    ABSTRACT In the last decade, novel tick-borne pathogenic phleboviruses in the family Bunyaviridae, all closely related to Uukuniemi virus (UUKV), have emerged on different continents. To reproduce the tick-mammal switch in vitro, we first established a reverse genetics system to rescue UUKV with a genome close to that of the authentic virus isolated from the Ixodes ricinus tick reservoir. The IRE/CTVM19 and IRE/CTVM20 cell lines, both derived from I. ricinus, were susceptible to the virus rescued from plasmid DNAs and supported production of the virus over many weeks, indicating that infection was persistent. The glycoprotein GC was mainly highly mannosylated on tick cell-derived viral progeny. The second envelope viral protein, GN, carried mostly N-glycans not recognized by the classical glycosidases peptide-N-glycosidase F (PNGase F) and endoglycosidase H (Endo H). Treatment with β-mercaptoethanol did not impact the apparent molecular weight of GN. On viruses originating from mammalian BHK-21 cells, GN glycosylations were exclusively sensitive to PNGase F, and the electrophoretic mobility of the protein was substantially slower after the reduction of disulfide bonds. Furthermore, the amount of viral nucleoprotein per focus forming unit differed markedly whether viruses were produced in tick or BHK-21 cells, suggesting a higher infectivity for tick cell-derived viruses. Together, our results indicate that UUKV particles derived from vector tick cells have glycosylation and structural specificities that may influence the initial infection in mammalian hosts. This study also highlights the importance of working with viruses originating from arthropod vector cells in investigations of the cell biology of arbovirus transmission and entry into mammalian hosts. IMPORTANCE Tick-borne phleboviruses represent a growing threat to humans globally. Although ticks are important vectors of infectious emerging diseases, previous studies have mainly involved virus stocks

  20. Detection, characterization, and prediction of tick-borne disease foci.

    PubMed

    Cortinas, M Roberto; Guerra, Marta A; Jones, Carl J; Kitron, Uriel

    2002-06-01

    Tick-borne disease (TBD) transmission foci need to be characterized in space and time, and are often discontinuous on both scales. An active TBD focus is dependent on the fulfillment of three conditions: tick survival, pathogen survival and opportunities for human exposure. The essentials for tick survival include food sources, reproduction, and protection from environmental extremes. The pathogen survival kit includes sufficient densities of ticks and suitable reservoir hosts, and opportunities for transmission between them in order to maintain infection. Opportunities for human exposure depend on sufficient number of encounters between ticks and humans. Because tick foci need to be described on a range of spatial and temporal resolutions, data for such characterization include a variety of surveillance data, field and laboratory experimental data, as well as results of statistical and mathematical analysis and modeling. The application of new tools from molecular biology, geographic information systems (GIS), and satellite imagery, in conjunction with appropriate analytical methods allow for detection of unknown foci and prediction of new ones. A long-term multi-scale study of Ixodes scapularis and Lyme disease in the north-central U. S. is reviewed. Diverse surveillance methods of ticks, rodents, deer, canids and humans were coupled with environmental characterization in situ to create a habitat profile for Lyme disease ticks. Incorporating various digitized databases, a statistical model was used to develop a risk map for tick distribution in the region. The process of introduction and establishment of new tick foci along the Illinois River is described in relation to the known tick distribution and predictions of invasion based on the risk model. PMID:12141734

  1. Immunization of Cattle with Tick Salivary Gland Extracts

    PubMed Central

    Nikpay, Ali; Nabian, Sedigheh

    2016-01-01

    Background: Rhipicephalus (Boophilus) annulatus tick is one of the most important ectoparasite of cattle. Recently, several laboratories in the world have been concentrated on immunizing cattle against tick using various types of tissue extracts of ticks. The aim of this study was to evaluate the effect of immunization of cattle with tick salivary gland extract on biological parameters of ticks and humoral immune responses of cattle. Methods: Fourteen more dominant protein bands identified as immunogenic by Western-blot analysis were eluted from polyacrylamide gel. Test and control groups were injected three times with eluted proteins and sterile PBS (pH= 7.2) respectively with equivalent amount of adjuvant. After four weeks a tick challenge was performed. Finally, biological parameters of collected engorged female ticks were recorded and humoral immune responses to immunization measured by ELISA. Results: The results indicated immunization of cattle resulted in reduction in mean tick counts, attachment, engorgement weights, feeding index, egg mass weight, hatchability and fertility index (respectively 63.1%, 62.6%, 30.2%, 36.4%, 40%, 78.7% and 13.3%) and increased duration of feeding, preoviposition and incubation period of eggs (respectively 8.6%, 45 and 31.34%). All changes were statistically significant (P< 0.05). Results showed an increase in antibody production of test group from the first week after immunization. The antibody level was boosted following tick infestation. Conclusion: This investigation indicates that immunization of cattle with these antigens could induce a protective immune response against Rh. (B.) annulatus tick that would be expected to provide a safe non-chemical means of tick control. PMID:27308287

  2. Development of vaccines against Ornithodoros soft ticks: An update.

    PubMed

    Díaz-Martín, Verónica; Manzano-Román, Raúl; Obolo-Mvoulouga, Prosper; Oleaga, Ana; Pérez-Sánchez, Ricardo

    2015-04-01

    Ticks are parasites of great medical and veterinary importance since they are vectors of numerous pathogens that affect humans, livestock and pets. Among the argasids, several species of the genus Ornithodoros transmit serious diseases such as tick-borne human relapsing fever (TBRF) and African Swine Fever (ASF). In particular, Ornithodoros erraticus is the main vector of these two diseases in the Mediterranean while O. moubata is the main vector in Africa. The presence of these Ornithodoros ticks in domestic and peridomestic environments may greatly hinder the eradication of TBRF and ASF from endemic areas. In addition, there is a constant threat of reintroduction and spreading of ASF into countries from where it has been eradicated (Spain and Portugal) or where it was never present (the Caucasus, Russia and Eastern Europe). In these countries, the presence of Ornithodoros vectors could have a tremendous impact on ASF transmission and long-term maintenance. Therefore, elimination of these ticks from at least synanthropic environments would contribute heavily to the prevention and control of the diseases they transmit. Tick control is a difficult task and although several methods for such control have been used, none of them has been fully effective against all ticks and the problems they cause. Nevertheless, immunological control using anti-tick vaccines offers an attractive alternative to the traditional use of acaricides. The aim of the present paper is to offer a brief overview of the current status in control measure development for Ornithodoros soft ticks, paying special attention to the development of vaccines against O. erraticus and O. moubata. Thus, our contribution includes an analysis of the chief attributes that the ideal antigens for an anti-tick vaccine should have, an exhaustive compilation and analysis of the scant anti-soft tick vaccine trials carried out to date using both concealed and salivary antigens and, finally, a brief description of the

  3. Development of vaccines against Ornithodoros soft ticks: An update.

    PubMed

    Díaz-Martín, Verónica; Manzano-Román, Raúl; Obolo-Mvoulouga, Prosper; Oleaga, Ana; Pérez-Sánchez, Ricardo

    2015-04-01

    Ticks are parasites of great medical and veterinary importance since they are vectors of numerous pathogens that affect humans, livestock and pets. Among the argasids, several species of the genus Ornithodoros transmit serious diseases such as tick-borne human relapsing fever (TBRF) and African Swine Fever (ASF). In particular, Ornithodoros erraticus is the main vector of these two diseases in the Mediterranean while O. moubata is the main vector in Africa. The presence of these Ornithodoros ticks in domestic and peridomestic environments may greatly hinder the eradication of TBRF and ASF from endemic areas. In addition, there is a constant threat of reintroduction and spreading of ASF into countries from where it has been eradicated (Spain and Portugal) or where it was never present (the Caucasus, Russia and Eastern Europe). In these countries, the presence of Ornithodoros vectors could have a tremendous impact on ASF transmission and long-term maintenance. Therefore, elimination of these ticks from at least synanthropic environments would contribute heavily to the prevention and control of the diseases they transmit. Tick control is a difficult task and although several methods for such control have been used, none of them has been fully effective against all ticks and the problems they cause. Nevertheless, immunological control using anti-tick vaccines offers an attractive alternative to the traditional use of acaricides. The aim of the present paper is to offer a brief overview of the current status in control measure development for Ornithodoros soft ticks, paying special attention to the development of vaccines against O. erraticus and O. moubata. Thus, our contribution includes an analysis of the chief attributes that the ideal antigens for an anti-tick vaccine should have, an exhaustive compilation and analysis of the scant anti-soft tick vaccine trials carried out to date using both concealed and salivary antigens and, finally, a brief description of the

  4. Tick salivary compounds: their role in modulation of host defences and pathogen transmission

    PubMed Central

    Kazimírová, Mária; Štibrániová, Iveta

    2013-01-01

    Ticks require blood meal to complete development and reproduction. Multifunctional tick salivary glands play a pivotal role in tick feeding and transmission of pathogens. Tick salivary molecules injected into the host modulate host defence responses to the benefit of the feeding ticks. To colonize tick organs, tick-borne microorganisms must overcome several barriers, i.e., tick gut membrane, tick immunity, and moulting. Tick-borne pathogens co-evolved with their vectors and hosts and developed molecular adaptations to avoid adverse effects of tick and host defences. Large gaps exist in the knowledge of survival strategies of tick-borne microorganisms and on the molecular mechanisms of tick-host-pathogen interactions. Prior to transmission to a host, the microorganisms penetrate and multiply in tick salivary glands. As soon as the tick is attached to a host, gene expression and production of salivary molecules is upregulated, primarily to facilitate feeding and avoid tick rejection by the host. Pathogens exploit tick salivary molecules for their survival and multiplication in the vector and transmission to and establishment in the hosts. Promotion of pathogen transmission by bioactive molecules in tick saliva was described as saliva-assisted transmission (SAT). SAT candidates comprise compounds with anti-haemostatic, anti-inflammatory and immunomodulatory functions, but the molecular mechanisms by which they mediate pathogen transmission are largely unknown. To date only a few tick salivary molecules associated with specific pathogen transmission have been identified and their functions partially elucidated. Advanced molecular techniques are applied in studying tick-host-pathogen interactions and provide information on expression of vector and pathogen genes during pathogen acquisition, establishment and transmission. Understanding the molecular events on the tick-host-pathogen interface may lead to development of new strategies to control tick-borne diseases. PMID

  5. Risk of exposure to ticks (Ixodidae) and the prevalence of tick-borne encephalitis virus (TBEV) in ticks in Southern Poland.

    PubMed

    Cuber, Piotr; Andreassen, Åshild; Vainio, Kirsti; Asman, Marek; Dudman, Susanne; Szilman, Piotr; Szilman, Ewa; Ottesen, Preben; Ånestad, Gabriel; Cieśla-Nobis, Sabina; Solarz, Krzysztof

    2015-04-01

    The article presents the results of the first study on seasonal activity of ticks and prevalence of tick-borne encephalitis virus (TBEV) in nymphs from the Silesian Province (Southern Poland). Previous studies on the prevalence of TBEV in ticks in Poland have been conducted mostly in northern and eastern regions, but none in the Silesian Province itself. The aims of this study were to analyse the seasonal variation in tick populations and compare TBEV prevalence in nymphs from different geographical locations in the Silesia. A total of 5160 questing Ixodes ricinus ticks were collected by the flagging method from 23 localities in southern Poland in 2010. Micro-climatic parameters (air temperature and humidity) were measured in order to estimate their influence on tick population. The highest tick activity was recorded in spring and was positively correlated with relative air humidity (RH). TBEV in the Silesian Province was analysed in 1750 nymphs and an overall prevalence was 0.11% (2 pools out of 175 analysed). The results of this study show that TBEV pool prevalence in nymphs is low in accordance with the low number of TBE cases reported within the region. PMID:25838177

  6. The role of particular tick developmental stages in the circulation of tick-borne pathogens affecting humans in Central Europe. 2. Tick-borne encephalitis virus.

    PubMed

    Karbowiak, Grzegorz; Biernat, Beata

    2016-01-01

    Hard-bodied ticks transmit various pathogens, such as Borrelia burgdorferi sensu lato, Anaplasma phagocytophilum, Rickettsia spp., Babesia spp., and carry numerous other microorganisms with an unknown pathogenic potential. Among them, tick-borne encephalitis virus has great importance. In Central European conditions all developmental stages of ticks participate in the zoonotic cycle of the TBE virus. According to pathogen and tick biology, the roles of larvae, nymphs and adults are different. Larvae and nymphs of Ixodes ricinus ticks are responsible for circulation in rodents and medium sized mammals; adults transfer the infection to ruminants and to next generations via transovarial transmission. All active developmental stages of I. ricinus can play role of the bridge vector, transmitting the infection to humans apart males which don't feed. The late summer peak of human infectivity is caused by the summer peak of I. ricinus nymphs' activity. The Dermacentor reticulatus tick attacks humans infrequently, but does participate in the circulation of the virus in the zoonotic foci; larvae and nymphs of the D. reticulatus ticks are responsible for circulation in rodents, mainly Microtinae, while adults transmit the infection to ruminants. PMID:27262951

  7. Surveillance of tick-borne encephalitis virus in wild birds and ticks in Tomsk city and its suburbs (Western Siberia).

    PubMed

    Mikryukova, Tamara P; Moskvitina, Nina S; Kononova, Yulia V; Korobitsyn, Igor G; Kartashov, Mikhail Y; Tyuten Kov, Oleg Y; Protopopova, Elena V; Romanenko, Vladimir N; Chausov, Evgeny V; Gashkov, Sergey I; Konovalova, Svetlana N; Moskvitin, Sergey S; Tupota, Natalya L; Sementsova, Alexandra O; Ternovoi, Vladimir A; Loktev, Valery B

    2014-03-01

    To study the role of wild birds in the transmission of tick borne encephalitis virus (TBEV), we investigated randomly captured wild birds bearing ixodid ticks in a very highly endemic TBE region located in Tomsk city and its suburbs in the south of Western Siberia, Russia. The 779 wild birds representing 60 species were captured carrying a total of 841 ticks, Ixodes pavlovskyi Pom., 1946 (n=531), Ixodes persulcatus P. Sch., 1930 (n=244), and Ixodes plumbeus Leach. 1815 (n=66). The highest average number of ticks per bird in a particular species was found for the fieldfare (Turdus pilaris Linnaeus, 1758) (5.60 ticks/bird) and the tree pipit (Anthus trivialis Linnaeus, 1758) (13.25 ticks/bird). Samples from wild birds and ticks collected in highly endemic periods from 2006 to 2011 were tested for the TBEV markers using monoclonal modified enzyme immunoassay (EIA) and RT-PCR. TBEV RNA and antigen were found in 9.7% and 22.8% samples collected from wild birds, respectively. TBEV markers were also detected in 14.1% I. persulcatus ticks, 5.2% I. pavlovskyi, and 4.2% I. plumbeus ticks collected from wild birds. Two TBEV strains were also isolated on PKE (pig kidney embryo) cells from fieldfare and Blyth's reed warbler (Acrocephalus dumetorum Blyth, 1849). Sequencing of 5'-NCR of TBEV revealed that all TBEV isolates belong to Far Eastern (dominate) and Siberian genotypes. Several phylogenetic subgroups included TBEV sequences novel for the Tomsk region. Our data suggest that wild birds are potential disseminators of TBEV, TBEV-infected ixodid ticks, and possibly other tick-borne infections.

  8. Importation of exotic ticks and tick-borne spotted fever group rickettsiae into the United States by migrating songbirds

    PubMed Central

    Mukherjee, Nabanita; Beati, Lorenza; Sellers, Michael; Burton, Laquita; Adamson, Steven; Robbins, Richard G.; Moore, Frank; Karim, Shahid

    2013-01-01

    Birds are capable of carrying ticks and, consequently, tick-transmitted microorganisms over long distances and across geographical barriers such as oceans and deserts. Ticks are hosts for several species of spotted fever group rickettsiae (SFGR), which can be transmitted to vertebrates during blood meals. In this study, the prevalence of this group of rickettsiae was examined in ticks infesting migratory songbirds by using polymerase chain reaction (PCR). During the 2009 and 2010 spring migration season, 2064 northward-migrating passerine songbirds were examined for ticks at Johnson Bayou, Louisiana. A total of 91 ticks was removed from 35 individual songbirds for tick species identification and spotted fever group rickettsia detection. Ticks were identified as Haemaphysalis juxtakochi (n=38, 42%), Amblyomma longirostre (n=22, 24%), Amblyomma nodosum (n=17, 19%), Amblyomma calcaratum (n=11, 12%), Amblyomma maculatum (n=2, 2%), and Haemaphysalis leporispalustris (n=1, 1%) by comparing their 12S rDNA gene sequence to homologous sequences in GenBank. Most of the identified ticks were exotic species originating outside of the United States. The phylogenetic analysis of the 71 ompA gene sequences of the rickettsial strains detected in the ticks revealed the occurrence of 6 distinct rickettsial genotypes. Two genotypes (corresponding to a total of 28 samples) were included in the Candidatus Rickettsia amblyommii clade (less than 1% divergence), 2 of them (corresponding to a total of 14 samples) clustered with Rickettsia sp. “Argentina” with less than 0.2% sequence divergence, and 2 of them (corresponding to a total of 27 samples), although closely related to the R. parkeri–R. africae lineage (2.50–3.41% divergence), exhibited sufficient genetic divergence from its members to possibly constitute a new rickettsial genotype. Overall, there does not seem to be a specific relationship between exotic tick species, the rickettsiae they harbor, or the reservoir

  9. Novel Phlebovirus with Zoonotic Potential Isolated from Ticks, Australia

    PubMed Central

    Wang, Jianning; Selleck, Paul; Yu, Meng; Ha, Wendy; Rootes, Chrissy; Gales, Rosemary; Wise, Terry; Crameri, Sandra; Chen, Honglei; Broz, Ivano; Hyatt, Alex; Woods, Rupert; Meehan, Brian; McCullough, Sam

    2014-01-01

    Recently discovered tick-borne phleboviruses have been associated with severe disease and death among persons in Asia and the United States. We report the discovery of a novel tick phlebovirus in Tasmania State, Australia, that is closely related to those zoonotic viruses found in Asia and North America. PMID:24856477

  10. Early Immunologic Events at the Tick-Host Interface

    PubMed Central

    Heinze, Dar M.; Carmical, J. Russ; Aronson, Judith F.; Thangamani, Saravanan

    2012-01-01

    Ixodes species ticks are competent vectors of tick-borne viruses including tick-borne encephalitis and Powassan encephalitis. Tick saliva has been shown to facilitate and enhance viral infection. This likely occurs by saliva-mediated modulation of host responses into patterns favorable for viral infection and dissemination. Because of the rapid kinetics of tick-borne viral transmission, this modulation must occur as early as tick attachment and initiation of feeding. In this study, cutaneous bite-site lesions were analyzed using Affymetrix mouse genome 430A 2.0 arrays and histopathology at 1, 3, 6, and 12 hours after uninfected Ixodes scapularis nymphal tick attachment. At 1 and 3 hrs after attachment, the gene expression profile is markedly different than at later time points. Upregulated gene ontology term clusters enriched at 1 and 3 hrs were related to post-translational modification. At 6 and 12 hrs, cytoskeletal rearrangements, DNA replication/cell division, inflammation, and chemotaxis were prominent clusters. At 6 and 12 hrs, extracellular matrix, signaling, and DNA binding clusters were downregulated. Histopathological analysis shows minimal inflammation at 1 and 3 hrs but an appreciable neutrophil infiltrate at 6 and 12 hrs. In addition, putative hyperemia, localized necrosis, and increased ECM deposition were identified. Putting the gene expression and histopathology analysis together suggests early tick feeding is characterized by modulation of host responses in resident cells that merges into a nascent, neutrophil-driven immune response by 12 hrs post-attachment. PMID:23077588

  11. A possible canine tick-bite reaction to Ixodes muris.

    PubMed

    Strong-Klefenz, Jennifer E; Gaskill, Cynthia L

    2008-03-01

    An Airedale terrier became acutely ill following attachment of an Ixodes muris tick. Clinical signs waned within hours of tick removal, similar to a pattern previously documented in animals harboring I. muris. This supports the theory that I. muris can induce a noninfectious, severe inflammatory reaction in domestic animals. PMID:18390101

  12. Ticks infesting bats (Mammalia: Chiroptera) in the Brazilian Pantanal.

    PubMed

    Muñoz-Leal, Sebastián; Eriksson, Alan; Santos, Carolina Ferreira; Fischer, Erich; de Almeida, Juliana Cardoso; Luz, Hermes R; Labruna, Marcelo B

    2016-05-01

    Ticks associated with bats have been poorly documented in the Neotropical Zoogeographical Region. In this study, a total of 1028 bats were sampled for tick infestations in the southern portion of the Brazilian Pantanal. A total of 368 ticks, morphologically identified as Ornithodoros hasei (n = 364) and O. mimon (n = 4), were collected from the following bat species: Artibeus planirostris, Platyrrhinus lineatus, Phyllostomus hastatus, Mimon crenulatum and Noctilio albiventris. Morphological identification of O. hasei was confirmed by molecular analysis. Regarding the most abundant bat species, only 40 (6.2%) out of 650 A. planirostris were infested by O. hasei, with a mean intensity of 7.2 ticks per infested bat, or a mean abundance of 0.44 ticks per sampled bat. Noteworthy, one single P. hastatus was infested by 55 O. hasei larvae, in contrast to the 2.5-7.2 range of mean intensity values for the whole study. As a complement to the present study, a total of 8 museum bat specimens (6 Noctilio albiventris and 2 N. leporinus), collected in the northern region of Pantanal, were examined for tick infestations. These bats contained 176 ticks, which were all morphologically identified as O. hasei larvae. Mean intensity of infestation was 22, with a range of 1-46 ticks per infested bat. Our results suggest that A. planirostris might play an important role in the natural life cycle of O. hasei in the Pantanal.

  13. Natural Transmission of Zoonotic Babesia spp. by Ixodes ricinus Ticks

    PubMed Central

    Becker, Claire A.M.; Bouju-Albert, Agnès; Jouglin, Maggy; Chauvin, Alain

    2009-01-01

    To determine characteristics of natural transmission of Babesia sp. EU1 and B. divergens by adult Ixodes ricinus ticks, we examined tick salivary gland contents. We found that I. ricinus is a competent vector for EU1 and that their sporozoites directly invade erythrocytes. We conclude that EU1 is naturally transmitted by I. ricinus. PMID:19193284

  14. Tick passage results in enhanced attenuation of babesia bovis

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Serial blood passage of virulent Babesia bovis in splenectomized cattle results in attenuated derivatives that do not cause neurologic disease. Tick transmissibility can be lost with attenuation, and has been reported to result in a reversion to virulence following tick passage. This study provides ...

  15. Anaplasma marginale and Theileria annulata in questing ticks from Portugal.

    PubMed

    Antunes, S; Ferrolho, J; Domingues, N; Santos, A S; Santos-Silva, M M; Domingos, A

    2016-09-01

    Ticks are ubiquitous arthropods and vectors of several pathogenic agents in animals and humans. Monitoring questing ticks is of great importance to ascertain the occurrence of pathogens and the potential vector species, offering an insight into the risk of disease transmission in a given area. In this study 428 host-seeking ticks, belonging to nine species of Ixodidae and collected from 17 of the 23 Portuguese mainland subregions, were screened for several tick-borne agents with veterinary relevance: Anaplasma marginale, Anaplasma ovis, Anaplasma centrale, Babesia spp., Coxiella burnetii and Theileria spp. Prevalence was assessed by PCR and amplified amplicons sequenced for validation of results. Twenty ticks, in a total of 428, were found positive: one Ixodes ventalloi for Theileria annulata and four Dermacentor marginatus, one Haemaphysalis punctata, five Ixodes ricinus, five I. ventalloi, and four Rhipicephalus sanguineus sensu lato for A. marginale. According to the reviewed literature, this is the first report of A. marginale and T. annulata detection in I. ventalloi. Furthermore, the amplification of A. marginale DNA in several tick species suggests a broad range for this agent in Portugal that might include other uncommon species as R. sanguineus s.l. This work provides new data towards a better understanding of tick-pathogen associations and also contributes to the surveillance of tick-borne agents in geographic areas with limited information. PMID:27394441

  16. Effects of Vegetation Microclimate on Larval Cattle Fever Tick Survival

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Cattle Fever Ticks (CFT), Rhipicephalus annulatus and R. microplus, have been a threat to the livestock industry for many years. These ticks are vectors of cattle fever, a disease produced by the hemoparasite Babesia bovis and B. bigemina. Laboratory research on CFT larval survival has shown that co...

  17. Tick Genomics: The Ixodes genome project and beyond

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Ticks and mites (subphylum Chelicerata; subclass Acari) are important pests of animals and plants worldwide. The Ixodes scapularis (black-legged tick) genome sequencing project marks the beginning of the genomics era for the field of acarology. This project is the first to sequence the genome of a...

  18. How ticks get under your skin: insertion mechanics of the feeding apparatus of Ixodes ricinus ticks.

    PubMed

    Richter, Dania; Matuschka, Franz-Rainer; Spielman, Andrew; Mahadevan, L

    2013-12-22

    The tick Ixodes ricinus uses its mouthparts to penetrate the skin of its host and to remain attached for about a week, during which time Lyme disease spirochaetes may pass from the tick to the host. To understand how the tick achieves both tasks, penetration and attachment, with the same set of implements, we recorded the insertion events by cinematography, interpreted the mouthparts' function by scanning electron microscopy and identified their points of articulation by confocal microscopy. Our structural dynamic observations suggest that the process of insertion and attachment occurs via a ratchet-like mechanism with two distinct stages. Initially, the two telescoping chelicerae pierce the skin and, by moving alternately, generate a toehold. Subsequently, a breaststroke-like motion, effected by simultaneous flexure and retraction of both chelicerae, pulls in the barbed hypostome. This combination of a flexible, dynamic mechanical ratchet and a static holdfast thus allows the tick to solve the problem of how to penetrate skin and also remain stuck for long periods of time. PMID:24174106

  19. How ticks get under your skin: insertion mechanics of the feeding apparatus of Ixodes ricinus ticks

    PubMed Central

    Richter, Dania; Matuschka, Franz-Rainer; Spielman, Andrew; Mahadevan, L.

    2013-01-01

    The tick Ixodes ricinus uses its mouthparts to penetrate the skin of its host and to remain attached for about a week, during which time Lyme disease spirochaetes may pass from the tick to the host. To understand how the tick achieves both tasks, penetration and attachment, with the same set of implements, we recorded the insertion events by cinematography, interpreted the mouthparts’ function by scanning electron microscopy and identified their points of articulation by confocal microscopy. Our structural dynamic observations suggest that the process of insertion and attachment occurs via a ratchet-like mechanism with two distinct stages. Initially, the two telescoping chelicerae pierce the skin and, by moving alternately, generate a toehold. Subsequently, a breaststroke-like motion, effected by simultaneous flexure and retraction of both chelicerae, pulls in the barbed hypostome. This combination of a flexible, dynamic mechanical ratchet and a static holdfast thus allows the tick to solve the problem of how to penetrate skin and also remain stuck for long periods of time. PMID:24174106

  20. A Case of Subacute Ataxia in the Summertime: Tick Paralysis.

    PubMed

    Laufer, Christin B; Chiota-McCollum, Nicole

    2015-08-01

    Tick paralysis is caused by a neurotoxin secreted in the saliva of a gravid female tick, and manifests with ataxia, areflexia, ascending paralysis, bulbar palsy, and ophthalmoparesis. An 84-year-old man presented in June in coastal Mississippi with several days of subacute ataxia, bulbar palsy, unilateral weakness, and absent deep tendon reflexes. MRI/MRA and extensive serum and cerebrospinal fluid investigations were unrevealing. His symptoms progressed over several days, until his nurse discovered and removed an engorged tick from his gluteal fold. Within hours of tick removal, his subacute symptoms completely resolved. While tick paralysis is rare in adults, it is a condition that internists should be familiar with, particularly in seasons and areas with high prevalence of disease. This case also highlights the importance of performing a thorough skin exam on patients with the aforementioned neurologic abnormalities. PMID:25794538

  1. Rickettsia slovaca from Dermacentor marginatus ticks in Sardinia, Italy.

    PubMed

    Masala, Giovanna; Chisu, Valentina; Satta, Giuseppe; Socolovschi, Christina; Raoult, Didier; Parola, Philippe

    2012-12-01

    Nineteen ticks belonging to the species Dermacentor marginatus, Rhipicephalus bursa, and Haemaphysalis sulcata were collected from wild animals (wild boar, deer, and mouflon) in south-western Sardinia, Italy. Five D. marginatus ticks from wild boar were PCR-positive when analyzed using gltA-specific and ompA-specific primers, leading to the identification and first isolation in cell culture of Rickettsia slovaca, the causative agent of tick-borne lymphadenopathy (TIBOLA), on the island of Sardinia. This study confirms the detection of a new tick-borne rickettsia that can be added to the others already known to be present in Sardinia (Rickettsia aeschlimannii, R. massiliae, and Candidatus Rickettsia barbariae). These data increase our knowledge of tick-borne rickettsioses in Sardinia and, more generally, in the Mediterranean basin.

  2. Ticks from the African buffalo (Syncerus caffer) in Ngamiland, Botswana.

    PubMed

    Carmichael, I H

    1976-03-01

    In November 1972, 93 out of 100 African buffalo from 3 areas in Ngamiland, Botswana, were found to be infested with ticks. The tick species present and the percentage of buffalo infested by each were: Hyalomma truncatum (63%), H. rufipes (54%), Rhipicephalus evertsi evertsi (68%), R. tricuspis (11%), R. simus (4%) and Boophilus decoloratus (1%). The mean number of ticks per animal was 8,6 (standard deviation +/-4,1), representing a mean of 6,5+/-3,4 male and 2,1+/-1,9 female ticks. The incidence of infestation with H. truncatum and the number of ticks of this species on infested animals were lowest in areas where plentiful surface water was responsible for an increase in humidity.

  3. 9 CFR 72.1 - Ticks [Boophilus annulatus (Margaropus annulatus), Boophilus microplus, or Rhipicephalus evertsi...

    Code of Federal Regulations, 2012 CFR

    2012-01-01

    ... 9 Animals and Animal Products 1 2012-01-01 2012-01-01 false Ticks ; interstate movement of... POULTRY) AND ANIMAL PRODUCTS TEXAS (SPLENETIC) FEVER IN CATTLE § 72.1 Ticks ; interstate movement of infested or exposed animals prohibited. No animals infested with ticks or exposed to tick infestation...

  4. 9 CFR 72.1 - Ticks [Boophilus annulatus (Margaropus annulatus), Boophilus microplus, or Rhipicephalus evertsi...

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... 9 Animals and Animal Products 1 2013-01-01 2013-01-01 false Ticks ; interstate movement of... POULTRY) AND ANIMAL PRODUCTS TEXAS (SPLENETIC) FEVER IN CATTLE § 72.1 Ticks ; interstate movement of infested or exposed animals prohibited. No animals infested with ticks or exposed to tick infestation...

  5. 9 CFR 72.1 - Ticks [Boophilus annulatus (Margaropus annulatus), Boophilus microplus, or Rhipicephalus evertsi...

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... 9 Animals and Animal Products 1 2011-01-01 2011-01-01 false Ticks ; interstate movement of... POULTRY) AND ANIMAL PRODUCTS TEXAS (SPLENETIC) FEVER IN CATTLE § 72.1 Ticks ; interstate movement of infested or exposed animals prohibited. No animals infested with ticks or exposed to tick infestation...

  6. Rickettsia spp. in seabird ticks from western Indian Ocean islands, 2011-2012.

    PubMed

    Dietrich, Muriel; Lebarbenchon, Camille; Jaeger, Audrey; Le Rouzic, Céline; Bastien, Matthieu; Lagadec, Erwan; McCoy, Karen D; Pascalis, Hervé; Le Corre, Matthieu; Dellagi, Koussay; Tortosa, Pablo

    2014-05-01

    We found a diversity of Rickettsia spp. in seabird ticks from 6 tropical islands. The bacteria showed strong host specificity and sequence similarity with strains in other regions. Seabird ticks may be key reservoirs for pathogenic Rickettsia spp., and bird hosts may have a role in dispersing ticks and tick-associated infectious agents over large distances.

  7. Rickettsia spp. in Seabird Ticks from Western Indian Ocean Islands, 2011–2012

    PubMed Central

    Lebarbenchon, Camille; Jaeger, Audrey; Le Rouzic, Céline; Bastien, Matthieu; Lagadec, Erwan; McCoy, Karen D.; Pascalis, Hervé; Le Corre, Matthieu; Dellagi, Koussay; Tortosa, Pablo

    2014-01-01

    We found a diversity of Rickettsia spp. in seabird ticks from 6 tropical islands. The bacteria showed strong host specificity and sequence similarity with strains in other regions. Seabird ticks may be key reservoirs for pathogenic Rickettsia spp., and bird hosts may have a role in dispersing ticks and tick-associated infectious agents over large distances. PMID:24751287

  8. Integrated Strategy for Sustainable Cattle Fever Tick Eradication in USA is Required to Mitigate the Impact of Global Change

    PubMed Central

    Pérez de León, Adalberto A.; Teel, Pete D.; Auclair, Allan N.; Messenger, Matthew T.; Guerrero, Felix D.; Schuster, Greta; Miller, Robert J.

    2012-01-01

    The ticks Rhipicephalus (Boophilus) annulatus and R. (B.) microplus, commonly known as cattle and southern cattle tick, respectively, impede the development and sustainability of livestock industries throughout tropical and other world regions. They affect animal productivity and wellbeing directly through their obligate blood-feeding habit and indirectly by serving as vectors of the infectious agents causing bovine babesiosis and anaplasmosis. The monumental scientific discovery of certain arthropod species as vectors of infectious agents is associated with the history of research on bovine babesiosis and R. annulatus. Together, R. microplus and R. annulatus are referred to as cattle fever ticks (CFT). Bovine babesiosis became a regulated foreign animal disease in the United States of America (U.S.) through efforts of the Cattle Fever Tick Eradication Program (CFTEP) established in 1906. The U.S. was declared free of CFT in 1943, with the exception of a permanent quarantine zone in south Texas along the border with Mexico. This achievement contributed greatly to the development and productivity of animal agriculture in the U.S. The permanent quarantine zone buffers CFT incursions from Mexico where both ticks and babesiosis are endemic. Until recently, the elimination of CFT outbreaks relied solely on the use of coumaphos, an organophosphate acaricide, in dipping vats or as a spray to treat livestock, or the vacation of pastures. However, ecological, societal, and economical changes are shifting the paradigm of systematically treating livestock to eradicate CFT. Keeping the U.S. CFT-free is a critical animal health issue affecting the economic stability of livestock and wildlife enterprises. Here, we describe vulnerabilities associated with global change forces challenging the CFTEP. The concept of integrated CFT eradication is discussed in reference to global change. PMID:22712018

  9. Integrated Strategy for Sustainable Cattle Fever Tick Eradication in USA is Required to Mitigate the Impact of Global Change.

    PubMed

    Pérez de León, Adalberto A; Teel, Pete D; Auclair, Allan N; Messenger, Matthew T; Guerrero, Felix D; Schuster, Greta; Miller, Robert J

    2012-01-01

    The ticks Rhipicephalus (Boophilus) annulatus and R. (B.) microplus, commonly known as cattle and southern cattle tick, respectively, impede the development and sustainability of livestock industries throughout tropical and other world regions. They affect animal productivity and wellbeing directly through their obligate blood-feeding habit and indirectly by serving as vectors of the infectious agents causing bovine babesiosis and anaplasmosis. The monumental scientific discovery of certain arthropod species as vectors of infectious agents is associated with the history of research on bovine babesiosis and R. annulatus. Together, R. microplus and R. annulatus are referred to as cattle fever ticks (CFT). Bovine babesiosis became a regulated foreign animal disease in the United States of America (U.S.) through efforts of the Cattle Fever Tick Eradication Program (CFTEP) established in 1906. The U.S. was declared free of CFT in 1943, with the exception of a permanent quarantine zone in south Texas along the border with Mexico. This achievement contributed greatly to the development and productivity of animal agriculture in the U.S. The permanent quarantine zone buffers CFT incursions from Mexico where both ticks and babesiosis are endemic. Until recently, the elimination of CFT outbreaks relied solely on the use of coumaphos, an organophosphate acaricide, in dipping vats or as a spray to treat livestock, or the vacation of pastures. However, ecological, societal, and economical changes are shifting the paradigm of systematically treating livestock to eradicate CFT. Keeping the U.S. CFT-free is a critical animal health issue affecting the economic stability of livestock and wildlife enterprises. Here, we describe vulnerabilities associated with global change forces challenging the CFTEP. The concept of integrated CFT eradication is discussed in reference to global change.

  10. Retiree Health Care: A Ticking Bomb.

    ERIC Educational Resources Information Center

    Daniels, Craig E.; Daniels, Janet D.

    1992-01-01

    With health insurance costs soaring for both current employees and retirees, governing boards of institutions of higher education must contain costs. Possible strategies include shifting some expenses from employer to employee, establishing flexible-benefit or cafeteria plans, using managed care to reduce unnecessary medical procedures,…

  11. Quantification of brown dog tick repellents, 2-hexanone and benzaldehyde, and release from tick-resistant beagles, Canis lupus familiaris

    Technology Transfer Automated Retrieval System (TEKTRAN)

    We have recently shown that repellency of the tick Rhipicephalus sanguineus sensu lato by the tick resistant dog breed Beagle is mediated by volatile organic compounds 2-hexanone and benzaldehyde present in Beagle dog odour. Ectoparasite location on animal hosts is affected by variation in odour com...

  12. Molecular detection of zoonotic tick-borne pathogens from ticks collected from ruminants in four South African provinces.

    PubMed

    Mtshali, Khethiwe; Khumalo, Zth; Nakao, Ryo; Grab, Dennis J; Sugimoto, Chihiro; Thekisoe, Omm

    2016-01-01

    Ticks carry and transmit a remarkable array of pathogens including bacteria, protozoa and viruses, which may be of veterinary and/or of medical significance. With little to no information regarding the presence of tick-borne zoonotic pathogens or their known vectors in southern Africa, the aim of our study was to screen for Anaplasma phagocytophilum, Borrelia burgdorferi, Coxiella burnetii, Rickettsia species and Ehrlichia ruminantium in ticks collected and identified from ruminants in the Eastern Cape, Free State, KwaZulu-Natal and Mpumalanga Provinces of South Africa. The most abundant tick species identified in this study were Rhipicephalus evertsi evertsi (40%), Rhipicephalus species (35%), Amblyomma hebraeum (10%) and Rhipicephalus decoloratus (14%). A total of 1634 ticks were collected. DNA was extracted, and samples were subjected to PCR amplification and sequencing. The overall infection rates of ticks with the target pathogens in the four Provinces were as follows: A. phagocytophilum, 7%; C. burnetii, 7%; E. ruminantium, 28%; and Rickettsia spp., 27%. The presence of B. burgdorferi could not be confirmed. The findings of this study show that zoonotic pathogens are present in ticks in the studied South African provinces. This information will aid in the epidemiology of tick-borne zoonotic diseases in the country as well as in raising awareness about such diseases in the veterinary, medical and tourism sectors, as they may be the most affected.

  13. Research Strategies to Reduce Tick Densities and the Risk of Tick-borne Disease Transmission through Host-Targeted Control

    Technology Transfer Automated Retrieval System (TEKTRAN)

    While white-tailed deer are not reservoir hosts for the Lyme disease agent, Borrelia burgdorferi, they are the keystone host animal on which adult female blacklegged ticks engorge on blood that is essential to production of tick eggs and completion of the life cycle. This session explores current re...

  14. Molecular detection of zoonotic tick-borne pathogens from ticks collected from ruminants in four South African provinces

    PubMed Central

    MTSHALI, Khethiwe; KHUMALO, Zamantungwa T. H.; NAKAO, Ryo; GRAB, Dennis J.; SUGIMOTO, Chihiro; THEKISOE, Oriel M. M.

    2015-01-01

    Ticks carry and transmit a remarkable array of pathogens including bacteria, protozoa and viruses, which may be of veterinary and/or of medical significance. With little to no information regarding the presence of tick-borne zoonotic pathogens or their known vectors in southern Africa, the aim of our study was to screen for Anaplasma phagocytophilum, Borrelia burgdorferi, Coxiella burnetii, Rickettsia species and Ehrlichia ruminantium in ticks collected and identified from ruminants in the Eastern Cape, Free State, KwaZulu-Natal and Mpumalanga Provinces of South Africa. The most abundant tick species identified in this study were Rhipicephalus evertsi evertsi (40%), Rhipicephalus species (35%), Amblyomma hebraeum (10%) and Rhipicephalus decoloratus (14%). A total of 1634 ticks were collected. DNA was extracted, and samples were subjected to PCR amplification and sequencing. The overall infection rates of ticks with the target pathogens in the four Provinces were as follows: A. phagocytophilum, 7%; C. burnetii, 7%; E. ruminantium, 28%; and Rickettsia spp., 27%. The presence of B. burgdorferi could not be confirmed. The findings of this study show that zoonotic pathogens are present in ticks in the studied South African provinces. This information will aid in the epidemiology of tick-borne zoonotic diseases in the country as well as in raising awareness about such diseases in the veterinary, medical and tourism sectors, as they may be the most affected. PMID:26227797

  15. Identification of 24h Ixodes scapularis immunogenic tick saliva proteins.

    PubMed

    Lewis, Lauren A; Radulović, Željko M; Kim, Tae K; Porter, Lindsay M; Mulenga, Albert

    2015-04-01

    Ixodes scapularis is arguably the most medically important tick species in the United States. This tick transmits 5 of the 14 human tick-borne disease (TBD) agents in the USA: Borrelia burgdorferi, Anaplasma phagocytophilum, B. miyamotoi, Babesia microti, and Powassan virus disease. Except for the Powassan virus disease, I. scapularis-vectored TBD agents require more than 24h post attachment to be transmitted. This study describes identification of 24h immunogenic I. scapularis tick saliva proteins, which could provide opportunities to develop strategies to stop tick feeding before transmission of the majority of pathogens. A 24h fed female I. scapularis phage display cDNA expression library was biopanned using rabbit antibodies to 24h fed I. scapularis female tick saliva proteins, subjected to next generation sequencing, de novo assembly, and bioinformatic analyses. A total of 182 contigs were assembled, of which ∼19% (35/182) are novel and did not show identity to any known proteins in GenBank. The remaining ∼81% (147/182) of contigs were provisionally identified based on matches in GenBank including ∼18% (27/147) that matched protein sequences previously annotated as hypothetical and putative tick saliva proteins. Others include proteases and protease inhibitors (∼3%, 5/147), transporters and/or ligand binding proteins (∼6%, 9/147), immunogenic tick saliva housekeeping enzyme-like (17%, 25/147), ribosomal protein-like (∼31%, 46/147), and those classified as miscellaneous (∼24%, 35/147). Notable among the miscellaneous class include antimicrobial peptides (microplusin and ricinusin), myosin-like proteins that have been previously found in tick saliva, and heat shock tick saliva protein. Data in this study provides the foundation for in-depth analysis of I. scapularis feeding during the first 24h, before the majority of TBD agents can be transmitted.

  16. Identification of 24 h Ixodes scapularis immunogenic tick saliva proteins

    PubMed Central

    Lewis, Lauren A.; Radulović, Željko M.; Kim, Tae K.; Porter, Lindsay M.; Mulenga, Albert

    2015-01-01

    Ixodes scapularis is arguably the most medically important tick species in the United States. This tick transmits 5 of the 14 human tick-borne disease (TBD) agents in the USA: Borrelia burgdorferi, Anaplasma phagocytophilum, B. miyamotoi, Babesia microti, and Powassan virus disease. Except for the Powassan virus disease, I. scapularis-vectored TBD agents require more than 24 h post attachment to be transmitted. This study describes identification of 24 h immunogenic I. scapularis tick saliva proteins, which could provide opportunities to develop strategies to stop tick feeding before transmission of the majority of pathogens. A 24 h fed female I. scapularis phage display cDNA expression library was biopanned using rabbit antibodies to 24 h fed I. scapularis female tick saliva proteins, subjected to next generation sequencing, de novo assembly, and bioinformatic analyses. A total of 182 contigs were assembled, of which ~19% (35/182) are novel and did not show identity to any known proteins in GenBank. The remaining ~81% (147/182) of contigs were provisionally identified based on matches in GenBank including ~18% (27/147) that matched protein sequences previously annotated as hypothetical and putative tick saliva proteins. Others include proteases and protease inhibitors (~3%, 5/147), transporters and/or ligand binding proteins (~6%, 9/147), immunogenic tick saliva housekeeping enzyme-like (17%, 25/147), ribosomal protein-like (~31%, 46/147), and those classified as miscellaneous (~24%, 35/147). Notable among the miscellaneous class include antimicrobial peptides (microplusin and ricinusin), myosin-like proteins that have been previously found in tick saliva, and heat shock tick saliva protein. Data in this study provides the foundation for in-depth analysis of I. scapularis feeding during the first 24 h, before the majority of TBD agents can be transmitted. PMID:25825233

  17. Cultivation of Rickettsia amblyommii in tick cells, prevalence in Florida lone star ticks (Amblyomma americanum)

    PubMed Central

    2014-01-01

    Background Rickettsia amblyommii is a bacterium in the spotted fever group of organisms associated with the lone star tick (LST), Amblyomma americanum. The LST is the most commonly reported tick to parasitize humans in the southeastern US. Within this geographic region, there have been suspected cases of Rocky Mountain spotted fever (RMSF) where the causative agent, R. rickettsii, was not identified in the local tick population. In these areas, patients with clinical signs of RMSF had low or no detectable antibodies to R. rickettsii, resulting in an inability to confirm a diagnosis. Methods R. amblyommii was cultivated from host-seeking LSTs trapped in Central Florida and propagated in ISE6 (Ixodes scapularis) and AAE2 (A. americanum) cells. Quantitative PCR targeting the 17-kD gene of Rickettsia spp. identified the genus of the organism in culture. Variable regions of groEL, gtlA and rompA genes were amplified and sequenced to confirm the species. The prevalence of R. amblyommii in LSTs within the geographic region was determined by qPCR followed by conventional PCR and direct sequencing. Results Analyses of amplified sequences from the cultured organism were 100% homologous to R. amblyommii. The overall prevalence of Rickettsia spp. in the local population of LSTs was 57.1% and rompA sequence analysis identified only R. amblyommii in LSTs. Conclusions A Florida strain of R. amblyommii was successfully cultivated in two tick cell lines. Further evaluation of the new strain and comparisons to the other geographic strains is needed. The prevalence of this SFG organism in the tick population warrants further investigation into the organism’s ability to cause clinical disease in mammalian species. PMID:24927809

  18. Employees as Customers: Exploring Service Climate, Employee Patronage, and Turnover

    ERIC Educational Resources Information Center

    Abston, Kristie A.; Kupritz, Virginia W.

    2011-01-01

    The role of retail employees as customers was explored by quantitatively examining the influence of service climate and employee patronage on employee turnover intentions. Employees representing all shifts in two stores of a national retailer participated. Results indicated that employee patronage partially mediates the effects of service climate…

  19. Agricultural Drainage Management Systems Task Force (ADMSTF)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The Agricultural Drainage Management Systems (ADMS) Task Force was initiated during a Charter meeting in the fall of 2002 by dedicated professional employees of Federal, State, and Local Government Agencies and Universities. The Agricultural Drainage Management (ADM) Coalition was established in 200...

  20. Prevalence of tick-borne pathogens in adult Dermacentor spp. ticks from nine collection sites in France.

    PubMed

    Bonnet, S; de la Fuente, J; Nicollet, P; Liu, X; Madani, N; Blanchard, B; Maingourd, C; Alongi, A; Torina, A; Fernández de Mera, I G; Vicente, J; George, J-C; Vayssier-Taussat, M; Joncour, G

    2013-04-01

    The importance of Dermacentor spp. in the transmission of tick-borne pathogens is not well recognized in Europe. To investigate the role of Dermacentor spp. in the transmission of tick-borne pathogens, questing ticks were collected in 9 sites from southern to northwestern France (Camargue Delta to Eastern Brittany) where Dermacentor spp. exist and tick-borne diseases had occurred previously. Three tick species were collected during the spring and autumn of 2009. Collected ticks (both males and females) included D. marginatus (n=377), D. reticulatus (n=74), and I. ricinus (n=45). All ticks were analyzed by PCR or reverse line blot for the presence of pathogens' DNA. Pathogens analyzed were based on veterinarian reports and included Anaplasma phagocytophilum, Coxiella burnetii, Anaplasma marginale, Borrelia burgdorferi, Bartonella spp., Babesia spp., Theileria spp., and Francisella sp. Francisella tularensis was not detected in any of the analyzed ticks. In D. marginatus, infection prevalence for A. phagocytophilum (3%) was similar to that found in I. ricinus in Europe. Other pathogens present in D. marginatus included A. marginale (0.5%), Bartonella spp. (9%), C. burnetii (12%), F. philomiragia (1.3%), and Theileria annulata/Babesia bovis (0.3%), which were detected for the first time in France. Pathogens detected in D. reticulatus included A. marginale (1%), Bartonella spp. (12%), C. burnetii (16%), Borrelia spp. (1.5%), and F. philomiragia (19%). Pathogens detected in I. ricinus included A. phagocytophilum (41%), Bartonella spp. (9%), C. burnetii (18%), A. marginale (1%), Borrelia spp. (4.5%), and Babesia sp. (7%). This study represents the first epidemiological approach to characterize tick-borne pathogens infecting Dermacentor spp. in France and that may be transmitted by ticks from this genus. Further experiments using experimental infections and transmission may be now conducted to analyze vector competency of Dermacentor spp. for these pathogens and to

  1. First human case of tick-borne encephalitis virus infection acquired in the Netherlands, July 2016.

    PubMed

    de Graaf, Joris A; Reimerink, Johan H J; Voorn, G Paul; Bij de Vaate, Elisabeth A; de Vries, Ankje; Rockx, Barry; Schuitemaker, Alie; Hira, Vishal

    2016-08-18

    In July 2016, the first autochthonous case of tick-borne encephalitis was diagnosed in the Netherlands, five days after a report that tick-borne encephalitis virus (TBEV) had been found in Dutch ticks. A person in their 60s without recent travel history suffered from neurological symptoms after a tick bite. TBEV serology was positive and the tick was positive in TBEV qRT-PCR. TBEV infection should be considered in patients with compatible symptoms in the Netherlands. PMID:27562931

  2. First human case of tick-borne encephalitis virus infection acquired in the Netherlands, July 2016

    PubMed Central

    de Graaf, Joris A; Reimerink, Johan H J; Voorn, G Paul; bij de Vaate, Elisabeth A; de Vries, Ankje; Rockx, Barry; Schuitemaker, Alie; Hira, Vishal

    2016-01-01

    In July 2016, the first autochthonous case of tick-borne encephalitis was diagnosed in the Netherlands, five days after a report that tick-borne encephalitis virus (TBEV) had been found in Dutch ticks. A person in their 60s without recent travel history suffered from neurological symptoms after a tick bite. TBEV serology was positive and the tick was positive in TBEV qRT-PCR. TBEV infection should be considered in patients with compatible symptoms in the Netherlands. PMID:27562931

  3. Evaluating a deer-targeted acaricide applicator for area-wide suppression of blacklegged ticks, Ixodes scapularis (Acari: Ixodidae), in Rhode Island.

    PubMed

    Miller, Nathan J; Thomas, William A; Mather, Thomas N

    2009-08-01

    Over a 5-year period, September 1997 through May 2002, as many as 25 U.S. Department of Agriculture-Agricultural Research Service "4-Poster" acaricide applicators were distributed in areas of high deer activity throughout a 518-hectare area in a rural Rhode Island community. Corn consumption and acaricide levels for each device were monitored weekly during each treatment season to assess the degree of deer use. The efficacy of acaricide treatment was determined by comparing relative blacklegged tick (Ixodes scapularis) densities in the 4-Poster treatment site to a separate, similar-sized nontreatment area. The tendency of white-tailed deer to use the 4-Poster was variable temporally, and appeared to be largely dependent on the availability of alternative food sources. Total corn consumption was nearly fourfold lower during large oak masting years when compared with no/low mast years. Moreover, habitat characteristics, such as the presence of maintained hay lands consisting of alfalfa and clover, also appeared to influence the frequency and amount of 4-Poster use. After 2 years of adequate treatment (nearly 12,000 kg of corn consumed), we achieved nearly 50% control of nymphal blacklegged ticks within the treatment site compared with tick abundance levels in the nontreated area. Moreover, that level of tick control was maintained for 1 year after removal of the 4-Poster devices but began to wane 2 years after treatment ended. PMID:19650734

  4. Managing employee performance.

    PubMed

    McConnell, Charles R

    2004-01-01

    Performance management consists of significantly more than periodic evaluation of performance. It is the art and science of dealing with employees in a manner intended to positively influence their thinking and behavior to achieve a desired level of performance. It is essential for the manager to always model positive behavior concerning performance; what one does or says as a manager always has an influence on others. The kinds of employee behavior most likely encountered relative to performance management efforts stem from resistance to change and lack of complete understanding of what is expected. Employee participation must be elicited whenever possible for performance improvement; as far as the inner working details of a specific job are concerned, there is no one who knows the job better than the person who does it everyday. For each task to be done, an employee needs to know what output is expected, how this output will be measured, and what standards are applied in assessing the output. Managing employee performance requires ongoing contact with each employee, regular feedback, and whatever coaching, counseling, and training are necessary to bring an employee back on track when a problem appears. Sustaining efficient and effective employee performance requires the manager's ongoing attention and involvement. PMID:15457845

  5. Understanding Generation X employees.

    PubMed

    Kupperschmidt, B R

    1998-12-01

    Understanding Generation X employees--those born between 1961 and 1981--is essential if they are to be recruited into and retained in nursing and their potential maximized. The author discusses the times, characteristics, and work values and demands of Generation X. Armed with an enhanced understanding, nurse administrators are better prepared to maximize the potential of Generation X employees.

  6. Managing employee performance.

    PubMed

    McConnell, Charles R

    2004-01-01

    Performance management consists of significantly more than periodic evaluation of performance. It is the art and science of dealing with employees in a manner intended to positively influence their thinking and behavior to achieve a desired level of performance. It is essential for the manager to always model positive behavior concerning performance; what one does or says as a manager always has an influence on others. The kinds of employee behavior most likely encountered relative to performance management efforts stem from resistance to change and lack of complete understanding of what is expected. Employee participation must be elicited whenever possible for performance improvement; as far as the inner working details of a specific job are concerned, there is no one who knows the job better than the person who does it everyday. For each task to be done, an employee needs to know what output is expected, how this output will be measured, and what standards are applied in assessing the output. Managing employee performance requires ongoing contact with each employee, regular feedback, and whatever coaching, counseling, and training are necessary to bring an employee back on track when a problem appears. Sustaining efficient and effective employee performance requires the manager's ongoing attention and involvement.

  7. Theme: Employee Ownership.

    ERIC Educational Resources Information Center

    Gordon, Michael E.; And Others

    1991-01-01

    Includes "Introduction" (Gordon); "Employee Ownership: Opportunities for Unions" (Blasi, Kruse); "Participation, Control, and Performance" (Rosen); Beyond the Contract: Taking on Ownership" (Mackin); "Worker Participation on Boards of Directors" (Hammer); and "Case Study of Employee Ownership and Governance in the Shipbuilding and Maritime…

  8. Flying ticks: anciently evolved associations that constitute a risk of infectious disease spread.

    PubMed

    de la Fuente, José; Estrada-Peña, Agustín; Cabezas-Cruz, Alejandro; Brey, Ricardo

    2015-01-01

    Ticks are important vectors of emerging zoonotic diseases affecting human and animal health worldwide. Ticks are often found on wild birds, which have been long recognized as a potential risk factor for dissemination of ticks and tick-borne pathogens (TBP), thus raising societal concerns and prompting research into their biology and ecology. To fully understand the role of birds in disseminating some ticks species and TBP, it is important to consider the evolutionary relationships between birds, ticks and transmitted pathogens. In this paper we reviewed the possible role of birds in the dissemination of TBP as a result of the evolution of host-tick-pathogen associations. Birds are central elements in the ecological networks of ticks, hosts and TBP. The study of host-tick-pathogen associations reveals a prominent role for birds in the dissemination of Borrelia spp. and Anaplasma phagocytophilum, with little contribution to the possible dissemination of other TBP. Birds have played a major role during tick evolution, which explains why they are by far the most important hosts supporting the ecological networks of ticks and several TBP. The immune response of birds to ticks and TBP has been largely overlooked. To implement effective measures for the control of tick-borne diseases, it is necessary to study bird-tick and bird-pathogen molecular interactions including the immune response of birds to tick infestation and pathogen infection. PMID:26467109

  9. Employer-employee relations.

    PubMed

    Copeland, J D

    1993-09-01

    As an employer, a veterinarian must be vigilant to protect the rights of both job applicants and employees. Federal and state statutes guarantee that applicants and employees will not be subjected to discrimination in any aspect of employment, including recruitment, hiring, promotion, compensation, and termination of employment. An employer may not discriminate on the basis of sex, race, color, national origin, religion, age, or physical disability. In addition, common law tort actions give employees powerful causes of action be against those employers who injure employees. More than ever, employers must be diligent in obeying the law. Employers must also take measures to protect themselves from employee claims by instituting risk management plans and purchasing adequate insurance coverage.

  10. Experimental Transmission of Karshi (Mammalian Tick-Borne Flavivirus Group) Virus by Ornithodoros Ticks >2,900 Days after Initial Virus Exposure Supports the Role of Soft Ticks as a Long-Term Maintenance Mechanism for Certain Flaviviruses

    PubMed Central

    Turell, Michael J.

    2015-01-01

    Background Members of the mammalian tick-borne flavivirus group, including tick-borne encephalitis virus, are responsible for at least 10,000 clinical cases of tick-borne encephalitis each year. To attempt to explain the long-term maintenance of members of this group, we followed Ornithodoros parkeri, O. sonrai, and O. tartakovskyi for >2,900 days after they had been exposed to Karshi virus, a member of the mammalian tick-borne flavivirus group. Methodology/Principal Findings Ticks were exposed to Karshi virus either by allowing them to feed on viremic suckling mice or by intracoelomic inoculation. The ticks were then allowed to feed individually on suckling mice after various periods of extrinsic incubation to determine their ability to transmit virus by bite and to determine how long the ticks would remain infectious. The ticks remained efficient vectors of Karshi virus, even when tested >2,900 d after their initial exposure to virus, including those ticks exposed to Karshi virus either orally or by inoculation. Conclusions/Significance Ornithodoros spp. ticks were able to transmit Karshi virus for >2,900 days (nearly 8 years) after a single exposure to a viremic mouse. Therefore, these ticks may serve as a long-term maintenance mechanism for Karshi virus and potentially other members of the mammalian tick-borne flavivirus group. PMID:26285211

  11. Borrelia, Rickettsia, and Ehrlichia species in bat ticks, France, 2010.

    PubMed

    Socolovschi, Cristina; Kernif, Tahar; Raoult, Didier; Parola, Philippe

    2012-12-01

    Argas vespertilionis, an argasid tick associated with bats and bat habitats in Europe, Africa, and Asia has been reported to bite humans; however, studies investigating the presence of vector-borne pathogens in these ticks are lacking. Using molecular tools, we tested 5 A. vespertilionis ticks collected in 2010 from the floor of a bat-infested attic in southwestern France that had been converted into bedrooms. Rickettsia sp. AvBat, a new genotype of spotted fever group rickettsiae, was detected and cultivated from 3 of the 5 ticks. A new species of the Ehrlichia canis group, Ehrlichia sp. AvBat, was also detected in 3 ticks. Four ticks were infected with Borrelia sp. CPB1, a relapsing fever agent of the Borrelia group that caused fatal borreliosis in a bat in the United Kingdom. Further studies are needed to characterize these new agents and determine if the A. vespertilionis tick is a vector and/or reservoir of these agents. PMID:23171714

  12. An Immunosuppressant Peptide from the Hard Tick Amblyomma variegatum.

    PubMed

    Tian, Yufeng; Chen, Wenlin; Mo, Guoxiang; Chen, Ran; Fang, Mingqian; Yedid, Gabriel; Yan, Xiuwen

    2016-01-01

    Ixodid ticks are well known for spreading transmitted tick-borne pathogens while being attached to their hosts for almost 1-2 weeks to obtain blood meals. Thus, they must secrete many immunosuppressant factors to combat the hosts' immune system. In the present work, we investigated an immunosuppressant peptide of the hard tick Amblyomma variegatum. This peptide, named amregulin, is composed of 40 residues with an amino acid sequence of HLHMHGNGATQVFKPRLVLKCPNAAQLIQPGKLQRQLLLQ. A cDNA of the precursor peptide was obtained from the National Center for Biotechnology Information (NCBI, Bethesda, MD, USA). In rat splenocytes, amregulin exerts significant anti-inflammatory effects by inhibiting the secretion of inflammatory factors in vitro, such as tumor necrosis factor-alpha (TNF-α), interleukin-1 (IL-1), interleukin-8 (IL-8) and interferon-gamma (IFN-γ). In rat splenocytes, treated with amregulin, compared to lipopolysaccharide (LPS) alone, the inhibition of the above inflammatory factors was significant at all tested concentrations (2, 4 and 8 µg/mL). Amregulin shows strong free radical scavenging and antioxidant activities (5, 10 and 20 µg/mL) in vitro. Amregulin also significantly inhibits adjuvant-induced paw inflammation in mouse models in vivo. This peptide may facilitate the ticks' successful blood feeding and may lead to host immunotolerance of the tick. These findings have important implications for the understanding of tick-host interactions and the co-evolution between ticks and the viruses that they bear. PMID:27153086

  13. Tick salivary secretion as a source of antihemostatics

    PubMed Central

    Chmelar, Jindrich; Calvo, Eric; Pedra, Joao H.F.; Francischetti, Ivo M. B.; Kotsyfakis, Michail

    2012-01-01

    Ticks are mostly obligatory blood feeding ectoparasites that have an impact on human and animal health. In addition to direct damage due to feeding, some tick species serve as the vectors for the causative agents of several diseases, such as the spirochetes of the genus Borrelia causing Lyme disease, the virus of tick-borne encephalitis, various Rickettsial pathogens or even protozoan parasites like Babesia spp. Hard ticks are unique among bloodfeeders because of their prolonged feeding period that may last up to two weeks. During such a long period of blood uptake, the host develops a wide range of mechanisms to prevent blood loss. The arthropod ectoparasite, in turn, secretes saliva in the sites of bite that assists blood feeding. Indeed, tick saliva represents a rich source of proteins with potent pharmacologic action that target different mechanisms of coagulation, platelet aggregation and vasoconstriction. Tick adaptation to their vertebrate hosts led to the inclusion of a powerful protein armamentarium in their salivary secretion that has been investigated by high throughput methods. The resulting knowledge can be exploited for the isolation of novel antihemostatic agents. Here we review the tick salivary antihemostatics and their characterized functions at the molecular and cellular levels. PMID:22564820

  14. Shrub clearing adversely affects the abundance of Ixodes ricinus ticks.

    PubMed

    Tack, Wesley; Madder, Maxime; Baeten, Lander; Vanhellemont, Margot; Verheyen, Kris

    2013-07-01

    In order to get a better understanding of the importance of vertical forest structure as a component of Ixodes ricinus tick habitat, an experiment was set up in a coniferous forest on sandy soils in northern Belgium. Ticks were sampled in six control and six treatment plots on various sampling occasions in 2008-2010. In the course of the study period, a moderate thinning was carried out in all plots and shrub clearing was performed in the treatment plots. Thinning had no effect on tick abundance, while shrub clearing had an adverse affect on the abundance of all three life stages (larva, nymph, adult) up to 2 years post-clearing. Our findings are especially relevant in the light of the ongoing efforts to improve vertical forest structure in Belgium and many other parts of Europe, which might create suitable habitats for ticks and change the epidemiology of tick-borne diseases. Also, our results indicate that shrub clearing could be applied as a tick control measure in recreational areas where there is a high degree of human-tick contact.

  15. Tick-borne rickettsiae in Guinea and Liberia.

    PubMed

    Mediannikov, Oleg; Diatta, Georges; Zolia, Yah; Balde, Mamadou Cellou; Kohar, Henry; Trape, Jean-François; Raoult, Didier

    2012-02-01

    While the high seroprevalence for the rickettsiae that cause spotted fevers and the multiple pathogenic rickettsiae is known, the data on the distribution of rickettsial diseases in Africa are often incomplete. We collected ticks from domestic or wild animals (generally a source of bushmeat) that were in contact with humans in 2 neighboring countries of tropical West Africa, Guinea and Liberia. In total, 382 ticks representing 6 species were collected in Liberia and 655 ticks representing 7 species were collected in Guinea. We found rickettsiae in 9 different species of ticks from both countries. Rickettsia africae was found in 93-100% of Amblyomma variegatum, in 14-93% of Rhipicephalus (B.) geigyi, Rh. (B.) annulatus, and Rh. (B.) decoloratus, and in several Hyalomma marginatum rufipes and Haemaphysalis paraleachi. A genetic variant of R. africae was found in Amblyomma compressum. R. massiliae was found in 10/61 (16%) of Rh. senegalensis ticks and in 2% of Haemaphysalis paraleachi ticks collected from dogs. We identified a new rickettsia in one of 44 (2%) Ixodes muniensis collected from a dog in Liberia. As this rickettsia is not yet isolated, we propose the provisional name "Candidatus Rickettsia liberiensis" (for the West African country where the host tick was collected). PMID:22309858

  16. Tick-borne rickettsiae in Guinea and Liberia.

    PubMed

    Mediannikov, Oleg; Diatta, Georges; Zolia, Yah; Balde, Mamadou Cellou; Kohar, Henry; Trape, Jean-François; Raoult, Didier

    2012-02-01

    While the high seroprevalence for the rickettsiae that cause spotted fevers and the multiple pathogenic rickettsiae is known, the data on the distribution of rickettsial diseases in Africa are often incomplete. We collected ticks from domestic or wild animals (generally a source of bushmeat) that were in contact with humans in 2 neighboring countries of tropical West Africa, Guinea and Liberia. In total, 382 ticks representing 6 species were collected in Liberia and 655 ticks representing 7 species were collected in Guinea. We found rickettsiae in 9 different species of ticks from both countries. Rickettsia africae was found in 93-100% of Amblyomma variegatum, in 14-93% of Rhipicephalus (B.) geigyi, Rh. (B.) annulatus, and Rh. (B.) decoloratus, and in several Hyalomma marginatum rufipes and Haemaphysalis paraleachi. A genetic variant of R. africae was found in Amblyomma compressum. R. massiliae was found in 10/61 (16%) of Rh. senegalensis ticks and in 2% of Haemaphysalis paraleachi ticks collected from dogs. We identified a new rickettsia in one of 44 (2%) Ixodes muniensis collected from a dog in Liberia. As this rickettsia is not yet isolated, we propose the provisional name "Candidatus Rickettsia liberiensis" (for the West African country where the host tick was collected).

  17. Ticks on humans in the Pantanal wetlands, Brazil.

    PubMed

    Ramos, Vanessa N; Osava, Carolina F; Piovezan, Ubiratan; Szabó, Matias P J

    2014-09-01

    Information on ticks biting humans in Brazil is very restricted. In fact, many times when human tick-borne diseases are diagnosed, the involved vector tick is not identified, although this may be clinically helpful. Pantanal is one of the world's largest floodplains, has an exuberant wildlife, and is place of extensive cattle ranching, ecotourism, and fishing. We herein report tick species found on humans in a 13-month survey in a region with both cattle and wildlife handling in the Brazilian Pantanal. From February 2012 to February 2013, a total of 280 ticks was collected from humans (n=22), 121 of which were attached. Amblyomma cajennense sensu lato nymphs were the main tick species and stage found attached to humans (n=93) especially during the dry months (winter). In the wet season (summer), Amblyomma parvum adults were the main ticks found attached to humans (n=19) followed by A. cajennense s.l. adults (n=9). Only one unattached nymph of A. parvum was collected in this study. These results reinforce that A. cajennense s.l. nymphs are an important parasite of humans (and vectors) in Brazil and draw also attention to A. parvum adults as frequent human parasites as well. PMID:24861806

  18. Borrelia, Rickettsia, and Ehrlichia Species in Bat Ticks, France, 2010

    PubMed Central

    Socolovschi, Cristina; Kernif, Tahar; Raoult, Didier

    2012-01-01

    Argas vespertilionis, an argasid tick associated with bats and bat habitats in Europe, Africa, and Asia has been reported to bite humans; however, studies investigating the presence of vector-borne pathogens in these ticks are lacking. Using molecular tools, we tested 5 A. vespertilionis ticks collected in 2010 from the floor of a bat-infested attic in southwestern France that had been converted into bedrooms. Rickettsia sp. AvBat, a new genotype of spotted fever group rickettsiae, was detected and cultivated from 3 of the 5 ticks. A new species of the Ehrlichia canis group, Ehrlichia sp. AvBat, was also detected in 3 ticks. Four ticks were infected with Borrelia sp. CPB1, a relapsing fever agent of the Borrelia group that caused fatal borreliosis in a bat in the United Kingdom. Further studies are needed to characterize these new agents and determine if the A. vespertilionis tick is a vector and/or reservoir of these agents. PMID:23171714

  19. Candidatus Rickettsia hoogstraalii in Ethiopian Argas persicus ticks.

    PubMed

    Pader, Vera; Nikitorowicz Buniak, Joanna; Abdissa, Alemseged; Adamu, Haileeysus; Tolosa, Tadele; Gashaw, Abebaw; Cutler, Ronald R; Cutler, Sally J

    2012-12-01

    Ethiopian soft ticks Argas persicus, hard ticks including both Amblyomma variegatum and Rhipicephalus (Boophilus) spp., and fleas were collected from livestock, traditional human dwellings, and cracks and crevices of trees. They were assessed in pools for the presence of Rickettsia using PCR-based methods. The extracted tick DNA was subjected to molecular screening for Rickettsia, which revealed 50.5% of the pooled samples to be positive for Rickettsia spp. These were then subjected to multi-gene analysis using both outer surface proteins and housekeeping genes with proven discriminatory potential. Sequencing of the citrate synthase and outer membrane genes clearly led to the identification of three distinct rickettsial species, Candidatus Rickettsia hoogstraalii in Argas persicus ticks; R. africae in hard tick pools, and R. felis in fleas. Furthermore, we demonstrated the presence of the plasmid-borne small heat-shock protein gene hsp2 in DNA from A. persicus ticks suggesting that Candidatus R. hoogstraalii carried by these ticks possess a plasmid. Unlike chromosomal gene sequences, the hsp2 gene failed to cluster with Candidatus R. hoogstraalii, instead falling into an isolated separate clade, suggesting a different origin for the plasmid. PMID:23140898

  20. High risk of tick bites in Dutch gardens.

    PubMed

    Mulder, Sara; van Vliet, Arnold J H; Bron, Wichertje A; Gassner, Fedor; Takken, Willem

    2013-12-01

    Lyme borreliosis is the most prevalent tick-borne disease throughout the Northern Hemisphere. Because the disease has large socioeconomic consequences, there is an urgent need to further educate the public to stimulate preventive behavior. Unfortunately, risk factors for tick bites are poorly known. In this study, we determined the habitats and activities at risk for tick bites for people of different age categories using reports of Dutch citizens. Most people, 43%, were bitten in the forest, and an unexpected large number of people reported tick bites from their gardens (31%). Hiking, hobby gardening, and playing were the most-mentioned activities during which tick bites were received; people aged from 50 to 69 and children below 10 were bitten most. Different age categories were bitten in different habitats and during different activities. People aged from 0 to 60 reported most tick bites related to visiting a forest and hiking, whereas people older than 60 were mainly bitten in gardens. The percentage of garden and hobby gardening tick bites increased with age, but was also high for children less than 10 years of age. We suggest that these findings should be taken into account for the development of prevention strategies aiming to decrease the number of Lyme borreliosis cases.

  1. Ticks on humans in the Pantanal wetlands, Brazil.

    PubMed

    Ramos, Vanessa N; Osava, Carolina F; Piovezan, Ubiratan; Szabó, Matias P J

    2014-09-01

    Information on ticks biting humans in Brazil is very restricted. In fact, many times when human tick-borne diseases are diagnosed, the involved vector tick is not identified, although this may be clinically helpful. Pantanal is one of the world's largest floodplains, has an exuberant wildlife, and is place of extensive cattle ranching, ecotourism, and fishing. We herein report tick species found on humans in a 13-month survey in a region with both cattle and wildlife handling in the Brazilian Pantanal. From February 2012 to February 2013, a total of 280 ticks was collected from humans (n=22), 121 of which were attached. Amblyomma cajennense sensu lato nymphs were the main tick species and stage found attached to humans (n=93) especially during the dry months (winter). In the wet season (summer), Amblyomma parvum adults were the main ticks found attached to humans (n=19) followed by A. cajennense s.l. adults (n=9). Only one unattached nymph of A. parvum was collected in this study. These results reinforce that A. cajennense s.l. nymphs are an important parasite of humans (and vectors) in Brazil and draw also attention to A. parvum adults as frequent human parasites as well.

  2. Borrelia hermsii Acquisition Order in Superinfected Ticks Determines Transmission Efficiency

    PubMed Central

    Raffel, Sandra J.; Schwan, Tom G.

    2013-01-01

    Multilocus sequence typing of Borrelia hermsii isolates reveals its divergence into two major genomic groups (GG), but no differences in transmission efficiency or host pathogenicity are associated with these genotypes. To compare GGI and GGII in the tick-host infection cycle, we first determined if spirochetes from the two groups could superinfect the tick vector Ornithodoros hermsi. We infected mice with isolates from each group and fed ticks sequentially on these mice. We then fed the infected ticks on naive mice and measured GGI and GGII spirochete densities in vector and host, using quantitative PCR of genotype-specific chromosomal DNA sequences. Sequential feedings resulted in dual tick infections, showing that GGI or GGII primary acquisition did not block superinfection by a secondary agent. On transmission to naive mice at short intervals after acquisition, ticks with primary GGI and secondary GGII spirochete infections caused mixed GGI and GGII infections in mice. However, ticks with primary GGII and secondary GGI spirochete infections caused only GGII infections with all isolate pairs examined. At longer intervals after acquisition, the exclusion of GGI by GGII spirochetes declined and cotransmission predominated. We then examined GGI and GGII spirochetemia in mice following single inoculation and coinoculation by needle and found that GGI spirochete densities were reduced on multiple days when coinoculated with GGII. These findings indicate that dual GGI-GGII spirochete infections can persist in ticks and that transmission to a vertebrate host is dependent on the order of tick acquisition and the interval between acquisition and transmission events. PMID:23716615

  3. Molecular characterization of tick salivary gland glutaminyl cyclase.

    PubMed

    Adamson, Steven W; Browning, Rebecca E; Chao, Chien-Chung; Bateman, Robert C; Ching, Wei-Mei; Karim, Shahid

    2013-09-01

    Glutaminyl cyclase (QC) catalyzes the cyclization of N-terminal glutamine residues into pyroglutamate. This post-translational modification extends the half-life of peptides and, in some cases, is essential in binding to their cognate receptor. Due to its potential role in the post-translational modification of tick neuropeptides, we report the molecular, biochemical and physiological characterization of salivary gland QC during the prolonged blood feeding of the black-legged tick (Ixodes scapularis) and the gulf-coast tick (Amblyomma maculatum). QC sequences from I. scapularis and A. maculatum showed a high degree of amino acid identity to each other and other arthropods and residues critical for zinc binding/catalysis (D159, E202, and H330) or intermediate stabilization (E201, W207, D248, D305, F325, and W329) are conserved. Analysis of QC transcriptional gene expression kinetics depicts an upregulation during the bloodmeal of adult female ticks prior to fast-feeding phases in both I. scapularis and A. maculatum suggesting a functional link with bloodmeal uptake. QC enzymatic activity was detected in saliva and extracts of tick salivary glands and midguts. Recombinant QC was shown to be catalytically active. Furthermore, knockdown of QC transcript by RNA interference resulted in lower enzymatic activity, and small, unviable egg masses in both studied tick species as well as lower engorged tick weights for I. scapularis. These results suggest that the post-translational modification of neurotransmitters and other bioactive peptides by QC is critical to oviposition and potentially other physiological processes. Moreover, these data suggest that tick-specific QC-modified neurotransmitters/hormones or other relevant parts of this system could potentially be used as novel physiological targets for tick control. PMID:23770496

  4. Effect of prescribed fire for tick control in California chaparral.

    PubMed

    Padgett, K A; Casher, L E; Stephens, S L; Lane, R S

    2009-09-01

    Prescribed fire was investigated as a method for controlling ixodid and argasid ticks in chaparral habitats in northern California. Two experimental and two adjacent control plots within a wildlife preserve were monitored for 1 yr postburn. Ticks were collected by flagging vegetation, by CO2-baited pitfall trap, and by live-trapping rodents. Twice as many rodents were caught at control sites compared with burn sites and no dusky-footed woodrats, Neotoma fuscipes Baird, were found in the treatment sites postburn. This species is known to be a reservoir of the agents of Lyme disease, Borrelia burgdorferi sensu stricto Johnson, Schmid, Hyde, Steigerwalt & Brenner, and human granulocytic anaplasmosis, Anaplasma phagocytophilum Dumler, Barbet, Bekker, Dasch, Palmer, Ray, Rikihisa, Rurangirwa. Six ixodid tick species were removed from rodents (Ixodes pacificus Cooley & Kohls, Ixodes jellisoni Cooley & Kohls, Ixodes spinipalpis Hadwen & Nuttall, Ixodes woodi Bishopp, Dermacentor occidentalis Marx, and Dermacentor parumapertus Neumann), two of which transmit bacterial zoonotic agents to people in the far-western United States. There was no decrease in number of ticks per animal trapped at either burn site compared with controls; in fact, the mean number of immature I. pacificus per rodent was significantly higher at one burn site than its control site. Soil refugia may protect ticks from fire-induced mortality; the argasid tick Ornithodoros coriaceus Koch, which lives in soil, was unaffected by the prescribed fire as were I. pacificus and D. occidentalis buried in packets 2.5 cm below ground. We conclude that although prescribed fires in chaparral habitats may diminish local rodent abundance, it does not decrease tick loads on rodents. Furthermore, burning chaparral does not result in a decreased abundance of adult ixodid ticks on vegetation and apparently does not affect argasid or ixodid ticks that are sheltered within soil refugia.

  5. Epidemiology of Tick-Borne Borreliosis in Morocco

    PubMed Central

    Diatta, Georges; Souidi, Yassine; Granjon, Laurent; Arnathau, Céline; Durand, Patrick; Chauvancy, Gilles; Mané, Youssouph; Sarih, M'hammed; Belghyti, Driss; Renaud, François; Trape, Jean-François

    2012-01-01

    Background The presence in Morocco of Argasid ticks of the Ornithodoros erraticus complex, the vector of tick-borne relapsing fever (TBRF) in North Africa, has been known since 1919, but the disease is rarely diagnosed and few epidemiological data are available. Methodology/Principal Findings Between 2006 and 2011, we investigated the presence of Ornithodoros ticks in rodent burrows in 34 sites distributed across Morocco. We also collected small mammals in 10 sites and we investigated TBRF in febrile patients in Kenitra district. The prevalence of Borrelia infections was assessed by nested PCR amplification in ticks and the brain tissue of small mammals, and by evaluation of thick blood films in patients. A high proportion of burrows were infested with ticks of the O. erraticus complex in all regions of Morocco, with a mean of 39.5% for the whole country. Borrelia infections were found in 39/382 (10.2%) of the ticks and 12/140 (8.6%) of the rodents and insectivores studied by PCR amplification, and 102 patients tested positive by thick blood film. Five small mammalian species were found infected: Dipodillus campestris, Meriones shawi, Gerbillus hoogstrali, Gerbillus occiduus and Atelerix algirus. Three Borrelia species were identified in ticks and/or rodents: B. hispanica, B. crocidurae and B. merionesi. Conclusions/Significance Tick populations belonging to O. erraticus complex are widely distributed in Morocco and a high proportion of ticks and small mammals are infected by Borrelia species. Although rarely diagnosed, TBRF may be a common cause of morbidity in all regions of Morocco. PMID:23029574

  6. Factors Associated with Tick Bite Preventive Practices among Farmworkers in Malaysia

    PubMed Central

    Wong, Li Ping; Tay, Sun Tee; Bulgiba, Awang; Zandi, Keivan; Kho, Kai Ling; Koh, Fui Xian; Ong, Bee Lee; Jaafar, Tariq; Hassan Nizam, Quaza Nizamuddin

    2016-01-01

    Background Farmworkers are at high-risk for tick bites, which potentially transmit various tick-borne diseases. Previous studies show that personal prevention against tick bites is key, and certain factors namely, knowledge, experience of tick bites, and health beliefs influence compliance with tick bites preventive behaviour. This study aimed to assess these factors and their associations with tick bite preventive practices among Malaysian farmworkers. Methods A total of eight cattle, goat and sheep farms in six states in Peninsular Malaysia participated in a cross-sectional survey between August and October 2013 Results A total of 151 (72.2%) out of 209 farmworkers answered the questionnaire. More than half of the farmworkers (n = 91) reported an experience of tick bites. Farms with monthly acaricide treatment had significantly (P<0.05) a low report of tick bites. Tick bite exposure rates did not differ significantly among field workers and administrative workers. The mean total knowledge score of ticks for the overall farmworkers was 13.6 (SD±3.2) from 20. The mean total tick bite preventive practices score for all farmworkers was 8.3 (SD±3.1) from 15. Fixed effect model showed the effects of four factors on tick bite prevention: (1) farms, (2) job categories (administrative workers vs. field workers), (3) perceived severity of tick bites, and (4) perceived barriers to tick bite prevention. Conclusions A high proportion of farmworkers, including administrative workers, reported an experience of tick bites. The effectiveness of monthly acaricide treatment was declared by low reports of tick bites on these farms. Tick bite preventive practices were insufficient, particularly in certain farms and for administrative workers. Our findings emphasise the need to have education programmes for all farmworkers and targeting farms with low prevention practices. Education and health programmes should increase the perception of the risk of tick bites and remove perceived

  7. Burden of tick-borne infections on American companion animals

    PubMed Central

    Berrada, Zenda L.; Telford, Sam R.

    2009-01-01

    This review examines the dynamics of tick biology and tick-borne infections in the United States. Clinical tick-borne diseases in dogs and cats are discussed. We demonstrate that there is much interest in tickborne infections at the level of the lay public (pet owners), describe trends in the distribution and prevalence of tickborne infections in the U.S., summarize some issues in understanding the degree of ill health due to tickborne infections, and suggest some avenues for research that would clarify these issues. PMID:19945085

  8. Ticks infesting amphibians and reptiles in Pernambuco, Northeastern Brazil.

    PubMed

    Dantas-Torres, Filipe; Oliveira-Filho, Edmilson F; Soares, Fábio Angelo M; Souza, Bruno O F; Valença, Raul Baltazar P; Sá, Fabrício B

    2008-01-01

    Ticks infesting amphibians and reptiles in the State of Pernambuco are reviewed, based on the current literature and new collections recently carried out by the authors. To date, three tick species have been found on amphibians and reptiles in Pernambuco. Amblyomma fuscum appears to be exclusively associated with Boa constrictor, its type host. Amblyomma rotundatum has a relatively low host-specificity, being found on toads, snakes, and iguana. Amblyomma dissimile has been found on a lizard and also small mammals (i.e., rodents and marsupials). New tick-host associations and locality records are given.

  9. Candidatus Neoehrlichia mikurensis in Ticks from Migrating Birds in Sweden

    PubMed Central

    Labbé Sandelin, Lisa; Tolf, Conny; Larsson, Sara; Wilhelmsson, Peter; Salaneck, Erik; Jaenson, Thomas G. T.; Lindgren, Per-Eric; Olsen, Björn; Waldenström, Jonas

    2015-01-01

    Candidatus Neoehrlichia mikurensis (CNM; family Anaplasmataceae) was recently recognized as a potential tick-borne human pathogen. The presence of CNM in mammals, in host-seeking Ixodes ticks and in ticks attached to mammals and birds has been reported recently. We investigated the presence of CNM in ornithophagous ticks from migrating birds. A total of 1,150 ticks (582 nymphs, 548 larvae, 18 undetermined ticks and two adult females) collected from 5,365 birds captured in south-eastern Sweden was screened for CNM by molecular methods. The birds represented 65 different species, of which 35 species were infested with one or more ticks. Based on a combination of morphological and molecular species identification, the majority of the ticks were identified as Ixodes ricinus. Samples were initially screened by real-time PCR targeting the CNM 16S rRNA gene, and confirmed by a second real-time PCR targeting the groEL gene. For positive samples, a 1260 base pair fragment of the 16S rRNA gene was sequenced. Based upon bacterial gene sequence identification, 2.1% (24/1150) of the analysed samples were CNM-positive. Twenty-two out of 24 CNM-positive ticks were molecularly identified as I. ricinus nymphs, and the remaining two were identified as I. ricinus based on morphology. The overall CNM prevalence in I. ricinus nymphs was 4.2%. None of the 548 tested larvae was positive. CNM-positive ticks were collected from 10 different bird species. The highest CNM-prevalences were recorded in nymphs collected from common redpoll (Carduelis flammea, 3/7), thrush nightingale (Luscinia luscinia, 2/29) and dunnock (Prunella modularis, 1/17). The 16S rRNA sequences obtained in this study were all identical to each other and to three previously reported European strains, two of which were obtained from humans. It is concluded that ornithophagous ticks may be infected with CNM and that birds most likely can disperse CNM-infected ticks over large geographical areas. PMID:26207834

  10. Candidatus Neoehrlichia mikurensis in Ticks from Migrating Birds in Sweden.

    PubMed

    Labbé Sandelin, Lisa; Tolf, Conny; Larsson, Sara; Wilhelmsson, Peter; Salaneck, Erik; Jaenson, Thomas G T; Lindgren, Per-Eric; Olsen, Björn; Waldenström, Jonas

    2015-01-01

    Candidatus Neoehrlichia mikurensis (CNM; family Anaplasmataceae) was recently recognized as a potential tick-borne human pathogen. The presence of CNM in mammals, in host-seeking Ixodes ticks and in ticks attached to mammals and birds has been reported recently. We investigated the presence of CNM in ornithophagous ticks from migrating birds. A total of 1,150 ticks (582 nymphs, 548 larvae, 18 undetermined ticks and two adult females) collected from 5,365 birds captured in south-eastern Sweden was screened for CNM by molecular methods. The birds represented 65 different species, of which 35 species were infested with one or more ticks. Based on a combination of morphological and molecular species identification, the majority of the ticks were identified as Ixodes ricinus. Samples were initially screened by real-time PCR targeting the CNM 16S rRNA gene, and confirmed by a second real-time PCR targeting the groEL gene. For positive samples, a 1260 base pair fragment of the 16S rRNA gene was sequenced. Based upon bacterial gene sequence identification, 2.1% (24/1150) of the analysed samples were CNM-positive. Twenty-two out of 24 CNM-positive ticks were molecularly identified as I. ricinus nymphs, and the remaining two were identified as I. ricinus based on morphology. The overall CNM prevalence in I. ricinus nymphs was 4.2%. None of the 548 tested larvae was positive. CNM-positive ticks were collected from 10 different bird species. The highest CNM-prevalences were recorded in nymphs collected from common redpoll (Carduelis flammea, 3/7), thrush nightingale (Luscinia luscinia, 2/29) and dunnock (Prunella modularis, 1/17). The 16S rRNA sequences obtained in this study were all identical to each other and to three previously reported European strains, two of which were obtained from humans. It is concluded that ornithophagous ticks may be infected with CNM and that birds most likely can disperse CNM-infected ticks over large geographical areas.

  11. New Borrelia species detected in ixodid ticks in Oromia, Ethiopia.

    PubMed

    Kumsa, Bersissa; Socolovschi, Cristina; Raoult, Didier; Parola, Philippe

    2015-04-01

    Little is known about Borrelia species transmitted by hard ticks in Ethiopia. The present study was conducted from November 2011 through March 2014 to address the occurrence and molecular identity of these bacteria in ixodid ticks infesting domestic animals in Oromia, Ethiopia. A total of 767 ixodid ticks collected from domestic animals were screened for Borrelia DNA by quantitative (q) real-time PCR followed by standard PCR and sequencing to identify the species. Overall, 3.8% (29/767) of the tested ticks were positive for Borrelia DNA, including 8/119 (6.7%) Amblyomma cohaerens, 1/42 (2.4%) Am. gemma, 3/53 (5.7%) Am. variegatum, 5/22 (22.7%) Amblyomma larvae, 3/60 (5%) Amblyomma nymphs, 2/139 (1.4%) Rhipicephalus (Boophilus) decoloratus, 2/31 (6.4%) Rh. decoloratus nymphs, and 5/118 (4.2%) Rh. pulchellus using 16S genus-specific qPCR. The prevalence of Borrelia DNA was significantly higher in genus Amblyomma (20/298, 6.7%) than in the genus Rhipicephalus (9/417, 2.1%) ticks (P=0.001). Sequencing of PCR products from the flaB and 16S rRNA genes of Borrelia spp. from Amblyomma ticks showed the presence of a new species between the relapsing fever and Lyme disease groups. However, Borrelia sp. detected in Rhipicephalus ticks clustered with B. theileri/B. lonestari. The human pathogenicity of the Borrelia sp. detected in Amblyomma ticks from Ethiopia has not yet been investigated, whereas the Borrelia sp. detected in Rhipicephalus ticks in our study is the causative agent of bovine borreliosis in cattle and may have veterinary importance in different parts of Ethiopia. Furthermore, the detection of previously unrecognized Borrelia species in Amblyomma and Rhipicephalus ticks in Ethiopia generates additional questions concerning the bacterial fauna in hard ticks and will prompt researchers to perform detailed studies for better understanding of ixodid ticks associated bacteria.

  12. Phthriasis palpebrarum can resemble tick larva infestation in an eyelid.

    PubMed

    Dağdelen, Serkan; Aykan, Umit; Cetinkaya, Kubilay

    2013-08-01

    The similarities of the larval and nymph stages of the tick and louse (Pthirus pubis) may lead to misdiagnosis in rare cases of infestation of the eyelashes. The most frequent manifestations of tick in the eye are conjunctivitis, uveitis, keratitis, and vasculitis. Tick inoculation of the skin can locally lead to formation of granuloma and abscess. More concerning is the potential systemic sequelae that can result from transmission of zoonoses such as Lyme disease. P. pubis can cause pruritic eyelid margins or unusual blepharoconjunctivitis. We present a case of phthiriasis palpebrarum in a 4-year-old boy. PMID:23993722

  13. Vasoconstriction induced by salivary gland extracts from ixodid ticks.

    PubMed

    Pekáriková, Danica; Rajská, Petra; Kazimírová, Mária; Pecháňová, Olga; Takáč, Peter; Nuttall, Patricia A

    2015-12-01

    In their quest for blood, most haematophagous parasites secrete vasodilators in their saliva to counter the host haemostatic response of vasoconstriction. Surprisingly, salivary gland extracts from adult female Dermacentor reticulatus and Rhipicephalus appendiculatus ticks induced constriction in a rat femoral artery model; males induced vasoconstriction or vasodilation depending on the time of feeding. Based on comparative HPLC fractionation, the active compounds inducing vasoconstriction do not appear to be prostaglandins (which ticks normally use as vasodilators). Vasoconstriction may be unique to ixodid ticks, helping them control blood flow during their prolonged blood-feeding of up to 10 days or more.

  14. New Borrelia species detected in ixodid ticks in Oromia, Ethiopia.

    PubMed

    Kumsa, Bersissa; Socolovschi, Cristina; Raoult, Didier; Parola, Philippe

    2015-04-01

    Little is known about Borrelia species transmitted by hard ticks in Ethiopia. The present study was conducted from November 2011 through March 2014 to address the occurrence and molecular identity of these bacteria in ixodid ticks infesting domestic animals in Oromia, Ethiopia. A total of 767 ixodid ticks collected from domestic animals were screened for Borrelia DNA by quantitative (q) real-time PCR followed by standard PCR and sequencing to identify the species. Overall, 3.8% (29/767) of the tested ticks were positive for Borrelia DNA, including 8/119 (6.7%) Amblyomma cohaerens, 1/42 (2.4%) Am. gemma, 3/53 (5.7%) Am. variegatum, 5/22 (22.7%) Amblyomma larvae, 3/60 (5%) Amblyomma nymphs, 2/139 (1.4%) Rhipicephalus (Boophilus) decoloratus, 2/31 (6.4%) Rh. decoloratus nymphs, and 5/118 (4.2%) Rh. pulchellus using 16S genus-specific qPCR. The prevalence of Borrelia DNA was significantly higher in genus Amblyomma (20/298, 6.7%) than in the genus Rhipicephalus (9/417, 2.1%) ticks (P=0.001). Sequencing of PCR products from the flaB and 16S rRNA genes of Borrelia spp. from Amblyomma ticks showed the presence of a new species between the relapsing fever and Lyme disease groups. However, Borrelia sp. detected in Rhipicephalus ticks clustered with B. theileri/B. lonestari. The human pathogenicity of the Borrelia sp. detected in Amblyomma ticks from Ethiopia has not yet been investigated, whereas the Borrelia sp. detected in Rhipicephalus ticks in our study is the causative agent of bovine borreliosis in cattle and may have veterinary importance in different parts of Ethiopia. Furthermore, the detection of previously unrecognized Borrelia species in Amblyomma and Rhipicephalus ticks in Ethiopia generates additional questions concerning the bacterial fauna in hard ticks and will prompt researchers to perform detailed studies for better understanding of ixodid ticks associated bacteria. PMID:25843811

  15. Attempt to detect evidence for tick-borne encephalitis virus in ticks and mammalian wildlife in The Netherlands.

    PubMed

    van der Poel, W H M; Van der Heide, R; Bakker, D; De Looff, M; De Jong, J; Van Manen, N; Gaasenbeck, C P H; Borgsteede, F H M

    2005-01-01

    To investigate if tick-borne encephalitis virus (TBEV) is present in mammalian wildlife species or ticks in The Netherlands, serum samples and ticks were tested for TBEV antibodies and TBEV RNA, respectively. Serum samples were collected from wild boar (666), deer (13), fox (399), and rodents (90), and were tested for TBEV antibodies, using ELISA, and SN test or HI test. Over a period of 4 years, a total of 906 ticks was collected from seven regions in The Netherlands. In four different regions, this was done on a monthly basis and during four consecutive summers. All ticks were tested for TBEV RNA by RT-PCR. TBEV antibody was detected by ELISA in two (0.5%) sera of foxes and 49 (7%) sera of wild boar, but not confirmed by HI or SNT. TBEV RNA was not detected in any of 906 ticks. It was concluded that there is no real evidence for a TBEV reservoir in ticks or wildlife in The Netherlands. PMID:15815150

  16. Ticks and tick-borne novel bunyavirus collected from the natural environment and domestic animals in Jinan city, East China.

    PubMed

    Wang, Dong; Wang, Yongming; Yang, Guoliang; Liu, Huiyuan; Xin, Zheng

    2016-02-01

    Since 2011, 73 cases of the severe fever with thrombocytopenia syndrome, a novel tick-borne disease, have been reported in Jinan city through information system for disease control and prevention. Therefore, this study aimed to investigate the species, distribution, host animals of ticks and tick-borne pathogens. A total of 722 ticks were collected from two types of natural environment and six kinds of domestic animal in Jinan city. All the sampled ticks belonged to the same species, namely Haemaphysalis longicornis, and 94.7% of them were adult. The density of free-living ticks in grassland was nearly six times that in shrub. The prevalence of the goat (53.3%) was highest among the domestic animals. The host body region most frequently parasitized by H. longicornis was the head (77.8%), especially ears and periocular region. Novel bunyavirus was detected on the free-ranging goats in Jinan city. Acaricide treatment with a higher concentration on the ears, periocular region and the groin of domestic animals should be recommended to control the ticks effectively.

  17. Identification of potential plant extracts for anti-tick activity against acaricide resistant cattle ticks, Rhipicephalus (Boophilus) microplus (Acari: Ixodidae).

    PubMed

    Ghosh, Srikanta; Tiwari, Shashi Shankar; Kumar, Bhanu; Srivastava, Sharad; Sharma, Anil Kumar; Kumar, Sachin; Bandyopadhyay, A; Julliet, Sanis; Kumar, Rajesh; Rawat, A K S

    2015-05-01

    To develop an eco-friendly tick control method, seven plant extracts were prepared using 50 and 95% ethanol and evaluated for acaricidal activity against cattle tick, Rhipicephalus (Boophilus) microplus. The adult immersion test was adopted for testing different extracts. Based on 72 h screening criterion, 95% ethanolic extracts of Datura metel fruits and Argemone mexicana whole plant were found effective showing more than 50% mortality of treated ticks. The 95% ethanolic extracts of D. metel fruits and A. mexicana whole plant exhibited acaricidal and reproductive inhibitory effects on treated ticks. The LC90 values of D. metel and A. mexicana extracts were determined as 7.13 and 11.3%, respectively. However, although both the extracts were found efficacious against deltamethrin-resistant IVRI-4 and multi-acaricide resistant IVRI-5 lines of R. (B.) microplus, they caused less mortality than treated ticks of the reference IVRI-I line. Phytochemical studies indicated the presence of alkaloids and glucosides in D. metel fruits and alkaloids, terpenoids, flavonoids and phenolics in A. mexicana whole plant extracts. The results indicated that these botanicals may play an important role in reducing the use of chemicals for tick control and possibly to manage resistant tick population in environment friendly manner. PMID:25717008

  18. Prevalence of Tick-Borne Pathogens in Ixodes ricinus and Dermacentor reticulatus Ticks from Different Geographical Locations in Belarus

    PubMed Central

    Reye, Anna L.; Stegniy, Valentina; Mishaeva, Nina P.; Velhin, Sviataslau; Hübschen, Judith M.; Ignatyev, George; Muller, Claude P.

    2013-01-01

    Worldwide, ticks are important vectors of human and animal pathogens. Besides Lyme Borreliosis, a variety of other bacterial and protozoal tick-borne infections are of medical interest in Europe. In this study, 553 questing and feeding Ixodes ricinus (n = 327) and Dermacentor reticulatus ticks (n = 226) were analysed by PCR for Borrelia, Rickettsia, Anaplasma, Coxiella, Francisella and Babesia species. Overall, the pathogen prevalence in ticks was 30.6% for I. ricinus and 45.6% for D. reticulatus. The majority of infections were caused by members of the spotted-fever group rickettsiae (24.4%), 9.4% of ticks were positive for Borrelia burgdorferi sensu lato, with Borrelia afzelii being the most frequently detected species (40.4%). Pathogens with low prevalence rates in ticks were Anaplasma phagocytophilum (2.2%), Coxiella burnetii (0.9%), Francisella tularensis subspecies (0.7%), Bartonella henselae (0.7%), Babesia microti (0.5%) and Babesia venatorum (0.4%). On a regional level, hotspots of pathogens were identified for A. phagocytophilum (12.5–17.2%), F. tularensis ssp. (5.5%) and C. burnetii (9.1%), suggesting established zoonotic cycles of these pathogens at least at these sites. Our survey revealed a high burden of tick-borne pathogens in questing and feeding I. ricinus and D. reticulatus ticks collected in different regions in Belarus, indicating a potential risk for humans and animals. Identified hotspots of infected ticks should be included in future surveillance studies, especially when F. tularensis ssp. and C. burnetii are involved. PMID:23349900

  19. Efficacy of orally administered powdered aloe juice (Aloe ferox) against ticks on cattle and ticks and fleas on dogs.

    PubMed

    Fourie, J J; Fourie, L J; Horak, I G

    2005-12-01

    The efficacy of orally administered powdered aloe juice (Aloe ferox) was evaluated against ticks on cattle and against ticks and fleas on dogs. Twelve calves were each infested over a 25-day period with approximately 4000 larvae of Rhipicephalus (Boophilus) decoloratus and allocated to 3 groups of 4 calves each. Three days after the last larval infestation and daily for 22 days thereafter, the calves in 1 group were fed 5 mg/kg body weight and those in another 25 mg/kg body weight of powdered aloe juice incorporated in game maintenance pellets, while the animals in the 3rd group received only pellets. Detached female ticks were collected daily and counted and the weights and the fertility of groups of 50 engorged female ticks collected from the animals were ascertained. The powdered aloe juice in the game maintenance pellets had no effect on the tick burdens of the calves or on the fertility of the ticks. Six dogs, in each of 2 groups, were treated daily for 15 consecutive days, commencing on Day -5 before the 1st tick infestation, with either 0.39 g or 0.74 g of powdered aloe juice, administered orally in gelatin capsules, while a 3rd group of 6 dogs served as untreated controls. All the dogs were challenged with Haemaphysalis leachi on Days 0 and + 7, and with Ctenocephalides felis on Days + 1 and + 8, and efficacy assessments were made 1 day after flea and 2 days after tick challenge, respectively. Treatment was not effective against ticks or fleas on the dogs.

  20. Prevalence of tick-borne pathogens in Ixodes ricinus and Dermacentor reticulatus ticks from different geographical locations in Belarus.

    PubMed

    Reye, Anna L; Stegniy, Valentina; Mishaeva, Nina P; Velhin, Sviataslau; Hübschen, Judith M; Ignatyev, George; Muller, Claude P

    2013-01-01

    Worldwide, ticks are important vectors of human and animal pathogens. Besides Lyme Borreliosis, a variety of other bacterial and protozoal tick-borne infections are of medical interest in Europe. In this study, 553 questing and feeding Ixodes ricinus (n = 327) and Dermacentor reticulatus ticks (n = 226) were analysed by PCR for Borrelia, Rickettsia, Anaplasma, Coxiella, Francisella and Babesia species. Overall, the pathogen prevalence in ticks was 30.6% for I. ricinus and 45.6% for D. reticulatus. The majority of infections were caused by members of the spotted-fever group rickettsiae (24.4%), 9.4% of ticks were positive for Borrelia burgdorferi sensu lato, with Borrelia afzelii being the most frequently detected species (40.4%). Pathogens with low prevalence rates in ticks were Anaplasma phagocytophilum (2.2%), Coxiella burnetii (0.9%), Francisella tularensis subspecies (0.7%), Bartonella henselae (0.7%), Babesia microti (0.5%) and Babesia venatorum (0.4%). On a regional level, hotspots of pathogens were identified for A. phagocytophilum (12.5-17.2%), F. tularensis ssp. (5.5%) and C. burnetii (9.1%), suggesting established zoonotic cycles of these pathogens at least at these sites. Our survey revealed a high burden of tick-borne pathogens in questing and feeding I. ricinus and D. reticulatus ticks collected in different regions in Belarus, indicating a potential risk for humans and animals. Identified hotspots of infected ticks should be included in future surveillance studies, especially when F. tularensis ssp. and C. burnetii are involved.

  1. Grassland agriculture

    Technology Transfer Automated Retrieval System (TEKTRAN)

    Agriculture in grassland environments is facing multiple stresses from: shifting demographics, declining and fragmented agricultural landscapes, declining environmental quality, variable and changing climate, volatile and increasing energy costs, marginal economic returns, and globalization. Degrad...

  2. Agricultural Production.

    ERIC Educational Resources Information Center

    Lehigh County Area Vocational-Technical School, Schnecksville, PA.

    This brochure describes the philosophy and scope of a secondary-level course in agricultural production. Addressed in the individual units of the course are the following topics: careers in agriculture and agribusiness, animal science and livestock production, agronomy, agricultural mechanics, supervised occupational experience programs, and the…

  3. Transgene expression and silencing in a tick cell line: A model system for functional tick genomics.

    PubMed

    Kurtti, Timothy J; Mattila, Joshua T; Herron, Michael J; Felsheim, Roderick F; Baldridge, Gerald D; Burkhardt, Nicole Y; Blazar, Bruce R; Hackett, Perry B; Meyer, Jason M; Munderloh, Ulrike G

    2008-10-01

    The genome project of the black legged tick, Ixodes scapularis, provides sequence data for testing gene function and regulation in this important pathogen vector. We tested Sleeping Beauty (SB), a Tc1/mariner group transposable element, and cationic lipid-based transfection reagents for delivery and genomic integration of transgenes into I. scapularis cell line ISE6. Plasmid DNA and dsRNA were effectively transfected into ISE6 cells and they were successfully transformed to express a red fluorescent protein (DsRed2) and a selectable marker, neomycin phosphotransferase (NEO). Frequency of transformation was estimated as 1 transformant per 5000-10,000 cells and cultures were incubated for 2-3 months in medium containing the neomycin analog G418 in order to isolate transformants. Genomic integration of the DsRed2 transgene was confirmed by inverse PCR and sequencing that demonstrated a TA nucleotide pair inserted between SB inverted/direct repeat sequences and tick genomic sequences, indicating that insertion of the DsRed2 gene into the tick cell genome occurred through the activity of SB transposase. RNAi using dsRNA transcribed from the DsRed2 gene silenced expression of red fluorescent protein in transformed ISE6 cells. SB transposition in cell line ISE6 provides an effective means to explore the functional genomics of I. scapularis. PMID:18722527

  4. Ticks and tick-borne pathogens from wildlife in the Free State Province, South Africa.

    PubMed

    Tonetti, N; Berggoetz, M; Rühle, C; Pretorius, A M; Gern, L

    2009-04-01

    Eight ixodid tick species, associated with 59 free-ranging mammals belonging to 10 species, were collected at five different localities in the Free State Province, South Africa. Four of the study areas were nature reserves (Willem Pretorius, Sandveld, Tussen-die-Riviere, and Soetdoring), and one site was a private farm located in Senekal district. The collection was performed from March 2006 until June 2006. Ticks (n=569) and tissues from animals (n=52) were analyzed by polymerase chain reaction, reverse line blot, and sequencing for various tick-borne pathogens belonging to the genera Babesia, Theileria, Anaplasma, and Ehrlichia. Rhipicephalus (Boophilus) microplus, the known vector of Babesia bovis responsible for Asiatic redwater in South Africa, was found for the first time in the Free State Province. Rhipicephalus warburtoni [corrected] also was collected in areas in the Free State where it has not been previously described. Anaplasma marginale was detected for the first time in a gemsbok (Oryx gazella gazella). Gene sequences recovered in this study were 98-100% homologous with GenBank sequences for Anaplasma bovis, Theileria separata, and Theileria sp. Malelane sable antelope. PMID:19395753

  5. 76 FR 12959 - Promoting Community Integrated Pest Management To Prevent Tick-Borne Diseases; Notice of Public...

    Federal Register 2010, 2011, 2012, 2013, 2014

    2011-03-09

    .... II. Background Tick-borne diseases, including Lyme, Rocky Mountain spotted fever, and anaplasmosis... Environmental protection, Community IPM, Insect Repellents, Integrated Pest Management, Lyme Disease, IPM, Tick... AGENCY Promoting Community Integrated Pest Management To Prevent Tick- Borne Diseases; Notice of...

  6. Cattle tick vaccine researchers join forces in CATVAC.

    PubMed

    Schetters, Theo; Bishop, Richard; Crampton, Michael; Kopáček, Petr; Lew-Tabor, Alicja; Maritz-Olivier, Christine; Miller, Robert; Mosqueda, Juan; Patarroyo, Joaquín; Rodriguez-Valle, Manuel; Scoles, Glen A; de la Fuente, José

    2016-01-01

    A meeting sponsored by the Bill & Melinda Gates Foundation was held at the Avanti Hotel, Mohammedia, Morocco, July 14-15, 2015. The meeting resulted in the formation of the Cattle Tick Vaccine Consortium (CATVAC). PMID:26911668

  7. Cattle tick vaccine researchers join forces in CATVAC

    Technology Transfer Automated Retrieval System (TEKTRAN)

    A meeting sponsored by the Bill & Melinda Gates Foundation was held at the Avanti Hotel, Mohammedia, Morocco, July 14–15, 2015. The meeting resulted in the formation of the Cattle Tick Vaccine Consortium (CATVAC)....

  8. [QUESTING BEHAVIOR OF HARD TICKS (IXODIDAE) IN ONTOGENESIS].

    PubMed

    Leonovich, S A

    2015-01-01

    Literary and own data on questing behavior of larvae, nymphs, and adults in main genera of hard ticks are analyzed. Evolutionary patterns of this behavior and the role of different life stages in this process are discussed. PMID:26827487

  9. [EFFECT OF PYRETHROIDS ON TAIGA TICKS (IXODES PERSULCATUS IXODIDAE)].

    PubMed

    Germant, O M; Shashina, N I

    2016-01-01

    Nonspecific prevention of infections, the agents of which are transmitted by Ixodes ticks, is aimed at stopping the suction of the ticks to humans and is substantially based one the use of acaricides. The most interesting group of compounds to be used to individually protect humans is pyrethroids that cause different nerve conduction disturbances in the ticks, which result in their paralysis and death more significantly rapidly than the compounds from other chemical groups. The effect of 8 pyrethroids was investigated when the taiga ticks were in contact with the tissue treated with the compounds. The relationship of the chemical structure of pyrethroids with their acaricidal activity was analyzed from motor activity values and knockdown time. The test pyreithroids, in order of decreasing acaricidal activity, are imiprothrin cyphenothrin, cyfluthrin, alpha-cyperamethrin, zeta-cyperimethrin fenothrin, flumethrin.

  10. [EFFECT OF PYRETHROIDS ON TAIGA TICKS (IXODES PERSULCATUS IXODIDAE)].

    PubMed

    Germant, O M; Shashina, N I

    2016-01-01

    Nonspecific prevention of infections, the agents of which are transmitted by Ixodes ticks, is aimed at stopping the suction of the ticks to humans and is substantially based one the use of acaricides. The most interesting group of compounds to be used to individually protect humans is pyrethroids that cause different nerve conduction disturbances in the ticks, which result in their paralysis and death more significantly rapidly than the compounds from other chemical groups. The effect of 8 pyrethroids was investigated when the taiga ticks were in contact with the tissue treated with the compounds. The relationship of the chemical structure of pyrethroids with their acaricidal activity was analyzed from motor activity values and knockdown time. The test pyreithroids, in order of decreasing acaricidal activity, are imiprothrin cyphenothrin, cyfluthrin, alpha-cyperamethrin, zeta-cyperimethrin fenothrin, flumethrin. PMID:27029149

  11. Small mammals as hosts of immature ixodid ticks.

    PubMed

    Horak, I G; Fourie, L J; Braack, L E O

    2005-09-01

    Two hundred and twenty-five small mammals belonging to 16 species were examined for ticks in Free State, Mpumalanga and Limpopo Provinces, South Africa, and 18 ixodid tick species, of which two could only be identified to genus level, were recovered. Scrub hares, Lepus saxatilis, and Cape hares, Lepus capensis, harboured the largest number of tick species. In Free State Province Namaqua rock mice, Aethomys namaquensis, and four-striped grass mice, Rhabdomys pumilio, were good hosts of the immature stages of Haemaphysalis leachi and Rhipicephalus gertrudae, while in Mpumalanga and Limpopo Provinces red veld rats, Aethomys chrysophilus, Namaqua rock mice and Natal multimammate mice, Mastomys natalensis were good hosts of H. leachi and Rhipicephalus simus. Haemaphysalis leachi was the only tick recovered from animals in all three provinces.

  12. Hiring the right employees.

    PubMed

    Reigle, Dale A

    2014-01-01

    Current employees provide the best examples of the type of aptitude, attitude, motivation, and fit we are looking for, or not looking for, in new employees. All four of these attributes are present in star employees. Using what we know about our best and worst employees can assist us in developing questions and scoring templates that will help us categorize current applicants. Hiring managers should formulate questions in a way that elicits informative responses from candidates about past performance in situations similar to those they will face on the job. Nonverbal clues can help provide insight beyond the simple verbal answer given by candidates. Practice, critique, and critical review of the outcomes of our hiring decisions improve our ability to become good hiring managers. PMID:25807621

  13. Employees with Cerebral Palsy

    MedlinePlus

    ... Resources Home | Accommodation and Compliance Series: Employees with Cerebral Palsy (CP) By Eddie Whidden, MA Preface Introduction Information About ... SOAR) at http://AskJAN.org/soar. Information about Cerebral Palsy (CP) What is CP? Cerebral palsy is a ...

  14. Understanding Employee Motivation.

    ERIC Educational Resources Information Center

    Lindner, James R.

    1998-01-01

    Extension employees (n=23) ranked the following as the most important motivational factors: interesting work, good wages, appreciation, job security, and good working conditions. The findings were related to theories of motivation formulated by Herzberg, Adams, and Vroom. (SK)

  15. Employee Selection Process: Integrating Employee Needs and Employer Motivators.

    ERIC Educational Resources Information Center

    Carroll, Brian J.

    1989-01-01

    Offers suggestions for managers relative to the employee selection process, focusing on the identification of a potential employee's needs and the employer's motivators that affect employee productivity. Discusses the use of a preemployment survey and offers a questionnaire that allows matching of the employee's needs with employment…

  16. Climate change and Ixodes tick-borne diseases of humans.

    PubMed

    Ostfeld, Richard S; Brunner, Jesse L

    2015-04-01

    The evidence that climate warming is changing the distribution of Ixodes ticks and the pathogens they transmit is reviewed and evaluated. The primary approaches are either phenomenological, which typically assume that climate alone limits current and future distributions, or mechanistic, asking which tick-demographic parameters are affected by specific abiotic conditions. Both approaches have promise but are severely limited when applied separately. For instance, phenomenological approaches (e.g. climate envelope models) often select abiotic variables arbitrarily and produce results that can be hard to interpret biologically. On the other hand, although laboratory studies demonstrate strict temperature and humidity thresholds for tick survival, these limits rarely apply to field situations. Similarly, no studies address the influence of abiotic conditions on more than a few life stages, transitions or demographic processes, preventing comprehensive assessments. Nevertheless, despite their divergent approaches, both mechanistic and phenomenological models suggest dramatic range expansions of Ixodes ticks and tick-borne disease as the climate warms. The predicted distributions, however, vary strongly with the models' assumptions, which are rarely tested against reasonable alternatives. These inconsistencies, limited data about key tick-demographic and climatic processes and only limited incorporation of non-climatic processes have weakened the application of this rich area of research to public health policy or actions. We urge further investigation of the influence of climate on vertebrate hosts and tick-borne pathogen dynamics. In addition, testing model assumptions and mechanisms in a range of natural contexts and comparing their relative importance as competing models in a rigorous statistical framework will significantly advance our understanding of how climate change will alter the distribution, dynamics and risk of tick-borne disease.

  17. Climate change and Ixodes tick-borne diseases of humans

    PubMed Central

    Ostfeld, Richard S.; Brunner, Jesse L.

    2015-01-01

    The evidence that climate warming is changing the distribution of Ixodes ticks and the pathogens they transmit is reviewed and evaluated. The primary approaches are either phenomenological, which typically assume that climate alone limits current and future distributions, or mechanistic, asking which tick-demographic parameters are affected by specific abiotic conditions. Both approaches have promise but are severely limited when applied separately. For instance, phenomenological approaches (e.g. climate envelope models) often select abiotic variables arbitrarily and produce results that can be hard to interpret biologically. On the other hand, although laboratory studies demonstrate strict temperature and humidity thresholds for tick survival, these limits rarely apply to field situations. Similarly, no studies address the influence of abiotic conditions on more than a few life stages, transitions or demographic processes, preventing comprehensive assessments. Nevertheless, despite their divergent approaches, both mechanistic and phenomenological models suggest dramatic range expansions of Ixodes ticks and tick-borne disease as the climate warms. The predicted distributions, however, vary strongly with the models' assumptions, which are rarely tested against reasonable alternatives. These inconsistencies, limited data about key tick-demographic and climatic processes and only limited incorporation of non-climatic processes have weakened the application of this rich area of research to public health policy or actions. We urge further investigation of the influence of climate on vertebrate hosts and tick-borne pathogen dynamics. In addition, testing model assumptions and mechanisms in a range of natural contexts and comparing their relative importance as competing models in a rigorous statistical framework will significantly advance our understanding of how climate change will alter the distribution, dynamics and risk of tick-borne disease. PMID:25688022

  18. Investigation of tick vectors of Hepatozoon canis in Brazil.

    PubMed

    Demoner, Larissa de Castro; Rubini, Adriano Stefani; Paduan, Karina dos Santos; Metzger, Betina; de Paula Antunes, João Marcelo Azevedo; Martins, Thiago Fenandes; Mathias, Maria Izabel Camargo; O'Dwyer, Lucia Helena

    2013-12-01

    Hepatozoon canis is a common apicomplexan parasite of dogs. In Brazil, in addition to Rhipicephalus sanguineus, Amblyomma ovale, Amblyomma cajennense, and Rhipicephalus (Boophilus) microplus have been suggested to act as vectors. The present study aimed to evaluate, under controlled conditions, the acquisition of H. canis by A. ovale, R. sanguineus, and A. cajennense after feeding on naturally infected dogs. Cytological and histophatological examinations were performed to recover oocysts and other sporogonic stages of the protozoan from the experimentally infected nymphs and adults. None of the R. sanguineus (n=30) or A. cajennense nymphs (n=15) that were dissected after feeding on H. canis naturally infected dogs became infected by the hemoparasite. Likewise, none of the R. sanguineus (n=165) and A. cajennense (n=114) adult ticks that were fed as nymphs on dogs demonstrated infection. Additionally, A. cajennense adult ticks were incapable of acquiring the infection, since no parasite was found in 62 adults that fed on H. canis-infected dogs. With regard to A. ovale ticks, 2 different infestations were carried out. Firstly, a dog with naturally occurring hepatozoonosis was infested with A. ovale adults originating from Rondônia, Brazil. Ticks fed to full engorgement. A total of 31 adults was collected from the dog and dissected on the third day after natural detachment. Oocysts were detected in 13 (42%) of the ticks. The second experimental infestation was carried out using adult ticks originating from São Paulo, Brazil. Surprisingly, of the 103 dissected ticks, only one (1%) contained oocysts in the hemocoel. No other sporogonic stage was found. Results indicate that different strains of A. ovale ticks may exist in Brazil with different susceptibilities to pathogens. Furthermore, it is possible that R. sanguineus and A. cajennense have little or no importance in the transmission of H. canis in rural areas of Brazil.

  19. Microbiome changes through ontogeny of a tick pathogen vector.

    PubMed

    Zolnik, Christine P; Prill, Robert J; Falco, Richard C; Daniels, Thomas J; Kolokotronis, Sergios-Orestis

    2016-10-01

    Blacklegged ticks (Ixodes scapularis) are one of the most important pathogen vectors in the United States, responsible for transmitting Lyme disease and other tick-borne diseases. The structure of a host's microbial community has the potential to affect the ecology and evolution of the host. We employed high-throughput sequencing of the 16S rRNA gene V3-V4 hypervariable regions in the first study to investigate the tick microbiome across all developmental stages (larvae, nymphs, adults). In addition to field-collected life stages, newly hatched laboratory-reared larvae were studied to determine the baseline microbial community structure and to assess transovarial transmission. We also targeted midguts and salivary glands due to their importance in pathogen maintenance and transmission. Over 100 000 sequences were produced per life stage replicate. Rickettsia was the most abundant bacterial genus across all sample types matching mostly the Ixodes rickettsial endosymbionts, and its proportion decreased as developmental stage progressed, with the exception of adult females that harboured a mean relative abundance of 97.9%. Laboratory-reared larvae displayed the lowest bacterial diversity, containing almost exclusively Rickettsia. Many of the remaining bacteria included genera associated with soil, water and plants, suggesting environmental acquisition while off-host. Female organs exhibited significantly different β-diversity than the whole tick from which they were derived. Our results demonstrate clear differences in both α- and β-diversity among tick developmental stages and between tick organs and the tick as a whole. Furthermore, field-acquired bacteria appear to be very important to the overall internal bacterial community of this tick species, with influence from the host bloodmeal appearing limited. PMID:27588381

  20. Agricultural Waste.

    PubMed

    Xue, Ling; Zhang, Panpan; Shu, Huajie; Chang, Chein-Chi; Wang, Renqing; Zhang, Shuping

    2016-10-01

    In recent years, the quantity of agricultural waste has been rising rapidly all over the world. As a result, the environmental problems and negative impacts of agricultural waste are drawn more and more attention. Therefore, there is a need to adopt proper approaches to reduce and reuse agricultural waste. This review presented about 200 literatures published in 2015 relating to the topic of agricultural waste. The review examined research on agricultural waste in 2015 from the following four aspects: the characterization, reuse, treatment, and management. Researchers highlighted the importance to reuse agricultural waste and investigated the potential to utilize it as biofertilizers, cultivation material, soil amendments, adsorbent, material, energy recycling, enzyme and catalyst etc. The treatment of agricultural waste included carbonization, biodegradation, composting hydrolysis and pyrolysis. Moreover, this review analyzed the differences of the research progress in 2015 from 2014. It may help to reveal the new findings and new trends in this field in 2015 comparing to 2014. PMID:27620093

  1. Agricultural Waste.

    PubMed

    Xue, Ling; Zhang, Panpan; Shu, Huajie; Chang, Chein-Chi; Wang, Renqing; Zhang, Shuping

    2016-10-01

    In recent years, the quantity of agricultural waste has been rising rapidly all over the world. As a result, the environmental problems and negative impacts of agricultural waste are drawn more and more attention. Therefore, there is a need to adopt proper approaches to reduce and reuse agricultural waste. This review presented about 200 literatures published in 2015 relating to the topic of agricultural waste. The review examined research on agricultural waste in 2015 from the following four aspects: the characterization, reuse, treatment, and management. Researchers highlighted the importance to reuse agricultural waste and investigated the potential to utilize it as biofertilizers, cultivation material, soil amendments, adsorbent, material, energy recycling, enzyme and catalyst etc. The treatment of agricultural waste included carbonization, biodegradation, composting hydrolysis and pyrolysis. Moreover, this review analyzed the differences of the research progress in 2015 from 2014. It may help to reveal the new findings and new trends in this field in 2015 comparing to 2014.

  2. Prevalence of ixodid ticks on cattle and sheep northeast of Iran.

    PubMed

    Hassan, Mehdi Aghamohammad; Raoofi, Afshin; Hosseini, Arman; Mehrara, Mohammad Reza; Amininajafi, Fatemeh

    2016-09-01

    A survey was carried out to investigate the prevalence of hard tick species (Acari: Ixodidae) on cattle and sheep north of Iran. The aim of study was to determine the prevalence of hard ticks on cattle and sheep in the mountainous areas of Golestan province and their geographical distribution. A total of 26 ticks were collected from 22 infested cattle and 26 ticks were collected from 12 infested sheep during activating seasons of ticks in 2013-2014. The species collected from cattle and sheep were Hyalomma marginatum, Hyalomma anatolicum, Hyalomma asiaticum, Rhipicephalus bursa and Rhipicephalus sanguineus. The results show that these are dominant tick species in the surveyed area. PMID:27605782

  3. [Immunization against tick-borne encephalitis].

    PubMed

    Krause, Martin; Majer, Sabine

    2016-01-01

    Tick-borne encephalitis (TBE) is a viral infection that may cause irreversible damage to the brain and even result in death. No specific therapy exists. Active immunization is of major importance in controlling the infection. Vaccination is recommended to all adults and children > 6 years who live in endemic areas. Two inactivated vaccines are available in Switzerland. The vaccination schedule includes a basic immunization composed of 3 injections followed by boosting every 10 years. The efficacy of the vaccines has never been investigated in controlled studies, however, from indirect evidence, the vaccines are thought to cause good protection and to be safe. Local reactions at the injections site may occur in one third and mild systemic side effects in one fifth of vaccinees. Anaphylactic reactions and severe central nervous side effects are very rare. PMID:27268448

  4. Transstadial Transmission of Borrelia turcica in Hyalomma aegyptium Ticks

    PubMed Central

    Kalmár, Zsuzsa; Cozma, Vasile; Sprong, Hein; Jahfari, Setareh; D’Amico, Gianluca; Mărcuțan, Daniel I.; Ionică, Angela M.; Magdaş, Cristian; Modrý, David; Mihalca, Andrei D.

    2015-01-01

    Borrelia turcica comprises the third major group of arthropod-transmitted borreliae and is phylogenetically divergent from other Borrelia groups. The novel group of Borrelia was initially isolated from Hyalomma aegyptium ticks in Turkey and it was recently found in blood and multiple organs of tortoises exported from Jordan to Japan. However, the ecology of these spirochetes and their development in ticks or the vertebrate hosts were not investigated in detail; our aims were to isolate the pathogen and to evaluate the possibility of transstadial transmission of Borrelia turcica by H. aegyptium ticks. Ticks were collected from Testudo graeca tortoises during the summer of 2013 from southeastern Romania. Engorged nymphs were successfully molted to the adult stage. Alive B. turcica was isolated from molted ticks by using Barbour-Stoenner-Kelly (BSK) II medium. Four pure cultures of spirochetes were obtained and analyzed by PCR and sequencing. Sequence analysis of glpQ, gyrB and flaB revealed 98%–100% similarities with B. turcica. H. aegyptium ticks collected from T. graeca tortoises were able to pass the infection with B. turcica via transstadial route, suggesting its vectorial capacity. PMID:25695663

  5. An Immunosuppressant Peptide from the Hard Tick Amblyomma variegatum

    PubMed Central

    Tian, Yufeng; Chen, Wenlin; Mo, Guoxiang; Chen, Ran; Fang, Mingqian; Yedid, Gabriel; Yan, Xiuwen

    2016-01-01

    Ixodid ticks are well known for spreading transmitted tick-borne pathogens while being attached to their hosts for almost 1–2 weeks to obtain blood meals. Thus, they must secrete many immunosuppressant factors to combat the hosts’ immune system. In the present work, we investigated an immunosuppressant peptide of the hard tick Amblyomma variegatum. This peptide, named amregulin, is composed of 40 residues with an amino acid sequence of HLHMHGNGATQVFKPRLVLKCPNAAQLIQPGKLQRQLLLQ. A cDNA of the precursor peptide was obtained from the National Center for Biotechnology Information (NCBI, Bethesda, MD, USA). In rat splenocytes, amregulin exerts significant anti-inflammatory effects by inhibiting the secretion of inflammatory factors in vitro, such as tumor necrosis factor-alpha (TNF-α), interleukin-1 (IL-1), interleukin-8 (IL-8) and interferon-gamma (IFN-γ). In rat splenocytes, treated with amregulin, compared to lipopolysaccharide (LPS) alone, the inhibition of the above inflammatory factors was significant at all tested concentrations (2, 4 and 8 µg/mL). Amregulin shows strong free radical scavenging and antioxidant activities (5, 10 and 20 µg/mL) in vitro. Amregulin also significantly inhibits adjuvant-induced paw inflammation in mouse models in vivo. This peptide may facilitate the ticks’ successful blood feeding and may lead to host immunotolerance of the tick. These findings have important implications for the understanding of tick-host interactions and the co-evolution between ticks and the viruses that they bear. PMID:27153086

  6. Biology and ecology of the brown dog tick, Rhipicephalus sanguineus

    PubMed Central

    2010-01-01

    The brown dog tick (Rhipicephalus sanguineus) is the most widespread tick in the world and a well-recognized vector of many pathogens affecting dogs and occasionally humans. This tick can be found on dogs living in both urban and rural areas, being highly adapted to live within human dwellings and being active throughout the year not only in tropical and subtropical regions, but also in some temperate areas. Depending on factors such as climate and host availability, Rh. sanguineus can complete up to four generations per year. Recent studies have demonstrated that ticks exposed to high temperatures attach and feed on humans and rabbits more rapidly. This observation suggests that the risk of human parasitism by Rh. sanguineus could increase in areas experiencing warmer and/or longer summers, consequently increasing the risk of transmission of zoonotic agents (e.g., Rickettsia conorii and Rickettsia rickettsii). In the present article, some aspects of the biology and ecology of Rh. sanguineus ticks are discussed including the possible impact of current climate changes on populations of this tick around the world. PMID:20377860

  7. Tick-borne pathogen - reversed and conventional discovery of disease.

    PubMed

    Tijsse-Klasen, Ellen; Koopmans, Marion P G; Sprong, Hein

    2014-01-01

    Molecular methods have increased the number of known microorganisms associated with ticks significantly. Some of these newly identified microorganisms are readily linked to human disease while others are yet unknown to cause human disease. The face of tick-borne disease discovery has changed with more diseases now being discovered in a "reversed way," detecting disease cases only years after the tick-borne microorganism was first discovered. Compared to the conventional discovery of infectious diseases, reverse order discovery presents researchers with new challenges. Estimating public health risks of such agents is especially challenging, as case definitions and diagnostic procedures may initially be missing. We discuss the advantages and shortcomings of molecular methods, serology, and epidemiological studies that might be used to study some fundamental questions regarding newly identified tick-borne diseases. With increased tick-exposure and improved detection methods, more tick-borne microorganisms will be added to the list of pathogens causing disease in humans in the future. PMID:25072045

  8. A tick B-cell inhibitory protein from salivary glands of the hard tick, Hyalomma asiaticum asiaticum

    SciTech Connect

    Yu Da; Liang Jiangguo; Yu Haining; Wu Haifeng; Xu Chunhua; Liu Jingze . E-mail: jzliu21@heinfo.net; Lai Ren . E-mail: rlai72@njau.edu.cn

    2006-05-05

    Some studies done to date suggest that B-cell inhibitory factor occurred in tick saliva. In this study, a novel protein having B-cell inhibitory activity was purified and characterized from the salivary glands of the hard tick, Hyalomma asiaticum asiaticum. This protein was named B-cell inhibitory factor (BIF). The cDNA encoding BIF was cloned by cDNA library screening. The predicted protein from the cDNA sequence is composed of 138 amino acids including the mature BIF. No similarity was found by Blast search. The lipopolysaccharide-induced B-cell proliferation was inhibited by BIF. This is First report of the identification and characterization of B-cell inhibitory protein from tick. The current study facilitates the study of identifying the interaction among tick, Borrelia burgdorferi, the causative agent of Lyme disease, and host.

  9. Communal farmers' perceptions of tick-borne diseases affecting cattle and investigation of tick control methods practiced in Zimbabwe.

    PubMed

    Sungirai, Marvelous; Moyo, Doreen Zandile; De Clercq, Patrick; Madder, Maxime

    2016-02-01

    Tick borne diseases (TBDs) are responsible for huge economic losses in cattle production in most African countries where the majority of cattle owners are the resource poor communal farmers. Governments have initiated and co-ordinate tick control programs with farmers required to contribute funds for their sustenance. The success of these programs will hinge upon the involvement of communal farmers in their design, implementation and evaluation. To this end, 313 communal farmers (approximately 8.4% response rate) were interviewed and 3 focus group discussions were carried out in the southern low-veld part of Zimbabwe with the objectives of investigating communal farmers' perceptions on TBDs affecting cattle, level of participation in government initiated tick control programs, other tick control methods practiced, types of acaricides used and their perceived effectiveness. There was a general awareness of TBDs with 67.7% (n=212) farmers being able to describe tick diseases with names or clinical and post-mortem signs. The diseases or problems frequently associated with ticks were cowdriosis (38%, n=119), mastitis (36.7%, n=115), anaplasmosis (36.1%, n=113), body damage (28.4%, n=89), babesiosis (24.6%, n=77) and poor body condition (16.6%, n=52). Cattle mortalities due to TBDs were reported by 23.8% (n=74) of the farmers. The plunge dip was consistently used by farmers (70.3%, n=220) to control ticks. Other tick control methods practiced were the hand spraying (67.4%, n=211), hand dressing (16.6%, n=52), traditional methods (5.4%, n=17), use of pour-ons (4.5%, n=14) and smearing (2.2%, n=7). The formamidines were the most common class of acaricide used (59.4%, n=186), followed by synthetic pyrethroids (29.1%, n=91), macro cyclic lactones (12.8%, n=40) and organophosphates (4.5%, n=14). Most farmers (75.2%, n=231) perceived these acaricides to be effective in controlling ticks. The results of focus group discussions showed that a number of factors influenced the

  10. Communal farmers' perceptions of tick-borne diseases affecting cattle and investigation of tick control methods practiced in Zimbabwe.

    PubMed

    Sungirai, Marvelous; Moyo, Doreen Zandile; De Clercq, Patrick; Madder, Maxime

    2016-02-01

    Tick borne diseases (TBDs) are responsible for huge economic losses in cattle production in most African countries where the majority of cattle owners are the resource poor communal farmers. Governments have initiated and co-ordinate tick control programs with farmers required to contribute funds for their sustenance. The success of these programs will hinge upon the involvement of communal farmers in their design, implementation and evaluation. To this end, 313 communal farmers (approximately 8.4% response rate) were interviewed and 3 focus group discussions were carried out in the southern low-veld part of Zimbabwe with the objectives of investigating communal farmers' perceptions on TBDs affecting cattle, level of participation in government initiated tick control programs, other tick control methods practiced, types of acaricides used and their perceived effectiveness. There was a general awareness of TBDs with 67.7% (n=212) farmers being able to describe tick diseases with names or clinical and post-mortem signs. The diseases or problems frequently associated with ticks were cowdriosis (38%, n=119), mastitis (36.7%, n=115), anaplasmosis (36.1%, n=113), body damage (28.4%, n=89), babesiosis (24.6%, n=77) and poor body condition (16.6%, n=52). Cattle mortalities due to TBDs were reported by 23.8% (n=74) of the farmers. The plunge dip was consistently used by farmers (70.3%, n=220) to control ticks. Other tick control methods practiced were the hand spraying (67.4%, n=211), hand dressing (16.6%, n=52), traditional methods (5.4%, n=17), use of pour-ons (4.5%, n=14) and smearing (2.2%, n=7). The formamidines were the most common class of acaricide used (59.4%, n=186), followed by synthetic pyrethroids (29.1%, n=91), macro cyclic lactones (12.8%, n=40) and organophosphates (4.5%, n=14). Most farmers (75.2%, n=231) perceived these acaricides to be effective in controlling ticks. The results of focus group discussions showed that a number of factors influenced the

  11. Apply Pesticides Correctly, A Guide for Commercial Applicators: Agricultural Pest Control -- Animal.

    ERIC Educational Resources Information Center

    Wamsley, Mary Ann, Ed.; Vermeire, Donna M., Ed.

    This guide contains basic information to meet specific standards for pesticide applicators. The text is concerned with the common pests of agricultural animals such as flies, ticks, bots, lice and mites. Methods for controlling these pests and appropriate pesticides are discussed. (CS)

  12. Ecological preferences of exophilic and endophilic ticks (Acari: Ixodidae) parasitizing wild carnivores in the Iberian Peninsula.

    PubMed

    Sobrino, Raquel; Millán, Javier; Oleaga, Alvaro; Gortázar, Christian; de la Fuente, José; Ruiz-Fons, Francisco

    2012-03-23

    Ticks parasitizing wild carnivores and the tick-borne pathogens (TBPs) that they transmit may affect domestic carnivores and humans. Thus, investigating the role of wild carnivores as tick hosts is of relevance for understanding the life cycle of ticks in natural foci and the epidemiology of TBPs shared with domestic animals and humans. Therefore, the main objective of this study was to determine the ixodid tick fauna of wild carnivores in Peninsular Spain and the environmental factors driving the risk of wild carnivores to be parasitized by ixodid ticks. We hypothesized that the adaptation of tick species to differing climatic conditions may be reflected in a similar parasitization risk of wild carnivores by ticks between bioclimatic regions in our study area. To test this, we surveyed ixodid ticks in wild carnivores in oceanic, continental-Mediterranean, and thermo-Mediterranean bioclimatic regions of Peninsular Spain. We analyzed the influence of environmental factors on the risk of wild carnivores to be parasitized by ticks by performing logistic regression models. Models were separately performed for exophilic and endophilic ticks under the expected differing influence of environmental conditions on their life cycle. We found differences in the composition of the tick community parasitizing wild carnivores from different bioclimatic regions. Modelling results partially confirmed our null hypothesis because bioclimatic region was not a relevant factor influencing the risk of wild carnivores to be parasitized by exophilic ticks. Bioclimatic region was however a factor driving the risk of wild carnivores to be parasitized by endophilic ticks. Spanish wild carnivores are hosts to a relevant number of tick species, some of them being potential vectors of pathogens causing serious animal and human diseases. Information provided herein can be of help to understand tick ecology in Spanish wildlife, the epidemiology of tick-borne diseases, and to prevent the risks of

  13. Anaplasma phagocytophilum and Anaplasma marginale Elicit Different Gene Expression Responses in Cultured Tick Cells

    PubMed Central

    Zivkovic, Zorica; Blouin, Edmour F.; Manzano-Roman, Raúl; Almazán, Consuelo; Naranjo, Victoria; Massung, Robert F.; Jongejan, Frans; Kocan, Katherine M.; de la Fuente, José

    2009-01-01

    The genus Anaplasma (Rickettsiales: Anaplasmataceae) includes obligate tick-transmitted intracellular organisms, Anaplasma phagocytophilum and Anaplasma marginale that multiply in both vertebrate and tick host cells. Recently, we showed that A. marginale affects the expression of tick genes that are involved in tick survival and pathogen infection and multiplication. However, the gene expression profile in A. phagocytophilum-infected tick cells is currently poorly characterized. The objectives of this study were to characterize tick gene expression profile in Ixodes scapularis ticks and cultured ISE6 cells in response to infection with A. phagocypthilum and to compare tick gene expression responses in A. phagocytophilum- and A. marginale-infected tick cells by microarray and real-time RT-PCR analyses. The results of these studies demonstrated modulation of tick gene expression by A. phagocytophilum and provided evidence of different gene expression responses in tick cells infected with A. phagocytophilum and A. marginale. These differences in Anaplasma-tick interactions may reflect differences in pathogen life cycle in the tick cells. PMID:19636428

  14. Ticks infesting wild and domestic animals and humans of Sri Lanka with new host records.

    PubMed

    Liyanaarachchi, D R; Rajakaruna, R S; Dikkumbura, A W; Rajapakse, R P V J

    2015-02-01

    An island-wide collection of tick species infesting humans, domesticated and wild animals and questing ticks in domestic and peridomestic environments was carried out during 2009-2011. A total of 30,461 ticks were collected from 30 different hosts and free living stages from the ground. The collection consisted of 22 tick species from 30 different hosts recording 12 tick species from humans, 19 from domesticated animals and 21 from wild animals, with a total of 97 new host records. The most common tick species on humans were Dermacentor auratus and Amblyomma testudinairum, while Haemaphysalis intermedia, Rhipicephalus microplus and Rhipicephalus sanguineus were common in domesticated and wild animals sharing 20 host species. Among the questing ticks, immature D. auratus was the most abundant. Humans and domesticated animals were mostly infested by the nymphal stages while adult ticks were found on wild animals. High number of new host records could be due to domestic animals picking tick species from wildlife and vise versa at the human/animal interface. Habitat destruction due to forest fragmentation has lead to wild animals roaming in urban and semi-urban neighbourhoods increasing the interactions of wild animals with domesticated animals. Wild animals play a significant role as a reservoir of many tick borne infections which can easily be spread to domesticated animals and then to humans via tick infestations. Data in this paper are useful for those interested in tick infesting wild and domestic animals and humans in describing the zoonotic potential of tick borne infections.

  15. Haemaphysalis longicornis Ticks as Reservoir and Vector of Severe Fever with Thrombocytopenia Syndrome Virus in China

    PubMed Central

    Luo, Li-Mei; Zhao, Li; Wen, Hong-Ling; Zhang, Zhen-Tang; Liu, Jian-Wei; Fang, Li-Zhu; Xue, Zai-Feng; Ma, Dong-Qiang; Zhang, Xiao-Shuang; Ding, Shu-Jun; Lei, Xiao-Ying

    2015-01-01

    Severe fever with thrombocytopenia syndrome (SFTS) is an emerging hemorrhagic fever in East Asia caused by SFTS virus (SFTSV), a newly discovered phlebovirus. The Haemaphysalis longicornis tick has been suspected to be the vector of SFTSV. To determine whether SFTSV can be transmitted among ticks, from ticks to animals, and from animals to ticks, we conducted transmission studies between developmental stages of H. longicornis ticks and between ticks and mice. Using reverse transcription PCR, we also analyzed the prevalence of SFTSV infection among H. longicornis ticks collected from vegetation in Shandong Province, China. Our results showed a low prevalence of SFTSV among collected ticks (0.2%, 8/3,300 ticks), and we showed that ticks fed on SFTSV-infected mice could acquire the virus and transstadially and transovarially transmit it to other developmental stages of ticks. Furthermore, SFTSV-infected ticks could transmit the virus to mice during feeding. Our findings indicate ticks could serve as a vector and reservoir of SFTSV. PMID:26402039

  16. Methods for rapid transfer and localization of lyme disease pathogens within the tick gut.

    PubMed

    Kariu, Toru; Coleman, Adam S; Anderson, John F; Pal, Utpal

    2011-02-14

    Lyme disease is caused by infection with the spirochete pathogen Borrelia burgdorferi, which is maintained in nature by a tick-rodent infection cycle. A tick-borne murine model has been developed to study Lyme disease in the laboratory. While naíve ticks can be infected with B. burgdorferi by feeding them on infected mice, the molting process takes several weeks to months to complete. Therefore, development of more rapid and efficient tick infection techniques, such as a microinjection-based procedure, is an important tool for the study of Lyme disease. The procedure requires only hours to generate infected ticks and allows control over the delivery of equal quantities of spirochetes in a cohort of ticks. This is particularly important as the generation of B. burgdorferi infected ticks by the natural feeding process using mice fails to ensure 100% infection rate and potentially results in variation of pathogen burden amongst fed ticks. Furthermore, microinjection can be used to infect ticks with B. burgdorferi isolates in cases where an attenuated strain is unable to establish infection in mice and thus can not be naturally acquired by ticks. This technique can also be used to deliver a variety of other biological materials into ticks, for example, specific antibodies or double stranded RNA. In this article, we will demonstrate the microinjection of nymphal ticks with in vitro-grown B. burgdorferi. We will also describe a method for localization of Lyme disease pathogens in the tick gut using confocal immunofluorescence microscopy.

  17. Broad-Range Survey of Tick-Borne Pathogens in Southern Germany Reveals a High Prevalence of Babesia microti and a Diversity of Other Tick-Borne Pathogens

    PubMed Central

    Crowder, Chris D.; Carolan, Heather E.; Rounds, Megan A.; Ecker, David J.; Haag, Heike; Mothes, Benedikt; Nolte, Oliver

    2014-01-01

    Abstract Ticks harbor numerous pathogens of significance to human and animal health. A better understanding of the pathogens carried by ticks in a given geographic area can alert health care providers of specific health risks leading to better diagnosis and treatments. In this study, we tested 226 Ixodes ricinis ticks from Southern Germany using a broad-range PCR and electrospray ionization mass spectrometry assay (PCR/ESI-MS) designed to identify tick-borne bacterial and protozoan pathogens in a single test. We found 21.2% of the ticks tested carried Borrelia burgdorferi sensu lato consisting of diverse genospecies; a surprisingly high percentage of ticks were infected with Babesia microti (3.5%). Other organisms found included Borrelia miyamotoi, Rickettsia helvetica, Rickettsia monacensis, and Anaplasma phagocytophilum. Of further significance was our finding that more than 7% of ticks were infected with more than one pathogen or putative pathogen. PMID:25072989

  18. Tick-Borne Encephalitis Virus Habitats in North East Germany: Reemergence of TBEV in Ticks after 15 Years of Inactivity

    PubMed Central

    Krienke, Anja; Riebold, Diana; Loebermann, Micha; Littmann, Martina; Fiedler, Karin; Klaus, Christine; Süss, Jochen; Reisinger, Emil Christian

    2014-01-01

    The incidence of tick-borne encephalitis has risen in Europe since 1990 and the tick-borne encephalitis virus (TBEV) has been documented to be spreading into regions where it was not previously endemic. In Mecklenburg-West Pomerania, a federal state in Northern Germany, TBEV was not detectable in over 16,000 collected ticks between 1992 and 2004. Until 2004, the last human case of TBE in the region was reported in 1985. Following the occurrence of three autochthonous human cases of TBE after 2004, however, we collected ticks from the areas in which the infections were contracted. To increase the chance of detecting TBEV-RNA, some of the ticks were fed on mice. Using nested RT-PCR, we were able to confirm the presence of TBEV in ticks for the first time after 15 years. A phylogenetic analysis revealed a close relationship between the sequences we obtained and a TBEV sequence from Mecklenburg-East Pomerania published in 1992 and pointed to the reemergence of a natural focus of TBEV after years of low activity. Our results imply that natural foci of TBEV may either persist at low levels of activity for years or reemerge through the agency of migrating birds. PMID:25110671

  19. History and complexity in tick-host dynamics: discrepancies between ‘real’ and ‘visible’ tick populations

    PubMed Central

    2014-01-01

    Background Numerical responses of ticks to changes in densities of their hosts can be complex and apparently unpredictable. Manipulations even of deterministic models can produce counter-intuitive results, including tick populations that either rise or fall under increasing host densities, depending on initial conditions. Methods In this paper I use an established simulation model to demonstrate a wide range of numerical responses to different scenarios of host changes, and to examine the basic mechanisms that drive them. Results The rate and direction of change of host densities affects the extent to which questing tick numbers reflect those of their hosts. Numerical responses differ profoundly between dynamic tick-host systems and those allowed to reach equilibrium. Conclusions The key to understanding tick-host dynamics is to understand the difference between ‘real’ and ‘visible’ tick populations. An appreciation of the implications of this difference – and of the conditions that influence it - will benefit the effective interpretation of field data. PMID:24885852

  20. Population-Based Passive Tick Surveillance and Detection of Expanding Foci of Blacklegged Ticks Ixodes scapularis and the Lyme Disease Agent Borrelia burgdorferi in Ontario, Canada

    PubMed Central

    Nelder, Mark P.; Russell, Curtis; Lindsay, L. Robbin; Dhar, Badal; Patel, Samir N.; Johnson, Steven; Moore, Stephen; Kristjanson, Erik; Li, Ye; Ralevski, Filip

    2014-01-01

    We identified ticks submitted by the public from 2008 through 2012 in Ontario, Canada, and tested blacklegged ticks Ixodes scapularis for Borrelia burgdorferi and Anaplasma phagocytophilum. Among the 18 species of ticks identified, I. scapularis, Dermacentor variabilis, Ixodes cookei and Amblyomma americanum represented 98.1% of the 14,369 ticks submitted. Rates of blacklegged tick submission per 100,000 population were highest in Ontario's Eastern region; D. variabilis in Central West and Eastern regions; I. cookei in Eastern and South West regions; and A. americanum had a scattered distribution. Rates of blacklegged tick submission per 100,000 population were highest from children (0–9 years old) and older adults (55–74 years old). In two health units in the Eastern region (i.e., Leeds, Grenville & Lanark District and Kingston-Frontenac and Lennox & Addington), the rate of submission for engorged and B. burgdorferi-positive blacklegged ticks was 47× higher than the rest of Ontario. Rate of spread for blacklegged ticks was relatively faster and across a larger geographic area along the northern shore of Lake Ontario/St. Lawrence River, compared with slower spread from isolated populations along the northern shore of Lake Erie. The infection prevalence of B. burgdorferi in blacklegged ticks increased in Ontario over the study period from 8.4% in 2008 to 19.1% in 2012. The prevalence of B. burgdorferi-positive blacklegged ticks increased yearly during the surveillance period and, while increases were not uniform across all regions, increases were greatest in the Central West region, followed by Eastern and South West regions. The overall infection prevalence of A. phagocytophilum in blacklegged ticks was 0.3%. This study provides essential information on ticks of medical importance in Ontario, and identifies demographic and geographic areas for focused public education on the prevention of tick bites and tick-borne diseases. PMID:25171252

  1. The Phenology of Ticks and the Effects of Long-Term Prescribed Burning on Tick Population Dynamics in Southwestern Georgia and Northwestern Florida

    PubMed Central

    Gleim, Elizabeth R.; Conner, L. Mike; Berghaus, Roy D.; Levin, Michael L.; Zemtsova, Galina E.; Yabsley, Michael J.

    2014-01-01

    Some tick populations have increased dramatically in the past several decades leading to an increase in the incidence and emergence of tick-borne diseases. Management strategies that can effectively reduce tick populations while better understanding regional tick phenology is needed. One promising management strategy is prescribed burning. However, the efficacy of prescribed burning as a mechanism for tick control is unclear because past studies have provided conflicting data, likely due to a failure of some studies to simulate operational management scenarios and/or account for other predictors of tick abundance. Therefore, our study was conducted to increase knowledge of tick population dynamics relative to long-term prescribed fire management. Furthermore, we targeted a region, southwestern Georgia and northwestern Florida (USA), in which little is known regarding tick dynamics so that basic phenology could be determined. Twenty-one plots with varying burn regimes (burned surrounded by burned [BB], burned surrounded by unburned [BUB], unburned surrounded by burned [UBB], and unburned surrounded by unburned [UBUB]) were sampled monthly for two years while simultaneously collecting data on variables that can affect tick abundance (e.g., host abundance, vegetation structure, and micro- and macro-climatic conditions). In total, 47,185 ticks were collected, of which, 99% were Amblyomma americanum, 0.7% were Ixodes scapularis, and fewer numbers of Amblyomma maculatum, Ixodes brunneus, and Dermacentor variabilis. Monthly seasonality trends were similar between 2010 and 2011. Long-term prescribed burning consistently and significantly reduced tick counts (overall and specifically for A. americanum and I. scapularis) regardless of the burn regimes and variables evaluated. Tick species composition varied according to burn regime with A. americanum dominating at UBUB, A. maculatum at BB, I. scapularis at UBB, and a more even composition at BUB. These data indicate that

  2. Tick-borne Diseases: The Big Two | NIH MedlinePlus the Magazine

    MedlinePlus

    ... been a tick bite. Photo: CDC/James Gathany Lyme disease Lyme disease is the most common tick-borne disease in ... nervous system can develop in patients with late Lyme disease. Lyme disease has different stages. The rash is ...

  3. Borrelia sp. in ticks recovered from white-tailed deer in Alabama.

    PubMed

    Luckhart, S; Mullen, G R; Durden, L A; Wright, J C

    1992-07-01

    Six hundred sixty-five hunter-killed white-tailed deer (Odocoileus virginianus) from 18 counties in Alabama (USA) were examined for ticks. Most of the collections were made at state-operated wildlife management areas. Four species of ticks (n = 4,527) were recovered: the lone star tick Amblyomma americanum (n = 482); the Gulf Coast tick A. maculatum (n = 11); the winter tick Dermacentor albipictus (n = 1,242); and the black-legged tick Ixodes scapularis (n = 2,792). Fifty-six percent of the ticks (n = 2,555) were examined for Borrelia sp. spirochetes using an immunofluorescent, polyclonal antibody assay. Spirochetes were detected in I. scapularis (five females, seven males) from Barbour, Butler, Coosa, and Lee counties and A. americanum (four males, four nymphs) from Hale, Lee, and Wilcox counties. Area-specific prevalences in ticks were as high as 3.3% for I. scapularis and 3.8% for A. americanum.

  4. Climate, niche, ticks, and models: what they are and how we should interpret them.

    PubMed

    Estrada-Peña, Agustín

    2008-12-01

    Ticks spend most of their life cycle in the environment, and all tick life cycle stages are dependent on a complex combination of climate variables. Furthermore, host availability and vegetation significantly modulate the dynamics of tick populations. Tick recruitment is dependent on successful reproduction, which in turn requires sufficient adult tick densities, available blood meal sources, and egg survival. Though many animals can serve as hosts, there are several determinants of host suitability. For example, host availability in time and space is an important determinant of tick bionomics. Shelter and protection from environmental extremes are critical to tick survival. Questing and diapausing ticks are vulnerable to extremes of temperature and humidity. There are concerns about how predicted climate change may alter several critical features of host-parasite relationships of ticks, the potential for invasion of new areas or alteration of patterns of pathogen transmission in particular. However, modeling approaches that relate known occurrences of tick species to climate (and/or landscape) features and predict geographic occurrences are not completely fulfilling our needs to understand how the "tick panorama" can change as a consequence of these climate trends. This is a short review about the concept of ecological niche as applied to ticks, as well as some raised concerns about its evaluation and strict definition, and its usefulness to map geographical suitability for ticks. Comments about how climate, hosts, and landscape configuration are briefly discussed regarding its applicability to tick mapping and with reference about their impact on tick abundance. I will further comment on already published observations about observed changes in the geographical range of ticks in parts of Europe. PMID:19030890

  5. Agricultural Wastes.

    ERIC Educational Resources Information Center

    Jewell, W. J.; Switzenbaum, M. S.

    1978-01-01

    Presents a literature review of agricultural wastes, covering publications of 1976-77. Some of the areas covered are: (1) water characteristics and impacts; (2) waste treatment; (3) reuse of agricultural wastes; and (4) nonpoint pollution sources. A list of 150 references is also presented. (HM)

  6. VOCATIONAL AGRICULTURE.

    ERIC Educational Resources Information Center

    California State Dept. of Education, Sacramento. Research Coordinating Unit.

    TO ASSIST THOSE WHO MAKE DECISIONS RELATING TO EDUCATIONAL PROGRAMS IN AGRICULTURE, RECENT RESEARCH IN VOCATIONAL AGRICULTURE IS SUMMARIZED. A 1963 STUDY TREATS THE RELATIONSHIP BETWEEN WORK EXPERIENCE AND STUDENT CHARACTERISTICS, PLANS, AND ASPIRATIONS. STUDIES ON POST-SECONDARY EDUCATION CONCERN GUIDELINES FOR TECHNICIAN PROGRAMS, JUSTIFICATION…

  7. 9 CFR 306.4 - Assignment of Program employees where members of family employed; soliciting employment...

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... Section 306.4 Animals and Animal Products FOOD SAFETY AND INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... employed at any establishment under his jurisdiction. Program employees are forbidden to solicit, for...

  8. Theileria sp. OT3 and other tick-borne pathogens in sheep and ticks in Italy: molecular characterization and phylogeny.

    PubMed

    Giangaspero, A; Marangi, M; Papini, R; Paoletti, B; Wijnveld, M; Jongejan, F

    2015-02-01

    PCR Reverse Line Blot (RLB) hybridization and sequencing were used to determine the dynamics of infection with tick-borne pathogens in one hundred apparently healthy sheep in Italy. Blood samples were tested once prior to the onset of the grazing season (June 2010) and once after the end of the grazing season (August 2010). Ticks collected from sheep and from the vegetation were also tested by PCR/RLB. Before grazing, 56% of the sheep harbored several tick-borne pathogens: Anaplasma ovis was the most prevalent (41%), followed by A. ovis co-infected with Theileria sp. OT3 (14%). After grazing, 87% of sheep were positive for A. ovis alone (41%), co-infected with Theileria sp. OT3 (8%) or co-infected with Babesia motasi (5%). Other sheep were infected with Anaplasma phagocytophilum alone (20%), co-infected with B. motasi (7%) or with Theileria sp. OT3 (5%) (p<0.001). After grazing, sheep were significantly more infected with tick-borne pathogens than before grazing. Ticks collected were all Haemaphysalis punctata (n-89) and 36% were positive for A. ovis, Ehrlichia ovina and A. ovis combined with A. phagocytophilum. Phylogenetic analysis including isolates from countries in the Mediterranean Basin show circulation of the same variants of Theileria sp. OT3, whereas two different geographical origins for the isolates of A. ovis and A. phagocytophilum were identified. This is the first report from Italy of Theileria sp. OT3 in sheep, whereas the detection of Ehrlichia ovina in ticks is worth noting, and the presence of A. phagocytophilum in sheep and in ticks poses a potential public health risk. PMID:25448422

  9. Establishment of a laboratory colony of taiga tick Ixodes persulcatus for tick-borne pathogen transmission studies.

    PubMed

    Konnai, Satoru; Saito, Yoichi; Nishikado, Hideto; Yamada, Shinji; Imamura, Saiki; Mori, Akina; Ito, Takuya; Onuma, Misao; Ohashi, Kazuhiko

    2008-01-01

    Ixodes persulcatus Schulze (I. persulcatus) is distributed in Russia and Far East Asia including Japan, and has been implicated as the vector of several human pathogens. In particular, I. persulcatus acts as the only tick vector for human lyme borreliosis in Japan. In order to elucidate the mechanism of transmission of I. persulcatus-borne pathogens, we developed a laboratory colony of I. persulcatus. Ticks were fed on Syrian hamster and engorged ticks that had dropped off the animals were collected and maintained to allow them to molt. Tick rearing was performed in incubator at 20 degrees C with 95% relative humidity and 12-hour light/dark photo-period regimen. We found out that adult females fed for 8 +/- 2 days and had a pre-oviposition period lasting for 7 +/- 2 days. The minimum egg incubation period was 1 month with the hatched larvae feeding for 3 +/- 1 days and molting to nymphs 3-4 months thereafter. Meanwhile, the nymphs fed for 4 +/- 1 days and molted to adult 2-3 months thereafter. For future analysis of gene expression profiles in I. persulcatus, we cloned and sequenced the actin gene (a housekeeping gene), and found that it is 92.7% to 98.6% homologous to the published sequences of related ixodid ticks. This laboratory colony of I. persulcatus will facilitate investigations on the role of tick-derived molecules on the transmission of I. persulcatus-borne pathogens and will be important for identification of potential anti-tick vaccine and acaricide target molecules.

  10. How to Remove a Tick | NIH MedlinePlus the Magazine

    MedlinePlus

    ... of this page please turn Javascript on. Feature: Ticks and Diseases How to Remove a Tick Past Issues / Spring - Summer 2010 Table of Contents ... with a good grasping end to remove the tick as close to the skin as possible. Do ...

  11. 9 CFR 95.28 - Hay or straw and similar material from tick-infested areas.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... tick-infested areas. 95.28 Section 95.28 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... THE UNITED STATES § 95.28 Hay or straw and similar material from tick-infested areas. Hay or straw, grass, or similar material from tick-infested pastures, ranges, or premises may disseminate...

  12. 9 CFR 95.28 - Hay or straw and similar material from tick-infested areas.

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... tick-infested areas. 95.28 Section 95.28 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... THE UNITED STATES § 95.28 Hay or straw and similar material from tick-infested areas. Hay or straw, grass, or similar material from tick-infested pastures, ranges, or premises may disseminate...

  13. 9 CFR 95.28 - Hay or straw and similar material from tick-infested areas.

    Code of Federal Regulations, 2012 CFR

    2012-01-01

    ... tick-infested areas. 95.28 Section 95.28 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... THE UNITED STATES § 95.28 Hay or straw and similar material from tick-infested areas. Hay or straw, grass, or similar material from tick-infested pastures, ranges, or premises may disseminate...

  14. 9 CFR 95.28 - Hay or straw and similar material from tick-infested areas.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... tick-infested areas. 95.28 Section 95.28 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... THE UNITED STATES § 95.28 Hay or straw and similar material from tick-infested areas. Hay or straw, grass, or similar material from tick-infested pastures, ranges, or premises may disseminate...

  15. Variation in the Microbiota of Ixodes Ticks with Regard to Geography, Species, and Sex.

    PubMed

    Van Treuren, Will; Ponnusamy, Loganathan; Brinkerhoff, R Jory; Gonzalez, Antonio; Parobek, Christian M; Juliano, Jonathan J; Andreadis, Theodore G; Falco, Richard C; Ziegler, Lorenza Beati; Hathaway, Nicholas; Keeler, Corinna; Emch, Michael; Bailey, Jeffrey A; Roe, R Michael; Apperson, Charles S; Knight, Rob; Meshnick, Steven R

    2015-09-01

    Ixodes scapularis is the principal vector of Lyme disease on the East Coast and in the upper Midwest regions of the United States, yet the tick is also present in the Southeast, where Lyme disease is absent or rare. A closely related species, I. affinis, also carries the pathogen in the South but does not seem to transmit it to humans. In order to better understand the geographic diversity of the tick, we analyzed the microbiota of 104 adult I. scapularis and 13 adult I. affinis ticks captured in 19 locations in South Carolina, North Carolina, Virginia, Connecticut, and New York. Initially, ticks from 4 sites were analyzed by 454 pyrosequencing. Subsequently, ticks from these sites plus 15 others were analyzed by sequencing with an Illumina MiSeq machine. By both analyses, the microbiomes of female ticks were significantly less diverse than those of male ticks. The dissimilarity between tick microbiomes increased with distance between sites, and the state in which a tick was collected could be inferred from its microbiota. The genus Rickettsia was prominent in all locations. Borrelia was also present in most locations and was present at especially high levels in one site in western Virginia. In contrast, members of the family Enterobacteriaceae were very common in North Carolina I. scapularis ticks but uncommon in I. scapularis ticks from other sites and in North Carolina I. affinis ticks. These data suggest substantial variations in the Ixodes microbiota in association with geography, species, and sex.

  16. Ticks (Acari: Ixodidae) associated with wildlife and vegetation of Haller park along the Kenyan coastline.

    PubMed

    Wanzala, W; Okanga, S

    2006-09-01

    This artcile describes the results obtained from a tick survey conducted in Haller park along the Kenyan coastline. The survey aimed at evaluating tick-host associations, assessing tick population density, and providing baseline information for planning future tick control and management in the park. Ticks (2,968) were collected by handpicking from eight species of wildlife and by dragging in 14 selected sites within the park. A considerable proportion of ticks were also collected from leaves, stems, and bark of most dominant trees, namely, Casuarina equisetifolia L. (Forst. and Forst.), Cocos nucifera L., Adansonia digitata L., Musa paradisiaca L., and Azadiracta indica Adr. Juss. Dragging was conducted in sites predominantly occupied by Cynodon dactylon L. (Pers.), Cenchrus ciliaris L., Stenotaphrum dimidiatum L. (Kuntze.) Brongn., and Brachiaria xantholeuca Hack. Ex Schinz Stapf. and Loudetia kagerensis K. Schum. Hutch. Eight tick species were identified, and the collection included Rhipicephalus pravus Dönitz 1910, Rhipicephalus pulchellus Gerstäcker 1873, Hyalomma marginatum rufipes Koch 1844, Amblyomma gemma Dönitz 1910, Amblyomma hebraeum Koch 1844, Amblyomma sparsum Neumann 1899, Amblyomma nuttalli Dönitz 1909, and Boophilus decoloratus Koch 1844. Given that the identified tick species are known to parasitize humans as well as livestock, there exist risks of emergence of zoonotic infections mediated by tick vectors. In the recreational environment of Haller park, where tick vectors share habitats with hosts, there is a need to develop sustainable and effective tick control and management strategies to minimize economic losses that tick infestation may cause.

  17. Detection of Rickettsia helvetica in Ixodes ricinus ticks collected from Pyrenean chamois in France.

    PubMed

    Davoust, Bernard; Socolovschi, Cristina; Revelli, Paul; Gibert, Philippe; Marié, Jean-Lou; Raoult, Didier; Parola, Philippe

    2012-12-01

    Seventy-one Ixodes ricinus ticks collected from Pyrenean chamois (Rupicapra pyrenaica) in the French Pyrenees were tested by real-time polymerase chain reaction to detect the presence of Rickettsia and Bartonella. Four ticks (6%) were positive for R. helvetica. The chamois carries infected ticks, and this enables the dissemination throughout the environment with this bacterium, a potential human pathogen.

  18. Lone star tick (Acari: Ixodidae) occurrence in Nebraska: historical and current perspectives.

    PubMed

    Cortinas, R; Spomer, S

    2013-03-01

    In 2010 and 2011, field collections were undertaken to determine the geographic range of the lone star tick, Amblyomma americanum (L.), in Nebraska In addition, tick identifications from submissions by the general public dating to 1911 were examined. Consistent lone star tick identifications from extreme southeast Nebraska began in 1987. Specimens have been identified from 27 counties, making lone star ticks the second most frequently and second most widely reported tick in the state after Dermacentor variabilis (Say). Surveys conducted in 70 sites in 43 counties yielded 2,169 ticks of which 1,035 were lone star ticks. Lone star ticks were more frequent in the southeast portion of the state and ticks were found in nine counties from which there were no known submissions. Life stage peaks observed during the surveys corresponded with those observed from submissions. Other ticks, incidental to the study, were also collected. Woody plant expansion into the tallgrass prairie, white-tailed deer (Odocoileus virgianianus L.) and wild turkey (Meleagris gallopavo L.) population growth, and the increased frequency of milder winters may be facilitating lone star tick occurrence in the region. Further studies will assess lone star tick establishment and disease pathogen prevalence in the state.

  19. Protective Immunity Against Tick Infestation in Cattle Vaccinated with Recombinant Trypsin Inhibitor of Rhipicephalus Microplus

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The southern cattle fever tick, Rhipicephalus microplus, and the related cattle fever tick species, R. annulatus, collectively referred to herein as Cattle Fever Ticks (CFT), transmit Babesia bovis and B. bigemina, and Anaplasma marginale, that cause bovine babesiosis and anaplasmosis, respectively....

  20. 9 CFR 72.12 - Cattle; exposure to tick infestation after treatment or inspection prohibited.

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... 9 Animals and Animal Products 1 2011-01-01 2011-01-01 false Cattle; exposure to tick infestation... (INCLUDING POULTRY) AND ANIMAL PRODUCTS TEXAS (SPLENETIC) FEVER IN CATTLE § 72.12 Cattle; exposure to tick infestation after treatment or inspection prohibited. The cattle shall not be exposed to tick...

  1. 9 CFR 72.12 - Cattle; exposure to tick infestation after treatment or inspection prohibited.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... 9 Animals and Animal Products 1 2013-01-01 2013-01-01 false Cattle; exposure to tick infestation... (INCLUDING POULTRY) AND ANIMAL PRODUCTS TEXAS (SPLENETIC) FEVER IN CATTLE § 72.12 Cattle; exposure to tick infestation after treatment or inspection prohibited. The cattle shall not be exposed to tick...

  2. 9 CFR 72.12 - Cattle; exposure to tick infestation after treatment or inspection prohibited.

    Code of Federal Regulations, 2012 CFR

    2012-01-01

    ... 9 Animals and Animal Products 1 2012-01-01 2012-01-01 false Cattle; exposure to tick infestation... (INCLUDING POULTRY) AND ANIMAL PRODUCTS TEXAS (SPLENETIC) FEVER IN CATTLE § 72.12 Cattle; exposure to tick infestation after treatment or inspection prohibited. The cattle shall not be exposed to tick...

  3. 9 CFR 72.12 - Cattle; exposure to tick infestation after treatment or inspection prohibited.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... 9 Animals and Animal Products 1 2014-01-01 2014-01-01 false Cattle; exposure to tick infestation... (INCLUDING POULTRY) AND ANIMAL PRODUCTS BOVINE BABESIOSIS § 72.12 Cattle; exposure to tick infestation after treatment or inspection prohibited. The cattle shall not be exposed to tick infestation after treatment...

  4. Passive tick surveillance, dog seropositivity, and incidence of human Lyme disease

    USGS Publications Warehouse

    Johnson, J.L.; Ginsberg, H.S.; Zhioua, E.; Whitworth, U.G.; Markowski, D.; Hyland, K.E.; Hu, R.

    2004-01-01

    Data on nymphal Ixodes scapularis ticks submitted by the public to the University of Rhode Island Tick Research Laboratory for testing from 1991 to 2000 were compared with human case data from the Rhode Island Department of Health to determine the efficacy of passive tick surveillance at assessing human risk of Lyme disease. Numbers of ticks submitted were highly correlated with human cases by county (r = 0.998, n = 5 counties) and by town (r = 0.916, n = 37 towns), as were the numbers of positive ticks submitted (r = 0.989 by county, r = 0.787 by town). Human cases were correlated with ticks submitted by town each year, and with positive ticks in all but 2 years. Thus, passive tick surveillance effectively assessed geographical risk of human Lyme disease. In contrast, tick submissions through time were not correlated with human cases from year to year. Dog seropositivity was significantly correlated with human cases by county in both years tested, but by town in only one of two years. Numbers of ticks submitted were correlated with dog seropositivity by county but not by town, apparently because of high variability among towns with small sample sizes. Our results suggest that passive tick surveillance, using ticks submitted by the public for Lyme spirochete testing, can be used to assess the geographical distribution of Lyme disease risk, but cannot reliably predict Lyme incidence from year to year.

  5. Frequency and Distribution of Rickettsiae, Borreliae, and Ehrlichiae Detected in Human-Parasitizing Ticks, Texas, USA.

    PubMed

    Mitchell, Elizabeth A; Williamson, Phillip C; Billingsley, Peggy M; Seals, Janel P; Ferguson, Erin E; Allen, Michael S

    2016-02-01

    To describe the presence and distribution of tickborne bacteria and their vectors in Texas, USA, we screened ticks collected from humans during 2008-2014 for Rickettsia, Borrelia, and Ehrlichia spp. Thirteen tick species were identified, and 23% of ticks carried bacterial DNA from at least 1 of the 3 genera tested.

  6. Frequency and Distribution of Rickettsiae, Borreliae, and Ehrlichiae Detected in Human-Parasitizing Ticks, Texas, USA

    PubMed Central

    Mitchell, Elizabeth A.; Williamson, Phillip C.; Billingsley, Peggy M.; Seals, Janel P.; Ferguson, Erin E.

    2016-01-01

    To describe the presence and distribution of tickborne bacteria and their vectors in Texas, USA, we screened ticks collected from humans during 2008–2014 for Rickettsia, Borrelia, and Ehrlichia spp. Thirteen tick species were identified, and 23% of ticks carried bacterial DNA from at least 1 of the 3 genera tested. PMID:26811941

  7. Detection of rickettsial DNA in ticks and wild boars in Kyoto City, Japan

    PubMed Central

    SOMEYA, Azusa; ITO, Ryuki; MAEDA, Akihiko; IKENAGA, Mitsuhiro

    2014-01-01

    ABSTRACT The tick is a well-known vector for arthropod-borne pathogens, such as tick-borne encephalitis, Lyme disease, Japanese spotted fever and severe fever with thrombocytopenia syndrome. It is therefore important to know the tick population and distribution in our environment and wild animals in order to prevent tick-borne diseases. Here, we report the results of tick surveillance from May to September 2011 at 14 geographical points and in 5 wild boars in Kyoto City, Kyoto prefecture, Japan. We collected 3,198 ticks comprising 5 tick species, Haemaphysalis (H.) longicornis, H. flava, H. kitaokai, Amblyomma testudinarium and Dermacentor taiwanensis. Interestingly, the proportion of tick species varied according to geographical region within the city. The ticks collected in the city were reported as potential vectors of pathogens, such as rickettsiosis. We detected rickettsial DNA by PCR in 71.1% of 201 ticks investigated. The ticks that carried rickettsiae were distributed across the whole the city. The sequences of PCR-amplified DNA fragments were determined and showed similarities to spotted fever group rickettsiae. Although their pathogenicity for animals including humans is still unclear, it is important to stay alert and pay attention to tick-borne diseases in order to ensure the safety of the citizens of the city as well as that of visitors. PMID:25298315

  8. Variation in the Microbiota of Ixodes Ticks with Regard to Geography, Species, and Sex

    PubMed Central

    Van Treuren, Will; Ponnusamy, Loganathan; Brinkerhoff, R. Jory; Gonzalez, Antonio; Parobek, Christian M.; Juliano, Jonathan J.; Andreadis, Theodore G.; Falco, Richard C.; Ziegler, Lorenza Beati; Hathaway, Nicholas; Keeler, Corinna; Emch, Michael; Bailey, Jeffrey A.; Roe, R. Michael; Apperson, Charles S.; Knight, Rob

    2015-01-01

    Ixodes scapularis is the principal vector of Lyme disease on the East Coast and in the upper Midwest regions of the United States, yet the tick is also present in the Southeast, where Lyme disease is absent or rare. A closely related species, I. affinis, also carries the pathogen in the South but does not seem to transmit it to humans. In order to better understand the geographic diversity of the tick, we analyzed the microbiota of 104 adult I. scapularis and 13 adult I. affinis ticks captured in 19 locations in South Carolina, North Carolina, Virginia, Connecticut, and New York. Initially, ticks from 4 sites were analyzed by 454 pyrosequencing. Subsequently, ticks from these sites plus 15 others were analyzed by sequencing with an Illumina MiSeq machine. By both analyses, the microbiomes of female ticks were significantly less diverse than those of male ticks. The dissimilarity between tick microbiomes increased with distance between sites, and the state in which a tick was collected could be inferred from its microbiota. The genus Rickettsia was prominent in all locations. Borrelia was also present in most locations and was present at especially high levels in one site in western Virginia. In contrast, members of the family Enterobacteriaceae were very common in North Carolina I. scapularis ticks but uncommon in I. scapularis ticks from other sites and in North Carolina I. affinis ticks. These data suggest substantial variations in the Ixodes microbiota in association with geography, species, and sex. PMID:26150449

  9. Evaluation of four bed bug traps for surveillances of brown dog ticks (Acari: Ixodidae)

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The brown dog tick can be a serious residential pest due to its unique ability, among ticks, to complete its lifecycle indoors. A single engorged and fertilized female tick can oviposit around 4,000 eggs, allowing indoor establishment to be rapid and easy to miss in early-stage infestations. Acari...

  10. The first detection of the tick-borne encephalitis virus (TBEV) RNA in Dermacentor reticulatus ticks collected from the lowland European bison (Bison bonasus bonasus L.).

    PubMed

    Biernat, Beata; Karbowiak, Grzegorz; Stańczak, Joanna; Masny, Aleksander; Werszko, Joanna

    2016-01-01

    Tick borne encephalitis virus (TBEV) (Flaviviridae, Flavivirus) is the causative agent of tick-borne encephalitis (TBE), a potentially fatal neurological infection. The disease is endemic in a large region in Eurasia, where is transmitted mainly by hard ticks: Ixodes ricinus and I. persulcatus. It is known that also Dermacentor reticulatus is involved in a circulation of TBEV, but the knowledge of its importance in the TBE epidemiology is still insufficient. The Białowieża Primeval Forest is located in eastern Poland and it is a well-known endemic focus of tick-borne encephalitis. The aim of this study was to identify the prevalence of tick-borne encephalitis virus (TBEV) in Dermacentor reticulatus ticks collected from European bison (Bison bonasus bonasus), an important host of hard ticks in the Białowieża Primeval Forest. In the years 2008-2009, a total of 114 adult D. reticulatus ticks were collected from 7 European bison and examined individually for the presence of TBEV RNA using nested RT-PCR assay. Positive results were noted in 18.42% of ticks. This is the first record of TBEV infection in ticks collected from European bison. PMID:26751883

  11. The first detection of the tick-borne encephalitis virus (TBEV) RNA in Dermacentor reticulatus ticks collected from the lowland European bison (Bison bonasus bonasus L.).

    PubMed

    Biernat, Beata; Karbowiak, Grzegorz; Stańczak, Joanna; Masny, Aleksander; Werszko, Joanna

    2016-01-01

    Tick borne encephalitis virus (TBEV) (Flaviviridae, Flavivirus) is the causative agent of tick-borne encephalitis (TBE), a potentially fatal neurological infection. The disease is endemic in a large region in Eurasia, where is transmitted mainly by hard ticks: Ixodes ricinus and I. persulcatus. It is known that also Dermacentor reticulatus is involved in a circulation of TBEV, but the knowledge of its importance in the TBE epidemiology is still insufficient. The Białowieża Primeval Forest is located in eastern Poland and it is a well-known endemic focus of tick-borne encephalitis. The aim of this study was to identify the prevalence of tick-borne encephalitis virus (TBEV) in Dermacentor reticulatus ticks collected from European bison (Bison bonasus bonasus), an important host of hard ticks in the Białowieża Primeval Forest. In the years 2008-2009, a total of 114 adult D. reticulatus ticks were collected from 7 European bison and examined individually for the presence of TBEV RNA using nested RT-PCR assay. Positive results were noted in 18.42% of ticks. This is the first record of TBEV infection in ticks collected from European bison.

  12. Concurrent micro-RNA mediated silencing of tick-borne flavivirus replication in tick vector and in the brain of vertebrate host

    PubMed Central

    Tsetsarkin, Konstantin A.; Liu, Guangping; Kenney, Heather; Hermance, Meghan; Thangamani, Saravanan; Pletnev, Alexander G.

    2016-01-01

    Tick-borne viruses include medically important zoonotic pathogens that can cause life-threatening diseases. Unlike mosquito-borne viruses, whose impact can be restrained via mosquito population control programs, for tick-borne viruses only vaccination remains the reliable means of disease prevention. For live vaccine viruses a concern exists, that spillovers from viremic vaccinees could result in introduction of genetically modified viruses into sustainable tick-vertebrate host transmission cycle in nature. To restrict tick-borne flavivirus (Langat virus, LGTV) vector tropism, we inserted target sequences for tick-specific microRNAs (mir-1, mir-275 and mir-279) individually or in combination into several distant regions of LGTV genome. This caused selective attenuation of viral replication in tick-derived cells. LGTV expressing combinations of target sequences for tick- and vertebrate CNS-specific miRNAs were developed. The resulting viruses replicated efficiently and remained stable in simian Vero cells, which do not express these miRNAs, however were severely restricted to replicate in tick-derived cells. In addition, simultaneous dual miRNA targeting led to silencing of virus replication in live Ixodes ricinus ticks and abolished virus neurotropism in highly permissive newborn mice. The concurrent restriction of adverse replication events in vertebrate and invertebrate hosts will, therefore, ensure the environmental safety of live tick-borne virus vaccine candidates. PMID:27620807

  13. Concurrent micro-RNA mediated silencing of tick-borne flavivirus replication in tick vector and in the brain of vertebrate host.

    PubMed

    Tsetsarkin, Konstantin A; Liu, Guangping; Kenney, Heather; Hermance, Meghan; Thangamani, Saravanan; Pletnev, Alexander G

    2016-01-01

    Tick-borne viruses include medically important zoonotic pathogens that can cause life-threatening diseases. Unlike mosquito-borne viruses, whose impact can be restrained via mosquito population control programs, for tick-borne viruses only vaccination remains the reliable means of disease prevention. For live vaccine viruses a concern exists, that spillovers from viremic vaccinees could result in introduction of genetically modified viruses into sustainable tick-vertebrate host transmission cycle in nature. To restrict tick-borne flavivirus (Langat virus, LGTV) vector tropism, we inserted target sequences for tick-specific microRNAs (mir-1, mir-275 and mir-279) individually or in combination into several distant regions of LGTV genome. This caused selective attenuation of viral replication in tick-derived cells. LGTV expressing combinations of target sequences for tick- and vertebrate CNS-specific miRNAs were developed. The resulting viruses replicated efficiently and remained stable in simian Vero cells, which do not express these miRNAs, however were severely restricted to replicate in tick-derived cells. In addition, simultaneous dual miRNA targeting led to silencing of virus replication in live Ixodes ricinus ticks and abolished virus neurotropism in highly permissive newborn mice. The concurrent restriction of adverse replication events in vertebrate and invertebrate hosts will, therefore, ensure the environmental safety of live tick-borne virus vaccine candidates. PMID:27620807

  14. Evidence of the role of tick subolesin in gene expression

    PubMed Central

    de la Fuente, José; Maritz-Olivier, Christine; Naranjo, Victoria; Ayoubi, Patricia; Nijhof, Ard M; Almazán, Consuelo; Canales, Mario; de la Lastra, José M Pérez; Galindo, Ruth C; Blouin, Edmour F; Gortazar, Christian; Jongejan, Frans; Kocan, Katherine M

    2008-01-01

    Background Subolesin is an evolutionary conserved protein that was discovered recently in Ixodes scapularis as a tick protective antigen and has a role in tick blood digestion, reproduction and development. In other organisms, subolesin orthologs may be involved in the control of developmental processes. Because of the profound effect of subolesin knockdown in ticks and other organisms, we hypothesized that subolesin plays a role in gene expression, and therefore affects multiple cellular processes. The objective of this study was to provide evidence for the role of subolesin in gene expression. Results Two subolesin-interacting proteins were identified and characterized by yeast two-hybrid screen, co-affinity purification and RNA interference (RNAi). The effect of subolesin knockdown on the tick gene expression pattern was characterized by microarray analysis and demonstrated that subolesin RNAi affects the expression of genes involved in multiple cellular pathways. The analysis of subolesin and interacting protein sequences identified regulatory motifs and predicted the presence of conserved protein kinase C (PKC) phosphorylation sites. Conclusion Collectively, these results provide evidence that subolesin plays a role in gene expression in ticks. PMID:18673577

  15. Apparent tick paralysis by Rhipicephalus sanguineus (Acari: Ixodidae) in dogs.

    PubMed

    Otranto, Domenico; Dantas-Torres, Filipe; Tarallo, Viviana Domenica; Ramos, Rafael Antonio do Nascimento; Stanneck, Dorothee; Baneth, Gad; de Caprariis, Donato

    2012-09-10

    Certain tick species including Ixodes holocyclus can inoculate neurotoxins that induce a rapid, ascending flaccid paralysis in animals. Rhipicephalus sanguineus, the most widespread tick of dogs, is recognized as a vector of several pathogens causing diseases in dogs and humans. A single report suggests its role as cause of paralysis in dogs. This study presents the clinical history of 14 young dogs heavily infested by R. sanguineus (intensity of infestation, 63-328) in an endemic area of southern Italy. During May to June of 2011, dogs were presented at the clinical examination with neurological signs of different degrees (e.g., hind limb ataxia, generalized lethargy, and difficulty in movements). All animals were treated with acaricides and by manual tick removal but ten of them died within a day, displaying neurological signs. The other 4 dogs recovered within 3 days with acaricidal and supportive treatment. Twelve dogs were positive by blood smear examination for Hepatozoon canis with a high parasitemia, two also for Babesia vogeli and two were negative for hemoparasites. Low-grade thrombocytopenia, hypoalbuminemia, and pancytopenia were the haematological alterations most frequently recorded. Other causes of neurological disease in dogs were excluded and the diagnosis of tick paralysis by R. sanguineus was confirmed (ex juvantibus) by early and complete recovery of 4 dogs following acaricidal treatment and tick removal. PMID:22546547

  16. Acquisition of exogenous haem is essential for tick reproduction

    PubMed Central

    Perner, Jan; Sobotka, Roman; Sima, Radek; Konvickova, Jitka; Sojka, Daniel; de Oliveira, Pedro Lagerblad; Hajdusek, Ondrej; Kopacek, Petr

    2016-01-01

    Haem and iron homeostasis in most eukaryotic cells is based on a balanced flux between haem biosynthesis and haem oxygenase-mediated degradation. Unlike most eukaryotes, ticks possess an incomplete haem biosynthetic pathway and, together with other (non-haematophagous) mites, lack a gene encoding haem oxygenase. We demonstrated, by membrane feeding, that ticks do not acquire bioavailable iron from haemoglobin-derived haem. However, ticks require dietary haemoglobin as an exogenous source of haem since, feeding with haemoglobin-depleted serum led to aborted embryogenesis. Supplementation of serum with haemoglobin fully restored egg fertility. Surprisingly, haemoglobin could be completely substituted by serum proteins for the provision of amino-acids in vitellogenesis. Acquired haem is distributed by haemolymph carrier protein(s) and sequestered by vitellins in the developing oocytes. This work extends, substantially, current knowledge of haem auxotrophy in ticks and underscores the importance of haem and iron metabolism as rational targets for anti-tick interventions. DOI: http://dx.doi.org/10.7554/eLife.12318.001 PMID:26949258

  17. Rickettsial infections in ticks from wild birds in Paraguay.

    PubMed

    Ogrzewalska, Maria; Literak, Ivan; Martins, Thiago F; Labruna, Marcelo B

    2014-03-01

    Ticks were collected from wild birds at 3 locations in Paraguay during the South American winter in August and September 2012. In total, 480 birds belonging to 106 species were examined. Overall, 31 (6.5%) birds representing 21 species were found parasitized by ticks which were identified as Amblyomma calcaratum Neumann (2 larvae, 20 nymphs), Amblyomma longirostre (Koch) (17 larvae, 3 nymphs), Amblyomma parvum Aragão (7 nymphs), Amblyomma aureolatum (Pallas) (1 nymph), Amblyomma ovale Koch (1 nymph), Amblyomma tigrinum Koch (1 larva), and Amblyomma spp. (4 larvae). Ticks collected accidentally on humans at the study locations during field work included 1 nymph of Amblyomma coelebs Neumann and 54 nymphs of Amblyomma cajennense (Fabricius). Most ticks were individually tested for the presence of Rickettsia species by polymerase chain reaction targeting rickettsial genes gltA and ompA and by amplicon sequencing. Two (12%) out of 17 A. longirostre larvae were found infected with Candidatus 'Rickettsia amblyommii', and 2 (33%) out of 6 A. parvum nymphs were infected with Candidatus 'Rickettsia andeanae'. This study provides the first report of rickettsial infections in Paraguayan ticks.

  18. Insight into tick biocontrol with special regard to fungi.

    PubMed

    Lonc, Elżbieta; Guz-Regner, Katarzyna; Kiewra, Dorota; Szczepańska, Anna

    2014-01-01

    The epidemiological and epizootic importance of ticks has been known for a few decades since of the discovery of their role as vectors of many new diseases, and the better detection of those already known. Given the durability of chemical preparations in the environment and the increasing problem of developing tick resistance, natural strategies for biological control are sought. A promising alternative to chemical pesticides is the use of entomopathogenic organisms for effective integrated pest management of low environmental impact. A number of promising microbes have been identified during the search for effective means of controlling the tick population, but the knowledge about the impact of these pathogens on the environment and other non-target organisms is still insufficient. Previous research has still not provided a definite answer about the safety of their use. It is known, however,that the chemicals which are currently used have a negative impact on the environment and/or cause resistance. No efficient biocompound has yet been devised for commercial use. Potential microorganisms for tick biocontrol (mainly bacteria and fungi) are natural tick pathogens, living in the same environment. With their adhesive properties, and their ability to digest the cuticle, they may constitute an appropriate ingredient of bioacaricides. Until now, fungal insecticides have been used only to control crop pests. PMID:25281814

  19. Tick-borne infections in human and animal population worldwide

    PubMed Central

    Brites-Neto, José; Duarte, Keila Maria Roncato; Martins, Thiago Fernandes

    2015-01-01

    The abundance and activity of ectoparasites and its hosts are affected by various abiotic factors, such as climate and other organisms (predators, pathogens and competitors) presenting thus multiples forms of association (obligate to facultative, permanent to intermittent and superficial to subcutaneous) developed during long co-evolving processes. Ticks are ectoparasites widespread globally and its eco epidemiology are closely related to the environmental conditions. They are obligatory hematophagous ectoparasites and responsible as vectors or reservoirs at the transmission of pathogenic fungi, protozoa, viruses, rickettsia and others bacteria during their feeding process on the hosts. Ticks constitute the second vector group that transmit the major number of pathogens to humans and play a role primary for animals in the process of diseases transmission. Many studies on bioecology of ticks, considering the information related to their population dynamics, to the host and the environment, comes possible the application and efficiency of tick control measures in the prevention programs of vector-borne diseases. In this review were considered some taxonomic, morphological, epidemiological and clinical fundamental aspects related to the tick-borne infections that affect human and animal populations. PMID:27047089

  20. [En route in Switzerland - tick-borne and hantavirus infections].

    PubMed

    Schmid, Sabine; Aliyev, Eldar; Engler, Olivier; Mütsch, Margot

    2013-06-01

    Tick-borne infections are endemic in Switzerland with borreliosis being the most frequent one, followed by the vaccine-preventable tick-borne encephalitis and more rarely by anaplasmosis, rickettsioses and babesiosis. Short characteristics of these infections are presented. The main preventive measures for stays in endemic regions include not leaving forest tracks and wearing closely fitted clothes and shoes, impregnated with an insecticide. Following at-risk activities, clothes as well as the body should be searched for ticks and they have to be removed using a tick removing tool. The body area of the tick bite has to be observed and a physician visit is strongly urged in case of rising fever and/or of erythema migrans. Hantavirus infections: Nephropathia epidemica is a zoonosis caused by the Puumala type of hantavirus and transmission occurs by inhaling aerolized excretions of the bank vole. There is no known human to human transmission. The incidence of this infection varies in a cyclic fashion and typical clinical symptoms include sudden onset of fever, headache, abdominal and back pain and transient renal impairment with initial oliguria and later polyuria. At-risk activities include camping and cleaning of rodent infestations. In these cases, face masks should be worn and the excretions be moistened before cleaning is started. In Germany, 2 - 3 years-cycles of outbreaks were observed between 2005 and 2012 with regional clusters approaching Switzerland. Therefore, disease awareness of physicians and infection surveillance are essential.

  1. Coxiella burnetii in Humans and Ticks in Rural Senegal

    PubMed Central

    Mediannikov, Oleg; Fenollar, Florence; Socolovschi, Cristina; Diatta, Georges; Bassene, Hubert; Molez, Jean-François; Sokhna, Cheikh; Trape, Jean-François; Raoult, Didier

    2010-01-01

    Background Q fever is a worldwide zoonotic disease caused by Coxiella burnetii. Epidemiologically, animals are considered reservoirs and humans incidental hosts. Methodology/Principal Findings We investigated Q fever in rural Senegal. Human samples (e.g., sera, saliva, breast milk, feces) were screened in the generally healthy population of two villages of the Sine-Saloum region. Ticks were collected in four regions. Seroprevalence was studied by immunofluorescence, and all other samples were tested by two qPCR systems for detection of C. burnetii. Positive samples were genotyped (multispacer typing) by amplification and sequencing of three spacers. Strains were isolated by cell culture. We found that the seroprevalence may be as high as 24.5% (59 of 238 studied) in Dielmo village. We identified spontaneous excretion of C. burnetii by humans through faeces and milk. Hard and soft ticks (8 species) were infected in 0–37.6%. We identified three genotypes of C. burnetii. The previously identified genotype 6 was the most common in ticks in all studied regions and the only one found in human samples. Three strains of genotype 6 of C. burnetii were also recovered from soft tick Ornithodoros sonrai. Two other genotypes found in ticks, 35 and 36, were identified for the first time. Conclusions/Significance Q fever should be considered a significant public health threat in Senegal. Humans, similar to other mammals, may continuously excrete C. burnetii. PMID:20386603

  2. Management of tick bites and lyme disease during pregnancy.

    PubMed

    Smith, Graeme N; Gemmill, Ian; Moore, Kieran M

    2012-11-01

    Lyme disease results from the bite of a black-legged tick, populations of which have now become established in parts of Nova Scotia, southeastern Quebec, southern Ontario from the Thousand Islands through the geographic regions on the north shore of Lake Ontario and Lake Erie, southeastern Manitoba, and British Columbia's Lower Mainland, Fraser Valley, and Vancouver Island. It takes more than 24 hours of attachment to transfer the spirochete Borrelia burgdorferi to the bitten animal or human. The diagnosis of Lyme disease is primarily clinical, with early Lyme disease characterized by a skin lesion (erythema migrans, a bull's-eye rash), which expands out from the site of the tick bite, and is often accompanied by influenza-like symptoms, arthralgia, myalgia, and fever. These signs and symptoms can present anywhere from three to 30 days after the tick bite. The management of pregnant women with a tick bite or suspected Lyme disease should be similar to that of non-pregnant adults, except that doxycyline, the first line antibiotic of choice, should not be used in pregnant women because of risk of permanent tooth discolouration and possible impact on bone formation in the fetus. An algorithm for the management of tick bites in pregnancy is presented. Clinical, serological, and epidemiological studies have all failed to demonstrate a causal association between infection with B. burgdorferi and any adverse pregnancy outcomes regardless of whether maternal exposure occurs before conception or during pregnancy itself.

  3. Apparent tick paralysis by Rhipicephalus sanguineus (Acari: Ixodidae) in dogs.

    PubMed

    Otranto, Domenico; Dantas-Torres, Filipe; Tarallo, Viviana Domenica; Ramos, Rafael Antonio do Nascimento; Stanneck, Dorothee; Baneth, Gad; de Caprariis, Donato

    2012-09-10

    Certain tick species including Ixodes holocyclus can inoculate neurotoxins that induce a rapid, ascending flaccid paralysis in animals. Rhipicephalus sanguineus, the most widespread tick of dogs, is recognized as a vector of several pathogens causing diseases in dogs and humans. A single report suggests its role as cause of paralysis in dogs. This study presents the clinical history of 14 young dogs heavily infested by R. sanguineus (intensity of infestation, 63-328) in an endemic area of southern Italy. During May to June of 2011, dogs were presented at the clinical examination with neurological signs of different degrees (e.g., hind limb ataxia, generalized lethargy, and difficulty in movements). All animals were treated with acaricides and by manual tick removal but ten of them died within a day, displaying neurological signs. The other 4 dogs recovered within 3 days with acaricidal and supportive treatment. Twelve dogs were positive by blood smear examination for Hepatozoon canis with a high parasitemia, two also for Babesia vogeli and two were negative for hemoparasites. Low-grade thrombocytopenia, hypoalbuminemia, and pancytopenia were the haematological alterations most frequently recorded. Other causes of neurological disease in dogs were excluded and the diagnosis of tick paralysis by R. sanguineus was confirmed (ex juvantibus) by early and complete recovery of 4 dogs following acaricidal treatment and tick removal.

  4. Tick holocyclotoxins trigger host paralysis by presynaptic inhibition

    PubMed Central

    Chand, Kirat K.; Lee, Kah Meng; Lavidis, Nickolas A.; Rodriguez-Valle, Manuel; Ijaz, Hina; Koehbach, Johannes; Clark, Richard J.; Lew-Tabor, Ala; Noakes, Peter G.

    2016-01-01

    Ticks are important vectors of pathogens and secreted neurotoxins with approximately 69 out of 692 tick species having the ability to induce severe toxicoses in their hosts. The Australian paralysis tick (Ixodes holocyclus) is known to be one of the most virulent tick species producing a flaccid paralysis and fatalities caused by a family of neurotoxins known as holocyclotoxins (HTs). The paralysis mechanism of these toxins is temperature dependent and is thought to involve inhibition of acetylcholine levels at the neuromuscular junction. However, the target and mechanism of this inhibition remain uncharacterised. Here, we report that three members of the holocyclotoxin family; HT-1 (GenBank AY766147), HT-3 (GenBank KP096303) and HT-12 (GenBank KP963967) induce muscle paralysis by inhibiting the dependence of transmitter release on extracellular calcium. Previous study was conducted using extracts from tick salivary glands, while the present study is the first to use pure toxins from I. holocyclus. Our findings provide greater insight into the mechanisms by which these toxins act to induce paralysis. PMID:27389875

  5. 7 CFR 15b.6 - Designation of responsible employee and adoption of grievance procedures.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... 7 Agriculture 1 2014-01-01 2014-01-01 false Designation of responsible employee and adoption of... Provisions § 15b.6 Designation of responsible employee and adoption of grievance procedures. (a) Designation... one person to coordinate its efforts to comply with this part. (b) Adoption of grievance procedures....

  6. 7 CFR 15b.6 - Designation of responsible employee and adoption of grievance procedures.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... 7 Agriculture 1 2010-01-01 2010-01-01 false Designation of responsible employee and adoption of... Provisions § 15b.6 Designation of responsible employee and adoption of grievance procedures. (a) Designation... one person to coordinate its efforts to comply with this part. (b) Adoption of grievance procedures....

  7. Enhancing Employee Skills.

    ERIC Educational Resources Information Center

    1999

    This document contains four symposium papers on enhancing employee skills. "The Effect of Study Skills Training Intervention on United States Air Force Aeromedical Apprentices" (John C. Griffith) demonstrates how study skills intervention resulted in a significant increase in the end-of-course scores of a sample of 90 randomly selected Air Force…

  8. Assessing Employee Skills.

    ERIC Educational Resources Information Center

    1997

    This document contains four papers from a symposium on assessing employee skills. "Bridging the Training Gap: Identifying Work Place Transferable Skills Needs in Manufacturing Organizations in East Central Minnesota" (K. Peter Kuchinke, James M. Brown, Howie Anderson, Joe Hobson) reports a study of a workplace education program in rural Minnesota…

  9. Managing Employee Assistance Programmes.

    ERIC Educational Resources Information Center

    Schmidenberg, Olive C.; Cordery, John L.

    1990-01-01

    Interviews with 20 branch managers and 20 accountants in an Australian bank determined factors influencing the success of an employee assistance program (EAP). It was found that policies requiring supervisors to act against normal managerial practice doom EAPs to failure. Organizational analysis to integrate the EAP within existing organizational…

  10. Employee Communication: A Bibliography.

    ERIC Educational Resources Information Center

    Balachandran, Sarojini

    This partially annotated bibliography of several hundred items includes material published since 1965. Entries are listed alphabetically by author. The following subject headings were used in the literature search for this bibliography: communication in management, communication in personnel management, reports to employees, attitude surveys,…

  11. Employees on the Move!

    ERIC Educational Resources Information Center

    Levin, Sarah

    This paper describes a method for designing, implementing, and evaluating a work-site physical activity campaign aimed at employees who are currently sedentary in their leisure time. Inactivity is a major but modifiable risk factor for coronary heart disease. Increasing the activity levels of underactive adults would have a positive impact on…

  12. The NOW Employee.

    ERIC Educational Resources Information Center

    Nadler, David

    The focus of this book is the relationship between the new generation of young people and the world of work. Basically the NOW (New Orientation to Work) employee views work as a means of self-actualization instead of merely a vehicle to economic security. The group under discussion is composed of those persons born between 1944 and 1951 who have…

  13. Coaching and counseling employees.

    PubMed

    Herakovic, J

    1992-01-01

    "To be effective, coaches need to exercise different forms of power," writes Dr. Herakovic in lesson two of his correspondence course on coaching and counseling employees. According to the professor, power has five forms: reward, coercive, legitimate, referent (charismatic) and expert power. He defines the five types of power and describes the uses and abuses of each type.

  14. Comparative population genetics of two invading ticks: evidence of the ecological mechanisms underlying tick range expansions

    PubMed Central

    Nadolny, Robyn; Gaff, Holly; Carlsson, Jens; Gauthier, David

    2015-01-01

    Two species of ixodid tick, Ixodes affinis Neumann and Amblyomma maculatum Koch, are simultaneously expanding their ranges throughout the mid-Atlantic region of the US. Although we have some understanding of the ecology and life history of these species, the ecological mechanisms governing where and how new populations establish and persist are unclear. To assess population connectivity and ancestry, we sequenced a fragment of the 16S mitochondrial rRNA gene from a representative sample of individuals of both species from populations throughout the eastern US. We found that despite overlapping host preferences throughout ontogeny, each species exhibited very different genetic and geographic patterns of population establishment and connectivity. Ixodes affinis was of two distinct mitochondrial clades, with a clear geographic break separating northern and southern populations. Both I. affinis populations showed evidence of recent expansion, although the southern population was more genetically diverse, indicating a longer history of establishment. Amblyomma maculatum exhibited diverse haplotypes that showed no significant relationship with geographic patterns and little apparent connectivity between sites. Heteroplasmy was also observed in the 16S mitochondrial rRNA gene in 3.5% of A. maculatum individuals. Genetic evidence suggests that these species rely on different key life stages to successfully disperse into novel environments, and that host vagility, habitat stability and habitat connectivity all play critical roles in the establishment of new tick populations. PMID:26254575

  15. Agriculture Education. Agricultural Metal Working.

    ERIC Educational Resources Information Center

    Stuttgart Public Schools, AR.

    This curriculum guide is designed for group instruction of secondary agricultural education students enrolled in one or two semester-long courses in agricultural metal working. The guide presents units of study in the following areas: (1) oxyacetylene welding, (2) arc welding, (3) sheet metal, (4) blueprint reading for welders and (5) job…

  16. 26 CFR 31.6011(b)-2 - Employees' account numbers.

    Code of Federal Regulations, 2014 CFR

    2014-04-01

    ..., present address, date and place of birth, father's full name, mother's full name before marriage, and the... known address, date and place of birth, father's full name, mother's full name before marriage, the... employee's services for the employer consist solely of agricultural labor, domestic service in a...

  17. 26 CFR 31.6011(b)-2 - Employees' account numbers.

    Code of Federal Regulations, 2012 CFR

    2012-04-01

    ..., present address, date and place of birth, father's full name, mother's full name before marriage, and the... known address, date and place of birth, father's full name, mother's full name before marriage, the... employee's services for the employer consist solely of agricultural labor, domestic service in a...

  18. 26 CFR 31.6011(b)-2 - Employees' account numbers.

    Code of Federal Regulations, 2013 CFR

    2013-04-01

    ..., present address, date and place of birth, father's full name, mother's full name before marriage, and the... known address, date and place of birth, father's full name, mother's full name before marriage, the... employee's services for the employer consist solely of agricultural labor, domestic service in a...

  19. 9 CFR 307.1 - Facilities for Program employees.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... AGRICULTURE AGENCY ORGANIZATION AND TERMINOLOGY; MANDATORY MEAT AND POULTRY PRODUCTS INSPECTION AND VOLUNTARY... protection and storage of Program supplies and with facilities suitable for Program employees to change clothing if such clothes changing facilities are deemed necessary by the circuit supervisor. At...

  20. 28 CFR 64.2 - Designated officers and employees.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... Service System. (i) Employees of the Department of Agriculture at the State, district or county level... military police officers, (2) Have been assigned to guard and protect property of the United States, or... Wildlife Service who are participating in sea lamprey control operations; (r) Uniformed and...

  1. 28 CFR 64.2 - Designated officers and employees.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... Service System. (i) Employees of the Department of Agriculture at the State, district or county level... military police officers, (2) Have been assigned to guard and protect property of the United States, or... Wildlife Service who are participating in sea lamprey control operations; (r) Uniformed and...

  2. 28 CFR 64.2 - Designated officers and employees.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... Service System. (i) Employees of the Department of Agriculture at the State, district or county level... military police officers, (2) Have been assigned to guard and protect property of the United States, or... Wildlife Service who are participating in sea lamprey control operations; (r) Uniformed and...

  3. 28 CFR 64.2 - Designated officers and employees.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... Service System. (i) Employees of the Department of Agriculture at the State, district or county level... military police officers, (2) Have been assigned to guard and protect property of the United States, or... Wildlife Service who are participating in sea lamprey control operations; (r) Uniformed and...

  4. 28 CFR 64.2 - Designated officers and employees.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... Service System. (i) Employees of the Department of Agriculture at the State, district or county level... military police officers, (2) Have been assigned to guard and protect property of the United States, or... Wildlife Service who are participating in sea lamprey control operations; (r) Uniformed and...

  5. 29 CFR 780.303 - Exemption applicable on employee basis.

    Code of Federal Regulations, 2012 CFR

    2012-07-01

    ... Employment in Agriculture That Is Exempted From the Minimum Wage and Overtime Pay Requirements Under Section... 29 Labor 3 2012-07-01 2012-07-01 false Exemption applicable on employee basis. 780.303 Section 780.303 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF...

  6. 29 CFR 780.303 - Exemption applicable on employee basis.

    Code of Federal Regulations, 2013 CFR

    2013-07-01

    ... Employment in Agriculture That Is Exempted From the Minimum Wage and Overtime Pay Requirements Under Section... 29 Labor 3 2013-07-01 2013-07-01 false Exemption applicable on employee basis. 780.303 Section 780.303 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF...

  7. 29 CFR 780.303 - Exemption applicable on employee basis.

    Code of Federal Regulations, 2010 CFR

    2010-07-01

    ... Employment in Agriculture That Is Exempted From the Minimum Wage and Overtime Pay Requirements Under Section... 29 Labor 3 2010-07-01 2010-07-01 false Exemption applicable on employee basis. 780.303 Section 780.303 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF...

  8. 29 CFR 780.303 - Exemption applicable on employee basis.

    Code of Federal Regulations, 2014 CFR

    2014-07-01

    ... Employment in Agriculture That Is Exempted From the Minimum Wage and Overtime Pay Requirements Under Section... 29 Labor 3 2014-07-01 2014-07-01 false Exemption applicable on employee basis. 780.303 Section 780.303 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF...

  9. 29 CFR 780.303 - Exemption applicable on employee basis.

    Code of Federal Regulations, 2011 CFR

    2011-07-01

    ... Employment in Agriculture That Is Exempted From the Minimum Wage and Overtime Pay Requirements Under Section... 29 Labor 3 2011-07-01 2011-07-01 false Exemption applicable on employee basis. 780.303 Section 780.303 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF...

  10. 26 CFR 1.1402(c)-3 - Employees.

    Code of Federal Regulations, 2010 CFR

    2010-04-01

    ... Health, Education, and Welfare pursuant to section 218 of the Social Security Act at the time a fee is... performance of service by an individual as an employee, as defined in the Federal Insurance Contributions Act...-bearing animals and wildlife) on such land, (2) The agricultural or horticultural commodities produced...

  11. 9 CFR 3.108 - Employees or attendants.

    Code of Federal Regulations, 2014 CFR

    2014-01-01

    ... 9 Animals and Animal Products 1 2014-01-01 2014-01-01 false Employees or attendants. 3.108 Section 3.108 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE STANDARDS Specifications for the Humane Handling, Care, Treatment,...

  12. 9 CFR 3.108 - Employees or attendants.

    Code of Federal Regulations, 2010 CFR

    2010-01-01

    ... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Employees or attendants. 3.108 Section 3.108 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE STANDARDS Specifications for the Humane Handling, Care, Treatment,...

  13. 9 CFR 3.108 - Employees or attendants.

    Code of Federal Regulations, 2012 CFR

    2012-01-01

    ... 9 Animals and Animal Products 1 2012-01-01 2012-01-01 false Employees or attendants. 3.108 Section 3.108 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE STANDARDS Specifications for the Humane Handling, Care, Treatment,...

  14. 9 CFR 3.108 - Employees or attendants.

    Code of Federal Regulations, 2011 CFR

    2011-01-01

    ... 9 Animals and Animal Products 1 2011-01-01 2011-01-01 false Employees or attendants. 3.108 Section 3.108 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE STANDARDS Specifications for the Humane Handling, Care, Treatment,...

  15. 9 CFR 3.108 - Employees or attendants.

    Code of Federal Regulations, 2013 CFR

    2013-01-01

    ... 9 Animals and Animal Products 1 2013-01-01 2013-01-01 false Employees or attendants. 3.108 Section 3.108 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL WELFARE STANDARDS Specifications for the Humane Handling, Care, Treatment,...

  16. Employee Perceptions of Quality Management: Effects of Employee Orientation Training

    ERIC Educational Resources Information Center

    Akdere, Mesut; Schmidt, Steven W.

    2008-01-01

    This empirical study examines employee perceptions of quality management at three different time periods. New employees at a large United States manufacturing organization were surveyed regarding their perceptions of their organization's quality management practices before they attended a new employee orientation training, immediately after the…

  17. Ticks collected from migratory birds, including a new record of Haemaphysalis formosensis, on Jeju Island, Korea.

    PubMed

    Choi, Chang-Yong; Kang, Chang-Wan; Kim, Eun-Mi; Lee, Sang; Moon, Kyoung-Ha; Oh, Mi-Rae; Yamauchi, Takeo; Yun, Young-Min

    2014-04-01

    Migratory birds may disperse parasites across ecological barriers, and recent climate change may alter the pattern of ectoparasite dispersal via changed patterns of bird migration. In order to document the parasitization of migratory birds by Ixodidae ticks on Jeju Island in Korea, we examined 934 migratory birds comprising 75 species for ticks from 2010 to 2012. In total, 313 ticks were collected from 74 migratory birds across 17 avian species and identified based on morphological keys. These ticks represented six species: Haemaphysalis flava, H. formosensis, H. longicornis, H. concinna, Ixodes turdus and I. nipponensis. Of particular note was the presence of H. formosensis, a species not previously reported to have been found in Korea, and H. concinna, which had not been previously reported on Jeju Island. The dominant tick species found were H. flava (226 ticks, 72.2 %) and I. turdus (54 ticks, 17.3 %), and ground-dwelling thrushes such as Pale thrushes (Turdus pallidus; 39 birds, 52.7 %) were the most important hosts. Although H. longicornis is the most abundant and prevalent terrestrial tick on Jeju Island, the species accounted for only 3.8 % of the total ticks collected in this study, suggesting that ticks on migratory birds may differ from the local tick fauna and that exotic ticks may be introduced via migratory birds. Therefore, long-term programs for tick and tick-borne disease surveillance are recommended to understand the role of migratory animals in the introduction of exotic species and associated pathogens and in life cycles of ticks at different stages in this region. PMID:24141529

  18. Ticks collected from migratory birds, including a new record of Haemaphysalis formosensis, on Jeju Island, Korea.

    PubMed

    Choi, Chang-Yong; Kang, Chang-Wan; Kim, Eun-Mi; Lee, Sang; Moon, Kyoung-Ha; Oh, Mi-Rae; Yamauchi, Takeo; Yun, Young-Min

    2014-04-01

    Migratory birds may disperse parasites across ecological barriers, and recent climate change may alter the pattern of ectoparasite dispersal via changed patterns of bird migration. In order to document the parasitization of migratory birds by Ixodidae ticks on Jeju Island in Korea, we examined 934 migratory birds comprising 75 species for ticks from 2010 to 2012. In total, 313 ticks were collected from 74 migratory birds across 17 avian species and identified based on morphological keys. These ticks represented six species: Haemaphysalis flava, H. formosensis, H. longicornis, H. concinna, Ixodes turdus and I. nipponensis. Of particular note was the presence of H. formosensis, a species not previously reported to have been found in Korea, and H. concinna, which had not been previously reported on Jeju Island. The dominant tick species found were H. flava (226 ticks, 72.2 %) and I. turdus (54 ticks, 17.3 %), and ground-dwelling thrushes such as Pale thrushes (Turdus pallidus; 39 birds, 52.7 %) were the most important hosts. Although H. longicornis is the most abundant and prevalent terrestrial tick on Jeju Island, the species accounted for only 3.8 % of the total ticks collected in this study, suggesting that ticks on migratory birds may differ from the local tick fauna and that exotic ticks may be introduced via migratory birds. Therefore, long-term programs for tick and tick-borne disease surveillance are recommended to understand the role of migratory animals in the introduction of exotic species and associated pathogens and in life cycles of ticks at different stages in this region.

  19. Tick pests and vectors (Acari: Ixodoidea) in European towns: Introduction, persistence and management.

    PubMed

    Uspensky, Igor

    2014-02-01

    Ticks have always been a part of fauna in and around human settlements, and their significance changed concurrently with the enlargement of settlements and their transformation into towns. The increased rate of urbanization during the last decades has created a new reality for tick existence. Two groups of ticks are of major concern for modern towns: those living under natural conditions of urban surroundings and those well-adapted to urban conditions. During the process of urbanization, encroachment into forested and uncultivated areas as well as protection of existing green spaces create opportunities for ticks living in nature to also exist under urban and suburban conditions. Conditions of modern urban and especially suburban environment in developed European countries adequately meet tick requirements. Tick species having an advantage in urban areas are those that can use one and the same host at all parasitic stages, can starve for a prolonged time, can use either urban pests or domesticated animals as hosts, and can live in man-made buildings. The ticks of the Argas reflexus group (Argasidae) and the brown dog tick Rhipicephalus sanguineus (Ixodidae) comply with practically all conditions necessary for successful survival in urban areas. The ability of ticks to transmit numerous human and animal pathogens and the presence of many reservoir hosts in urban and suburban areas create persistent danger for human populations and domestic animals. Impact on urban ticks should be directed against the two major requirements of tick existence: reducing populations of potential tick hosts (feral pigeons, stray dogs and cats, and urban rodents), and changing other environmental conditions to make them less suitable for ticks. It is especially important that urban inhabitants be properly informed about the danger posed by ticks, the sites of possible tick attacks, and basic self-protection techniques.

  20. Pyrosequencing and characterization of immune response genes from the American dog tick, Dermacentor variabilis (L.).

    PubMed

    Jaworski, D C; Zou, Z; Bowen, C J; Wasala, N B; Madden, R; Wang, Y; Kocan, K M; Jiang, H; Dillwith, J W

    2010-10-01

    Ticks continue to be a threat to animal and human health, and new and novel control strategies are needed for ticks and tick-borne pathogens. The characterization of the tick-pathogen interface and the tick immune response to microbial infections is fundamental toward the formulation of new control strategies for ticks and the pathogens they transmit. Our overall hypothesis for this research is that the tick immune system manages the maintenance of pathogens. Therefore, discovery of tick immune response genes may provide targets for novel control strategies directed toward reducing vector competency and pathogen transmission. In these studies, 454 pyrosequencing, a high-throughput genomic sequencing method was used to discover tick genes expressed in response to bacterial and fungal infections. Expressed sequence tags (ESTs) were analysed from Dermacentor variabilis ticks that had been injected with bacteria (Escherichia coli, Bacillus subtilis, Micrococcus luteus) or fungi (Saccharomyces cerevisiae and Candida albicans) and ticks that were naturally infected with the intracellular bacterium, Anaplasma marginale. By this approach, ESTs were assembled into 5995 contigs. Contigs fell into the five main functional categories of metabolism, genetic information processing, environmental information processing, cellular processes and human diseases. We identified more than 30 genes that are likely to encode for proteins involved in tick immune function. We further analysed by reverse transcriptase PCR (RT-PCR) the expression of 22 of these genes in each of our bacterial or fungal treatment groups and found that seven were up-regulated. Up-regulation of these seven genes was confirmed for bacterial, but not fungal treatment by quantitative PCR (qPCR). One of these products was novel, encoding a new tick defensin. Our results clearly demonstrate the complexities of the tick immune system and mark new directions for further study and characterization of proteins that

  1. Host surveys, ixodid tick biology and transmission scenarios as related to the tick-borne pathogen, Ehrlichia canis

    PubMed Central

    Stich, R. W.; Schaefer, John J.; Bremer, William G.; Needham, Glen R.; Jittapalapong, Sathaporn

    2008-01-01

    The ehrlichioses have been subject to increasing interest from veterinary and public health perspectives, but experimental studies of these diseases and their etiologic agents can be challenging. Ehrlichia canis, the primary etiologic agent of canine monocytic ehrlichiosis, is relatively well characterized and offers unique advantages and opportunities to study interactions between a monocytotropic pathogen and both its vertebrate and invertebrate hosts. Historically, advances in tick-borne disease control strategies have typically followed explication of tick-pathogen-vertebrate interactions, thus it is reasonable to expect novel, more sustainable approaches to control of these diseases as the transmission of their associated infections are investigated at the molecular through ecological levels. Better understanding of the interactions between E. canis and its canine and tick hosts would also elucidate similar interactions for other Ehrlichia species as well as the potential roles of canine sentinels, reservoirs and models of tick-borne zoonoses. This article summarizes natural exposure studies and experimental investigations of E. canis in the context of what is understood about biological vectors of tick-borne Anaplasmataceae. PMID:18963493

  2. Ethnoecological knowledge of ticks and treatment of tick-borne diseases among Maasai people in Northern Tanzania

    PubMed Central

    Kioko, John; Baker, Julia; Shannon, Avery; Kiffner, Christian

    2015-01-01

    Aim: The aim of this study was to understand traditional knowledge of tick ecology and remedies for tick-borne diseases (TBDs) among the Maasai people in northern Tanzania. Materials and Methods: Semi-structured interviews were conducted among specific groups likely to be knowledgeable about tick ecology and TBDs in livestock among the Maasai people. Results: A total of 25 plant species belonging to 18 families were used to treat 8 different TBDs of livestock. Most of the plant species used were of Fabaceae and Burseraceae families. Aloe volkensii, Cissus grandifolia, and Terminalia brownii were the most commonly used plant species. The major plant growth form used was trees, while stems and bark were the main plant parts used. Most treatments were taken orally. Conclusion: Maasai people have substantial knowledge on tick ecology exemplified by their ability to differentiate between different tick species and the range of remedies for each of the TBDs. Because traditional ethnoveterinary remedies are frequently utilized, their effectiveness should be further investigated. PMID:27065643

  3. Ticking All the Boxes? A Systematic Review of Education and Communication Interventions to Prevent Tick-Borne Disease

    PubMed Central

    Amlôt, Richard; Rubin, G. James

    2012-01-01

    Abstract Tick-borne disease has become increasingly prevalent across Europe. Despite the effectiveness of protective behaviors, relatively few people adopt them when in areas where ticks are known to be present. In this systematic review we identified studies that assessed the impact of any educational or behavioral interventions intended to encourage the widespread use of protective behaviors against tick-borne disease. An extensive search of electronic databases returned a total of only nine such studies. Only two of these were fully randomized controlled trials, with the remaining studies using weaker designs and often relying solely on self-reports to assess behavior. The majority of research in this area has not explicitly noted the consideration of any formal psychological theory on how best to promote behaviors that protect health. Nonetheless, the results show that both knowledge of and attitudes towards tick-borne disease are amenable to change, although the stability of these changes over time has not yet been determined. Not all intervention strategies have proved effective, with some producing detrimental effects. More theory-based, methodologically-robust studies are urgently required if we are to gain a better understanding of the most effective strategies for encouraging members of the public to adopt behaviors known to protect against tick-borne disease. PMID:22607072

  4. [Genetic diversity of the tick-borne encephalitis virus in Ixodes persulcatus ticks in northeastern European Russia].

    PubMed

    Mikriukova, T P; Chausov, E V; Konovalova, S N; Kononova, Iu V; Protopopova, E V; Kartashov, M Iu; Trnovoĭ, V A; Glushkova, L I; Korabel'nikov, I V; Egorova, I Iu; Loktev, V B

    2014-01-01

    The genetic diversity of the tick-borne encephalitis virus (TBEV) in the PCR-positive Taiga ticks collected in the Republic of Komi in 2010 was evaluated. The analyses of nucleotide sequences of the 5'-NCR fragments of viral genome from ticks had shown that 13 isolates of TBEV from 16 sequencing variants were represented by the highly pathogenic Far Eastern genotype of the TBEV and only 3 isolates were identified as the Siberian genotype of TBEV. The nucleotide sequences of 5'-NCR of viral genome strongly varied variable in individual ticks. Variability for the A1 element has been observed in all the tested samples, and for elements C1, B2, CS B--in more than 50%. A2 element and ATG codon of the 5'-NCR remained completely conservative. Computer simulation of conformations of the 5'-NCR of TBEV genome demonstrated the possibility of significant changes of the spatial structure of the 5'-NCR of viral genome in individual taiga ticks. The obtained data confirm the hypothesis that the variability in the 5'-NCR of TBEV genome can be crucial for efficient replication of TBEV in different hosts. PMID:25272463

  5. Employee involvement: motivation or manipulation?

    PubMed

    McConnell, C R

    1998-03-01

    Employee involvement is subject to a great deal of verbal tribute; there is hardly a manager at work today who will not praise the value of employee input. However, many employee involvement efforts leave employees feeling more manipulated than motivated. This occurs because supervisors and managers, while expecting employees to change the way they work, are themselves either unwilling to change or remain unconscious of the need to change. The result is that, although employee input is regularly solicited in a number of forms, it is often discounted, ignored, or altered to fit the manager's preconceptions. Often the employee is left feeling manipulated. Since the opportunity for involvement can be a strong motivator, it becomes the manager's task to learn how to provide involvement opportunity in manipulative fashion. This can be accomplished by providing involvement opportunity accompanied by clear outcome expectations and allowing employees the freedom to pursue those outcomes in their own way.

  6. Employee guide to respiratory protection

    SciTech Connect

    Wright, E.M.

    1982-01-01

    This employee guide discusses use of respiratory protective equipment for particulates, gases, vapors, supplied air, and self-contained breathing apparatus. It also covers equipment selection medical factors, fitting criteria; care; and employee responsibilities. (PSB)

  7. Impact of biodiversity on tick-borne diseases.

    PubMed

    Dudek, Krzysztof

    2014-01-01

    It is a well-known fact that high biodiversity is related to the health and proper functioning of environment. Recently, the attempts to search the relations between biodiversity and human health are also undertaken. A number of studies demonstrate that people living in undegraded environment are less exposed to the diseases of affluence. However, they are at a higher risk of contracting zoonoses. It is believed that the higher the number of animals, the higher is the number of ticks. Consequently, there is a serious risk of borreliosis and other tick-borne diseases. Such assumption, however, may be erroneous. A number of studies suggest a decreasing prevalence of tick-borne disease pathogens in high-biodiversity areas. In this paper, a promising hypothesis explaining this relation is discussed.

  8. Tick-related facial cellulitis caused by Francisella tularensis.

    PubMed

    Arslan, Ferhat; Karagöz, Ergenekon; Zemheri, Ebru; Vahaboglu, Haluk; Mert, Ali

    2016-06-01

    Tick-borne illnesses have diverse biological and clinical features that make recognition and appropriate treatment challenging. Arthropod-transmitted (ticks, fleas and deer flies) tularaemia remains a concern worldwide. Generally, two kinds of tularaemia manifestations, namely ulceroglandular and glandular infections, can arise from the bite of an infected arthropod vector. If the ulceroglandular or glandular form is not treated, suppuration can arise from the gland. In addition, cellulitis is rarely observed around the ulcers. In our case, with the knowledge of tick exposure to the scalp, tularaemia was not initially considered for facial cellulitis without regional lymphadenopathy and also due to apparent failure to respond to doxycycline and gentamicin therapy. Serological confirmation in the late stages of the disease suggests the importance of clinical suspicion in such rare conditions. PMID:27367325

  9. Tick-borne relapsing fever in North America.

    PubMed

    Dworkin, Mark S; Schwan, Tom G; Anderson, Donald E

    2002-03-01

    Relapsing fever is characterized by recurring episodes of fever and nonspecific symptoms (e.g., headache, myalgia, arthralgia, shaking chills, and abdominal complaints). The illness is caused by an infection from the Borrelia species (spirochetes) that may be acquired through the bite of an infected tick (Ornithodoros species) or contact with the hemolymph of an infected human body louse (Pediculus humanus). In North America, most cases have been acquired in the western United States, southern British Columbia, and few cases have been reported from Mexico. Most cases have been acquired from exposure to rustic tick-infested cabins and caves. This article reviews relapsing fever, especially tick-borne relapsing fever in North America. PMID:11982310

  10. Rickettsia africae and Candidatus Rickettsia barbariae in Ticks in Israel

    PubMed Central

    Waner, Trevor; Keysary, Avi; Eremeeva, Marina E.; Din, Adi Beth; Mumcuoglu, Kosta Y.; King, Roni; Atiya-Nasagi, Yafit

    2014-01-01

    DNA of several spotted fever group rickettsiae was found in ticks in Israel. The findings include evidence for the existence of Rickettsia africae and Candidatus Rickettsia barbariae in ticks in Israel. The DNA of R. africae was detected in a Hyalomma detritum tick from a wild boar and DNA of C. Rickettsia barbariae was detected in Rhipicephalus turanicus and Rhipicephalus sanguineus collected from vegetation. The DNA of Rickettsia massiliae was found in Rh. sanguineus and Haemaphysalis erinacei, whereas DNA of Rickettsia sibirica mongolitimonae was detected in a Rhipicephalus (Boophilus) annulatus. Clinicians should be aware that diseases caused by a variety of rickettsiae previously thought to be present only in other countries outside of the Middle East may infect residents of Israel who have not necessarily traveled overseas. Furthermore, this study reveals again that the epidemiology of the spotted fever group rickettsiae may not only involve Rickettsia conorii but may include other rickettsiae. PMID:24615133

  11. Rickettsia africae and Candidatus Rickettsia barbariae in ticks in Israel.

    PubMed

    Waner, Trevor; Keysary, Avi; Eremeeva, Marina E; Din, Adi Beth; Mumcuoglu, Kosta Y; King, Roni; Atiya-Nasagi, Yafit

    2014-05-01

    DNA of several spotted fever group rickettsiae was found in ticks in Israel. The findings include evidence for the existence of Rickettsia africae and Candidatus Rickettsia barbariae in ticks in Israel. The DNA of R. africae was detected in a Hyalomma detritum tick from a wild boar and DNA of C. Rickettsia barbariae was detected in Rhipicephalus turanicus and Rhipicephalus sanguineus collected from vegetation. The DNA of Rickettsia massiliae was found in Rh. sanguineus and Haemaphysalis erinacei, whereas DNA of Rickettsia sibirica mongolitimonae was detected in a Rhipicephalus (Boophilus) annulatus. Clinicians should be aware that diseases caused by a variety of rickettsiae previously thought to be present only in other countries outside of the Middle East may infect residents of Israel who have not necessarily traveled overseas. Furthermore, this study reveals again that the epidemiology of the spotted fever group rickettsiae may not only involve Rickettsia conorii but may include other rickettsiae.

  12. Agricultural Microbiology.

    ERIC Educational Resources Information Center

    Brill, Winston J.

    1981-01-01

    Elucidates strategies for applying microbiological techniques to traditional agricultural practices. Discusses the manipulation of microorganisms that live with plants and also the problems involved in the introduction of new genes into crop plants by recombinant DNA methods. (CS)

  13. Agricultural Geophysics

    Technology Transfer Automated Retrieval System (TEKTRAN)

    The four geophysical methods predominantly used for agricultural purposes are resistivity, electromagnetic induction, ground penetrating radar (GPR), and time domain reflectometry (TDR). Resistivity and electromagnetic induction methods are typically employed to map lateral variations of apparent so...

  14. [The distribution characteristics of the taiga tick (Ixodidae) in the city of Tomsk].

    PubMed

    Romanenko, V N

    1999-01-01

    The study conducted in 1996-1997 has shown that in large town lads there is a steady population of the taiga tick with the maximum number 3 specimens per 1 km of account route. In these lads there are well developed wood and shrub layer, grass cover and thick ground litter layer. Tick larvae often occur on rodents from these territories. In lads and gardens, where the ground litter is ruined and herbal cover is oppressed, the taiga ticks do not occur. In outskirts the number of ticks is higher. Abundance of ticks in these areas has an inverted dependence upon recreational load degree.

  15. Rickettsia bellii in Amblyomma rotundatum ticks parasitizing Rhinella jimi from northeastern Brazil.

    PubMed

    Horta, Mauricio C; Saraiva, Danilo G; Oliveira, Glauber M B; Martins, Thiago F; Labruna, Marcelo B

    2015-01-01

    This study evaluated rickettsial infection in Amblyomma rotundatum ticks collected from toads (Rhinella jimi) in the Brazilian Caatinga biome, an unique semiarid region of South America. Tick infestations were observed in 57.8% toads (26/45); mean infestation: 1.6 ticks/toad. DNA extraction from 42 ticks (6 larvae, 22 nymphs and 11 female adults) was tested by polymerase chain reaction (PCR) targeting Rickettsia organisms, which were detected in 100% of the ticks. Amplicons' DNA sequences were identical to each other and 99% identical to Rickettsia bellii from GenBank. DNA samples extracted from the blood of the 45 toads were negative by rickettsia-PCR protocols.

  16. The effect of tick size on trading volume share in three competing stock markets

    NASA Astrophysics Data System (ADS)

    Nagumo, Shota; Shimada, Takashi; Ito, Nobuyasu

    2016-09-01

    The relationship between tick sizes and trading volume share in two and three competing markets is studied theoretically. By introducing a simple model which is equipped with multiple markets and non-strategic traders, we analytically calculate the share. It is shown that share is shifted from a market with a larger tick size to a market with a smaller tick size, and the size of share-shift is determined by difference between tick sizes not by ratio between tick sizes in both cases of two markets and three markets.

  17. Does employee fitness decrease employee absenteeism and medical cost?

    PubMed

    White, P

    In recent years American have become increasingly interested in physical fitness and optimum health care. Health care is big business in the United States. American industry has lead the nation in a quest for wellness by establishing wellness programs for it's employees. This article will attempt to determine: 1) if employees on a fitness program facilitate cost containment for industry when compared to employees not participating in a fitness program; and 2) if employees on a fitness program experience reduced absenteeism due to health reasons and reduced medical costs compared to employees not participating in a fitness program.

  18. Managerial Responsibility for Employee Discipline.

    ERIC Educational Resources Information Center

    Hafner, Arthur W.; Kibble-Smith, Brian G.

    1988-01-01

    Discusses corrective action and employee discipline in library management, covering: (1) factors affecting the library manager's right to discipline; (2) employee orientation and training; (3) employee performance measurement; (4) corrective strategies; (5) termination as an option; (6) the importance of fairness; and (7) positive results of…

  19. Temporary Employees: A Permanent Boon?

    ERIC Educational Resources Information Center

    Simonetti, Jack L.; And Others

    1988-01-01

    Discusses the growing use of temporary employees by companies, including the reasons that temporary help is popular. Describes the types of people likely to become temporary employees and reports results from a survey of 144 members of the American Society for Personnel Administration regarding their organizations' use of temporary employees. (CH)

  20. Professional Employees Turn to Unions

    ERIC Educational Resources Information Center

    Chamot, Dennis

    1976-01-01

    White-collar and professional employees are increasingly turning to unions to combat their loss of independence as employees of large organizations. Managers should realize that they and professional employees have different viewpoints about job situations and that the current trend toward white-collar unionism is apt to continue. (JG)